3E2CA

Escherichia coli bacterioferritin mutant e128r/e135r
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
158
structure length
158
Chain Sequence
b'MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDERGHIDWLRTELDLIQKMGLQNYLQAQIREEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Structural and Mechanistic Studies of a Stabilized Subunit Dimer Variant of Escherichia coli Bacterioferritin Identify Residues Required for Core Formation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e2cA00
1JTSA 3R2OA 5D8XA 3QZ3A 1NNQA 2ZG8X 3R2KA 5D8SA 1L8HA 2JD80 1DPSA 5IX6A 4CY9A 4M34A 5D8YA 4ERUA 3U90A 5LBHA 2PYBA 5LS9A 2G4HA 4II4A 5GOUA 5LG8A 3RE7A 2ZA7A 4ZTTA 4EVEA 2YJKA 2Z5QA 1RCEA 4IXKA 2CLBA 3RBCA 5D8QA 3PW8A 1YV1A 1JI4A 3E6RA 2V2IA 2FFXJ 4DI0A 4CVTA 2ITBA 5K53A 3KA9A 2ZG9X 5ERKA 5JKMA 3SHXA 3WVWA 4ZMCA 4MY7A 5GU3X 5HQOA 4M33A 3Q4QA 2GS4A 4A25A 1SQ3A 3EGMA 2V2MA 4PG0A 1TK6A 5FFAA 2C2FA 1UVHA 4ITWA 2XJNA 2UX1A 4PGKA 5JKMG 5I4JA 2F7NA 5GN8A 1Z6OM 3F35A 2CN6A 4TODA 3PVYB 3SH6A 4M32A 2Z5RA 3BKNA 4TOEA 3UOFA 3BT5A 5HJHA 4ZKHA 4Y08A 3WVUA 1KRQA 2QQYA 3A68A 1B71A 4ZKWA 1JIGA 3ERZA 2Z6MA 4ETRA 4REUA 2Z5PA 1LKOA 3PW1A 4RC6B 3Q4OA 3F36A 2XJOA 4QUWA 4IWKA 2XKQA 4ISMA 2CIHA 3F37A 5E2DA 4P18A 4XKUA 1EUMA 1YUXA 2YW6A 2CHIA 3QVDA 4RC8A 3RGDA 2ZURX 3AJOA 3WNWA 2HTNA 2V2RA 5J93A 2V2PA 2GYDA 4PGIA 4RC7B 5AXSA 3H7GA 3GVYA 3QHCA 3WVVA 3KA3A 3A9QA 3KX9A 1BCFA 2C2UA 3R2SA 3O7SA 2CHPA 4CYBA 2CF7A 2IB0A 3T9JA 2ZA8A 3PVRA 1AEWA 4CVRA 1RCIA 2Y3QA 1BFRA 1S30A 2BW1A 3KWOA 3NP0X 3AF8X 1YUZA 1O9IA 1JKVA 3O7RA 4RC5A 1NF4A 5K52A 2D5KA 4CVSA 4ZLWA 1NF6A 1QYBA 3KA8A 3F39A 2OH3A 4TOCA 3UNOA 3Q4RA 2V2LA 3PVTB 1GWGA 2YJJA 4KVQA 5E1UA 5LG2A 2CEIA 3OGHA 1JGCA 1S3QA 1MFRA 2V2JA 4TO9A 1N1QA 3BVLA 4LYXA 3IS7A 2BJYA 2IU2A 4TW3A 1F33A 5HJFA 4CYAA 4R42A 1L8IA 1TJOA 5FFBA 2FZFA 4AM5A 3QHBA 1Z6OA 2Z90A 4LQNA 5GU1X 2C2JA 4ITTA 5C6FA 4CMYA 4ZL5A 1VJXA 3BVIA 3PWQA 1BG7A 3E1OA 3BVEA 5ERJA 4PG1A 2FG8A 3E2CA 4KVRA 2FL0A 3OJ5A 2V2OA 2ZA6A 2XJMA 2YW7A 4MKUA 1LB3A 2BK6A 4LQJA 1OTKA 1VLGA 3PW8C 2IY4A 5GU2X 1R03A 1HRSA 3R2HA 2C41A 4DYUA 3QD8A 3R2RA 4IWJA 3IS8A 1Z4AA 2WTLA 2BKCA 2CLUA 4II4B 1TKOA 3PZAA 4TOFA 5CMQA 3VNXA 2QF9A 3QB9A 5FFCA 3SE1A 4CMYV 4DE6A 3BVFA 4DASA 4MJYA 2FG4A 4ISPA 1FHAA 1O9RA 2HR5A 1DATA 1VEQA 3FSEA 3PWQC 3R2LA 3SIDA 3IQ1A 3E6SA 3PWFA 5D8PA 3TA8A 3PVYA 4MN9A 4OYNA 4DYYA 3E1LA 5D8OA 2V2SA 3F33A 4LPJA 3GHQA 3ES3A 4XKTA 2JD70 2RBDA 4EVBA 4ZJKA 1JI5A 5FFEA 3EZUA 3R2MA 1XZ3A 3NP2X 1JYBA 2VXIA 3KA6A 2OC5A 5GN8B 5J8WA 3KXUA 4CVPA 2XGWA 4RC6A 2V2NA 4XKSA 3E1JA 1ZS3A 1RYTA 3EZ0A 5JKLG 1SOFA 3AF7X 4AM2A 3GE4A 2C6RA 2VXXA 3F38A 1RCDA 4EVDA 4YKHA 4AM4A 2FHAA 3F34A 4XGSA 5JACA 1JREA 3PW1B 1UMNA 1QGHA 4Z5SA 3FI6A 3UOIA 4RC7A 1TKPA 4DZ0A 5CMRA 4ZL6A 1RCGA 4LPMA 3KA4A 1J30A 2JD60 4U3GA 4ZKXA 3AF9X 1VELA 3E1MA 1MOJA 2X170 2VZBA 2FKZA 2CN7A 3AJPA 5J8SA 4LYUA 4LPNA 4DYZA 5J9VA 3RAVA 3MPSA 3PVRB 1DVBA 2WLUA 4TOGA 1IERA 3PVTA 3AJQA 1S2ZA 1LKMA 4TOHA 5GU0X 1F30A 4RC5B 1VEIA 1ZUJA 3FVBA 2GYQA 3E1QA 2WLAA 3F32A 5D8RA 5FEJA 3HL1A 2W0OA 4LQHA 3RD0A 1JKUA 2FJCA 5FFDA 4TOAA 4E6KA 4M35A 3ISFA 5CZUA 1H96A 3E1PA 3NOZX 2ZG7X 4LQVA 4ML5A 1IESA 2V15A 3Q4NA 3AK9A 3ISEA 1RCCA 4EVCA 3HIUA 1LKPA 1XZ1A 3E1NA 4MUDA 4Z3BA 3AK8A 1NFVA 4TOBA 4KVSA 5JKLA 4DYXA 3BVKA
chains in the Genus database with same CATH superfamily
1JTSA 3R2OA 5D8XA 3QZ3A 1NNQA 2ZG8X 3R2KA 5D8SA 1L8HA 2JD80 1DPSA 5IX6A 4CY9A 4M34A 5D8YA 4W4KB 4ERUA 3U90A 5LBHA 2PYBA 5LS9A 2G4HA 4II4A 5GOUA 5LG8A 3RE7A 2ZA7A 4ZTTA 4EVEA 2YJKA 5JDOA 2Z5QA 1RCEA 4IXKA 2CLBA 3RBCA 5D8QA 3PW8A 1YV1A 1JI4A 3E6RA 2V2IA 2CWLA 2FFXJ 4DI0A 4CVTA 2ITBA 5K53A 3KA9A 2ZG9X 5ERKA 5JKMA 3SHXA 3M6JA 3WVWA 4ZMCA 4MY7A 3D19A 5GU3X 5HQOA 4M33A 3Q4QA 2GS4A 4A25A 1SQ3A 3EGMA 2V2MA 4PG0A 1TK6A 5FFAA 2C2FA 1UVHA 4ITWA 2XJNA 2UX1A 4PGKA 5JKMG 5I4JA 2F7NA 5GN8A 1Z6OM 3F35A 2CN6A 4TODA 3PVYB 4W4LB 3SH6A 4M32A 2Z5RA 3BKNA 4TOEA 3UOFA 3BT5A 5HJHA 4ZKHA 4Y08A 3WVUA 1KRQA 2N02A 2Y44A 2QQYA 3A68A 1B71A 4ZKWA 1JIGA 3ERZA 2Z6MA 3FRSA 4ETRA 4REUA 2Z5PA 1LKOA 3PW1A 4RC6B 3Q4OA 3F36A 2XJOA 4QUWA 4IWKA 2XKQA 4ISMA 2CIHA 3F37A 5E2DA 4P18A 4XKUA 1EUMA 1YUXA 2YW6A 2CHIA 3QVDA 4RC8A 3RGDA 2ZURX 3AJOA 3WNWA 2HTNA 2V2RA 5J93A 2V2PA 2GYDA 4PGIA 4RC7B 5AXSA 3H7GA 3GVYA 3QHCA 3WVVA 3KA3A 3A9QA 3KX9A 1BCFA 2C2UA 3R2SA 4X0JA 3O7SA 2CHPA 4CYBA 2CF7A 3JZ9A 2IB0A 3T9JA 2ZA8A 3PVRA 1AEWA 3LKDA 4CVRA 1RCIA 2Y3QA 1BFRA 1S30A 2BW1A 3KWOA 3NP0X 3AF8X 1YUZA 1O9IA 1JKVA 3O7RA 4RC5A 1NF4A 3C21A 5K52A 2D5KA 4CVSA 4ZLWA 1NF6A 1QYBA 3KA8A 3F39A 2OH3A 4TOCA 3UNOA 3Q4RA 2V2LA 3PVTB 1GWGA 2YJJA 4KVQA 5E1UA 5LG2A 2CEIA 3OGHA 1JGCA 1S3QA 1MFRA 2V2JA 4TO9A 1N1QA 3BVLA 4LYXA 3VV9A 3C1ZA 3IS7A 2BJYA 2IU2A 4TW3A 1F33A 5HJFA 4CYAA 4R42A 1L8IA 3KDQA 1TJOA 5FFBA 2FZFA 4AM5A 2V8UA 3QHBA 4WJG4 1Z6OA 2Z90A 3C1YA 4LQNA 5GU1X 2C2JA 4ITTA 5C6FA 4CMYA 4ZL5A 1VJXA 3BVIA 3PWQA 1BG7A 3E1OA 3BVEA 5ERJA 4PG1A 2FG8A 3E2CA 4KVRA 2FL0A 3OJ5A 3W54A 2V2OA 2ZA6A 2XJMA 2YW7A 4MKUA 1LB3A 2BK6A 4LQJA 1OTKA 1VLGA 3PW8C 2IY4A 5GU2X 1R03A 1HRSA 3R2HA 2C41A 4DYUA 3QD8A 3R2RA 4IWJA 3IS8A 1Z4AA 2WTLA 3L0MA 2BKCA 2CLUA 4II4B 2WWXB 1TKOA 3PZAA 4TOFA 5CMQA 5JDOB 3VNXA 2QF9A 3QB9A 5FFCA 3GGYA 3SE1A 4CMYV 4DE6A 3BVFA 4DASA 4MJYA 2FG4A 4ISPA 1FHAA 1O9RA 2HR5A 1DATA 1VEQA 3FSEA 3PWQC 3R2LA 3SIDA 3IQ1A 3E6SA 3PWFA 5D8PA 3TA8A 3PVYA 4MN9A 4OYNA 4DYYA 3E1LA 5D8OA 2V2SA 3F33A 4LPJA 3GHQA 3ES3A 4XKTA 2JD70 2RBDA 4EVBA 4ZJKA 1JI5A 5FFEA 3EZUA 3V3KB 3R2MA 1XZ3A 3NP2X 1JYBA 2VXIA 3KA6A 2OC5A 5GN8B 5J8WA 3KXUA 4MXPA 4CVPA 2XGWA 4RC6A 2V2NA 4XKSA 3E1JA 1ZS3A 1RYTA 3EZ0A 5JKLG 1SOFA 3JZAB 3AF7X 4AM2A 3GE4A 2C6RA 2AR0A 2VXXA 1RCDA 3F38A 4EVDA 4YXJA 4YKHA 4AM4A 2FHAA 3F34A 4XGSA 5JACA 1JREA 3PW1B 3UFBA 1UMNA 1QGHA 4Z5SA 3FI6A 3UOIA 4RC7A 1TKPA 4DZ0A 5CMRA 4ZL6A 1RCGA 3DBYA 4LPMA 4YVZA 3KA4A 1J30A 2JD60 4U3GA 3KHKA 4ZKXA 3AF9X 1VELA 3E1MA 1MOJA 2X170 2VZBA 2FKZA 2CN7A 2MGYA 3AJPA 5J8SA 3FRRA 4LYUA 4LPNA 4DYZA 4KXRB 5J9VA 3RAVA 3MPSA 3PVRB 1DVBA 3C23A 2WLUA 4TOGA 1IERA 3PVTA 3AJQA 3GGZA 1S2ZA 1LKMA 4TOHA 5GU0X 1F30A 4YXMA 2V8TA 4RC5B 1VEIA 1ZUJA 3FVBA 2GYQA 3E1QA 2WLAA 3F32A 5D8RA 5FEJA 2OKCA 3HL1A 2W0OA 3N6OA 4LQHA 3RD0A 1JKUA 2FJCA 5FFDA 4TOAA 4E6KA 4M35A 3ISFA 5CZUA 1H96A 3E1PA 3NOZX 4E40A 2G38B 5HU6D 2ZG7X 4LQVA 4ML5A 1IESA 2V15A 3Q4NA 3VVAA 3AK9A 3ISEA 1RCCA 4EVCA 3HIUA 1LKPA 1XZ1A 3E1NA 4MUDA 4Z3BA 3AK8A 1NFVA 4TOBA 4KVSA 5JKLA 4DYXA 3BVKA
chains in the Genus database with same CATH topology
1JTSA 3R2OA 5D8XA 3QZ3A 1NNQA 2ZG8X 3R2KA 5D8SA 1L8HA 2JD80 1DPSA 5IX6A 4CY9A 4M34A 5D8YA 4W4KB 4ERUA 3U90A 5LBHA 2PYBA 5LS9A 2G4HA 4II4A 5GOUA 5LG8A 3RE7A 2ZA7A 4ZTTA 4EVEA 2YJKA 5JDOA 2Z5QA 1RCEA 4IXKA 2CLBA 3RBCA 5D8QA 3PW8A 1YV1A 1JI4A 3E6RA 2V2IA 2CWLA 2FFXJ 4DI0A 4CVTA 2ITBA 5K53A 3KA9A 2ZG9X 5ERKA 5JKMA 3SHXA 3M6JA 3WVWA 4ZMCA 4MY7A 3D19A 5GU3X 5HQOA 4M33A 3Q4QA 2GS4A 4A25A 1SQ3A 3EGMA 2V2MA 4PG0A 1TK6A 5FFAA 2C2FA 1UVHA 4ITWA 2XJNA 2UX1A 4PGKA 5JKMG 5I4JA 2F7NA 5GN8A 1Z6OM 3F35A 2CN6A 4TODA 3PVYB 4W4LB 3SH6A 4M32A 2Z5RA 3BKNA 4TOEA 3UOFA 3BT5A 5HJHA 4ZKHA 4Y08A 3WVUA 1KRQA 2N02A 2Y44A 2QQYA 3A68A 1B71A 4ZKWA 1JIGA 3ERZA 2Z6MA 3FRSA 4ETRA 4REUA 2Z5PA 1LKOA 3PW1A 4RC6B 3Q4OA 3F36A 2XJOA 4QUWA 4IWKA 2XKQA 4ISMA 2CIHA 3F37A 5E2DA 4P18A 4XKUA 1EUMA 1YUXA 2YW6A 2CHIA 3QVDA 4RC8A 3RGDA 2ZURX 3AJOA 3WNWA 2HTNA 2V2RA 5J93A 2V2PA 2GYDA 4PGIA 4RC7B 5AXSA 3H7GA 3GVYA 3QHCA 3WVVA 3KA3A 3A9QA 3KX9A 1BCFA 2C2UA 3R2SA 4X0JA 3O7SA 2CHPA 4CYBA 2CF7A 3JZ9A 2IB0A 3T9JA 2ZA8A 3PVRA 1AEWA 3LKDA 4CVRA 1RCIA 2Y3QA 1BFRA 1S30A 2BW1A 3KWOA 3NP0X 3AF8X 1YUZA 1O9IA 1JKVA 3O7RA 4RC5A 1NF4A 3C21A 5K52A 2D5KA 4CVSA 4ZLWA 1NF6A 1QYBA 3KA8A 3F39A 2OH3A 4TOCA 3UNOA 3Q4RA 2V2LA 3PVTB 1GWGA 2YJJA 4KVQA 5E1UA 5LG2A 2CEIA 3OGHA 1JGCA 1S3QA 1MFRA 2V2JA 4TO9A 1N1QA 3BVLA 4LYXA 3VV9A 3C1ZA 3IS7A 2BJYA 2IU2A 4TW3A 1F33A 5HJFA 4CYAA 4R42A 1L8IA 3KDQA 1TJOA 5FFBA 2FZFA 4AM5A 2V8UA 3QHBA 4WJG4 1Z6OA 2Z90A 3C1YA 4LQNA 5GU1X 2C2JA 4ITTA 5C6FA 4CMYA 4ZL5A 1VJXA 3BVIA 3PWQA 1BG7A 3E1OA 3BVEA 5ERJA 4PG1A 2FG8A 3E2CA 4KVRA 2FL0A 3OJ5A 3W54A 2V2OA 2ZA6A 2XJMA 2YW7A 4MKUA 1LB3A 2BK6A 4LQJA 1OTKA 1VLGA 3PW8C 2IY4A 5GU2X 1R03A 1HRSA 3R2HA 2C41A 4DYUA 3QD8A 3R2RA 4IWJA 3IS8A 1Z4AA 2WTLA 3L0MA 2BKCA 2CLUA 4II4B 2WWXB 1TKOA 3PZAA 4TOFA 5CMQA 5JDOB 3VNXA 2QF9A 3QB9A 5FFCA 3GGYA 3SE1A 4CMYV 4DE6A 3BVFA 4DASA 4MJYA 2FG4A 4ISPA 1FHAA 1O9RA 2HR5A 1DATA 1VEQA 3FSEA 3PWQC 3R2LA 3SIDA 3IQ1A 3E6SA 3PWFA 5D8PA 3TA8A 3PVYA 4MN9A 4OYNA 4DYYA 3E1LA 5D8OA 2V2SA 3F33A 4LPJA 3GHQA 3ES3A 4XKTA 2JD70 2RBDA 4EVBA 4ZJKA 1JI5A 5FFEA 3EZUA 3V3KB 3R2MA 1XZ3A 3NP2X 1JYBA 2VXIA 3KA6A 2OC5A 5GN8B 5J8WA 3KXUA 4MXPA 4CVPA 2XGWA 4RC6A 2V2NA 4XKSA 3E1JA 1ZS3A 1RYTA 3EZ0A 5JKLG 1SOFA 3JZAB 3AF7X 4AM2A 3GE4A 2C6RA 2AR0A 2VXXA 1RCDA 3F38A 4EVDA 4YXJA 4YKHA 4AM4A 2FHAA 3F34A 4XGSA 5JACA 1JREA 3PW1B 3UFBA 1UMNA 1QGHA 4Z5SA 3FI6A 3UOIA 4RC7A 1TKPA 4DZ0A 5CMRA 4ZL6A 1RCGA 3DBYA 4LPMA 4YVZA 3KA4A 1J30A 2JD60 4U3GA 3KHKA 4ZKXA 3AF9X 1VELA 3E1MA 1MOJA 2X170 2VZBA 2FKZA 2CN7A 2MGYA 3AJPA 5J8SA 3FRRA 4LYUA 4LPNA 4DYZA 4KXRB 5J9VA 3RAVA 3MPSA 3PVRB 1DVBA 3C23A 2WLUA 4TOGA 1IERA 3PVTA 3AJQA 3GGZA 1S2ZA 1LKMA 4TOHA 5GU0X 1F30A 4YXMA 2V8TA 4RC5B 1VEIA 1ZUJA 3FVBA 2GYQA 3E1QA 2WLAA 3F32A 5D8RA 5FEJA 2OKCA 3HL1A 2W0OA 3N6OA 4LQHA 3RD0A 1JKUA 2FJCA 5FFDA 4TOAA 4E6KA 4M35A 3ISFA 5CZUA 1H96A 3E1PA 3NOZX 4E40A 2G38B 5HU6D 2ZG7X 4LQVA 4ML5A 1IESA 2V15A 3Q4NA 3VVAA 3AK9A 3ISEA 1RCCA 4EVCA 3HIUA 1LKPA 1XZ1A 3E1NA 4MUDA 4Z3BA 3AK8A 1NFVA 4TOBA 4KVSA 5JKLA 4DYXA 3BVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTS A;  3R2O A;  5D8X A;  3QZ3 A;  1NNQ A;  2ZG8 X;  3R2K A;  5D8S A;  1L8H A;  2JD8 0;  1DPS A;  5IX6 A;  4CY9 A;  4M34 A;  5D8Y A;  4ERU A;  3U90 A;  5LBH A;  2PYB A;  5LS9 A;  2G4H A;  4II4 A;  5GOU A;  5LG8 A;  3RE7 A;  2ZA7 A;  4ZTT A;  4EVE A;  2YJK A;  2Z5Q A;  1RCE A;  4IXK A;  2CLB A;  3RBC A;  5D8Q A;  3PW8 A;  1YV1 A;  1JI4 A;  3E6R A;  2V2I A;  2FFX J;  4DI0 A;  4CVT A;  2ITB A;  5K53 A;  3KA9 A;  2ZG9 X;  5ERK A;  5JKM A;  3SHX A;  3WVW A;  4ZMC A;  4MY7 A;  5GU3 X;  5HQO A;  4M33 A;  3Q4Q A;  2GS4 A;  4A25 A;  1SQ3 A;  3EGM A;  2V2M A;  4PG0 A;  1TK6 A;  5FFA A;  2C2F A;  1UVH A;  4ITW A;  2XJN A;  2UX1 A;  4PGK A;  5JKM G;  5I4J A;  2F7N A;  5GN8 A;  1Z6O M;  3F35 A;  2CN6 A;  4TOD A;  3PVY B;  3SH6 A;  4M32 A;  2Z5R A;  3BKN A;  4TOE A;  3UOF A;  3BT5 A;  5HJH A;  4ZKH A;  4Y08 A;  3WVU A;  1KRQ A;  2QQY A;  3A68 A;  1B71 A;  4ZKW A;  1JIG A;  3ERZ A;  2Z6M A;  4ETR A;  4REU A;  2Z5P A;  1LKO A;  3PW1 A;  4RC6 B;  3Q4O A;  3F36 A;  2XJO A;  4QUW A;  4IWK A;  2XKQ A;  4ISM A;  2CIH A;  3F37 A;  5E2D A;  4P18 A;  4XKU A;  1EUM A;  1YUX A;  2YW6 A;  2CHI A;  3QVD A;  4RC8 A;  3RGD A;  2ZUR X;  3AJO A;  3WNW A;  2HTN A;  2V2R A;  5J93 A;  2V2P A;  2GYD A;  4PGI A;  4RC7 B;  5AXS A;  3H7G A;  3GVY A;  3QHC A;  3WVV A;  3KA3 A;  3A9Q A;  3KX9 A;  1BCF A;  2C2U A;  3R2S A;  3O7S A;  2CHP A;  4CYB A;  2CF7 A;  2IB0 A;  3T9J A;  2ZA8 A;  3PVR A;  1AEW A;  4CVR A;  1RCI A;  2Y3Q A;  1BFR A;  1S30 A;  2BW1 A;  3KWO A;  3NP0 X;  3AF8 X;  1YUZ A;  1O9I A;  1JKV A;  3O7R A;  4RC5 A;  1NF4 A;  5K52 A;  2D5K A;  4CVS A;  4ZLW A;  1NF6 A;  1QYB A;  3KA8 A;  3F39 A;  2OH3 A;  4TOC A;  3UNO A;  3Q4R A;  2V2L A;  3PVT B;  1GWG A;  2YJJ A;  4KVQ A;  5E1U A;  5LG2 A;  2CEI A;  3OGH A;  1JGC A;  1S3Q A;  1MFR A;  2V2J A;  4TO9 A;  1N1Q A;  3BVL A;  4LYX A;  3IS7 A;  2BJY A;  2IU2 A;  4TW3 A;  1F33 A;  5HJF A;  4CYA A;  4R42 A;  1L8I A;  1TJO A;  5FFB A;  2FZF A;  4AM5 A;  3QHB A;  1Z6O A;  2Z90 A;  4LQN A;  5GU1 X;  2C2J A;  4ITT A;  5C6F A;  4CMY A;  4ZL5 A;  1VJX A;  3BVI A;  3PWQ A;  1BG7 A;  3E1O A;  3BVE A;  5ERJ A;  4PG1 A;  2FG8 A;  3E2C A;  4KVR A;  2FL0 A;  3OJ5 A;  2V2O A;  2ZA6 A;  2XJM A;  2YW7 A;  4MKU A;  1LB3 A;  2BK6 A;  4LQJ A;  1OTK A;  1VLG A;  3PW8 C;  2IY4 A;  5GU2 X;  1R03 A;  1HRS A;  3R2H A;  2C41 A;  4DYU A;  3QD8 A;  3R2R A;  4IWJ A;  3IS8 A;  1Z4A A;  2WTL A;  2BKC A;  2CLU A;  4II4 B;  1TKO A;  3PZA A;  4TOF A;  5CMQ A;  3VNX A;  2QF9 A;  3QB9 A;  5FFC A;  3SE1 A;  4CMY V;  4DE6 A;  3BVF A;  4DAS A;  4MJY A;  2FG4 A;  4ISP A;  1FHA A;  1O9R A;  2HR5 A;  1DAT A;  1VEQ A;  3FSE A;  3PWQ C;  3R2L A;  3SID A;  3IQ1 A;  3E6S A;  3PWF A;  5D8P A;  3TA8 A;  3PVY A;  4MN9 A;  4OYN A;  4DYY A;  3E1L A;  5D8O A;  2V2S A;  3F33 A;  4LPJ A;  3GHQ A;  3ES3 A;  4XKT A;  2JD7 0;  2RBD A;  4EVB A;  4ZJK A;  1JI5 A;  5FFE A;  3EZU A;  3R2M A;  1XZ3 A;  3NP2 X;  1JYB A;  2VXI A;  3KA6 A;  2OC5 A;  5GN8 B;  5J8W A;  3KXU A;  4CVP A;  2XGW A;  4RC6 A;  2V2N A;  4XKS A;  3E1J A;  1ZS3 A;  1RYT A;  3EZ0 A;  5JKL G;  1SOF A;  3AF7 X;  4AM2 A;  3GE4 A;  2C6R A;  2VXX A;  3F38 A;  1RCD A;  4EVD A;  4YKH A;  4AM4 A;  2FHA A;  3F34 A;  4XGS A;  5JAC A;  1JRE A;  3PW1 B;  1UMN A;  1QGH A;  4Z5S A;  3FI6 A;  3UOI A;  4RC7 A;  1TKP A;  4DZ0 A;  5CMR A;  4ZL6 A;  1RCG A;  4LPM A;  3KA4 A;  1J30 A;  2JD6 0;  4U3G A;  4ZKX A;  3AF9 X;  1VEL A;  3E1M A;  1MOJ A;  2X17 0;  2VZB A;  2FKZ A;  2CN7 A;  3AJP A;  5J8S A;  4LYU A;  4LPN A;  4DYZ A;  5J9V A;  3RAV A;  3MPS A;  3PVR B;  1DVB A;  2WLU A;  4TOG A;  1IER A;  3PVT A;  3AJQ A;  1S2Z A;  1LKM A;  4TOH A;  5GU0 X;  1F30 A;  4RC5 B;  1VEI A;  1ZUJ A;  3FVB A;  2GYQ A;  3E1Q A;  2WLA A;  3F32 A;  5D8R A;  5FEJ A;  3HL1 A;  2W0O A;  4LQH A;  3RD0 A;  1JKU A;  2FJC A;  5FFD A;  4TOA A;  4E6K A;  4M35 A;  3ISF A;  5CZU A;  1H96 A;  3E1P A;  3NOZ X;  2ZG7 X;  4LQV A;  4ML5 A;  1IES A;  2V15 A;  3Q4N A;  3AK9 A;  3ISE A;  1RCC A;  4EVC A;  3HIU A;  1LKP A;  1XZ1 A;  3E1N A;  4MUD A;  4Z3B A;  3AK8 A;  1NFV A;  4TOB A;  4KVS A;  5JKL A;  4DYX A;  3BVK A; 
#chains in the Genus database with same CATH topology
 1JTS A;  3R2O A;  5D8X A;  3QZ3 A;  1NNQ A;  2ZG8 X;  3R2K A;  5D8S A;  1L8H A;  2JD8 0;  1DPS A;  5IX6 A;  4CY9 A;  4M34 A;  5D8Y A;  4W4K B;  4ERU A;  3U90 A;  5LBH A;  2PYB A;  5LS9 A;  2G4H A;  4II4 A;  5GOU A;  5LG8 A;  3RE7 A;  2ZA7 A;  4ZTT A;  4EVE A;  2YJK A;  5JDO A;  2Z5Q A;  1RCE A;  4IXK A;  2CLB A;  3RBC A;  5D8Q A;  3PW8 A;  1YV1 A;  1JI4 A;  3E6R A;  2V2I A;  2CWL A;  2FFX J;  4DI0 A;  4CVT A;  2ITB A;  5K53 A;  3KA9 A;  2ZG9 X;  5ERK A;  5JKM A;  3SHX A;  3M6J A;  3WVW A;  4ZMC A;  4MY7 A;  3D19 A;  5GU3 X;  5HQO A;  4M33 A;  3Q4Q A;  2GS4 A;  4A25 A;  1SQ3 A;  3EGM A;  2V2M A;  4PG0 A;  1TK6 A;  5FFA A;  2C2F A;  1UVH A;  4ITW A;  2XJN A;  2UX1 A;  4PGK A;  5JKM G;  5I4J A;  2F7N A;  5GN8 A;  1Z6O M;  3F35 A;  2CN6 A;  4TOD A;  3PVY B;  4W4L B;  3SH6 A;  4M32 A;  2Z5R A;  3BKN A;  4TOE A;  3UOF A;  3BT5 A;  5HJH A;  4ZKH A;  4Y08 A;  3WVU A;  1KRQ A;  2N02 A;  2Y44 A;  2QQY A;  3A68 A;  1B71 A;  4ZKW A;  1JIG A;  3ERZ A;  2Z6M A;  3FRS A;  4ETR A;  4REU A;  2Z5P A;  1LKO A;  3PW1 A;  4RC6 B;  3Q4O A;  3F36 A;  2XJO A;  4QUW A;  4IWK A;  2XKQ A;  4ISM A;  2CIH A;  3F37 A;  5E2D A;  4P18 A;  4XKU A;  1EUM A;  1YUX A;  2YW6 A;  2CHI A;  3QVD A;  4RC8 A;  3RGD A;  2ZUR X;  3AJO A;  3WNW A;  2HTN A;  2V2R A;  5J93 A;  2V2P A;  2GYD A;  4PGI A;  4RC7 B;  5AXS A;  3H7G A;  3GVY A;  3QHC A;  3WVV A;  3KA3 A;  3A9Q A;  3KX9 A;  1BCF A;  2C2U A;  3R2S A;  4X0J A;  3O7S A;  2CHP A;  4CYB A;  2CF7 A;  3JZ9 A;  2IB0 A;  3T9J A;  2ZA8 A;  3PVR A;  1AEW A;  3LKD A;  4CVR A;  1RCI A;  2Y3Q A;  1BFR A;  1S30 A;  2BW1 A;  3KWO A;  3NP0 X;  3AF8 X;  1YUZ A;  1O9I A;  1JKV A;  3O7R A;  4RC5 A;  1NF4 A;  3C21 A;  5K52 A;  2D5K A;  4CVS A;  4ZLW A;  1NF6 A;  1QYB A;  3KA8 A;  3F39 A;  2OH3 A;  4TOC A;  3UNO A;  3Q4R A;  2V2L A;  3PVT B;  1GWG A;  2YJJ A;  4KVQ A;  5E1U A;  5LG2 A;  2CEI A;  3OGH A;  1JGC A;  1S3Q A;  1MFR A;  2V2J A;  4TO9 A;  1N1Q A;  3BVL A;  4LYX A;  3VV9 A;  3C1Z A;  3IS7 A;  2BJY A;  2IU2 A;  4TW3 A;  1F33 A;  5HJF A;  4CYA A;  4R42 A;  1L8I A;  3KDQ A;  1TJO A;  5FFB A;  2FZF A;  4AM5 A;  2V8U A;  3QHB A;  4WJG 4;  1Z6O A;  2Z90 A;  3C1Y A;  4LQN A;  5GU1 X;  2C2J A;  4ITT A;  5C6F A;  4CMY A;  4ZL5 A;  1VJX A;  3BVI A;  3PWQ A;  1BG7 A;  3E1O A;  3BVE A;  5ERJ A;  4PG1 A;  2FG8 A;  3E2C A;  4KVR A;  2FL0 A;  3OJ5 A;  3W54 A;  2V2O A;  2ZA6 A;  2XJM A;  2YW7 A;  4MKU A;  1LB3 A;  2BK6 A;  4LQJ A;  1OTK A;  1VLG A;  3PW8 C;  2IY4 A;  5GU2 X;  1R03 A;  1HRS A;  3R2H A;  2C41 A;  4DYU A;  3QD8 A;  3R2R A;  4IWJ A;  3IS8 A;  1Z4A A;  2WTL A;  3L0M A;  2BKC A;  2CLU A;  4II4 B;  2WWX B;  1TKO A;  3PZA A;  4TOF A;  5CMQ A;  5JDO B;  3VNX A;  2QF9 A;  3QB9 A;  5FFC A;  3GGY A;  3SE1 A;  4CMY V;  4DE6 A;  3BVF A;  4DAS A;  4MJY A;  2FG4 A;  4ISP A;  1FHA A;  1O9R A;  2HR5 A;  1DAT A;  1VEQ A;  3FSE A;  3PWQ C;  3R2L A;  3SID A;  3IQ1 A;  3E6S A;  3PWF A;  5D8P A;  3TA8 A;  3PVY A;  4MN9 A;  4OYN A;  4DYY A;  3E1L A;  5D8O A;  2V2S A;  3F33 A;  4LPJ A;  3GHQ A;  3ES3 A;  4XKT A;  2JD7 0;  2RBD A;  4EVB A;  4ZJK A;  1JI5 A;  5FFE A;  3EZU A;  3V3K B;  3R2M A;  1XZ3 A;  3NP2 X;  1JYB A;  2VXI A;  3KA6 A;  2OC5 A;  5GN8 B;  5J8W A;  3KXU A;  4MXP A;  4CVP A;  2XGW A;  4RC6 A;  2V2N A;  4XKS A;  3E1J A;  1ZS3 A;  1RYT A;  3EZ0 A;  5JKL G;  1SOF A;  3JZA B;  3AF7 X;  4AM2 A;  3GE4 A;  2C6R A;  2AR0 A;  2VXX A;  1RCD A;  3F38 A;  4EVD A;  4YXJ A;  4YKH A;  4AM4 A;  2FHA A;  3F34 A;  4XGS A;  5JAC A;  1JRE A;  3PW1 B;  3UFB A;  1UMN A;  1QGH A;  4Z5S A;  3FI6 A;  3UOI A;  4RC7 A;  1TKP A;  4DZ0 A;  5CMR A;  4ZL6 A;  1RCG A;  3DBY A;  4LPM A;  4YVZ A;  3KA4 A;  1J30 A;  2JD6 0;  4U3G A;  3KHK A;  4ZKX A;  3AF9 X;  1VEL A;  3E1M A;  1MOJ A;  2X17 0;  2VZB A;  2FKZ A;  2CN7 A;  2MGY A;  3AJP A;  5J8S A;  3FRR A;  4LYU A;  4LPN A;  4DYZ A;  4KXR B;  5J9V A;  3RAV A;  3MPS A;  3PVR B;  1DVB A;  3C23 A;  2WLU A;  4TOG A;  1IER A;  3PVT A;  3AJQ A;  3GGZ A;  1S2Z A;  1LKM A;  4TOH A;  5GU0 X;  1F30 A;  4YXM A;  2V8T A;  4RC5 B;  1VEI A;  1ZUJ A;  3FVB A;  2GYQ A;  3E1Q A;  2WLA A;  3F32 A;  5D8R A;  5FEJ A;  2OKC A;  3HL1 A;  2W0O A;  3N6O A;  4LQH A;  3RD0 A;  1JKU A;  2FJC A;  5FFD A;  4TOA A;  4E6K A;  4M35 A;  3ISF A;  5CZU A;  1H96 A;  3E1P A;  3NOZ X;  4E40 A;  2G38 B;  5HU6 D;  2ZG7 X;  4LQV A;  4ML5 A;  1IES A;  2V15 A;  3Q4N A;  3VVA A;  3AK9 A;  3ISE A;  1RCC A;  4EVC A;  3HIU A;  1LKP A;  1XZ1 A;  3E1N A;  4MUD A;  4Z3B A;  3AK8 A;  1NFV A;  4TOB A;  4KVS A;  5JKL A;  4DYX A;  3BVK A; 
#chains in the Genus database with same CATH homology
 1JTS A;  3R2O A;  5D8X A;  3QZ3 A;  1NNQ A;  2ZG8 X;  3R2K A;  5D8S A;  1L8H A;  2JD8 0;  1DPS A;  5IX6 A;  4CY9 A;  4M34 A;  5D8Y A;  4W4K B;  4ERU A;  3U90 A;  5LBH A;  2PYB A;  5LS9 A;  2G4H A;  4II4 A;  5GOU A;  5LG8 A;  3RE7 A;  2ZA7 A;  4ZTT A;  4EVE A;  2YJK A;  5JDO A;  2Z5Q A;  1RCE A;  4IXK A;  2CLB A;  3RBC A;  5D8Q A;  3PW8 A;  1YV1 A;  1JI4 A;  3E6R A;  2V2I A;  2CWL A;  2FFX J;  4DI0 A;  4CVT A;  2ITB A;  5K53 A;  3KA9 A;  2ZG9 X;  5ERK A;  5JKM A;  3SHX A;  3M6J A;  3WVW A;  4ZMC A;  4MY7 A;  3D19 A;  5GU3 X;  5HQO A;  4M33 A;  3Q4Q A;  2GS4 A;  4A25 A;  1SQ3 A;  3EGM A;  2V2M A;  4PG0 A;  1TK6 A;  5FFA A;  2C2F A;  1UVH A;  4ITW A;  2XJN A;  2UX1 A;  4PGK A;  5JKM G;  5I4J A;  2F7N A;  5GN8 A;  1Z6O M;  3F35 A;  2CN6 A;  4TOD A;  3PVY B;  4W4L B;  3SH6 A;  4M32 A;  2Z5R A;  3BKN A;  4TOE A;  3UOF A;  3BT5 A;  5HJH A;  4ZKH A;  4Y08 A;  3WVU A;  1KRQ A;  2N02 A;  2Y44 A;  2QQY A;  3A68 A;  1B71 A;  4ZKW A;  1JIG A;  3ERZ A;  2Z6M A;  3FRS A;  4ETR A;  4REU A;  2Z5P A;  1LKO A;  3PW1 A;  4RC6 B;  3Q4O A;  3F36 A;  2XJO A;  4QUW A;  4IWK A;  2XKQ A;  4ISM A;  2CIH A;  3F37 A;  5E2D A;  4P18 A;  4XKU A;  1EUM A;  1YUX A;  2YW6 A;  2CHI A;  3QVD A;  4RC8 A;  3RGD A;  2ZUR X;  3AJO A;  3WNW A;  2HTN A;  2V2R A;  5J93 A;  2V2P A;  2GYD A;  4PGI A;  4RC7 B;  5AXS A;  3H7G A;  3GVY A;  3QHC A;  3WVV A;  3KA3 A;  3A9Q A;  3KX9 A;  1BCF A;  2C2U A;  3R2S A;  4X0J A;  3O7S A;  2CHP A;  4CYB A;  2CF7 A;  3JZ9 A;  2IB0 A;  3T9J A;  2ZA8 A;  3PVR A;  1AEW A;  3LKD A;  4CVR A;  1RCI A;  2Y3Q A;  1BFR A;  1S30 A;  2BW1 A;  3KWO A;  3NP0 X;  3AF8 X;  1YUZ A;  1O9I A;  1JKV A;  3O7R A;  4RC5 A;  1NF4 A;  3C21 A;  5K52 A;  2D5K A;  4CVS A;  4ZLW A;  1NF6 A;  1QYB A;  3KA8 A;  3F39 A;  2OH3 A;  4TOC A;  3UNO A;  3Q4R A;  2V2L A;  3PVT B;  1GWG A;  2YJJ A;  4KVQ A;  5E1U A;  5LG2 A;  2CEI A;  3OGH A;  1JGC A;  1S3Q A;  1MFR A;  2V2J A;  4TO9 A;  1N1Q A;  3BVL A;  4LYX A;  3VV9 A;  3C1Z A;  3IS7 A;  2BJY A;  2IU2 A;  4TW3 A;  1F33 A;  5HJF A;  4CYA A;  4R42 A;  1L8I A;  3KDQ A;  1TJO A;  5FFB A;  2FZF A;  4AM5 A;  2V8U A;  3QHB A;  4WJG 4;  1Z6O A;  2Z90 A;  3C1Y A;  4LQN A;  5GU1 X;  2C2J A;  4ITT A;  5C6F A;  4CMY A;  4ZL5 A;  1VJX A;  3BVI A;  3PWQ A;  1BG7 A;  3E1O A;  3BVE A;  5ERJ A;  4PG1 A;  2FG8 A;  3E2C A;  4KVR A;  2FL0 A;  3OJ5 A;  3W54 A;  2V2O A;  2ZA6 A;  2XJM A;  2YW7 A;  4MKU A;  1LB3 A;  2BK6 A;  4LQJ A;  1OTK A;  1VLG A;  3PW8 C;  2IY4 A;  5GU2 X;  1R03 A;  1HRS A;  3R2H A;  2C41 A;  4DYU A;  3QD8 A;  3R2R A;  4IWJ A;  3IS8 A;  1Z4A A;  2WTL A;  3L0M A;  2BKC A;  2CLU A;  4II4 B;  2WWX B;  1TKO A;  3PZA A;  4TOF A;  5CMQ A;  5JDO B;  3VNX A;  2QF9 A;  3QB9 A;  5FFC A;  3GGY A;  3SE1 A;  4CMY V;  4DE6 A;  3BVF A;  4DAS A;  4MJY A;  2FG4 A;  4ISP A;  1FHA A;  1O9R A;  2HR5 A;  1DAT A;  1VEQ A;  3FSE A;  3PWQ C;  3R2L A;  3SID A;  3IQ1 A;  3E6S A;  3PWF A;  5D8P A;  3TA8 A;  3PVY A;  4MN9 A;  4OYN A;  4DYY A;  3E1L A;  5D8O A;  2V2S A;  3F33 A;  4LPJ A;  3GHQ A;  3ES3 A;  4XKT A;  2JD7 0;  2RBD A;  4EVB A;  4ZJK A;  1JI5 A;  5FFE A;  3EZU A;  3V3K B;  3R2M A;  1XZ3 A;  3NP2 X;  1JYB A;  2VXI A;  3KA6 A;  2OC5 A;  5GN8 B;  5J8W A;  3KXU A;  4MXP A;  4CVP A;  2XGW A;  4RC6 A;  2V2N A;  4XKS A;  3E1J A;  1ZS3 A;  1RYT A;  3EZ0 A;  5JKL G;  1SOF A;  3JZA B;  3AF7 X;  4AM2 A;  3GE4 A;  2C6R A;  2AR0 A;  2VXX A;  1RCD A;  3F38 A;  4EVD A;  4YXJ A;  4YKH A;  4AM4 A;  2FHA A;  3F34 A;  4XGS A;  5JAC A;  1JRE A;  3PW1 B;  3UFB A;  1UMN A;  1QGH A;  4Z5S A;  3FI6 A;  3UOI A;  4RC7 A;  1TKP A;  4DZ0 A;  5CMR A;  4ZL6 A;  1RCG A;  3DBY A;  4LPM A;  4YVZ A;  3KA4 A;  1J30 A;  2JD6 0;  4U3G A;  3KHK A;  4ZKX A;  3AF9 X;  1VEL A;  3E1M A;  1MOJ A;  2X17 0;  2VZB A;  2FKZ A;  2CN7 A;  2MGY A;  3AJP A;  5J8S A;  3FRR A;  4LYU A;  4LPN A;  4DYZ A;  4KXR B;  5J9V A;  3RAV A;  3MPS A;  3PVR B;  1DVB A;  3C23 A;  2WLU A;  4TOG A;  1IER A;  3PVT A;  3AJQ A;  3GGZ A;  1S2Z A;  1LKM A;  4TOH A;  5GU0 X;  1F30 A;  4YXM A;  2V8T A;  4RC5 B;  1VEI A;  1ZUJ A;  3FVB A;  2GYQ A;  3E1Q A;  2WLA A;  3F32 A;  5D8R A;  5FEJ A;  2OKC A;  3HL1 A;  2W0O A;  3N6O A;  4LQH A;  3RD0 A;  1JKU A;  2FJC A;  5FFD A;  4TOA A;  4E6K A;  4M35 A;  3ISF A;  5CZU A;  1H96 A;  3E1P A;  3NOZ X;  4E40 A;  2G38 B;  5HU6 D;  2ZG7 X;  4LQV A;  4ML5 A;  1IES A;  2V15 A;  3Q4N A;  3VVA A;  3AK9 A;  3ISE A;  1RCC A;  4EVC A;  3HIU A;  1LKP A;  1XZ1 A;  3E1N A;  4MUD A;  4Z3B A;  3AK8 A;  1NFV A;  4TOB A;  4KVS A;  5JKL A;  4DYX A;  3BVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...