3E2CA

Escherichia coli bacterioferritin mutant e128r/e135r
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDERGHIDWLRTELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Structural and Mechanistic Studies of a Stabilized Subunit Dimer Variant of Escherichia coli Bacterioferritin Identify Residues Required for Core Formation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e2cA00
3NP2X 4Y08A 3RE7A 2XJOA 1UVHA 3QHCA 2X170 4CVTA 3QZ3A 2VZBA 4ETRA 1Z6OM 5D8YA 5IX6A 1FHAA 2ZA7A 4QUWA 5LBHA 5E1UA 1VELA 1GWGA 5JKLA 4MJYA 2ZG8X 4TOFA 2OH3A 1TJOA 1RCIA 2V2RA 3H7GA 1JKVA 3BVKA 5K52A 5HJHA 1B71A 3BVFA 1JIGA 4RC5A 4RC7A 3E1JA 4MKUA 4A25A 3RGDA 4IWJA 4ZL6A 1QGHA 1H96A 2GYQA 1NFVA 3R2HA 3KA4A 2FG8A 4DYXA 2ZG7X 3HL1A 2ZURX 1MFRA 3NOZX 3EGMA 2WLUA 2C2JA 4LQJA 4P18A 4PGKA 3BVIA 1ZS3A 4M35A 5LG2A 4EVDA 2CLBA 1SQ3A 1O9IA 1JGCA 4PGIA 1TK6A 1YUXA 2YJJA 3A9QA 5JKLG 2YJKA 3R2RA 4LQNA 3KA6A 4LYXA 2Z5QA 3PVYA 4M32A 1J30A 5JACA 3UNOA 2IB0A 2CN6A 5D8QA 5AXSA 1AEWA 3E1LA 5D8SA 1RCGA 4ISMA 3E6SA 1RCCA 5LS9A 4MUDA 3IS7A 5FFDA 1RCEA 3O7SA 1DATA 1NF6A 2VXXA 4XGSA 3QHBA 4KVQA 5CMQA 2C41A 5FFEA 1N1QA 5GU0X 4RC6B 4CY9A 1L8IA 4LPMA 3NP0X 2G4HA 1F30A 5HQOA 4LPJA 4R42A 3F36A 3Q4QA 3RD0A 1LB3A 1QYBA 2IY4A 1XZ1A 3AK8A 3PWFA 2CHPA 3PWQC 3F39A 3AK9A 1LKPA 4DI0A 4TOAA 3R2MA 4LPNA 2FL0A 3ES3A 4ITWA 3E1MA 5I4JA 2OC5A 3PW1A 5JKMA 3PW1B 2BK6A 1F33A 1IESA 3R2KA 5ERJA 1BCFA 4DYUA 2FKZA 4II4B 3PWQA 3O7RA 3E1OA 4ZLWA 1JI5A 4DYYA 3AJQA 3WVUA 2V2JA 2FFXJ 2VXIA 4M33A 4CVSA 3UOFA 2QQYA 3BKNA 1VEIA 1S30A 1L8HA 5GOUA 3FSEA 1NF4A 3PVRB 4Z3BA 3QB9A 1LKOA 5HJFA 3GHQA 3ISEA 2FZFA 2F7NA 2V2IA 3R2LA 3E6RA 1DVBA 3FI6A 5C6FA 5CMRA 4PG1A 4ZMCA 4DYZA 1JREA 2YW7A 2JD80 3SH6A 2V2SA 2IU2A 3AF8X 2Z6MA 1JI4A 2UX1A 3AF7X 3KXUA 3Q4RA 2V2OA 4RC8A 1MOJA 2JD60 5J8WA 3RBCA 3OJ5A 5FEJA 2V2MA 4CMYA 3OGHA 2FG4A 5JKMG 3PW8C 4TODA 4XKSA 2V15A 4XKTA 1TKOA 2Y3QA 1UMNA 2CN7A 3AJPA 5D8PA 1IERA 3UOIA 5J93A 3FVBA 4IWKA 4ISPA 2CLUA 4ZJKA 2C2FA 3PW8A 3SHXA 2FHAA 1YV1A 4TOHA 1HRSA 2Z90A 2CF7A 1BFRA 4CVRA 4AM5A 4ZKWA 2WLAA 1Z6OA 5FFAA 4RC6A 4EVBA 4TOBA 3QVDA 3AF9X 1LKMA 5D8XA 3BVLA 5K53A 3KX9A 2ZG9X 4CYAA 2RBDA 4Z5SA 2HTNA 3E1QA 2YW6A 4E6KA 2WTLA 1ZUJA 3F37A 3U90A 2BJYA 1RCDA 4TOEA 4IXKA 4TOCA 5GU1X 4KVSA 1RYTA 4U3GA 3F38A 3ERZA 1JYBA 1S3QA 3E2CA 4DASA 3Q4NA 4KVRA 4LQVA 4II4A 1EUMA 3KA3A 4ERUA 4OYNA 3QD8A 2XKQA 4YKHA 1NNQA 2XJNA 3BT5A 3GVYA 1DPSA 4EVEA 5J9VA 4CVPA 3ISFA 5J8SA 1TKPA 1R03A 4XKUA 3PVRA 5D8OA 4ZKXA 2XGWA 1JKUA 4MN9A 5ERKA 1YUZA 4PG0A 1O9RA 2Z5RA 3PVTA 4RC7B 3PVTB 4RC5B 4LQHA 2XJMA 3EZUA 2C6RA 3F32A 1XZ3A 3Q4OA 4ML5A 2BKCA 1VJXA 3KWOA 4CYBA 5GU3X 2PYBA 2CHIA 1S2ZA 2FJCA 3BVEA 3E1PA 4TOGA 3WVWA 3KA9A 5GN8A 3E1NA 5GN8B 2V2NA 1KRQA 3RAVA 2D5KA 2V2PA 4MY7A 1OTKA 3HIUA 2CEIA 4CMYV 2C2UA 5D8RA 1Z4AA 3F35A 3A68A 3F33A 1SOFA 3VNXA 3MPSA 2Z5PA 2V2LA 2ZA6A 5CZUA 3F34A 1BG7A 2W0OA 3EZ0A 4LYUA 5FFCA 1VLGA 4TO9A 2GYDA 4REUA 2CIHA 5E2DA 3PVYB 3KA8A 3WVVA 4AM4A 3IS8A 4DE6A 4ITTA 2GS4A 3SIDA 4TW3A 4DZ0A 1JTSA 4AM2A 3R2OA 5FFBA 2QF9A 2JD70 2ZA8A 3AJOA 3TA8A 3PZAA 5LG8A 3T9JA 4M34A 3SE1A 4EVCA 3WNWA 2HR5A 2BW1A 3R2SA 5GU2X 3GE4A 2ITBA 4ZKHA 3IQ1A 1VEQA 4ZTTA 4ZL5A
chains in the Genus database with same CATH superfamily
3NP2X 4Y08A 3KHKA 3RE7A 2XJOA 1UVHA 3QHCA 2X170 4CVTA 3QZ3A 2CWLA 2VZBA 4ETRA 1Z6OM 5D8YA 5IX6A 1FHAA 5JDOB 2ZA7A 4QUWA 4YXJA 5LBHA 5E1UA 1VELA 1GWGA 5JKLA 4MJYA 2ZG8X 4TOFA 2OH3A 4YVZA 1TJOA 1RCIA 2V2RA 3H7GA 1JKVA 3BVKA 4YXMA 5K52A 2OKCA 5HJHA 1B71A 3BVFA 1JIGA 4RC5A 4RC7A 3E1JA 4MKUA 4A25A 3RGDA 2AR0A 4IWJA 4ZL6A 1QGHA 1H96A 2GYQA 1NFVA 3C21A 3UFBA 3R2HA 3KA4A 3M6JA 2FG8A 4DYXA 2ZG7X 3HL1A 2ZURX 1MFRA 3NOZX 3EGMA 2WLUA 2C2JA 3V3KB 4LQJA 4P18A 4PGKA 3BVIA 1ZS3A 4W4LB 4M35A 5LG2A 4EVDA 2CLBA 1SQ3A 1O9IA 1JGCA 4PGIA 1TK6A 1YUXA 2YJJA 3A9QA 5JKLG 2YJKA 3R2RA 4LQNA 3KA6A 4LYXA 2Z5QA 3PVYA 4M32A 1J30A 5JACA 3UNOA 2IB0A 2CN6A 5D8QA 5AXSA 1AEWA 3E1LA 5D8SA 1RCGA 4ISMA 3E6SA 1RCCA 5LS9A 4MUDA 3IS7A 5FFDA 1RCEA 3O7SA 3C1ZA 3JZ9A 1DATA 3KDQA 1NF6A 3N6OA 2VXXA 2V8UA 4XGSA 3QHBA 4KVQA 5CMQA 2C41A 5FFEA 1N1QA 5GU0X 4RC6B 4CY9A 1L8IA 2N02A 4LPMA 3NP0X 2G4HA 1F30A 2V8TA 5HQOA 4LPJA 4R42A 3F36A 3Q4QA 3RD0A 1LB3A 1QYBA 2IY4A 1XZ1A 3AK8A 3PWFA 5JDOA 2CHPA 3PWQC 3F39A 3JZAB 3AK9A 1LKPA 4DI0A 4TOAA 3R2MA 4LPNA 2FL0A 3ES3A 4ITWA 3E1MA 5I4JA 2OC5A 3PW1A 5JKMA 3PW1B 2BK6A 1F33A 1IESA 3R2KA 5ERJA 2Y44A 1BCFA 4DYUA 2FKZA 4II4B 3PWQA 3O7RA 3E1OA 4ZLWA 1JI5A 4DYYA 3AJQA 3WVUA 2V2JA 2FFXJ 2VXIA 4M33A 4CVSA 3UOFA 2QQYA 4X0JA 3BKNA 1VEIA 1S30A 1L8HA 4WJG4 5GOUA 3GGZA 3FSEA 1NF4A 3PVRB 4Z3BA 3QB9A 1LKOA 5HJFA 3GHQA 3ISEA 2FZFA 2F7NA 2MGYA 2V2IA 3R2LA 3E6RA 3W54A 1DVBA 4MXPA 3FI6A 5C6FA 5CMRA 4PG1A 3DBYA 4ZMCA 4DYZA 1JREA 2YW7A 2JD80 3SH6A 2V2SA 2IU2A 3AF8X 2Z6MA 1JI4A 2UX1A 5HU6D 3AF7X 3KXUA 3Q4RA 2V2OA 4RC8A 1MOJA 2JD60 5J8WA 3RBCA 3OJ5A 5FEJA 2V2MA 4CMYA 3OGHA 2FG4A 5JKMG 3PW8C 4TODA 4XKSA 2V15A 4XKTA 1TKOA 2Y3QA 3FRSA 1UMNA 2CN7A 3AJPA 5D8PA 1IERA 3UOIA 5J93A 3FVBA 4IWKA 4ISPA 2CLUA 4ZJKA 2C2FA 3PW8A 3SHXA 2FHAA 2WWXB 3VV9A 1YV1A 4TOHA 1HRSA 2Z90A 2CF7A 1BFRA 4CVRA 4AM5A 4ZKWA 2WLAA 1Z6OA 3D19A 4RC6A 5FFAA 4EVBA 3GGYA 4TOBA 3QVDA 3AF9X 1LKMA 5D8XA 3BVLA 5K53A 4KXRB 3KX9A 2ZG9X 4CYAA 2RBDA 4Z5SA 2HTNA 3E1QA 2YW6A 4E6KA 2WTLA 1ZUJA 3F37A 3U90A 2BJYA 1RCDA 4TOEA 4IXKA 4TOCA 5GU1X 4KVSA 1RYTA 4U3GA 3F38A 4E40A 3ERZA 1JYBA 1S3QA 3E2CA 4DASA 3Q4NA 4KVRA 4LQVA 3LKDA 4II4A 1EUMA 3KA3A 4ERUA 4OYNA 3QD8A 2XKQA 4YKHA 1NNQA 2XJNA 3BT5A 3GVYA 1DPSA 4EVEA 5J9VA 4CVPA 3ISFA 5J8SA 1TKPA 1R03A 4XKUA 3PVRA 5D8OA 3C1YA 4ZKXA 2XGWA 1JKUA 4MN9A 5ERKA 1YUZA 4PG0A 1O9RA 2Z5RA 3PVTA 4RC7B 3PVTB 4RC5B 4LQHA 4W4KB 2XJMA 3EZUA 2C6RA 3F32A 1XZ3A 3Q4OA 4ML5A 2BKCA 1VJXA 3KWOA 4CYBA 5GU3X 2PYBA 2CHIA 1S2ZA 2FJCA 3BVEA 3E1PA 4TOGA 3WVWA 3KA9A 5GN8A 3E1NA 5GN8B 2V2NA 1KRQA 3RAVA 2G38B 2D5KA 2V2PA 4MY7A 1OTKA 3HIUA 2CEIA 3VVAA 4CMYV 2C2UA 5D8RA 1Z4AA 3F35A 3A68A 3F33A 1SOFA 3VNXA 3MPSA 2Z5PA 2V2LA 2ZA6A 5CZUA 3F34A 1BG7A 2W0OA 3EZ0A 4LYUA 5FFCA 1VLGA 4TO9A 2GYDA 4REUA 3C23A 2CIHA 5E2DA 3PVYB 3KA8A 3WVVA 3FRRA 4AM4A 3IS8A 4DE6A 4ITTA 2GS4A 3SIDA 4TW3A 4DZ0A 1JTSA 4AM2A 3R2OA 5FFBA 2QF9A 2JD70 2ZA8A 3AJOA 3TA8A 3PZAA 5LG8A 3T9JA 4M34A 3SE1A 4EVCA 3L0MA 3WNWA 2HR5A 2BW1A 3R2SA 5GU2X 3GE4A 2ITBA 4ZKHA 3IQ1A 1VEQA 4ZTTA 4ZL5A
chains in the Genus database with same CATH topology
3NP2X 4Y08A 3KHKA 3RE7A 2XJOA 1UVHA 3QHCA 2X170 4CVTA 3QZ3A 2CWLA 2VZBA 4ETRA 1Z6OM 5D8YA 5IX6A 1FHAA 5JDOB 2ZA7A 4QUWA 4YXJA 5LBHA 5E1UA 1VELA 1GWGA 5JKLA 4MJYA 2ZG8X 4TOFA 2OH3A 4YVZA 1TJOA 1RCIA 2V2RA 3H7GA 1JKVA 3BVKA 4YXMA 5K52A 2OKCA 5HJHA 1B71A 3BVFA 1JIGA 4RC5A 4RC7A 3E1JA 4MKUA 4A25A 3RGDA 2AR0A 4IWJA 4ZL6A 1QGHA 1H96A 2GYQA 1NFVA 3C21A 3UFBA 3R2HA 3KA4A 3M6JA 2FG8A 4DYXA 2ZG7X 3HL1A 2ZURX 1MFRA 3NOZX 3EGMA 2WLUA 2C2JA 3V3KB 4LQJA 4P18A 4PGKA 3BVIA 1ZS3A 4W4LB 4M35A 5LG2A 4EVDA 2CLBA 1SQ3A 1O9IA 1JGCA 4PGIA 1TK6A 1YUXA 2YJJA 3A9QA 5JKLG 2YJKA 3R2RA 4LQNA 3KA6A 4LYXA 2Z5QA 3PVYA 4M32A 1J30A 5JACA 3UNOA 2IB0A 2CN6A 5D8QA 5AXSA 1AEWA 3E1LA 5D8SA 1RCGA 4ISMA 3E6SA 1RCCA 5LS9A 4MUDA 3IS7A 5FFDA 1RCEA 3O7SA 3C1ZA 3JZ9A 1DATA 3KDQA 1NF6A 3N6OA 2VXXA 2V8UA 4XGSA 3QHBA 4KVQA 5CMQA 2C41A 5FFEA 1N1QA 5GU0X 4RC6B 4CY9A 1L8IA 2N02A 4LPMA 3NP0X 2G4HA 1F30A 2V8TA 5HQOA 4LPJA 4R42A 3F36A 3Q4QA 3RD0A 1LB3A 1QYBA 2IY4A 1XZ1A 3AK8A 3PWFA 5JDOA 2CHPA 3PWQC 3F39A 3JZAB 3AK9A 1LKPA 4DI0A 4TOAA 3R2MA 4LPNA 2FL0A 3ES3A 4ITWA 3E1MA 5I4JA 2OC5A 3PW1A 5JKMA 3PW1B 2BK6A 1F33A 1IESA 3R2KA 5ERJA 2Y44A 1BCFA 4DYUA 2FKZA 4II4B 3PWQA 3O7RA 3E1OA 4ZLWA 1JI5A 4DYYA 3AJQA 3WVUA 2V2JA 2FFXJ 2VXIA 4M33A 4CVSA 3UOFA 2QQYA 4X0JA 3BKNA 1VEIA 1S30A 1L8HA 4WJG4 5GOUA 3GGZA 3FSEA 1NF4A 3PVRB 4Z3BA 3QB9A 1LKOA 5HJFA 3GHQA 3ISEA 2FZFA 2F7NA 2MGYA 2V2IA 3R2LA 3E6RA 3W54A 1DVBA 4MXPA 3FI6A 5C6FA 5CMRA 4PG1A 3DBYA 4ZMCA 4DYZA 1JREA 2YW7A 2JD80 3SH6A 2V2SA 2IU2A 3AF8X 2Z6MA 1JI4A 2UX1A 5HU6D 3AF7X 3KXUA 3Q4RA 2V2OA 4RC8A 1MOJA 2JD60 5J8WA 3RBCA 3OJ5A 5FEJA 2V2MA 4CMYA 3OGHA 2FG4A 5JKMG 3PW8C 4TODA 4XKSA 2V15A 4XKTA 1TKOA 2Y3QA 3FRSA 1UMNA 2CN7A 3AJPA 5D8PA 1IERA 3UOIA 5J93A 3FVBA 4IWKA 4ISPA 2CLUA 4ZJKA 2C2FA 3PW8A 3SHXA 2FHAA 2WWXB 3VV9A 1YV1A 4TOHA 1HRSA 2Z90A 2CF7A 1BFRA 4CVRA 4AM5A 4ZKWA 2WLAA 1Z6OA 3D19A 4RC6A 5FFAA 4EVBA 3GGYA 4TOBA 3QVDA 3AF9X 1LKMA 5D8XA 3BVLA 5K53A 4KXRB 3KX9A 2ZG9X 4CYAA 2RBDA 4Z5SA 2HTNA 3E1QA 2YW6A 4E6KA 2WTLA 1ZUJA 3F37A 3U90A 2BJYA 1RCDA 4TOEA 4IXKA 4TOCA 5GU1X 4KVSA 1RYTA 4U3GA 3F38A 4E40A 3ERZA 1JYBA 1S3QA 3E2CA 4DASA 3Q4NA 4KVRA 4LQVA 3LKDA 4II4A 1EUMA 3KA3A 4ERUA 4OYNA 3QD8A 2XKQA 4YKHA 1NNQA 2XJNA 3BT5A 3GVYA 1DPSA 4EVEA 5J9VA 4CVPA 3ISFA 5J8SA 1TKPA 1R03A 4XKUA 3PVRA 5D8OA 3C1YA 4ZKXA 2XGWA 1JKUA 4MN9A 5ERKA 1YUZA 4PG0A 1O9RA 2Z5RA 3PVTA 4RC7B 3PVTB 4RC5B 4LQHA 4W4KB 2XJMA 3EZUA 2C6RA 3F32A 1XZ3A 3Q4OA 4ML5A 2BKCA 1VJXA 3KWOA 4CYBA 5GU3X 2PYBA 2CHIA 1S2ZA 2FJCA 3BVEA 3E1PA 4TOGA 3WVWA 3KA9A 5GN8A 3E1NA 5GN8B 2V2NA 1KRQA 3RAVA 2G38B 2D5KA 2V2PA 4MY7A 1OTKA 3HIUA 2CEIA 3VVAA 4CMYV 2C2UA 5D8RA 1Z4AA 3F35A 3A68A 3F33A 1SOFA 3VNXA 3MPSA 2Z5PA 2V2LA 2ZA6A 5CZUA 3F34A 1BG7A 2W0OA 3EZ0A 4LYUA 5FFCA 1VLGA 4TO9A 2GYDA 4REUA 3C23A 2CIHA 5E2DA 3PVYB 3KA8A 3WVVA 3FRRA 4AM4A 3IS8A 4DE6A 4ITTA 2GS4A 3SIDA 4TW3A 4DZ0A 1JTSA 4AM2A 3R2OA 5FFBA 2QF9A 2JD70 2ZA8A 3AJOA 3TA8A 3PZAA 5LG8A 3T9JA 4M34A 3SE1A 4EVCA 3L0MA 3WNWA 2HR5A 2BW1A 3R2SA 5GU2X 3GE4A 2ITBA 4ZKHA 3IQ1A 1VEQA 4ZTTA 4ZL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NP2 X;  4Y08 A;  3RE7 A;  2XJO A;  1UVH A;  3QHC A;  2X17 0;  4CVT A;  3QZ3 A;  2VZB A;  4ETR A;  1Z6O M;  5D8Y A;  5IX6 A;  1FHA A;  2ZA7 A;  4QUW A;  5LBH A;  5E1U A;  1VEL A;  1GWG A;  5JKL A;  4MJY A;  2ZG8 X;  4TOF A;  2OH3 A;  1TJO A;  1RCI A;  2V2R A;  3H7G A;  1JKV A;  3BVK A;  5K52 A;  5HJH A;  1B71 A;  3BVF A;  1JIG A;  4RC5 A;  4RC7 A;  3E1J A;  4MKU A;  4A25 A;  3RGD A;  4IWJ A;  4ZL6 A;  1QGH A;  1H96 A;  2GYQ A;  1NFV A;  3R2H A;  3KA4 A;  2FG8 A;  4DYX A;  2ZG7 X;  3HL1 A;  2ZUR X;  1MFR A;  3NOZ X;  3EGM A;  2WLU A;  2C2J A;  4LQJ A;  4P18 A;  4PGK A;  3BVI A;  1ZS3 A;  4M35 A;  5LG2 A;  4EVD A;  2CLB A;  1SQ3 A;  1O9I A;  1JGC A;  4PGI A;  1TK6 A;  1YUX A;  2YJJ A;  3A9Q A;  5JKL G;  2YJK A;  3R2R A;  4LQN A;  3KA6 A;  4LYX A;  2Z5Q A;  3PVY A;  4M32 A;  1J30 A;  5JAC A;  3UNO A;  2IB0 A;  2CN6 A;  5D8Q A;  5AXS A;  1AEW A;  3E1L A;  5D8S A;  1RCG A;  4ISM A;  3E6S A;  1RCC A;  5LS9 A;  4MUD A;  3IS7 A;  5FFD A;  1RCE A;  3O7S A;  1DAT A;  1NF6 A;  2VXX A;  4XGS A;  3QHB A;  4KVQ A;  5CMQ A;  2C41 A;  5FFE A;  1N1Q A;  5GU0 X;  4RC6 B;  4CY9 A;  1L8I A;  4LPM A;  3NP0 X;  2G4H A;  1F30 A;  5HQO A;  4LPJ A;  4R42 A;  3F36 A;  3Q4Q A;  3RD0 A;  1LB3 A;  1QYB A;  2IY4 A;  1XZ1 A;  3AK8 A;  3PWF A;  2CHP A;  3PWQ C;  3F39 A;  3AK9 A;  1LKP A;  4DI0 A;  4TOA A;  3R2M A;  4LPN A;  2FL0 A;  3ES3 A;  4ITW A;  3E1M A;  5I4J A;  2OC5 A;  3PW1 A;  5JKM A;  3PW1 B;  2BK6 A;  1F33 A;  1IES A;  3R2K A;  5ERJ A;  1BCF A;  4DYU A;  2FKZ A;  4II4 B;  3PWQ A;  3O7R A;  3E1O A;  4ZLW A;  1JI5 A;  4DYY A;  3AJQ A;  3WVU A;  2V2J A;  2FFX J;  2VXI A;  4M33 A;  4CVS A;  3UOF A;  2QQY A;  3BKN A;  1VEI A;  1S30 A;  1L8H A;  5GOU A;  3FSE A;  1NF4 A;  3PVR B;  4Z3B A;  3QB9 A;  1LKO A;  5HJF A;  3GHQ A;  3ISE A;  2FZF A;  2F7N A;  2V2I A;  3R2L A;  3E6R A;  1DVB A;  3FI6 A;  5C6F A;  5CMR A;  4PG1 A;  4ZMC A;  4DYZ A;  1JRE A;  2YW7 A;  2JD8 0;  3SH6 A;  2V2S A;  2IU2 A;  3AF8 X;  2Z6M A;  1JI4 A;  2UX1 A;  3AF7 X;  3KXU A;  3Q4R A;  2V2O A;  4RC8 A;  1MOJ A;  2JD6 0;  5J8W A;  3RBC A;  3OJ5 A;  5FEJ A;  2V2M A;  4CMY A;  3OGH A;  2FG4 A;  5JKM G;  3PW8 C;  4TOD A;  4XKS A;  2V15 A;  4XKT A;  1TKO A;  2Y3Q A;  1UMN A;  2CN7 A;  3AJP A;  5D8P A;  1IER A;  3UOI A;  5J93 A;  3FVB A;  4IWK A;  4ISP A;  2CLU A;  4ZJK A;  2C2F A;  3PW8 A;  3SHX A;  2FHA A;  1YV1 A;  4TOH A;  1HRS A;  2Z90 A;  2CF7 A;  1BFR A;  4CVR A;  4AM5 A;  4ZKW A;  2WLA A;  1Z6O A;  5FFA A;  4RC6 A;  4EVB A;  4TOB A;  3QVD A;  3AF9 X;  1LKM A;  5D8X A;  3BVL A;  5K53 A;  3KX9 A;  2ZG9 X;  4CYA A;  2RBD A;  4Z5S A;  2HTN A;  3E1Q A;  2YW6 A;  4E6K A;  2WTL A;  1ZUJ A;  3F37 A;  3U90 A;  2BJY A;  1RCD A;  4TOE A;  4IXK A;  4TOC A;  5GU1 X;  4KVS A;  1RYT A;  4U3G A;  3F38 A;  3ERZ A;  1JYB A;  1S3Q A;  3E2C A;  4DAS A;  3Q4N A;  4KVR A;  4LQV A;  4II4 A;  1EUM A;  3KA3 A;  4ERU A;  4OYN A;  3QD8 A;  2XKQ A;  4YKH A;  1NNQ A;  2XJN A;  3BT5 A;  3GVY A;  1DPS A;  4EVE A;  5J9V A;  4CVP A;  3ISF A;  5J8S A;  1TKP A;  1R03 A;  4XKU A;  3PVR A;  5D8O A;  4ZKX A;  2XGW A;  1JKU A;  4MN9 A;  5ERK A;  1YUZ A;  4PG0 A;  1O9R A;  2Z5R A;  3PVT A;  4RC7 B;  3PVT B;  4RC5 B;  4LQH A;  2XJM A;  3EZU A;  2C6R A;  3F32 A;  1XZ3 A;  3Q4O A;  4ML5 A;  2BKC A;  1VJX A;  3KWO A;  4CYB A;  5GU3 X;  2PYB A;  2CHI A;  1S2Z A;  2FJC A;  3BVE A;  3E1P A;  4TOG A;  3WVW A;  3KA9 A;  5GN8 A;  3E1N A;  5GN8 B;  2V2N A;  1KRQ A;  3RAV A;  2D5K A;  2V2P A;  4MY7 A;  1OTK A;  3HIU A;  2CEI A;  4CMY V;  2C2U A;  5D8R A;  1Z4A A;  3F35 A;  3A68 A;  3F33 A;  1SOF A;  3VNX A;  3MPS A;  2Z5P A;  2V2L A;  2ZA6 A;  5CZU A;  3F34 A;  1BG7 A;  2W0O A;  3EZ0 A;  4LYU A;  5FFC A;  1VLG A;  4TO9 A;  2GYD A;  4REU A;  2CIH A;  5E2D A;  3PVY B;  3KA8 A;  3WVV A;  4AM4 A;  3IS8 A;  4DE6 A;  4ITT A;  2GS4 A;  3SID A;  4TW3 A;  4DZ0 A;  1JTS A;  4AM2 A;  3R2O A;  5FFB A;  2QF9 A;  2JD7 0;  2ZA8 A;  3AJO A;  3TA8 A;  3PZA A;  5LG8 A;  3T9J A;  4M34 A;  3SE1 A;  4EVC A;  3WNW A;  2HR5 A;  2BW1 A;  3R2S A;  5GU2 X;  3GE4 A;  2ITB A;  4ZKH A;  3IQ1 A;  1VEQ A;  4ZTT A;  4ZL5 A; 
#chains in the Genus database with same CATH topology
 3NP2 X;  4Y08 A;  3KHK A;  3RE7 A;  2XJO A;  1UVH A;  3QHC A;  2X17 0;  4CVT A;  3QZ3 A;  2CWL A;  2VZB A;  4ETR A;  1Z6O M;  5D8Y A;  5IX6 A;  1FHA A;  5JDO B;  2ZA7 A;  4QUW A;  4YXJ A;  5LBH A;  5E1U A;  1VEL A;  1GWG A;  5JKL A;  4MJY A;  2ZG8 X;  4TOF A;  2OH3 A;  4YVZ A;  1TJO A;  1RCI A;  2V2R A;  3H7G A;  1JKV A;  3BVK A;  4YXM A;  5K52 A;  2OKC A;  5HJH A;  1B71 A;  3BVF A;  1JIG A;  4RC5 A;  4RC7 A;  3E1J A;  4MKU A;  4A25 A;  3RGD A;  2AR0 A;  4IWJ A;  4ZL6 A;  1QGH A;  1H96 A;  2GYQ A;  1NFV A;  3C21 A;  3UFB A;  3R2H A;  3KA4 A;  3M6J A;  2FG8 A;  4DYX A;  2ZG7 X;  3HL1 A;  2ZUR X;  1MFR A;  3NOZ X;  3EGM A;  2WLU A;  2C2J A;  3V3K B;  4LQJ A;  4P18 A;  4PGK A;  3BVI A;  1ZS3 A;  4W4L B;  4M35 A;  5LG2 A;  4EVD A;  2CLB A;  1SQ3 A;  1O9I A;  1JGC A;  4PGI A;  1TK6 A;  1YUX A;  2YJJ A;  3A9Q A;  5JKL G;  2YJK A;  3R2R A;  4LQN A;  3KA6 A;  4LYX A;  2Z5Q A;  3PVY A;  4M32 A;  1J30 A;  5JAC A;  3UNO A;  2IB0 A;  2CN6 A;  5D8Q A;  5AXS A;  1AEW A;  3E1L A;  5D8S A;  1RCG A;  4ISM A;  3E6S A;  1RCC A;  5LS9 A;  4MUD A;  3IS7 A;  5FFD A;  1RCE A;  3O7S A;  3C1Z A;  3JZ9 A;  1DAT A;  3KDQ A;  1NF6 A;  3N6O A;  2VXX A;  2V8U A;  4XGS A;  3QHB A;  4KVQ A;  5CMQ A;  2C41 A;  5FFE A;  1N1Q A;  5GU0 X;  4RC6 B;  4CY9 A;  1L8I A;  2N02 A;  4LPM A;  3NP0 X;  2G4H A;  1F30 A;  2V8T A;  5HQO A;  4LPJ A;  4R42 A;  3F36 A;  3Q4Q A;  3RD0 A;  1LB3 A;  1QYB A;  2IY4 A;  1XZ1 A;  3AK8 A;  3PWF A;  5JDO A;  2CHP A;  3PWQ C;  3F39 A;  3JZA B;  3AK9 A;  1LKP A;  4DI0 A;  4TOA A;  3R2M A;  4LPN A;  2FL0 A;  3ES3 A;  4ITW A;  3E1M A;  5I4J A;  2OC5 A;  3PW1 A;  5JKM A;  3PW1 B;  2BK6 A;  1F33 A;  1IES A;  3R2K A;  5ERJ A;  2Y44 A;  1BCF A;  4DYU A;  2FKZ A;  4II4 B;  3PWQ A;  3O7R A;  3E1O A;  4ZLW A;  1JI5 A;  4DYY A;  3AJQ A;  3WVU A;  2V2J A;  2FFX J;  2VXI A;  4M33 A;  4CVS A;  3UOF A;  2QQY A;  4X0J A;  3BKN A;  1VEI A;  1S30 A;  1L8H A;  4WJG 4;  5GOU A;  3GGZ A;  3FSE A;  1NF4 A;  3PVR B;  4Z3B A;  3QB9 A;  1LKO A;  5HJF A;  3GHQ A;  3ISE A;  2FZF A;  2F7N A;  2MGY A;  2V2I A;  3R2L A;  3E6R A;  3W54 A;  1DVB A;  4MXP A;  3FI6 A;  5C6F A;  5CMR A;  4PG1 A;  3DBY A;  4ZMC A;  4DYZ A;  1JRE A;  2YW7 A;  2JD8 0;  3SH6 A;  2V2S A;  2IU2 A;  3AF8 X;  2Z6M A;  1JI4 A;  2UX1 A;  5HU6 D;  3AF7 X;  3KXU A;  3Q4R A;  2V2O A;  4RC8 A;  1MOJ A;  2JD6 0;  5J8W A;  3RBC A;  3OJ5 A;  5FEJ A;  2V2M A;  4CMY A;  3OGH A;  2FG4 A;  5JKM G;  3PW8 C;  4TOD A;  4XKS A;  2V15 A;  4XKT A;  1TKO A;  2Y3Q A;  3FRS A;  1UMN A;  2CN7 A;  3AJP A;  5D8P A;  1IER A;  3UOI A;  5J93 A;  3FVB A;  4IWK A;  4ISP A;  2CLU A;  4ZJK A;  2C2F A;  3PW8 A;  3SHX A;  2FHA A;  2WWX B;  3VV9 A;  1YV1 A;  4TOH A;  1HRS A;  2Z90 A;  2CF7 A;  1BFR A;  4CVR A;  4AM5 A;  4ZKW A;  2WLA A;  1Z6O A;  3D19 A;  4RC6 A;  5FFA A;  4EVB A;  3GGY A;  4TOB A;  3QVD A;  3AF9 X;  1LKM A;  5D8X A;  3BVL A;  5K53 A;  4KXR B;  3KX9 A;  2ZG9 X;  4CYA A;  2RBD A;  4Z5S A;  2HTN A;  3E1Q A;  2YW6 A;  4E6K A;  2WTL A;  1ZUJ A;  3F37 A;  3U90 A;  2BJY A;  1RCD A;  4TOE A;  4IXK A;  4TOC A;  5GU1 X;  4KVS A;  1RYT A;  4U3G A;  3F38 A;  4E40 A;  3ERZ A;  1JYB A;  1S3Q A;  3E2C A;  4DAS A;  3Q4N A;  4KVR A;  4LQV A;  3LKD A;  4II4 A;  1EUM A;  3KA3 A;  4ERU A;  4OYN A;  3QD8 A;  2XKQ A;  4YKH A;  1NNQ A;  2XJN A;  3BT5 A;  3GVY A;  1DPS A;  4EVE A;  5J9V A;  4CVP A;  3ISF A;  5J8S A;  1TKP A;  1R03 A;  4XKU A;  3PVR A;  5D8O A;  3C1Y A;  4ZKX A;  2XGW A;  1JKU A;  4MN9 A;  5ERK A;  1YUZ A;  4PG0 A;  1O9R A;  2Z5R A;  3PVT A;  4RC7 B;  3PVT B;  4RC5 B;  4LQH A;  4W4K B;  2XJM A;  3EZU A;  2C6R A;  3F32 A;  1XZ3 A;  3Q4O A;  4ML5 A;  2BKC A;  1VJX A;  3KWO A;  4CYB A;  5GU3 X;  2PYB A;  2CHI A;  1S2Z A;  2FJC A;  3BVE A;  3E1P A;  4TOG A;  3WVW A;  3KA9 A;  5GN8 A;  3E1N A;  5GN8 B;  2V2N A;  1KRQ A;  3RAV A;  2G38 B;  2D5K A;  2V2P A;  4MY7 A;  1OTK A;  3HIU A;  2CEI A;  3VVA A;  4CMY V;  2C2U A;  5D8R A;  1Z4A A;  3F35 A;  3A68 A;  3F33 A;  1SOF A;  3VNX A;  3MPS A;  2Z5P A;  2V2L A;  2ZA6 A;  5CZU A;  3F34 A;  1BG7 A;  2W0O A;  3EZ0 A;  4LYU A;  5FFC A;  1VLG A;  4TO9 A;  2GYD A;  4REU A;  3C23 A;  2CIH A;  5E2D A;  3PVY B;  3KA8 A;  3WVV A;  3FRR A;  4AM4 A;  3IS8 A;  4DE6 A;  4ITT A;  2GS4 A;  3SID A;  4TW3 A;  4DZ0 A;  1JTS A;  4AM2 A;  3R2O A;  5FFB A;  2QF9 A;  2JD7 0;  2ZA8 A;  3AJO A;  3TA8 A;  3PZA A;  5LG8 A;  3T9J A;  4M34 A;  3SE1 A;  4EVC A;  3L0M A;  3WNW A;  2HR5 A;  2BW1 A;  3R2S A;  5GU2 X;  3GE4 A;  2ITB A;  4ZKH A;  3IQ1 A;  1VEQ A;  4ZTT A;  4ZL5 A; 
#chains in the Genus database with same CATH homology
 3NP2 X;  4Y08 A;  3KHK A;  3RE7 A;  2XJO A;  1UVH A;  3QHC A;  2X17 0;  4CVT A;  3QZ3 A;  2CWL A;  2VZB A;  4ETR A;  1Z6O M;  5D8Y A;  5IX6 A;  1FHA A;  5JDO B;  2ZA7 A;  4QUW A;  4YXJ A;  5LBH A;  5E1U A;  1VEL A;  1GWG A;  5JKL A;  4MJY A;  2ZG8 X;  4TOF A;  2OH3 A;  4YVZ A;  1TJO A;  1RCI A;  2V2R A;  3H7G A;  1JKV A;  3BVK A;  4YXM A;  5K52 A;  2OKC A;  5HJH A;  1B71 A;  3BVF A;  1JIG A;  4RC5 A;  4RC7 A;  3E1J A;  4MKU A;  4A25 A;  3RGD A;  2AR0 A;  4IWJ A;  4ZL6 A;  1QGH A;  1H96 A;  2GYQ A;  1NFV A;  3C21 A;  3UFB A;  3R2H A;  3KA4 A;  3M6J A;  2FG8 A;  4DYX A;  2ZG7 X;  3HL1 A;  2ZUR X;  1MFR A;  3NOZ X;  3EGM A;  2WLU A;  2C2J A;  3V3K B;  4LQJ A;  4P18 A;  4PGK A;  3BVI A;  1ZS3 A;  4W4L B;  4M35 A;  5LG2 A;  4EVD A;  2CLB A;  1SQ3 A;  1O9I A;  1JGC A;  4PGI A;  1TK6 A;  1YUX A;  2YJJ A;  3A9Q A;  5JKL G;  2YJK A;  3R2R A;  4LQN A;  3KA6 A;  4LYX A;  2Z5Q A;  3PVY A;  4M32 A;  1J30 A;  5JAC A;  3UNO A;  2IB0 A;  2CN6 A;  5D8Q A;  5AXS A;  1AEW A;  3E1L A;  5D8S A;  1RCG A;  4ISM A;  3E6S A;  1RCC A;  5LS9 A;  4MUD A;  3IS7 A;  5FFD A;  1RCE A;  3O7S A;  3C1Z A;  3JZ9 A;  1DAT A;  3KDQ A;  1NF6 A;  3N6O A;  2VXX A;  2V8U A;  4XGS A;  3QHB A;  4KVQ A;  5CMQ A;  2C41 A;  5FFE A;  1N1Q A;  5GU0 X;  4RC6 B;  4CY9 A;  1L8I A;  2N02 A;  4LPM A;  3NP0 X;  2G4H A;  1F30 A;  2V8T A;  5HQO A;  4LPJ A;  4R42 A;  3F36 A;  3Q4Q A;  3RD0 A;  1LB3 A;  1QYB A;  2IY4 A;  1XZ1 A;  3AK8 A;  3PWF A;  5JDO A;  2CHP A;  3PWQ C;  3F39 A;  3JZA B;  3AK9 A;  1LKP A;  4DI0 A;  4TOA A;  3R2M A;  4LPN A;  2FL0 A;  3ES3 A;  4ITW A;  3E1M A;  5I4J A;  2OC5 A;  3PW1 A;  5JKM A;  3PW1 B;  2BK6 A;  1F33 A;  1IES A;  3R2K A;  5ERJ A;  2Y44 A;  1BCF A;  4DYU A;  2FKZ A;  4II4 B;  3PWQ A;  3O7R A;  3E1O A;  4ZLW A;  1JI5 A;  4DYY A;  3AJQ A;  3WVU A;  2V2J A;  2FFX J;  2VXI A;  4M33 A;  4CVS A;  3UOF A;  2QQY A;  4X0J A;  3BKN A;  1VEI A;  1S30 A;  1L8H A;  4WJG 4;  5GOU A;  3GGZ A;  3FSE A;  1NF4 A;  3PVR B;  4Z3B A;  3QB9 A;  1LKO A;  5HJF A;  3GHQ A;  3ISE A;  2FZF A;  2F7N A;  2MGY A;  2V2I A;  3R2L A;  3E6R A;  3W54 A;  1DVB A;  4MXP A;  3FI6 A;  5C6F A;  5CMR A;  4PG1 A;  3DBY A;  4ZMC A;  4DYZ A;  1JRE A;  2YW7 A;  2JD8 0;  3SH6 A;  2V2S A;  2IU2 A;  3AF8 X;  2Z6M A;  1JI4 A;  2UX1 A;  5HU6 D;  3AF7 X;  3KXU A;  3Q4R A;  2V2O A;  4RC8 A;  1MOJ A;  2JD6 0;  5J8W A;  3RBC A;  3OJ5 A;  5FEJ A;  2V2M A;  4CMY A;  3OGH A;  2FG4 A;  5JKM G;  3PW8 C;  4TOD A;  4XKS A;  2V15 A;  4XKT A;  1TKO A;  2Y3Q A;  3FRS A;  1UMN A;  2CN7 A;  3AJP A;  5D8P A;  1IER A;  3UOI A;  5J93 A;  3FVB A;  4IWK A;  4ISP A;  2CLU A;  4ZJK A;  2C2F A;  3PW8 A;  3SHX A;  2FHA A;  2WWX B;  3VV9 A;  1YV1 A;  4TOH A;  1HRS A;  2Z90 A;  2CF7 A;  1BFR A;  4CVR A;  4AM5 A;  4ZKW A;  2WLA A;  1Z6O A;  3D19 A;  4RC6 A;  5FFA A;  4EVB A;  3GGY A;  4TOB A;  3QVD A;  3AF9 X;  1LKM A;  5D8X A;  3BVL A;  5K53 A;  4KXR B;  3KX9 A;  2ZG9 X;  4CYA A;  2RBD A;  4Z5S A;  2HTN A;  3E1Q A;  2YW6 A;  4E6K A;  2WTL A;  1ZUJ A;  3F37 A;  3U90 A;  2BJY A;  1RCD A;  4TOE A;  4IXK A;  4TOC A;  5GU1 X;  4KVS A;  1RYT A;  4U3G A;  3F38 A;  4E40 A;  3ERZ A;  1JYB A;  1S3Q A;  3E2C A;  4DAS A;  3Q4N A;  4KVR A;  4LQV A;  3LKD A;  4II4 A;  1EUM A;  3KA3 A;  4ERU A;  4OYN A;  3QD8 A;  2XKQ A;  4YKH A;  1NNQ A;  2XJN A;  3BT5 A;  3GVY A;  1DPS A;  4EVE A;  5J9V A;  4CVP A;  3ISF A;  5J8S A;  1TKP A;  1R03 A;  4XKU A;  3PVR A;  5D8O A;  3C1Y A;  4ZKX A;  2XGW A;  1JKU A;  4MN9 A;  5ERK A;  1YUZ A;  4PG0 A;  1O9R A;  2Z5R A;  3PVT A;  4RC7 B;  3PVT B;  4RC5 B;  4LQH A;  4W4K B;  2XJM A;  3EZU A;  2C6R A;  3F32 A;  1XZ3 A;  3Q4O A;  4ML5 A;  2BKC A;  1VJX A;  3KWO A;  4CYB A;  5GU3 X;  2PYB A;  2CHI A;  1S2Z A;  2FJC A;  3BVE A;  3E1P A;  4TOG A;  3WVW A;  3KA9 A;  5GN8 A;  3E1N A;  5GN8 B;  2V2N A;  1KRQ A;  3RAV A;  2G38 B;  2D5K A;  2V2P A;  4MY7 A;  1OTK A;  3HIU A;  2CEI A;  3VVA A;  4CMY V;  2C2U A;  5D8R A;  1Z4A A;  3F35 A;  3A68 A;  3F33 A;  1SOF A;  3VNX A;  3MPS A;  2Z5P A;  2V2L A;  2ZA6 A;  5CZU A;  3F34 A;  1BG7 A;  2W0O A;  3EZ0 A;  4LYU A;  5FFC A;  1VLG A;  4TO9 A;  2GYD A;  4REU A;  3C23 A;  2CIH A;  5E2D A;  3PVY B;  3KA8 A;  3WVV A;  3FRR A;  4AM4 A;  3IS8 A;  4DE6 A;  4ITT A;  2GS4 A;  3SID A;  4TW3 A;  4DZ0 A;  1JTS A;  4AM2 A;  3R2O A;  5FFB A;  2QF9 A;  2JD7 0;  2ZA8 A;  3AJO A;  3TA8 A;  3PZA A;  5LG8 A;  3T9J A;  4M34 A;  3SE1 A;  4EVC A;  3L0M A;  3WNW A;  2HR5 A;  2BW1 A;  3R2S A;  5GU2 X;  3GE4 A;  2ITB A;  4ZKH A;  3IQ1 A;  1VEQ A;  4ZTT A;  4ZL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...