3E2HA

Structure of the m67 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
b'GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
pubmed rcsb
total genus 51
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e2hA00
3HPJA 2HJLA 4JQVA 4V3EB 3KYOA 4U1HA 3VXPA 4D0CA 3JTCA 1UXSA 4PGDA 2FO4A 1I7RA 5EO1A 1XR8A 3HLAA 3RL1A 4WJ5A 4NO5A 4WU7A 3DX7A 3BZEA 5D2LA 2AK4A 3MRKA 5E8OA 4GUPA 4F7MA 4PJCA 1WBYA 3MRBA 1RJYA 1HSAA 1ZT1A 4WDIA 1DUZA 2VLRA 3ARDA 4LCCC 4N0CA 1T1YA 5C0IA 2GUOA 2CIIA 1FFNA 4PRBA 1M6OA 4JFDA 1I7TA 5IB5A 4HS3A 4LNRA 4HX1A 4PJ7A 4F7PA 2AXGA 4QOKA 5D7IA 4N0UA 1I7UA 5HGHA 2P5WA 1T0MA 3CCHA 4PRIA 3KXFA 2CLVA 2AV7A 3TJHA 1RK0A 5HHMA 3DX6A 1T21A 4NQXA 4NQDA 1BQHA 4MXQA 4XXCA 3MRPA 3VXRA 1I4FA 3P77A 1ZT7A 1FO0H 2GITA 3MRJA 5SWQA 3TO2A 3BH8A 1AGCA 3M17A 4L4VA 4PJBA 1S7WA 2F53A 3ILPA 3FT2A 2HJKA 4PJXA 3P9MA 1A6ZA 3SKMA 3MRIA 5C07A 3HG1A 3KPSA 4G8GA 2BCKA 4IRSA 5C0GA 3ECBA 5SWZA 3GSNH 1FZKA 4ZAKA 1HHGA 2NX5A 3CVHA 1ZT4A 2D31A 3MRRA 3VFOA 1YN6A 1T7VA 2X4RA 2H6PA 3TBYA 5F9JA 3GMPA 3OV6A 4Y2DA 1AO7A 3VFMA 2BNRA 2F54A 4LHUA 3TPUE 3VFUA 3VFRA 3VWJA 3QDJA 1R3HA 4PG9A 4U6XA 5B38A 2XFXA 1LK2A 4F7CA 1HOCA 3KPNA 1FFOA 1X7QA 5HGAA 1JE6A 3C9NA 4HKJA 1BD2A 3MRMA 3MRFA 4IIQC 5C0DA 4QRTA 3PWPA 5DEFA 1VGKA 2ZOKA 2A83A 3SDCA 1QQDA 3FFCA 3P4MA 3QUYA 4JFEA 4UQ2A 1G6RH 1B0RA 3QUZA 3TBVA 1P7QA 1NANH 4FFEX 1ONQA 5C08A 5MEPA 1CD1A 2F74A 4ZUWA 2P5EA 3FQNA 3TBSA 3MREA 3MRCA 3VFNA 1BIIA 5IROA 1HHJA 3NFNA 2VE6A 3MRDA 4PJAA 1LEGA 4NQCA 3MROA 3FT4A 1ZHBA 1T22A 3PQYA 3FQWA 4L8SC 3GMLA 4EI5A 5GSRA 3PWJA 1S9XA 3GMMA 1UQSA 3IXAA 4PJEA 3BH9A 1KJ3H 1E27A 5AD0A 1AGDA 3RWEA 3WL9A 4LCYA 3MV8A 3AM8A 1MWAH 2X4OA 1S9YA 3FRUA 4PDCE 2CLRA 2X4QA 3DXAA 4PREA 3TBWA 4U6YA 2HLAA 5INCA 4PGBA 3HAEA 3UPRA 1A1NA 4PGCA 3GSXA 3BEWA 5BS0A 1S7VA 1XR9A 3GMOA 1JPFA 4N8VA 1T7WA 2CIKA 4QRUA 1ZS8A 3HUJA 5C0AA 3TO4A 3M1BA 5D7JC 4PJ8A 3V5DA 1HYRC 4NO0A 5ENWA 3I6LD 3T8XA 4HUVA 3H7BA 5E9DA 3MGTA 3CC5A 3DTXA 5E8NA 5EFIA 1T7XA 3U0PA 4MJIA 3MGOA 3FOLA 3BGMA 2X4UA 1INQA 1EFXA 3ROOA 3MRHA 4PJDA 1JGDA 5HGBA 1JHTA 4PRAA 1S7UA 3W0WA 1VACA 4PRHA 4JFFA 4X6DA 3BP7A 4QRSA 1QSEA 4HV8A 4G42A 3O3AA 2Q7YA 3FQXA 1T7YA 3KPQA 4I4WA 2ZSVA 1QLFA 5HGDA 2BVPA 1EEYA 2X4PA 2UWEA 5INDA 4U1LA 3LKPA 2H26A 3RWFA 3TIDA 2PYEA 3VH8A 1FFPA 1HHHA 1K8DA 4JRXA 1KTLA 4HUUA 3JTTA 1G7PA 3B3IA 4U1KA 3D3VA 4D0DA 2AV1A 3P9LA 5IB2A 3VXMA 5J1AA 3RZCA 1GZPA 4F7TA 1Z5LA 4X6CA 1HHKA 1MI5A 1CG9A 2ZOLA 3VFPA 1KPRA 3BP4A 1KPUA 4CVXA 1VADA 4JFPA 3DMMA 3LKRA 4NT6A 3P4NA 3X14A 2ESVA 1S7QA 3VXSA 5MENA 1HSBA 2WY3A 5HHOA 2BSTA 3WLBA 3AU1A 3VCLA 4WU5A 4MJ6A 5EU5A 3X13A 4ZUSA 4I48A 3RWHA 2JCCA 4EUPA 5MERA 1YDPA 5MEOA 1JGEA 3L3KA 1WBXA 3UTSA 5B39A 1E28A 3D2UA 5F7DA 1N3NA 2ZSWA 3QDMA 1S8DA 5BXFA 5FA4A 3UBXA 4F7EA 1AGFA 3KYNA 1QRNA 3LV3A 3KPRA 3HE6A 3VFTA 2CLZA 4APQA 3RWDA 4MJ5A 4PJFA 1T1WA 4U1NA 4U1IA 1OGAA 4JQXA 4NO3A 3GIVA 1JPGA 3C8KA 5D2NA 2MHAA 3SCMA 1S7XA 3MA7A 3KPOA 1QSFA 5EU3A 2YEZA 1MHEA 1W72A 5ACZA 3IT8D 3RL2A 3FOMA 1WBZA 3L3GA 3KPLA 1OSZA 5E6IC 3FT3A 1HHIA 4O2EA 3CH1A 3QEQA 5DDHA 3DBXA 3WUWA 3OX8A 3OXSA 1NEZA 4Y16A 4UQ3A 5IVXA 4NQVA 4E5XA 3DX8A 1KJMA 1YN7A 2C7UA 3QUKA 4D0BA 3HCVA 1KJVA 4X6FA 2OI9A 3LN4A 1S9WA 4MX7A 5EO0A 3LN5A 1JUFA 3GSVA 3L9RA 3TN0A 4MNGA 3RWGA 3BVNA 2X4TA 2VLLA 3BUYA 1GZQA 5HHNA 2FWOA 4E0RA 3L3JA 3X11A 5J6HA 3PWNA 1QO3A 2YPKA 1T80A 3LKQA 3JTSA 1TVHA 3L3HA 5FKPA 3BWAA 4Z78A 3B6SA 3BEVA 5IEHA 4MVBA 1ZSDA 3ARGA 2OL3H 3FQUA 3PWUA 4WW2C 3GMQA 3RWIA 1T7ZA 5L2KA 3W39A 3O8XA 1KJ2H 4PRDA 1W0WA 1N59A 2BNQA 4HUXA 2GTWA 2BVOA 1L8JA 3L3DA 1ED3A 4MQ7A 1TMCA 1I1FA 4NNYA 4NNXA 3BO8A 5E00A 3V5HA 1CE6A 3E2HA 4V3DB 5HHPA 5GSVA 5IB3A 4L4TA 2FIKA 5IEKA 4U1MA 3ILQC 1XZ0A 1FZOA 3O3BA 1P4LA 4S0UC 3MRGA 2BSSA 1KBGH 5ISZA 4ZFZA 3O3EA 4PV9A 5H94A 1EEZA 3RWCA 3S6CA 1P1ZA 2VAAA 3GSWA 1I1YA 1KCGC 1S7RA 1PQZA 3O4LA 3PWVA 4WO4A 3RWJA 3VFWA 3D25A 3GMNA 3QULA 4IHOA 1AGEA 4EN3C 3SPVA 3MV9A 3GMRA 4NQEA 3LKOA 3VFVA 3O3DA 1MHCA 3MRNA 4PJ9A 3TF7A 3REWA 3I6KA 1T1ZA 5EU6A 4PJIA 3VXOA 4PGEA 3SDAA 1Q94A 3WS6A 2YPLA 4MNQA 2GT9A 4NHUE 1SYVA 3SJVA 3D18A 3V5KA 3TBTA 3SDDA 5IM7A 2FYYA 3BZFA 1A9BA 3SKOA 2BSRA 3FQTA 3KPPA 3QDGA 1KPVA 4LCWA 5IB4A 4L8CA 1N2RA 4K71B 4L3EA 1QVOA 1QR1A 1QEWA 1FZMA 4QRPA 3QZWA 5J6GA 3H9HA 4G9DA 1ZHLA 3ARFA 1LQVA 3G08A 3GJFA 3MV7A 4HWZA 3D39A 3VRIA 4CW1A 5BRZA 4ONOA 1BZ9A 1UXWA 3WS3A 1TVBA 3GSQA 4G59A 4NO2A 3FQRA 1ZHKA 5EOTA 4N0FA 1OF2A 3PABA 3I6GA 4QRQA 1AGBA 3VXUA 2V2XA 5IB1A 3ROLA 5FDWA 1SYSA 4QRRA 3ERYA 3TFKA 3JVGA 4Y4FA 2X4SA 1NAMH 3KLAA 1A1MA 3P73A 4JFOA 4O2CA 4PJ5A 5EU4A 3TIEA 1RK1A 2GAZA 5FA3A 3P4OA 4L8DA 3MYJA 5HHQA 1RJZA 3T1FA 4ZUUA 4HUWA 2BVQA 3CZFA 3LKNA 4PG2A 3MR9A 1XH3A 2AKRA 4ZUTA 5L2JA 1DDHA 3VFSA 4PJHA 1LDPH 4GKSA 3TZVC 3VRJA 2VLKA 3E3QA 2RFXA 3H9SA 4G9FA 3KPMA 4L8BA 5HYJA 1T0NA 5SWSA 4PR5A 4U1SA 2AXFA 5MEQA 3MRLA 4WWKC 3QQ3A 4GKNA 2VABA 1A9EA 4Z76A 1LP9A 1T20A 1IM3A 3QFDA 4ELMA 4JRYA 5C0BA 4WUUA 3TVMA 3BHBA 3OXRA 1YPZA 1A1OA 1DE4A 1G7QA 3E6FA 4PRPA 5EUOA 1LD9A 3CDGA 2PO6A 5JHDA 3LKSA 5E8PA 4G43A 3FTGA 4N5EA 4PJGA 3O9WA 3UTTA 2E7LE 3PWLA 1M05A 3RTQA 2X70A 3CPLA 3QQ4A 3SDXA 3UTQA 5C0JA 4MS8A 1C16A 4NSKA 2VLJA 3X12A 1JF1A 2FZ3A 3GSOA 4PRNA 1ZVSA 4JFQA 2DYPA 2CKBH 4X6EA 5F1IA 5BJTA 3MRQA 5C0EA 5DEGA 2GJ6A 1OGTA 3ARBA 2J8UA 1I1AA 3GSUA 3BXNA 1AKJA 1FG2A 3ES6A 4K7FA 1LEKA 1W0VA 4Z77A 5D5MA 4O2FA 1DUYA 2GTZA 1ZAGA 3RGVC 3AREA 1FZJA 3QFJA 3RUGA 3L3IA 4CVZA 3TA3A 4IRJA 4FTVA 5F1NA 3QUXA 3HE7A 5C0FA 5D9SA 4PP8C 1JFMA 4L29A 5D7LA 1N5AA 1S7SA 4L9LC 4ZUVA 3BW9A 1S7TA 4U1JA 3VWKA 3VJ6A 1B0GA 4G8IA 1K5NA 3VXNA 2HN7A 3KWWA 2NW3A 2V2WA 3FONA 4Y4KA 4Y4HA 2XPGA 1U58A 4PV8A 3QI9A 5C0CA 1ZHNA 3E6HA 1EXUA 1IM9A 5C09A 5C9JA 4L3CA 3GSRA 1T1XA 1B3JA 2X4NA
chains in the Genus database with same CATH superfamily
3HPJA 2HJLA 4JQVA 4V3EB 3KYOA 4U1HA 3VXPA 4D0CA 3JTCA 1UXSA 4PGDA 2FO4A 1I7RA 5EO1A 1XR8A 3HLAA 3RL1A 4WJ5A 4NO5A 4WU7A 3DX7A 3BZEA 5D2LA 2AK4A 3MRKA 5E8OA 4GUPA 4F7MA 4PJCA 1WBYA 3MRBA 1RJYA 1HSAA 1ZT1A 4WDIA 1DUZA 2VLRA 3ARDA 4LCCC 4N0CA 1T1YA 5C0IA 2GUOA 2CIIA 1FFNA 4PRBA 1M6OA 4JFDA 1I7TA 5IB5A 4HS3A 4LNRA 4HX1A 4PJ7A 4F7PA 2AXGA 4QOKA 5D7IA 4N0UA 1I7UA 5HGHA 2P5WA 1T0MA 3CCHA 4PRIA 3KXFA 2CLVA 2AV7A 3TJHA 1RK0A 5HHMA 3DX6A 1T21A 4NQXA 4NQDA 1BQHA 4MXQA 4XXCA 3MRPA 3VXRA 1I4FA 3P77A 1ZT7A 1FO0H 2GITA 3MRJA 5SWQA 3TO2A 3BH8A 1AGCA 3M17A 4L4VA 4PJBA 1S7WA 2F53A 3ILPA 3FT2A 2HJKA 4PJXA 3P9MA 1A6ZA 3SKMA 3MRIA 5C07A 3HG1A 3KPSA 4G8GA 2BCKA 4IRSA 5C0GA 3ECBA 5SWZA 3GSNH 1FZKA 4ZAKA 1HHGA 2NX5A 3CVHA 1ZT4A 2D31A 3MRRA 3VFOA 1YN6A 1T7VA 2X4RA 2H6PA 3TBYA 5F9JA 3GMPA 3OV6A 4Y2DA 1AO7A 3VFMA 2BNRA 2F54A 4LHUA 3TPUE 3VFUA 3VFRA 3VWJA 3QDJA 1R3HA 4PG9A 4U6XA 5B38A 2XFXA 1LK2A 4F7CA 1HOCA 3KPNA 1FFOA 1X7QA 5HGAA 1JE6A 3C9NA 4HKJA 1BD2A 3MRMA 3MRFA 4IIQC 5C0DA 4QRTA 3PWPA 5DEFA 1VGKA 2ZOKA 2A83A 3SDCA 1QQDA 3FFCA 3P4MA 3QUYA 4JFEA 4UQ2A 1G6RH 1B0RA 3QUZA 3TBVA 1P7QA 1NANH 4FFEX 1ONQA 5C08A 5MEPA 1CD1A 2F74A 4ZUWA 2P5EA 3FQNA 3TBSA 3MREA 3MRCA 3VFNA 1BIIA 5IROA 1HHJA 3NFNA 2VE6A 3MRDA 4PJAA 1LEGA 4NQCA 3MROA 3FT4A 1ZHBA 1T22A 3PQYA 3FQWA 4L8SC 3GMLA 4EI5A 5GSRA 3PWJA 1S9XA 3GMMA 1UQSA 3IXAA 4PJEA 3BH9A 1KJ3H 1E27A 5AD0A 1AGDA 3RWEA 3WL9A 4LCYA 3MV8A 4JO8A 3AM8A 1MWAH 2X4OA 1S9YA 3FRUA 4PDCE 2CLRA 2X4QA 3DXAA 4PREA 3TBWA 4U6YA 2HLAA 5INCA 4PGBA 3HAEA 3UPRA 1A1NA 4PGCA 3GSXA 3BEWA 5BS0A 1S7VA 1XR9A 3GMOA 1JPFA 4N8VA 1T7WA 2CIKA 4QRUA 1ZS8A 3HUJA 5C0AA 3TO4A 3M1BA 5D7JC 4PJ8A 3V5DA 1HYRC 4NO0A 5ENWA 3I6LD 3T8XA 4HUVA 3H7BA 5E9DA 3MGTA 3CC5A 3DTXA 5E8NA 5EFIA 1T7XA 3U0PA 4MJIA 3MGOA 3FOLA 3BGMA 2X4UA 1INQA 1EFXA 3ROOA 3MRHA 4PJDA 1JGDA 5HGBA 1JHTA 4PRAA 1S7UA 3W0WA 1VACA 4PRHA 4JFFA 4X6DA 3BP7A 4QRSA 1QSEA 4HV8A 4G42A 3O3AA 2Q7YA 3FQXA 1T7YA 3KPQA 4I4WA 2ZSVA 1QLFA 5HGDA 2BVPA 1EEYA 2X4PA 2UWEA 5INDA 4U1LA 3LKPA 2H26A 3RWFA 3TIDA 2PYEA 3VH8A 1FFPA 1HHHA 1K8DA 4JRXA 1KTLA 4HUUA 3JTTA 1G7PA 3B3IA 4U1KA 3D3VA 4D0DA 2AV1A 3P9LA 5IB2A 3VXMA 5J1AA 3RZCA 1GZPA 4F7TA 1Z5LA 4X6CA 1HHKA 1MI5A 1CG9A 2ZOLA 3VFPA 1KPRA 3BP4A 1KPUA 4CVXA 1VADA 4JFPA 3DMMA 3LKRA 4NT6A 3P4NA 3X14A 2ESVA 1S7QA 3VXSA 5MENA 1HSBA 2WY3A 5HHOA 2BSTA 3WLBA 3AU1A 3VCLA 4WU5A 4MJ6A 5EU5A 3X13A 4ZUSA 4I48A 3RWHA 2JCCA 2O5NA 4G59C 4EUPA 5MERA 1YDPA 5MEOA 1JGEA 3L3KA 1WBXA 3UTSA 5B39A 1E28A 3D2UA 5F7DA 1N3NA 2IA1A 2ZSWA 3QDMA 1S8DA 5BXFA 5FA4A 3UBXA 4F7EA 1AGFA 3KYNA 1QRNA 3LV3A 3KPRA 3HE6A 3VFTA 2CLZA 4APQA 3RWDA 4MJ5A 4PJFA 1T1WA 4U1NA 4U1IA 1OGAA 4JQXA 4NO3A 3GIVA 1JPGA 3C8KA 5D2NA 2MHAA 3SCMA 1S7XA 3MA7A 3KPOA 1QSFA 5EU3A 2YEZA 1MHEA 1W72A 5ACZA 3IT8D 3RL2A 3FOMA 1WBZA 3L3GA 3KPLA 1OSZA 5E6IC 3FT3A 1HHIA 4O2EA 3CH1A 3QEQA 5DDHA 3DBXA 3WUWA 3OX8A 3OXSA 1NEZA 4Y16A 4UQ3A 5IVXA 4NQVA 4E5XA 3DX8A 1KJMA 1YN7A 2C7UA 3QUKA 4D0BA 3HCVA 1KJVA 4X6FA 2OI9A 3LN4A 1S9WA 4MX7A 5EO0A 3LN5A 1JUFA 3GSVA 3L9RA 3TN0A 4MNGA 3RWGA 3BVNA 2X4TA 2VLLA 3BUYA 1GZQA 5HHNA 2FWOA 4E0RA 3L3JA 3X11A 5J6HA 3PWNA 1QO3A 2YPKA 1T80A 3LKQA 3JTSA 1TVHA 3L3HA 5FKPA 3BWAA 4Z78A 3B6SA 3BEVA 5IEHA 4MVBA 1ZSDA 3ARGA 2OL3H 3FQUA 3PWUA 4WW2C 3GMQA 3RWIA 1T7ZA 5L2KA 3W39A 3O8XA 1KJ2H 4PRDA 1W0WA 1N59A 2BNQA 4HUXA 2GTWA 2BVOA 1L8JA 3L3DA 1ED3A 4MQ7A 1TMCA 1I1FA 4NNYA 4NNXA 3BO8A 5E00A 3V5HA 1CE6A 3E2HA 4V3DB 5HHPA 5GSVA 5IB3A 4L4TA 2FIKA 5IEKA 4U1MA 3ILQC 1XZ0A 1FZOA 3O3BA 1P4LA 4S0UC 3MRGA 2BSSA 1KBGH 5ISZA 4ZFZA 3O3EA 4PV9A 5H94A 1EEZA 3RWCA 3S6CA 1P1ZA 2VAAA 3GSWA 1I1YA 1KCGC 1S7RA 1PQZA 3O4LA 3PWVA 4WO4A 3RWJA 3VFWA 3D25A 3GMNA 3QULA 4IHOA 1AGEA 4EN3C 3SPVA 3MV9A 3GMRA 4NQEA 3LKOA 3VFVA 3O3DA 1MHCA 3MRNA 4PJ9A 3TF7A 3REWA 3I6KA 1T1ZA 5EU6A 4PJIA 3VXOA 4PGEA 3SDAA 1Q94A 3WS6A 2YPLA 4MNQA 2GT9A 4NHUE 1SYVA 3SJVA 3D18A 3V5KA 3TBTA 3SDDA 5IM7A 2FYYA 3BZFA 1A9BA 3SKOA 2BSRA 3FQTA 3KPPA 3QDGA 1KPVA 4LCWA 5IB4A 4L8CA 1N2RA 4K71B 4L3EA 1QVOA 1QR1A 1QEWA 1FZMA 4QRPA 3QZWA 5J6GA 3H9HA 4G9DA 1ZHLA 3ARFA 1LQVA 3G08A 3GJFA 3MV7A 4HWZA 3D39A 3VRIA 4CW1A 5BRZA 4ONOA 1BZ9A 1UXWA 3WS3A 1TVBA 3GSQA 4G59A 4NO2A 3FQRA 1ZHKA 5EOTA 4N0FA 1OF2A 3PABA 3I6GA 4QRQA 1AGBA 3VXUA 2V2XA 5IB1A 3ROLA 5FDWA 1SYSA 4QRRA 3ERYA 3TFKA 3JVGA 4Y4FA 2X4SA 1NAMH 3KLAA 1A1MA 3P73A 4JFOA 4O2CA 4PJ5A 5EU4A 3TIEA 1RK1A 4BKWA 2GAZA 5FA3A 3P4OA 4L8DA 3MYJA 5HHQA 1RJZA 3T1FA 4ZUUA 4HUWA 2BVQA 3CZFA 3LKNA 4PG2A 3MR9A 1XH3A 2AKRA 4ZUTA 5L2JA 1DDHA 3VFSA 4PJHA 1LDPH 4GKSA 3TZVC 3VRJA 2VLKA 3E3QA 2RFXA 3H9SA 4G9FA 3KPMA 4L8BA 5HYJA 1T0NA 5SWSA 4PR5A 4U1SA 2AXFA 5MEQA 3MRLA 4WWKC 3QQ3A 4GKNA 2VABA 1A9EA 4Z76A 1LP9A 1T20A 1IM3A 3QFDA 4ELMA 4JRYA 5C0BA 4WUUA 3TVMA 3BHBA 3OXRA 1YPZA 1A1OA 1DE4A 1G7QA 3E6FA 4PRPA 5EUOA 1LD9A 3CDGA 2PO6A 5JHDA 3LKSA 5E8PA 4G43A 3FTGA 4N5EA 4PJGA 3O9WA 3UTTA 2E7LE 3PWLA 1M05A 3RTQA 2X70A 3CPLA 3QQ4A 3SDXA 3UTQA 5C0JA 4MS8A 1C16A 4NSKA 2VLJA 3X12A 1JF1A 2FZ3A 3GSOA 4PRNA 1ZVSA 4JFQA 2DYPA 2CKBH 4X6EA 5F1IA 5BJTA 3MRQA 5C0EA 5DEGA 2GJ6A 1OGTA 3ARBA 2J8UA 2NYKA 1I1AA 3GSUA 3BXNA 1AKJA 1FG2A 3ES6A 4K7FA 1LEKA 1W0VA 4Z77A 5D5MA 4O2FA 1DUYA 2GTZA 1ZAGA 3RGVC 3AREA 1FZJA 3QFJA 3RUGA 3L3IA 4CVZA 3TA3A 4IRJA 4FTVA 5F1NA 3QUXA 3HE7A 5C0FA 5D9SA 4PP8C 1JFMA 4L29A 5D7LA 1N5AA 1S7SA 4L9LC 4ZUVA 3BW9A 1S7TA 4U1JA 3VWKA 3VJ6A 1B0GA 4G8IA 1K5NA 3VXNA 2HN7A 3KWWA 2NW3A 2V2WA 3FONA 4Y4KA 4Y4HA 2XPGA 3I0TA 1U58A 4PV8A 3QI9A 5C0CA 1ZHNA 3E6HA 1EXUA 1IM9A 5C09A 5C9JA 4L3CA 3GSRA 1T1XA 1B3JA 2X4NA
chains in the Genus database with same CATH topology
3HPJA 2HJLA 4JQVA 4V3EB 3KYOA 4U1HA 3VXPA 4D0CA 3JTCA 1UXSA 4PGDA 2FO4A 1I7RA 5EO1A 1XR8A 3HLAA 3RL1A 4WJ5A 4NO5A 4WU7A 3DX7A 3BZEA 5D2LA 2AK4A 3MRKA 5E8OA 4GUPA 4F7MA 4PJCA 1WBYA 3MRBA 1RJYA 1HSAA 1ZT1A 4WDIA 1DUZA 2VLRA 3ARDA 4LCCC 4N0CA 1T1YA 5C0IA 2GUOA 2CIIA 1FFNA 4PRBA 1M6OA 4JFDA 1I7TA 5IB5A 4HS3A 4LNRA 4HX1A 4PJ7A 4F7PA 2AXGA 4QOKA 5D7IA 4N0UA 1I7UA 5HGHA 2P5WA 1T0MA 3CCHA 4PRIA 3KXFA 2CLVA 2AV7A 3TJHA 1RK0A 5HHMA 3DX6A 1T21A 4NQXA 4NQDA 1BQHA 4MXQA 4XXCA 3MRPA 3VXRA 1I4FA 3P77A 1ZT7A 1FO0H 2GITA 3MRJA 5SWQA 3TO2A 3BH8A 1AGCA 3M17A 4L4VA 4PJBA 1S7WA 2F53A 3ILPA 3FT2A 2HJKA 4PJXA 3P9MA 1A6ZA 3SKMA 3MRIA 5C07A 3HG1A 3KPSA 4G8GA 2BCKA 4IRSA 5C0GA 3ECBA 5SWZA 3GSNH 1FZKA 4ZAKA 1HHGA 2NX5A 3CVHA 1ZT4A 2D31A 3MRRA 3VFOA 1YN6A 1T7VA 2X4RA 2H6PA 3TBYA 5F9JA 3GMPA 3OV6A 4Y2DA 1AO7A 3VFMA 2BNRA 2F54A 4LHUA 3TPUE 3VFUA 3VFRA 3VWJA 3QDJA 1R3HA 4PG9A 4U6XA 5B38A 2XFXA 1LK2A 4F7CA 1HOCA 3KPNA 1FFOA 1X7QA 5HGAA 1JE6A 3C9NA 4HKJA 1BD2A 3MRMA 3MRFA 4IIQC 5C0DA 4QRTA 3PWPA 5DEFA 1VGKA 2ZOKA 2A83A 3SDCA 1QQDA 3FFCA 3P4MA 3QUYA 4JFEA 4UQ2A 1G6RH 1B0RA 3QUZA 3TBVA 1P7QA 1NANH 4FFEX 1ONQA 5C08A 5MEPA 1CD1A 2F74A 4ZUWA 2P5EA 3FQNA 3TBSA 3MREA 3MRCA 3VFNA 1BIIA 5IROA 1HHJA 3NFNA 2VE6A 3MRDA 4PJAA 1LEGA 4NQCA 3MROA 3FT4A 1ZHBA 1T22A 3PQYA 3FQWA 4L8SC 3GMLA 4EI5A 5GSRA 3PWJA 1S9XA 3GMMA 1UQSA 3IXAA 4PJEA 3BH9A 1KJ3H 1E27A 5AD0A 1AGDA 3RWEA 3WL9A 4LCYA 3MV8A 3AM8A 1MWAH 2X4OA 1S9YA 3FRUA 4PDCE 2CLRA 2X4QA 3DXAA 4PREA 3TBWA 4U6YA 2HLAA 5INCA 4PGBA 3HAEA 3UPRA 1A1NA 4PGCA 3GSXA 3BEWA 5BS0A 1S7VA 1XR9A 3GMOA 1JPFA 4N8VA 1T7WA 2CIKA 4QRUA 1ZS8A 3HUJA 5C0AA 3TO4A 3M1BA 5D7JC 4PJ8A 3V5DA 1HYRC 4NO0A 5ENWA 3I6LD 3T8XA 4HUVA 3H7BA 5E9DA 3MGTA 3CC5A 3DTXA 5E8NA 5EFIA 1T7XA 3U0PA 4MJIA 3MGOA 3FOLA 3BGMA 2X4UA 1INQA 1EFXA 3ROOA 3MRHA 4PJDA 1JGDA 5HGBA 1JHTA 4PRAA 1S7UA 3W0WA 1VACA 4PRHA 4JFFA 4X6DA 3BP7A 4QRSA 1QSEA 4HV8A 4G42A 3O3AA 2Q7YA 3FQXA 1T7YA 3KPQA 4I4WA 2ZSVA 1QLFA 5HGDA 2BVPA 1EEYA 2X4PA 2UWEA 5INDA 4U1LA 3LKPA 2H26A 3RWFA 3TIDA 2PYEA 3VH8A 1FFPA 1HHHA 1K8DA 4JRXA 1KTLA 4HUUA 3JTTA 1G7PA 3B3IA 4U1KA 3D3VA 4D0DA 2AV1A 3P9LA 5IB2A 3VXMA 5J1AA 3RZCA 1GZPA 4F7TA 1Z5LA 4X6CA 1HHKA 1MI5A 1CG9A 2ZOLA 3VFPA 1KPRA 3BP4A 1KPUA 4CVXA 1VADA 4JFPA 3DMMA 3LKRA 4NT6A 3P4NA 3X14A 2ESVA 1S7QA 3VXSA 5MENA 1HSBA 2WY3A 5HHOA 2BSTA 3WLBA 3AU1A 3VCLA 4WU5A 4MJ6A 5EU5A 3X13A 4ZUSA 4I48A 3RWHA 2JCCA 4EUPA 5MERA 1YDPA 5MEOA 1JGEA 3L3KA 1WBXA 3UTSA 5B39A 1E28A 3D2UA 5F7DA 1N3NA 2ZSWA 3QDMA 1S8DA 5BXFA 5FA4A 3UBXA 4F7EA 1AGFA 3KYNA 1QRNA 3LV3A 3KPRA 3HE6A 3VFTA 2CLZA 4APQA 3RWDA 4MJ5A 4PJFA 1T1WA 4U1NA 4U1IA 1OGAA 4JQXA 4NO3A 3GIVA 1JPGA 3C8KA 5D2NA 2MHAA 3SCMA 1S7XA 3MA7A 3KPOA 1QSFA 5EU3A 2YEZA 1MHEA 1W72A 5ACZA 3IT8D 3RL2A 3FOMA 1WBZA 3L3GA 3KPLA 1OSZA 5E6IC 3FT3A 1HHIA 4O2EA 3CH1A 3QEQA 5DDHA 3DBXA 3WUWA 3OX8A 3OXSA 1NEZA 4Y16A 4UQ3A 5IVXA 4NQVA 4E5XA 3DX8A 1KJMA 1YN7A 2C7UA 3QUKA 4D0BA 3HCVA 1KJVA 4X6FA 2OI9A 3LN4A 1S9WA 4MX7A 5EO0A 3LN5A 1JUFA 3GSVA 3L9RA 3TN0A 4MNGA 3RWGA 3BVNA 2X4TA 2VLLA 3BUYA 1GZQA 5HHNA 2FWOA 4E0RA 3L3JA 3X11A 5J6HA 3PWNA 1QO3A 2YPKA 1T80A 3LKQA 3JTSA 1TVHA 3L3HA 5FKPA 3BWAA 4Z78A 3B6SA 3BEVA 5IEHA 4MVBA 1ZSDA 3ARGA 2OL3H 3FQUA 3PWUA 4WW2C 3GMQA 3RWIA 1T7ZA 5L2KA 3W39A 3O8XA 1KJ2H 4PRDA 1W0WA 1N59A 2BNQA 4HUXA 2GTWA 2BVOA 1L8JA 3L3DA 1ED3A 4MQ7A 1TMCA 1I1FA 4NNYA 4NNXA 3BO8A 5E00A 3V5HA 1CE6A 3E2HA 4V3DB 5HHPA 5GSVA 5IB3A 4L4TA 2FIKA 5IEKA 4U1MA 3ILQC 1XZ0A 1FZOA 3O3BA 1P4LA 4S0UC 3MRGA 2BSSA 1KBGH 5ISZA 4ZFZA 3O3EA 4PV9A 5H94A 1EEZA 3RWCA 3S6CA 1P1ZA 2VAAA 3GSWA 1I1YA 1KCGC 1S7RA 1PQZA 3O4LA 3PWVA 4WO4A 3RWJA 3VFWA 3D25A 3GMNA 3QULA 4IHOA 1AGEA 4EN3C 3SPVA 3MV9A 3GMRA 4NQEA 3LKOA 3VFVA 3O3DA 1MHCA 3MRNA 4PJ9A 3TF7A 3REWA 3I6KA 1T1ZA 5EU6A 4PJIA 3VXOA 4PGEA 3SDAA 1Q94A 3WS6A 2YPLA 4MNQA 2GT9A 4NHUE 1SYVA 3SJVA 3D18A 3V5KA 3TBTA 3SDDA 5IM7A 2FYYA 3BZFA 1A9BA 3SKOA 2BSRA 3FQTA 3KPPA 3QDGA 1KPVA 4LCWA 5IB4A 4L8CA 1N2RA 4K71B 4L3EA 1QVOA 1QR1A 1QEWA 1FZMA 4QRPA 3QZWA 5J6GA 3H9HA 4G9DA 1ZHLA 3ARFA 1LQVA 3G08A 3GJFA 3MV7A 4HWZA 3D39A 3VRIA 4CW1A 5BRZA 4ONOA 1BZ9A 1UXWA 3WS3A 1TVBA 3GSQA 4G59A 4NO2A 3FQRA 1ZHKA 5EOTA 4N0FA 1OF2A 3PABA 3I6GA 4QRQA 1AGBA 3VXUA 2V2XA 5IB1A 3ROLA 5FDWA 1SYSA 4QRRA 3ERYA 3TFKA 3JVGA 4Y4FA 2X4SA 1NAMH 3KLAA 1A1MA 3P73A 4JFOA 4O2CA 4PJ5A 5EU4A 3TIEA 1RK1A 2GAZA 5FA3A 3P4OA 4L8DA 3MYJA 5HHQA 1RJZA 3T1FA 4ZUUA 4HUWA 2BVQA 3CZFA 3LKNA 4PG2A 3MR9A 1XH3A 2AKRA 4ZUTA 5L2JA 1DDHA 3VFSA 4PJHA 1LDPH 4GKSA 3TZVC 3VRJA 2VLKA 3E3QA 2RFXA 3H9SA 4G9FA 3KPMA 4L8BA 5HYJA 1T0NA 5SWSA 4PR5A 4U1SA 2AXFA 5MEQA 3MRLA 4WWKC 3QQ3A 4GKNA 2VABA 1A9EA 4Z76A 1LP9A 1T20A 1IM3A 3QFDA 4ELMA 4JRYA 5C0BA 4WUUA 3TVMA 3BHBA 3OXRA 1YPZA 1A1OA 1DE4A 1G7QA 3E6FA 4PRPA 5EUOA 1LD9A 3CDGA 2PO6A 5JHDA 3LKSA 5E8PA 4G43A 3FTGA 4N5EA 4PJGA 3O9WA 3UTTA 2E7LE 3PWLA 1M05A 3RTQA 2X70A 3CPLA 3QQ4A 3SDXA 3UTQA 5C0JA 4MS8A 1C16A 4NSKA 2VLJA 3X12A 1JF1A 2FZ3A 3GSOA 4PRNA 1ZVSA 4JFQA 2DYPA 2CKBH 4X6EA 5F1IA 5BJTA 3MRQA 5C0EA 5DEGA 2GJ6A 1OGTA 3ARBA 2J8UA 1I1AA 3GSUA 3BXNA 1AKJA 1FG2A 3ES6A 4K7FA 1LEKA 1W0VA 4Z77A 5D5MA 4O2FA 1DUYA 2GTZA 1ZAGA 3RGVC 3AREA 1FZJA 3QFJA 3RUGA 3L3IA 4CVZA 3TA3A 4IRJA 4FTVA 5F1NA 3QUXA 3HE7A 5C0FA 5D9SA 4PP8C 1JFMA 4L29A 5D7LA 1N5AA 1S7SA 4L9LC 4ZUVA 3BW9A 1S7TA 4U1JA 3VWKA 3VJ6A 1B0GA 4G8IA 1K5NA 3VXNA 2HN7A 3KWWA 2NW3A 2V2WA 3FONA 4Y4KA 4Y4HA 2XPGA 1U58A 4PV8A 3QI9A 5C0CA 1ZHNA 3E6HA 1EXUA 1IM9A 5C09A 5C9JA 4L3CA 3GSRA 1T1XA 1B3JA 2X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPJ A;  2HJL A;  4JQV A;  4V3E B;  3KYO A;  4U1H A;  3VXP A;  4D0C A;  3JTC A;  1UXS A;  4PGD A;  2FO4 A;  1I7R A;  5EO1 A;  1XR8 A;  3HLA A;  3RL1 A;  4WJ5 A;  4NO5 A;  4WU7 A;  3DX7 A;  3BZE A;  5D2L A;  2AK4 A;  3MRK A;  5E8O A;  4GUP A;  4F7M A;  4PJC A;  1WBY A;  3MRB A;  1RJY A;  1HSA A;  1ZT1 A;  4WDI A;  1DUZ A;  2VLR A;  3ARD A;  4LCC C;  4N0C A;  1T1Y A;  5C0I A;  2GUO A;  2CII A;  1FFN A;  4PRB A;  1M6O A;  4JFD A;  1I7T A;  5IB5 A;  4HS3 A;  4LNR A;  4HX1 A;  4PJ7 A;  4F7P A;  2AXG A;  4QOK A;  5D7I A;  4N0U A;  1I7U A;  5HGH A;  2P5W A;  1T0M A;  3CCH A;  4PRI A;  3KXF A;  2CLV A;  2AV7 A;  3TJH A;  1RK0 A;  5HHM A;  3DX6 A;  1T21 A;  4NQX A;  4NQD A;  1BQH A;  4MXQ A;  4XXC A;  3MRP A;  3VXR A;  1I4F A;  3P77 A;  1ZT7 A;  1FO0 H;  2GIT A;  3MRJ A;  5SWQ A;  3TO2 A;  3BH8 A;  1AGC A;  3M17 A;  4L4V A;  4PJB A;  1S7W A;  2F53 A;  3ILP A;  3FT2 A;  2HJK A;  4PJX A;  3P9M A;  1A6Z A;  3SKM A;  3MRI A;  5C07 A;  3HG1 A;  3KPS A;  4G8G A;  2BCK A;  4IRS A;  5C0G A;  3ECB A;  5SWZ A;  3GSN H;  1FZK A;  4ZAK A;  1HHG A;  2NX5 A;  3CVH A;  1ZT4 A;  2D31 A;  3MRR A;  3VFO A;  1YN6 A;  1T7V A;  2X4R A;  2H6P A;  3TBY A;  5F9J A;  3GMP A;  3OV6 A;  4Y2D A;  1AO7 A;  3VFM A;  2BNR A;  2F54 A;  4LHU A;  3TPU E;  3VFU A;  3VFR A;  3VWJ A;  3QDJ A;  1R3H A;  4PG9 A;  4U6X A;  5B38 A;  2XFX A;  1LK2 A;  4F7C A;  1HOC A;  3KPN A;  1FFO A;  1X7Q A;  5HGA A;  1JE6 A;  3C9N A;  4HKJ A;  1BD2 A;  3MRM A;  3MRF A;  4IIQ C;  5C0D A;  4QRT A;  3PWP A;  5DEF A;  1VGK A;  2ZOK A;  2A83 A;  3SDC A;  1QQD A;  3FFC A;  3P4M A;  3QUY A;  4JFE A;  4UQ2 A;  1G6R H;  1B0R A;  3QUZ A;  3TBV A;  1P7Q A;  1NAN H;  4FFE X;  1ONQ A;  5C08 A;  5MEP A;  1CD1 A;  2F74 A;  4ZUW A;  2P5E A;  3FQN A;  3TBS A;  3MRE A;  3MRC A;  3VFN A;  1BII A;  5IRO A;  1HHJ A;  3NFN A;  2VE6 A;  3MRD A;  4PJA A;  1LEG A;  4NQC A;  3MRO A;  3FT4 A;  1ZHB A;  1T22 A;  3PQY A;  3FQW A;  4L8S C;  3GML A;  4EI5 A;  5GSR A;  3PWJ A;  1S9X A;  3GMM A;  1UQS A;  3IXA A;  4PJE A;  3BH9 A;  1KJ3 H;  1E27 A;  5AD0 A;  1AGD A;  3RWE A;  3WL9 A;  4LCY A;  3MV8 A;  3AM8 A;  1MWA H;  2X4O A;  1S9Y A;  3FRU A;  4PDC E;  2CLR A;  2X4Q A;  3DXA A;  4PRE A;  3TBW A;  4U6Y A;  2HLA A;  5INC A;  4PGB A;  3HAE A;  3UPR A;  1A1N A;  4PGC A;  3GSX A;  3BEW A;  5BS0 A;  1S7V A;  1XR9 A;  3GMO A;  1JPF A;  4N8V A;  1T7W A;  2CIK A;  4QRU A;  1ZS8 A;  3HUJ A;  5C0A A;  3TO4 A;  3M1B A;  5D7J C;  4PJ8 A;  3V5D A;  1HYR C;  4NO0 A;  5ENW A;  3I6L D;  3T8X A;  4HUV A;  3H7B A;  5E9D A;  3MGT A;  3CC5 A;  3DTX A;  5E8N A;  5EFI A;  1T7X A;  3U0P A;  4MJI A;  3MGO A;  3FOL A;  3BGM A;  2X4U A;  1INQ A;  1EFX A;  3ROO A;  3MRH A;  4PJD A;  1JGD A;  5HGB A;  1JHT A;  4PRA A;  1S7U A;  3W0W A;  1VAC A;  4PRH A;  4JFF A;  4X6D A;  3BP7 A;  4QRS A;  1QSE A;  4HV8 A;  4G42 A;  3O3A A;  2Q7Y A;  3FQX A;  1T7Y A;  3KPQ A;  4I4W A;  2ZSV A;  1QLF A;  5HGD A;  2BVP A;  1EEY A;  2X4P A;  2UWE A;  5IND A;  4U1L A;  3LKP A;  2H26 A;  3RWF A;  3TID A;  2PYE A;  3VH8 A;  1FFP A;  1HHH A;  1K8D A;  4JRX A;  1KTL A;  4HUU A;  3JTT A;  1G7P A;  3B3I A;  4U1K A;  3D3V A;  4D0D A;  2AV1 A;  3P9L A;  5IB2 A;  3VXM A;  5J1A A;  3RZC A;  1GZP A;  4F7T A;  1Z5L A;  4X6C A;  1HHK A;  1MI5 A;  1CG9 A;  2ZOL A;  3VFP A;  1KPR A;  3BP4 A;  1KPU A;  4CVX A;  1VAD A;  4JFP A;  3DMM A;  3LKR A;  4NT6 A;  3P4N A;  3X14 A;  2ESV A;  1S7Q A;  3VXS A;  5MEN A;  1HSB A;  2WY3 A;  5HHO A;  2BST A;  3WLB A;  3AU1 A;  3VCL A;  4WU5 A;  4MJ6 A;  5EU5 A;  3X13 A;  4ZUS A;  4I48 A;  3RWH A;  2JCC A;  4EUP A;  5MER A;  1YDP A;  5MEO A;  1JGE A;  3L3K A;  1WBX A;  3UTS A;  5B39 A;  1E28 A;  3D2U A;  5F7D A;  1N3N A;  2ZSW A;  3QDM A;  1S8D A;  5BXF A;  5FA4 A;  3UBX A;  4F7E A;  1AGF A;  3KYN A;  1QRN A;  3LV3 A;  3KPR A;  3HE6 A;  3VFT A;  2CLZ A;  4APQ A;  3RWD A;  4MJ5 A;  4PJF A;  1T1W A;  4U1N A;  4U1I A;  1OGA A;  4JQX A;  4NO3 A;  3GIV A;  1JPG A;  3C8K A;  5D2N A;  2MHA A;  3SCM A;  1S7X A;  3MA7 A;  3KPO A;  1QSF A;  5EU3 A;  2YEZ A;  1MHE A;  1W72 A;  5ACZ A;  3IT8 D;  3RL2 A;  3FOM A;  1WBZ A;  3L3G A;  3KPL A;  1OSZ A;  5E6I C;  3FT3 A;  1HHI A;  4O2E A;  3CH1 A;  3QEQ A;  5DDH A;  3DBX A;  3WUW A;  3OX8 A;  3OXS A;  1NEZ A;  4Y16 A;  4UQ3 A;  5IVX A;  4NQV A;  4E5X A;  3DX8 A;  1KJM A;  1YN7 A;  2C7U A;  3QUK A;  4D0B A;  3HCV A;  1KJV A;  4X6F A;  2OI9 A;  3LN4 A;  1S9W A;  4MX7 A;  5EO0 A;  3LN5 A;  1JUF A;  3GSV A;  3L9R A;  3TN0 A;  4MNG A;  3RWG A;  3BVN A;  2X4T A;  2VLL A;  3BUY A;  1GZQ A;  5HHN A;  2FWO A;  4E0R A;  3L3J A;  3X11 A;  5J6H A;  3PWN A;  1QO3 A;  2YPK A;  1T80 A;  3LKQ A;  3JTS A;  1TVH A;  3L3H A;  5FKP A;  3BWA A;  4Z78 A;  3B6S A;  3BEV A;  5IEH A;  4MVB A;  1ZSD A;  3ARG A;  2OL3 H;  3FQU A;  3PWU A;  4WW2 C;  3GMQ A;  3RWI A;  1T7Z A;  5L2K A;  3W39 A;  3O8X A;  1KJ2 H;  4PRD A;  1W0W A;  1N59 A;  2BNQ A;  4HUX A;  2GTW A;  2BVO A;  1L8J A;  3L3D A;  1ED3 A;  4MQ7 A;  1TMC A;  1I1F A;  4NNY A;  4NNX A;  3BO8 A;  5E00 A;  3V5H A;  1CE6 A;  3E2H A;  4V3D B;  5HHP A;  5GSV A;  5IB3 A;  4L4T A;  2FIK A;  5IEK A;  4U1M A;  3ILQ C;  1XZ0 A;  1FZO A;  3O3B A;  1P4L A;  4S0U C;  3MRG A;  2BSS A;  1KBG H;  5ISZ A;  4ZFZ A;  3O3E A;  4PV9 A;  5H94 A;  1EEZ A;  3RWC A;  3S6C A;  1P1Z A;  2VAA A;  3GSW A;  1I1Y A;  1KCG C;  1S7R A;  1PQZ A;  3O4L A;  3PWV A;  4WO4 A;  3RWJ A;  3VFW A;  3D25 A;  3GMN A;  3QUL A;  4IHO A;  1AGE A;  4EN3 C;  3SPV A;  3MV9 A;  3GMR A;  4NQE A;  3LKO A;  3VFV A;  3O3D A;  1MHC A;  3MRN A;  4PJ9 A;  3TF7 A;  3REW A;  3I6K A;  1T1Z A;  5EU6 A;  4PJI A;  3VXO A;  4PGE A;  3SDA A;  1Q94 A;  3WS6 A;  2YPL A;  4MNQ A;  2GT9 A;  4NHU E;  1SYV A;  3SJV A;  3D18 A;  3V5K A;  3TBT A;  3SDD A;  5IM7 A;  2FYY A;  3BZF A;  1A9B A;  3SKO A;  2BSR A;  3FQT A;  3KPP A;  3QDG A;  1KPV A;  4LCW A;  5IB4 A;  4L8C A;  1N2R A;  4K71 B;  4L3E A;  1QVO A;  1QR1 A;  1QEW A;  1FZM A;  4QRP A;  3QZW A;  5J6G A;  3H9H A;  4G9D A;  1ZHL A;  3ARF A;  1LQV A;  3G08 A;  3GJF A;  3MV7 A;  4HWZ A;  3D39 A;  3VRI A;  4CW1 A;  5BRZ A;  4ONO A;  1BZ9 A;  1UXW A;  3WS3 A;  1TVB A;  3GSQ A;  4G59 A;  4NO2 A;  3FQR A;  1ZHK A;  5EOT A;  4N0F A;  1OF2 A;  3PAB A;  3I6G A;  4QRQ A;  1AGB A;  3VXU A;  2V2X A;  5IB1 A;  3ROL A;  5FDW A;  1SYS A;  4QRR A;  3ERY A;  3TFK A;  3JVG A;  4Y4F A;  2X4S A;  1NAM H;  3KLA A;  1A1M A;  3P73 A;  4JFO A;  4O2C A;  4PJ5 A;  5EU4 A;  3TIE A;  1RK1 A;  2GAZ A;  5FA3 A;  3P4O A;  4L8D A;  3MYJ A;  5HHQ A;  1RJZ A;  3T1F A;  4ZUU A;  4HUW A;  2BVQ A;  3CZF A;  3LKN A;  4PG2 A;  3MR9 A;  1XH3 A;  2AKR A;  4ZUT A;  5L2J A;  1DDH A;  3VFS A;  4PJH A;  1LDP H;  4GKS A;  3TZV C;  3VRJ A;  2VLK A;  3E3Q A;  2RFX A;  3H9S A;  4G9F A;  3KPM A;  4L8B A;  5HYJ A;  1T0N A;  5SWS A;  4PR5 A;  4U1S A;  2AXF A;  5MEQ A;  3MRL A;  4WWK C;  3QQ3 A;  4GKN A;  2VAB A;  1A9E A;  4Z76 A;  1LP9 A;  1T20 A;  1IM3 A;  3QFD A;  4ELM A;  4JRY A;  5C0B A;  4WUU A;  3TVM A;  3BHB A;  3OXR A;  1YPZ A;  1A1O A;  1DE4 A;  1G7Q A;  3E6F A;  4PRP A;  5EUO A;  1LD9 A;  3CDG A;  2PO6 A;  5JHD A;  3LKS A;  5E8P A;  4G43 A;  3FTG A;  4N5E A;  4PJG A;  3O9W A;  3UTT A;  2E7L E;  3PWL A;  1M05 A;  3RTQ A;  2X70 A;  3CPL A;  3QQ4 A;  3SDX A;  3UTQ A;  5C0J A;  4MS8 A;  1C16 A;  4NSK A;  2VLJ A;  3X12 A;  1JF1 A;  2FZ3 A;  3GSO A;  4PRN A;  1ZVS A;  4JFQ A;  2DYP A;  2CKB H;  4X6E A;  5F1I A;  5BJT A;  3MRQ A;  5C0E A;  5DEG A;  2GJ6 A;  1OGT A;  3ARB A;  2J8U A;  1I1A A;  3GSU A;  3BXN A;  1AKJ A;  1FG2 A;  3ES6 A;  4K7F A;  1LEK A;  1W0V A;  4Z77 A;  5D5M A;  4O2F A;  1DUY A;  2GTZ A;  1ZAG A;  3RGV C;  3ARE A;  1FZJ A;  3QFJ A;  3RUG A;  3L3I A;  4CVZ A;  3TA3 A;  4IRJ A;  4FTV A;  5F1N A;  3QUX A;  3HE7 A;  5C0F A;  5D9S A;  4PP8 C;  1JFM A;  4L29 A;  5D7L A;  1N5A A;  1S7S A;  4L9L C;  4ZUV A;  3BW9 A;  1S7T A;  4U1J A;  3VWK A;  3VJ6 A;  1B0G A;  4G8I A;  1K5N A;  3VXN A;  2HN7 A;  3KWW A;  2NW3 A;  2V2W A;  3FON A;  4Y4K A;  4Y4H A;  2XPG A;  1U58 A;  4PV8 A;  3QI9 A;  5C0C A;  1ZHN A;  3E6H A;  1EXU A;  1IM9 A;  5C09 A;  5C9J A;  4L3C A;  3GSR A;  1T1X A;  1B3J A;  2X4N A; 
#chains in the Genus database with same CATH topology
 3HPJ A;  2HJL A;  4JQV A;  4V3E B;  3KYO A;  4U1H A;  3VXP A;  4D0C A;  3JTC A;  1UXS A;  4PGD A;  2FO4 A;  1I7R A;  5EO1 A;  1XR8 A;  3HLA A;  3RL1 A;  4WJ5 A;  4NO5 A;  4WU7 A;  3DX7 A;  3BZE A;  5D2L A;  2AK4 A;  3MRK A;  5E8O A;  4GUP A;  4F7M A;  4PJC A;  1WBY A;  3MRB A;  1RJY A;  1HSA A;  1ZT1 A;  4WDI A;  1DUZ A;  2VLR A;  3ARD A;  4LCC C;  4N0C A;  1T1Y A;  5C0I A;  2GUO A;  2CII A;  1FFN A;  4PRB A;  1M6O A;  4JFD A;  1I7T A;  5IB5 A;  4HS3 A;  4LNR A;  4HX1 A;  4PJ7 A;  4F7P A;  2AXG A;  4QOK A;  5D7I A;  4N0U A;  1I7U A;  5HGH A;  2P5W A;  1T0M A;  3CCH A;  4PRI A;  3KXF A;  2CLV A;  2AV7 A;  3TJH A;  1RK0 A;  5HHM A;  3DX6 A;  1T21 A;  4NQX A;  4NQD A;  1BQH A;  4MXQ A;  4XXC A;  3MRP A;  3VXR A;  1I4F A;  3P77 A;  1ZT7 A;  1FO0 H;  2GIT A;  3MRJ A;  5SWQ A;  3TO2 A;  3BH8 A;  1AGC A;  3M17 A;  4L4V A;  4PJB A;  1S7W A;  2F53 A;  3ILP A;  3FT2 A;  2HJK A;  4PJX A;  3P9M A;  1A6Z A;  3SKM A;  3MRI A;  5C07 A;  3HG1 A;  3KPS A;  4G8G A;  2BCK A;  4IRS A;  5C0G A;  3ECB A;  5SWZ A;  3GSN H;  1FZK A;  4ZAK A;  1HHG A;  2NX5 A;  3CVH A;  1ZT4 A;  2D31 A;  3MRR A;  3VFO A;  1YN6 A;  1T7V A;  2X4R A;  2H6P A;  3TBY A;  5F9J A;  3GMP A;  3OV6 A;  4Y2D A;  1AO7 A;  3VFM A;  2BNR A;  2F54 A;  4LHU A;  3TPU E;  3VFU A;  3VFR A;  3VWJ A;  3QDJ A;  1R3H A;  4PG9 A;  4U6X A;  5B38 A;  2XFX A;  1LK2 A;  4F7C A;  1HOC A;  3KPN A;  1FFO A;  1X7Q A;  5HGA A;  1JE6 A;  3C9N A;  4HKJ A;  1BD2 A;  3MRM A;  3MRF A;  4IIQ C;  5C0D A;  4QRT A;  3PWP A;  5DEF A;  1VGK A;  2ZOK A;  2A83 A;  3SDC A;  1QQD A;  3FFC A;  3P4M A;  3QUY A;  4JFE A;  4UQ2 A;  1G6R H;  1B0R A;  3QUZ A;  3TBV A;  1P7Q A;  1NAN H;  4FFE X;  1ONQ A;  5C08 A;  5MEP A;  1CD1 A;  2F74 A;  4ZUW A;  2P5E A;  3FQN A;  3TBS A;  3MRE A;  3MRC A;  3VFN A;  1BII A;  5IRO A;  1HHJ A;  3NFN A;  2VE6 A;  3MRD A;  4PJA A;  1LEG A;  4NQC A;  3MRO A;  3FT4 A;  1ZHB A;  1T22 A;  3PQY A;  3FQW A;  4L8S C;  3GML A;  4EI5 A;  5GSR A;  3PWJ A;  1S9X A;  3GMM A;  1UQS A;  3IXA A;  4PJE A;  3BH9 A;  1KJ3 H;  1E27 A;  5AD0 A;  1AGD A;  3RWE A;  3WL9 A;  4LCY A;  3MV8 A;  4JO8 A;  3AM8 A;  1MWA H;  2X4O A;  1S9Y A;  3FRU A;  4PDC E;  2CLR A;  2X4Q A;  3DXA A;  4PRE A;  3TBW A;  4U6Y A;  2HLA A;  5INC A;  4PGB A;  3HAE A;  3UPR A;  1A1N A;  4PGC A;  3GSX A;  3BEW A;  5BS0 A;  1S7V A;  1XR9 A;  3GMO A;  1JPF A;  4N8V A;  1T7W A;  2CIK A;  4QRU A;  1ZS8 A;  3HUJ A;  5C0A A;  3TO4 A;  3M1B A;  5D7J C;  4PJ8 A;  3V5D A;  1HYR C;  4NO0 A;  5ENW A;  3I6L D;  3T8X A;  4HUV A;  3H7B A;  5E9D A;  3MGT A;  3CC5 A;  3DTX A;  5E8N A;  5EFI A;  1T7X A;  3U0P A;  4MJI A;  3MGO A;  3FOL A;  3BGM A;  2X4U A;  1INQ A;  1EFX A;  3ROO A;  3MRH A;  4PJD A;  1JGD A;  5HGB A;  1JHT A;  4PRA A;  1S7U A;  3W0W A;  1VAC A;  4PRH A;  4JFF A;  4X6D A;  3BP7 A;  4QRS A;  1QSE A;  4HV8 A;  4G42 A;  3O3A A;  2Q7Y A;  3FQX A;  1T7Y A;  3KPQ A;  4I4W A;  2ZSV A;  1QLF A;  5HGD A;  2BVP A;  1EEY A;  2X4P A;  2UWE A;  5IND A;  4U1L A;  3LKP A;  2H26 A;  3RWF A;  3TID A;  2PYE A;  3VH8 A;  1FFP A;  1HHH A;  1K8D A;  4JRX A;  1KTL A;  4HUU A;  3JTT A;  1G7P A;  3B3I A;  4U1K A;  3D3V A;  4D0D A;  2AV1 A;  3P9L A;  5IB2 A;  3VXM A;  5J1A A;  3RZC A;  1GZP A;  4F7T A;  1Z5L A;  4X6C A;  1HHK A;  1MI5 A;  1CG9 A;  2ZOL A;  3VFP A;  1KPR A;  3BP4 A;  1KPU A;  4CVX A;  1VAD A;  4JFP A;  3DMM A;  3LKR A;  4NT6 A;  3P4N A;  3X14 A;  2ESV A;  1S7Q A;  3VXS A;  5MEN A;  1HSB A;  2WY3 A;  5HHO A;  2BST A;  3WLB A;  3AU1 A;  3VCL A;  4WU5 A;  4MJ6 A;  5EU5 A;  3X13 A;  4ZUS A;  4I48 A;  3RWH A;  2JCC A;  2O5N A;  4G59 C;  4EUP A;  5MER A;  1YDP A;  5MEO A;  1JGE A;  3L3K A;  1WBX A;  3UTS A;  5B39 A;  1E28 A;  3D2U A;  5F7D A;  1N3N A;  2IA1 A;  2ZSW A;  3QDM A;  1S8D A;  5BXF A;  5FA4 A;  3UBX A;  4F7E A;  1AGF A;  3KYN A;  1QRN A;  3LV3 A;  3KPR A;  3HE6 A;  3VFT A;  2CLZ A;  4APQ A;  3RWD A;  4MJ5 A;  4PJF A;  1T1W A;  4U1N A;  4U1I A;  1OGA A;  4JQX A;  4NO3 A;  3GIV A;  1JPG A;  3C8K A;  5D2N A;  2MHA A;  3SCM A;  1S7X A;  3MA7 A;  3KPO A;  1QSF A;  5EU3 A;  2YEZ A;  1MHE A;  1W72 A;  5ACZ A;  3IT8 D;  3RL2 A;  3FOM A;  1WBZ A;  3L3G A;  3KPL A;  1OSZ A;  5E6I C;  3FT3 A;  1HHI A;  4O2E A;  3CH1 A;  3QEQ A;  5DDH A;  3DBX A;  3WUW A;  3OX8 A;  3OXS A;  1NEZ A;  4Y16 A;  4UQ3 A;  5IVX A;  4NQV A;  4E5X A;  3DX8 A;  1KJM A;  1YN7 A;  2C7U A;  3QUK A;  4D0B A;  3HCV A;  1KJV A;  4X6F A;  2OI9 A;  3LN4 A;  1S9W A;  4MX7 A;  5EO0 A;  3LN5 A;  1JUF A;  3GSV A;  3L9R A;  3TN0 A;  4MNG A;  3RWG A;  3BVN A;  2X4T A;  2VLL A;  3BUY A;  1GZQ A;  5HHN A;  2FWO A;  4E0R A;  3L3J A;  3X11 A;  5J6H A;  3PWN A;  1QO3 A;  2YPK A;  1T80 A;  3LKQ A;  3JTS A;  1TVH A;  3L3H A;  5FKP A;  3BWA A;  4Z78 A;  3B6S A;  3BEV A;  5IEH A;  4MVB A;  1ZSD A;  3ARG A;  2OL3 H;  3FQU A;  3PWU A;  4WW2 C;  3GMQ A;  3RWI A;  1T7Z A;  5L2K A;  3W39 A;  3O8X A;  1KJ2 H;  4PRD A;  1W0W A;  1N59 A;  2BNQ A;  4HUX A;  2GTW A;  2BVO A;  1L8J A;  3L3D A;  1ED3 A;  4MQ7 A;  1TMC A;  1I1F A;  4NNY A;  4NNX A;  3BO8 A;  5E00 A;  3V5H A;  1CE6 A;  3E2H A;  4V3D B;  5HHP A;  5GSV A;  5IB3 A;  4L4T A;  2FIK A;  5IEK A;  4U1M A;  3ILQ C;  1XZ0 A;  1FZO A;  3O3B A;  1P4L A;  4S0U C;  3MRG A;  2BSS A;  1KBG H;  5ISZ A;  4ZFZ A;  3O3E A;  4PV9 A;  5H94 A;  1EEZ A;  3RWC A;  3S6C A;  1P1Z A;  2VAA A;  3GSW A;  1I1Y A;  1KCG C;  1S7R A;  1PQZ A;  3O4L A;  3PWV A;  4WO4 A;  3RWJ A;  3VFW A;  3D25 A;  3GMN A;  3QUL A;  4IHO A;  1AGE A;  4EN3 C;  3SPV A;  3MV9 A;  3GMR A;  4NQE A;  3LKO A;  3VFV A;  3O3D A;  1MHC A;  3MRN A;  4PJ9 A;  3TF7 A;  3REW A;  3I6K A;  1T1Z A;  5EU6 A;  4PJI A;  3VXO A;  4PGE A;  3SDA A;  1Q94 A;  3WS6 A;  2YPL A;  4MNQ A;  2GT9 A;  4NHU E;  1SYV A;  3SJV A;  3D18 A;  3V5K A;  3TBT A;  3SDD A;  5IM7 A;  2FYY A;  3BZF A;  1A9B A;  3SKO A;  2BSR A;  3FQT A;  3KPP A;  3QDG A;  1KPV A;  4LCW A;  5IB4 A;  4L8C A;  1N2R A;  4K71 B;  4L3E A;  1QVO A;  1QR1 A;  1QEW A;  1FZM A;  4QRP A;  3QZW A;  5J6G A;  3H9H A;  4G9D A;  1ZHL A;  3ARF A;  1LQV A;  3G08 A;  3GJF A;  3MV7 A;  4HWZ A;  3D39 A;  3VRI A;  4CW1 A;  5BRZ A;  4ONO A;  1BZ9 A;  1UXW A;  3WS3 A;  1TVB A;  3GSQ A;  4G59 A;  4NO2 A;  3FQR A;  1ZHK A;  5EOT A;  4N0F A;  1OF2 A;  3PAB A;  3I6G A;  4QRQ A;  1AGB A;  3VXU A;  2V2X A;  5IB1 A;  3ROL A;  5FDW A;  1SYS A;  4QRR A;  3ERY A;  3TFK A;  3JVG A;  4Y4F A;  2X4S A;  1NAM H;  3KLA A;  1A1M A;  3P73 A;  4JFO A;  4O2C A;  4PJ5 A;  5EU4 A;  3TIE A;  1RK1 A;  4BKW A;  2GAZ A;  5FA3 A;  3P4O A;  4L8D A;  3MYJ A;  5HHQ A;  1RJZ A;  3T1F A;  4ZUU A;  4HUW A;  2BVQ A;  3CZF A;  3LKN A;  4PG2 A;  3MR9 A;  1XH3 A;  2AKR A;  4ZUT A;  5L2J A;  1DDH A;  3VFS A;  4PJH A;  1LDP H;  4GKS A;  3TZV C;  3VRJ A;  2VLK A;  3E3Q A;  2RFX A;  3H9S A;  4G9F A;  3KPM A;  4L8B A;  5HYJ A;  1T0N A;  5SWS A;  4PR5 A;  4U1S A;  2AXF A;  5MEQ A;  3MRL A;  4WWK C;  3QQ3 A;  4GKN A;  2VAB A;  1A9E A;  4Z76 A;  1LP9 A;  1T20 A;  1IM3 A;  3QFD A;  4ELM A;  4JRY A;  5C0B A;  4WUU A;  3TVM A;  3BHB A;  3OXR A;  1YPZ A;  1A1O A;  1DE4 A;  1G7Q A;  3E6F A;  4PRP A;  5EUO A;  1LD9 A;  3CDG A;  2PO6 A;  5JHD A;  3LKS A;  5E8P A;  4G43 A;  3FTG A;  4N5E A;  4PJG A;  3O9W A;  3UTT A;  2E7L E;  3PWL A;  1M05 A;  3RTQ A;  2X70 A;  3CPL A;  3QQ4 A;  3SDX A;  3UTQ A;  5C0J A;  4MS8 A;  1C16 A;  4NSK A;  2VLJ A;  3X12 A;  1JF1 A;  2FZ3 A;  3GSO A;  4PRN A;  1ZVS A;  4JFQ A;  2DYP A;  2CKB H;  4X6E A;  5F1I A;  5BJT A;  3MRQ A;  5C0E A;  5DEG A;  2GJ6 A;  1OGT A;  3ARB A;  2J8U A;  2NYK A;  1I1A A;  3GSU A;  3BXN A;  1AKJ A;  1FG2 A;  3ES6 A;  4K7F A;  1LEK A;  1W0V A;  4Z77 A;  5D5M A;  4O2F A;  1DUY A;  2GTZ A;  1ZAG A;  3RGV C;  3ARE A;  1FZJ A;  3QFJ A;  3RUG A;  3L3I A;  4CVZ A;  3TA3 A;  4IRJ A;  4FTV A;  5F1N A;  3QUX A;  3HE7 A;  5C0F A;  5D9S A;  4PP8 C;  1JFM A;  4L29 A;  5D7L A;  1N5A A;  1S7S A;  4L9L C;  4ZUV A;  3BW9 A;  1S7T A;  4U1J A;  3VWK A;  3VJ6 A;  1B0G A;  4G8I A;  1K5N A;  3VXN A;  2HN7 A;  3KWW A;  2NW3 A;  2V2W A;  3FON A;  4Y4K A;  4Y4H A;  2XPG A;  3I0T A;  1U58 A;  4PV8 A;  3QI9 A;  5C0C A;  1ZHN A;  3E6H A;  1EXU A;  1IM9 A;  5C09 A;  5C9J A;  4L3C A;  3GSR A;  1T1X A;  1B3J A;  2X4N A; 
#chains in the Genus database with same CATH homology
 3HPJ A;  2HJL A;  4JQV A;  4V3E B;  3KYO A;  4U1H A;  3VXP A;  4D0C A;  3JTC A;  1UXS A;  4PGD A;  2FO4 A;  1I7R A;  5EO1 A;  1XR8 A;  3HLA A;  3RL1 A;  4WJ5 A;  4NO5 A;  4WU7 A;  3DX7 A;  3BZE A;  5D2L A;  2AK4 A;  3MRK A;  5E8O A;  4GUP A;  4F7M A;  4PJC A;  1WBY A;  3MRB A;  1RJY A;  1HSA A;  1ZT1 A;  4WDI A;  1DUZ A;  2VLR A;  3ARD A;  4LCC C;  4N0C A;  1T1Y A;  5C0I A;  2GUO A;  2CII A;  1FFN A;  4PRB A;  1M6O A;  4JFD A;  1I7T A;  5IB5 A;  4HS3 A;  4LNR A;  4HX1 A;  4PJ7 A;  4F7P A;  2AXG A;  4QOK A;  5D7I A;  4N0U A;  1I7U A;  5HGH A;  2P5W A;  1T0M A;  3CCH A;  4PRI A;  3KXF A;  2CLV A;  2AV7 A;  3TJH A;  1RK0 A;  5HHM A;  3DX6 A;  1T21 A;  4NQX A;  4NQD A;  1BQH A;  4MXQ A;  4XXC A;  3MRP A;  3VXR A;  1I4F A;  3P77 A;  1ZT7 A;  1FO0 H;  2GIT A;  3MRJ A;  5SWQ A;  3TO2 A;  3BH8 A;  1AGC A;  3M17 A;  4L4V A;  4PJB A;  1S7W A;  2F53 A;  3ILP A;  3FT2 A;  2HJK A;  4PJX A;  3P9M A;  1A6Z A;  3SKM A;  3MRI A;  5C07 A;  3HG1 A;  3KPS A;  4G8G A;  2BCK A;  4IRS A;  5C0G A;  3ECB A;  5SWZ A;  3GSN H;  1FZK A;  4ZAK A;  1HHG A;  2NX5 A;  3CVH A;  1ZT4 A;  2D31 A;  3MRR A;  3VFO A;  1YN6 A;  1T7V A;  2X4R A;  2H6P A;  3TBY A;  5F9J A;  3GMP A;  3OV6 A;  4Y2D A;  1AO7 A;  3VFM A;  2BNR A;  2F54 A;  4LHU A;  3TPU E;  3VFU A;  3VFR A;  3VWJ A;  3QDJ A;  1R3H A;  4PG9 A;  4U6X A;  5B38 A;  2XFX A;  1LK2 A;  4F7C A;  1HOC A;  3KPN A;  1FFO A;  1X7Q A;  5HGA A;  1JE6 A;  3C9N A;  4HKJ A;  1BD2 A;  3MRM A;  3MRF A;  4IIQ C;  5C0D A;  4QRT A;  3PWP A;  5DEF A;  1VGK A;  2ZOK A;  2A83 A;  3SDC A;  1QQD A;  3FFC A;  3P4M A;  3QUY A;  4JFE A;  4UQ2 A;  1G6R H;  1B0R A;  3QUZ A;  3TBV A;  1P7Q A;  1NAN H;  4FFE X;  1ONQ A;  5C08 A;  5MEP A;  1CD1 A;  2F74 A;  4ZUW A;  2P5E A;  3FQN A;  3TBS A;  3MRE A;  3MRC A;  3VFN A;  1BII A;  5IRO A;  1HHJ A;  3NFN A;  2VE6 A;  3MRD A;  4PJA A;  1LEG A;  4NQC A;  3MRO A;  3FT4 A;  1ZHB A;  1T22 A;  3PQY A;  3FQW A;  4L8S C;  3GML A;  4EI5 A;  5GSR A;  3PWJ A;  1S9X A;  3GMM A;  1UQS A;  3IXA A;  4PJE A;  3BH9 A;  1KJ3 H;  1E27 A;  5AD0 A;  1AGD A;  3RWE A;  3WL9 A;  4LCY A;  3MV8 A;  3AM8 A;  1MWA H;  2X4O A;  1S9Y A;  3FRU A;  4PDC E;  2CLR A;  2X4Q A;  3DXA A;  4PRE A;  3TBW A;  4U6Y A;  2HLA A;  5INC A;  4PGB A;  3HAE A;  3UPR A;  1A1N A;  4PGC A;  3GSX A;  3BEW A;  5BS0 A;  1S7V A;  1XR9 A;  3GMO A;  1JPF A;  4N8V A;  1T7W A;  2CIK A;  4QRU A;  1ZS8 A;  3HUJ A;  5C0A A;  3TO4 A;  3M1B A;  5D7J C;  4PJ8 A;  3V5D A;  1HYR C;  4NO0 A;  5ENW A;  3I6L D;  3T8X A;  4HUV A;  3H7B A;  5E9D A;  3MGT A;  3CC5 A;  3DTX A;  5E8N A;  5EFI A;  1T7X A;  3U0P A;  4MJI A;  3MGO A;  3FOL A;  3BGM A;  2X4U A;  1INQ A;  1EFX A;  3ROO A;  3MRH A;  4PJD A;  1JGD A;  5HGB A;  1JHT A;  4PRA A;  1S7U A;  3W0W A;  1VAC A;  4PRH A;  4JFF A;  4X6D A;  3BP7 A;  4QRS A;  1QSE A;  4HV8 A;  4G42 A;  3O3A A;  2Q7Y A;  3FQX A;  1T7Y A;  3KPQ A;  4I4W A;  2ZSV A;  1QLF A;  5HGD A;  2BVP A;  1EEY A;  2X4P A;  2UWE A;  5IND A;  4U1L A;  3LKP A;  2H26 A;  3RWF A;  3TID A;  2PYE A;  3VH8 A;  1FFP A;  1HHH A;  1K8D A;  4JRX A;  1KTL A;  4HUU A;  3JTT A;  1G7P A;  3B3I A;  4U1K A;  3D3V A;  4D0D A;  2AV1 A;  3P9L A;  5IB2 A;  3VXM A;  5J1A A;  3RZC A;  1GZP A;  4F7T A;  1Z5L A;  4X6C A;  1HHK A;  1MI5 A;  1CG9 A;  2ZOL A;  3VFP A;  1KPR A;  3BP4 A;  1KPU A;  4CVX A;  1VAD A;  4JFP A;  3DMM A;  3LKR A;  4NT6 A;  3P4N A;  3X14 A;  2ESV A;  1S7Q A;  3VXS A;  5MEN A;  1HSB A;  2WY3 A;  5HHO A;  2BST A;  3WLB A;  3AU1 A;  3VCL A;  4WU5 A;  4MJ6 A;  5EU5 A;  3X13 A;  4ZUS A;  4I48 A;  3RWH A;  2JCC A;  4EUP A;  5MER A;  1YDP A;  5MEO A;  1JGE A;  3L3K A;  1WBX A;  3UTS A;  5B39 A;  1E28 A;  3D2U A;  5F7D A;  1N3N A;  2ZSW A;  3QDM A;  1S8D A;  5BXF A;  5FA4 A;  3UBX A;  4F7E A;  1AGF A;  3KYN A;  1QRN A;  3LV3 A;  3KPR A;  3HE6 A;  3VFT A;  2CLZ A;  4APQ A;  3RWD A;  4MJ5 A;  4PJF A;  1T1W A;  4U1N A;  4U1I A;  1OGA A;  4JQX A;  4NO3 A;  3GIV A;  1JPG A;  3C8K A;  5D2N A;  2MHA A;  3SCM A;  1S7X A;  3MA7 A;  3KPO A;  1QSF A;  5EU3 A;  2YEZ A;  1MHE A;  1W72 A;  5ACZ A;  3IT8 D;  3RL2 A;  3FOM A;  1WBZ A;  3L3G A;  3KPL A;  1OSZ A;  5E6I C;  3FT3 A;  1HHI A;  4O2E A;  3CH1 A;  3QEQ A;  5DDH A;  3DBX A;  3WUW A;  3OX8 A;  3OXS A;  1NEZ A;  4Y16 A;  4UQ3 A;  5IVX A;  4NQV A;  4E5X A;  3DX8 A;  1KJM A;  1YN7 A;  2C7U A;  3QUK A;  4D0B A;  3HCV A;  1KJV A;  4X6F A;  2OI9 A;  3LN4 A;  1S9W A;  4MX7 A;  5EO0 A;  3LN5 A;  1JUF A;  3GSV A;  3L9R A;  3TN0 A;  4MNG A;  3RWG A;  3BVN A;  2X4T A;  2VLL A;  3BUY A;  1GZQ A;  5HHN A;  2FWO A;  4E0R A;  3L3J A;  3X11 A;  5J6H A;  3PWN A;  1QO3 A;  2YPK A;  1T80 A;  3LKQ A;  3JTS A;  1TVH A;  3L3H A;  5FKP A;  3BWA A;  4Z78 A;  3B6S A;  3BEV A;  5IEH A;  4MVB A;  1ZSD A;  3ARG A;  2OL3 H;  3FQU A;  3PWU A;  4WW2 C;  3GMQ A;  3RWI A;  1T7Z A;  5L2K A;  3W39 A;  3O8X A;  1KJ2 H;  4PRD A;  1W0W A;  1N59 A;  2BNQ A;  4HUX A;  2GTW A;  2BVO A;  1L8J A;  3L3D A;  1ED3 A;  4MQ7 A;  1TMC A;  1I1F A;  4NNY A;  4NNX A;  3BO8 A;  5E00 A;  3V5H A;  1CE6 A;  3E2H A;  4V3D B;  5HHP A;  5GSV A;  5IB3 A;  4L4T A;  2FIK A;  5IEK A;  4U1M A;  3ILQ C;  1XZ0 A;  1FZO A;  3O3B A;  1P4L A;  4S0U C;  3MRG A;  2BSS A;  1KBG H;  5ISZ A;  4ZFZ A;  3O3E A;  4PV9 A;  5H94 A;  1EEZ A;  3RWC A;  3S6C A;  1P1Z A;  2VAA A;  3GSW A;  1I1Y A;  1KCG C;  1S7R A;  1PQZ A;  3O4L A;  3PWV A;  4WO4 A;  3RWJ A;  3VFW A;  3D25 A;  3GMN A;  3QUL A;  4IHO A;  1AGE A;  4EN3 C;  3SPV A;  3MV9 A;  3GMR A;  4NQE A;  3LKO A;  3VFV A;  3O3D A;  1MHC A;  3MRN A;  4PJ9 A;  3TF7 A;  3REW A;  3I6K A;  1T1Z A;  5EU6 A;  4PJI A;  3VXO A;  4PGE A;  3SDA A;  1Q94 A;  3WS6 A;  2YPL A;  4MNQ A;  2GT9 A;  4NHU E;  1SYV A;  3SJV A;  3D18 A;  3V5K A;  3TBT A;  3SDD A;  5IM7 A;  2FYY A;  3BZF A;  1A9B A;  3SKO A;  2BSR A;  3FQT A;  3KPP A;  3QDG A;  1KPV A;  4LCW A;  5IB4 A;  4L8C A;  1N2R A;  4K71 B;  4L3E A;  1QVO A;  1QR1 A;  1QEW A;  1FZM A;  4QRP A;  3QZW A;  5J6G A;  3H9H A;  4G9D A;  1ZHL A;  3ARF A;  1LQV A;  3G08 A;  3GJF A;  3MV7 A;  4HWZ A;  3D39 A;  3VRI A;  4CW1 A;  5BRZ A;  4ONO A;  1BZ9 A;  1UXW A;  3WS3 A;  1TVB A;  3GSQ A;  4G59 A;  4NO2 A;  3FQR A;  1ZHK A;  5EOT A;  4N0F A;  1OF2 A;  3PAB A;  3I6G A;  4QRQ A;  1AGB A;  3VXU A;  2V2X A;  5IB1 A;  3ROL A;  5FDW A;  1SYS A;  4QRR A;  3ERY A;  3TFK A;  3JVG A;  4Y4F A;  2X4S A;  1NAM H;  3KLA A;  1A1M A;  3P73 A;  4JFO A;  4O2C A;  4PJ5 A;  5EU4 A;  3TIE A;  1RK1 A;  2GAZ A;  5FA3 A;  3P4O A;  4L8D A;  3MYJ A;  5HHQ A;  1RJZ A;  3T1F A;  4ZUU A;  4HUW A;  2BVQ A;  3CZF A;  3LKN A;  4PG2 A;  3MR9 A;  1XH3 A;  2AKR A;  4ZUT A;  5L2J A;  1DDH A;  3VFS A;  4PJH A;  1LDP H;  4GKS A;  3TZV C;  3VRJ A;  2VLK A;  3E3Q A;  2RFX A;  3H9S A;  4G9F A;  3KPM A;  4L8B A;  5HYJ A;  1T0N A;  5SWS A;  4PR5 A;  4U1S A;  2AXF A;  5MEQ A;  3MRL A;  4WWK C;  3QQ3 A;  4GKN A;  2VAB A;  1A9E A;  4Z76 A;  1LP9 A;  1T20 A;  1IM3 A;  3QFD A;  4ELM A;  4JRY A;  5C0B A;  4WUU A;  3TVM A;  3BHB A;  3OXR A;  1YPZ A;  1A1O A;  1DE4 A;  1G7Q A;  3E6F A;  4PRP A;  5EUO A;  1LD9 A;  3CDG A;  2PO6 A;  5JHD A;  3LKS A;  5E8P A;  4G43 A;  3FTG A;  4N5E A;  4PJG A;  3O9W A;  3UTT A;  2E7L E;  3PWL A;  1M05 A;  3RTQ A;  2X70 A;  3CPL A;  3QQ4 A;  3SDX A;  3UTQ A;  5C0J A;  4MS8 A;  1C16 A;  4NSK A;  2VLJ A;  3X12 A;  1JF1 A;  2FZ3 A;  3GSO A;  4PRN A;  1ZVS A;  4JFQ A;  2DYP A;  2CKB H;  4X6E A;  5F1I A;  5BJT A;  3MRQ A;  5C0E A;  5DEG A;  2GJ6 A;  1OGT A;  3ARB A;  2J8U A;  1I1A A;  3GSU A;  3BXN A;  1AKJ A;  1FG2 A;  3ES6 A;  4K7F A;  1LEK A;  1W0V A;  4Z77 A;  5D5M A;  4O2F A;  1DUY A;  2GTZ A;  1ZAG A;  3RGV C;  3ARE A;  1FZJ A;  3QFJ A;  3RUG A;  3L3I A;  4CVZ A;  3TA3 A;  4IRJ A;  4FTV A;  5F1N A;  3QUX A;  3HE7 A;  5C0F A;  5D9S A;  4PP8 C;  1JFM A;  4L29 A;  5D7L A;  1N5A A;  1S7S A;  4L9L C;  4ZUV A;  3BW9 A;  1S7T A;  4U1J A;  3VWK A;  3VJ6 A;  1B0G A;  4G8I A;  1K5N A;  3VXN A;  2HN7 A;  3KWW A;  2NW3 A;  2V2W A;  3FON A;  4Y4K A;  4Y4H A;  2XPG A;  1U58 A;  4PV8 A;  3QI9 A;  5C0C A;  1ZHN A;  3E6H A;  1EXU A;  1IM9 A;  5C09 A;  5C9J A;  4L3C A;  3GSR A;  1T1X A;  1B3J A;  2X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...