3E2HA

Structure of the m67 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
total genus 51
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e2hA00
3V5KA 1LK2A 3MRLA 3MRJA 4N5EA 5E6IC 2RFXA 3RGVC 5C0AA 3MRCA 3GSRA 4APQA 4JFDA 4MNGA 1BQHA 1T7VA 3CH1A 3HPJA 3X13A 1TVBA 1AO7A 1JPGA 3LKPA 1ZT7A 1I7UA 1G6RH 3CZFA 3PWJA 1DDHA 1T7YA 3VXSA 4HX1A 5HHPA 5IEHA 3GSVA 4NQEA 1QVOA 3P4OA 5C0CA 3I6LD 5HYJA 4I4WA 1S9XA 4PP8C 1FZKA 3MRBA 3VJ6A 3MR9A 3KPMA 1KJ3H 4HS3A 4Z78A 2BSSA 3M1BA 2Q7YA 5E8PA 5FA3A 4GKNA 1HOCA 5EU4A 1DUZA 3T1FA 3VFMA 3VFUA 5DEFA 2D31A 2VLKA 3X12A 1E27A 3HCVA 1A1NA 3MGTA 4NNXA 3X14A 3BH9A 3KYOA 3P73A 4ZUVA 1T1WA 3VFNA 2NX5A 1AGFA 3O3DA 4NNYA 4QRRA 1B3JA 1QQDA 4U1MA 2ZSWA 2YPLA 1AGCA 5ENWA 3FTGA 5AD0A 3LN4A 1HHGA 1M6OA 3QEQA 4PG2A 1KPUA 1U58A 4PJXA 3UBXA 3PWUA 4PRAA 2MHAA 4U6XA 5IEKA 2HJLA 3AM8A 2GTZA 4WO4A 3QULA 3FT4A 3I6KA 4N8VA 1A6ZA 3TBWA 3GSOA 1JHTA 2BNRA 5F1IA 3GSQA 1JGEA 3RL1A 3BVNA 3BHBA 4PJ9A 5D7JC 4PDCE 3V5HA 2BSTA 3BP7A 1YDPA 1WBYA 3FT3A 3MV9A 1A9BA 3RZCA 1UXWA 2PYEA 3KWWA 1P4LA 3ILPA 3KLAA 3SPVA 3PWNA 3GMPA 3VRIA 5FDWA 2AV7A 1JPFA 3BXNA 4MS8A 3AREA 3MRGA 1OF2A 2JCCA 3WS3A 1G7PA 4CW1A 3MRDA 3QUZA 4NQXA 5FKPA 4IRSA 1JFMA 1JUFA 3RWFA 3MRQA 4MVBA 5GSVA 5INCA 2CLZA 3ARGA 3SDCA 3TN0A 3VFVA 1QO3A 4WWKC 5SWSA 4QRPA 3QDGA 1T20A 3LV3A 1OGTA 1T1YA 2VE6A 2YEZA 3QFJA 1X7QA 3GMMA 1PQZA 4QRSA 5FA4A 4D0CA 2J8UA 2A83A 1T7XA 1FFNA 3ERYA 1DE4A 4PJDA 4NO3A 2FWOA 3TO2A 3W39A 4G8IA 1LD9A 5JHDA 1P7QA 1Q94A 4GUPA 3X11A 3PQYA 5C0DA 2CIKA 4ONOA 1NAMH 1YPZA 3FQXA 1I7RA 3H9HA 3SDAA 4E0RA 4PGDA 4L4VA 1W0VA 4UQ2A 3TF7A 1WBZA 2H26A 3KPPA 3RWDA 3HAEA 2BVQA 3BWAA 3HLAA 3MRMA 3RL2A 1S9YA 3VXPA 3O3EA 5C0FA 1EFXA 4MJ5A 4PJ5A 1JF1A 4Z77A 4PJEA 4IIQC 3MRPA 3LKNA 2E7LE 4Y16A 1FG2A 3CC5A 3TVMA 3GSUA 1BZ9A 2DYPA 3ES6A 4GKSA 4PRPA 3VWKA 1ONQA 4U1JA 4WU7A 1C16A 5BRZA 3V5DA 4ZUUA 3M17A 3T8XA 3BEWA 3VFOA 4QRUA 1YN6A 3VXNA 4PJCA 2AXGA 3DTXA 1T0MA 3REWA 1N3NA 2GJ6A 4Z76A 1K8DA 3ARBA 3P9MA 5IB2A 3KPNA 4FFEX 3TJHA 5E9DA 4L8SC 4NO5A 4PRIA 3SKOA 3UTQA 1QSFA 2GAZA 4HUXA 3AU1A 5C0BA 1QSEA 2FYYA 3TBSA 2PO6A 4PGBA 4S0UC 3P4MA 4PV8A 1HHJA 3LN5A 4G9DA 5F9JA 4PJHA 3RWIA 3VFPA 1N59A 3FQRA 2X4PA 5EU5A 3QFDA 1LQVA 1ZT1A 5EO0A 5EU6A 4Y2DA 4LCYA 4HUUA 3L9RA 1SYSA 5EU3A 1HSAA 3D2UA 1P1ZA 1RK1A 3HG1A 4L8BA 4L8DA 4ZUTA 5C0IA 4IRJA 4PR5A 2XPGA 4HV8A 3B3IA 4WW2C 4JRYA 3O3BA 3O8XA 1QRNA 3VXRA 5HGHA 1S8DA 4EI5A 4U6YA 5EOTA 3UTSA 1CE6A 3KPQA 3VRJA 5IVXA 2F54A 4G9FA 3I6GA 5MEPA 1JGDA 2VLJA 4PJ7A 5IB1A 5D9SA 4ZAKA 4PG9A 3E2HA 3D25A 3QUYA 3GSNH 1S7WA 2BSRA 1S7TA 1ZVSA 3MV7A 4HKJA 5HHMA 3TBVA 3GMLA 5EO1A 4NO0A 3GMNA 3LKOA 3W0WA 3MRIA 4PJIA 4PRHA 3GJFA 4MJ6A 3RWGA 4E5XA 3HE6A 1I4FA 1S7VA 4LHUA 3LKRA 2H6PA 5L2KA 3PABA 1T21A 4V3DB 3DX7A 3QZWA 5INDA 3KPSA 1RJYA 1EEYA 1S7UA 2X70A 2CKBH 1JE6A 4WDIA 3WL9A 3MV8A 3VFRA 4EUPA 5B39A 5IB3A 1W0WA 2C7UA 4L3EA 5HHNA 2XFXA 1GZQA 1MI5A 4N0FA 1GZPA 1R3HA 2HLAA 3GMRA 1T22A 5HGDA 3HUJA 4F7TA 3D18A 3ROLA 3L3JA 3BZEA 3ECBA 3JTSA 3TA3A 1AGBA 1B0RA 3L3KA 3MRKA 4U1SA 3E6FA 3FOMA 1M05A 3WS6A 5B38A 3ARFA 3S6CA 1IM3A 3JTCA 1AGEA 1LDPH 2FZ3A 1KPVA 4X6CA 1K5NA 5F7DA 3P9LA 1KTLA 1T7WA 5J1AA 3D39A 1BIIA 4ZUSA 4F7PA 3OXRA 5EFIA 4JQVA 3SJVA 5MERA 2X4SA 3DBXA 1LP9A 4PJ8A 1KJVA 2HN7A 4HUWA 3QUKA 3FRUA 4NO2A 1KBGH 3G08A 3MGOA 4JFQA 3TZVC 4CVZA 3KPLA 2X4RA 5IM7A 3RWEA 2HJKA 3KPOA 5DEGA 2ZSVA 3DXAA 1N5AA 3SDDA 4PGEA 3P4NA 4Y4FA 2FIKA 1I1FA 4N0UA 1RK0A 2BCKA 1ZHLA 1HSBA 3KXFA 4G43A 2AKRA 3VXOA 3QQ3A 3KPRA 4F7MA 5C0JA 1VADA 3O4LA 5C08A 5ISZA 4FTVA 3GMQA 3D3VA 2V2XA 4LCCC 5J6GA 3SDXA 3WUWA 3C8KA 1XR9A 4JRXA 1I7TA 3H7BA 3O9WA 4XXCA 5L2JA 1TVHA 3VXUA 5D7LA 5E8NA 5DDHA 2ESVA 1KPRA 3MRHA 4U1HA 3VFWA 1QR1A 1RJZA 3UPRA 5H94A 5J6HA 4PV9A 5D5MA 5ACZA 5EUOA 2YPKA 1FZMA 3GSWA 5C07A 5C9JA 4L9LC 3DX8A 1LEGA 4G42A 1E28A 2ZOLA 4EN3C 2WY3A 3OX8A 2BVOA 4I48A 5SWQA 2ZOKA 3MREA 2P5EA 3L3DA 2FO4A 4JQXA 2CLRA 4D0DA 4L3CA 1MWAH 3FQWA 1XR8A 4WJ5A 3FQTA 4V3EB 1KCGC 3ROOA 4L8CA 2X4UA 3QDMA 3O3AA 5F1NA 4F7CA 4QOKA 1I1AA 3RWHA 1T80A 1HHKA 4ELMA 3FFCA 3SKMA 3JVGA 4G8GA 3VFTA 4MXQA 5BS0A 1OSZA 3TPUE 3B6SA 3GSXA 3PWVA 3QQ4A 4K7FA 1ZHKA 4X6DA 4LCWA 3LKQA 2GT9A 2F74A 5HHQA 1VGKA 1B0GA 1UQSA 3CVHA 4HUVA 2GTWA 1A9EA 2CLVA 1S7SA 2CIIA 4U1IA 4PJAA 3OV6A 3RWJA 4ZUWA 1EXUA 3TBTA 3DMMA 3TIEA 3H9SA 3NFNA 1FZOA 4PRBA 5MEQA 3BO8A 3CDGA 2F53A 2OI9A 3KYNA 4NQDA 1YN7A 3L3HA 1FFOA 1Z5LA 5GSRA 3GIVA 1ZHBA 3CPLA 2X4OA 4F7EA 5C09A 3C9NA 3SCMA 3VWJA 1KJ2H 3RTQA 5BXFA 4MJIA 5HGBA 4N0CA 4U1NA 2OL3H 5C0GA 1QLFA 1S7XA 4PRDA 1INQA 1MHEA 3BH8A 5D2LA 4JFFA 1IM9A 5E8OA 3MRFA 4O2CA 5IB5A 1SYVA 1HHHA 2BNQA 1OGAA 2VAAA 1W72A 1LEKA 2NW3A 1XH3A 3PWLA 1UXSA 4QRTA 3FT2A 3WLBA 5HHOA 3BP4A 4PJGA 3L3GA 4NQVA 1HHIA 1T0NA 1ZSDA 1QEWA 1AGDA 1XZ0A 2UWEA 5IB4A 1S9WA 3VH8A 1ZHNA 4L4TA 3IT8D 1CG9A 3DX6A 5SWZA 3VFSA 4Y4KA 3MRNA 5HGAA 2P5WA 5MEOA 4U1LA 3E3QA 1NANH 4Y4HA 4CVXA 3RUGA 3L3IA 4NHUE 3TIDA 1I1YA 1NEZA 4NSKA 1L8JA 1AKJA 2X4TA 1T1XA 1A1MA 3U0PA 4L29A 4PJFA 4WU5A 3TO4A 1DUYA 4UQ3A 1G7QA 1ZT4A 1WBXA 1ZAGA 3TBYA 5MENA 2BVPA 3ILQC 1FFPA 3BGMA 4QRQA 2V2WA 2AK4A 2VLRA 3QI9A 4LNRA 1MHCA 1S7RA 5IROA 4NT6A 1A1OA 2X4QA 4WUUA 4X6EA 5E00A 3FONA 4O2EA 1ED3A 3BUYA 3JTTA 4G59A 4IHOA 3VXMA 4JFEA 5BJTA 2GITA 3BW9A 4X6FA 5D7IA 1HYRC 4PREA 2AXFA 3MROA 1ZS8A 1T1ZA 3RWCA 3GMOA 3CCHA 3VCLA 4K71B 5D2NA 1TMCA 4ZFZA 4HWZA 1S7QA 4NQCA 1KJMA 3FOLA 3MA7A 3QDJA 1T7ZA 1BD2A 4PRNA 3FQNA 1VACA 2AV1A 4MX7A 3IXAA 3E6HA 3HE7A 3ARDA 1CD1A 1FZJA 3MYJA 1FO0H 4JFPA 3QUXA 4O2FA 3FQUA 2VLLA 3LKSA 2GUOA 4PGCA 5C0EA 4MQ7A 1N2RA 4D0BA 4PJBA 4U1KA 3OXSA 3TFKA 2X4NA 3BZFA 3UTTA 3BEVA 3MRRA 3P77A 1EEZA 3PWPA 4JFOA 4MNQA 2VABA
chains in the Genus database with same CATH superfamily
3V5KA 1LK2A 3MRLA 3MRJA 4N5EA 5E6IC 2RFXA 3RGVC 5C0AA 3MRCA 3GSRA 4APQA 4JFDA 4MNGA 1BQHA 1T7VA 3CH1A 3HPJA 3X13A 1TVBA 1AO7A 1JPGA 3LKPA 1ZT7A 1I7UA 1G6RH 3CZFA 3PWJA 1DDHA 1T7YA 3VXSA 4HX1A 5HHPA 5IEHA 3GSVA 4NQEA 1QVOA 3P4OA 5C0CA 3I6LD 5HYJA 4I4WA 1S9XA 4PP8C 1FZKA 3MRBA 3VJ6A 3MR9A 3KPMA 1KJ3H 4HS3A 4Z78A 2BSSA 3M1BA 2Q7YA 5E8PA 5FA3A 4GKNA 1HOCA 5EU4A 1DUZA 3T1FA 3VFMA 3VFUA 5DEFA 2D31A 2VLKA 3X12A 1E27A 3HCVA 1A1NA 3MGTA 4NNXA 3X14A 3BH9A 3KYOA 3P73A 4ZUVA 1T1WA 3VFNA 2NX5A 1AGFA 3O3DA 4NNYA 4QRRA 1B3JA 1QQDA 4U1MA 2ZSWA 2YPLA 1AGCA 5ENWA 3FTGA 5AD0A 3LN4A 1HHGA 1M6OA 3QEQA 4PG2A 1KPUA 1U58A 4PJXA 3UBXA 3PWUA 4PRAA 2MHAA 4U6XA 5IEKA 2HJLA 3AM8A 2GTZA 4WO4A 3QULA 3FT4A 3I6KA 4N8VA 1A6ZA 3TBWA 3GSOA 1JHTA 2BNRA 5F1IA 3GSQA 1JGEA 3RL1A 3BVNA 3BHBA 4PJ9A 5D7JC 4PDCE 3V5HA 2BSTA 3BP7A 1YDPA 1WBYA 3FT3A 3MV9A 1A9BA 3RZCA 1UXWA 2PYEA 3KWWA 1P4LA 3ILPA 3KLAA 3SPVA 3PWNA 3GMPA 3VRIA 5FDWA 2AV7A 1JPFA 3BXNA 4MS8A 3AREA 3MRGA 1OF2A 2JCCA 3WS3A 1G7PA 4CW1A 3MRDA 3QUZA 4NQXA 5FKPA 4IRSA 1JFMA 1JUFA 3RWFA 3MRQA 4MVBA 5GSVA 5INCA 2CLZA 3ARGA 3SDCA 3TN0A 3VFVA 1QO3A 4WWKC 5SWSA 4QRPA 3QDGA 1T20A 3LV3A 1OGTA 1T1YA 2VE6A 2YEZA 3QFJA 1X7QA 3GMMA 1PQZA 4QRSA 5FA4A 4D0CA 2J8UA 2A83A 1T7XA 1FFNA 3ERYA 1DE4A 4PJDA 4NO3A 2FWOA 3TO2A 3W39A 4G8IA 1LD9A 5JHDA 1P7QA 1Q94A 4GUPA 3X11A 3PQYA 5C0DA 2CIKA 4ONOA 1NAMH 1YPZA 3FQXA 1I7RA 3H9HA 3SDAA 4E0RA 4PGDA 4L4VA 1W0VA 4UQ2A 3TF7A 1WBZA 2H26A 3KPPA 3RWDA 3HAEA 2BVQA 3BWAA 3HLAA 3MRMA 3RL2A 1S9YA 3VXPA 3O3EA 5C0FA 1EFXA 4MJ5A 4PJ5A 1JF1A 4Z77A 4PJEA 4IIQC 3MRPA 3LKNA 2E7LE 4Y16A 1FG2A 3CC5A 3TVMA 3GSUA 1BZ9A 2DYPA 3ES6A 4GKSA 4PRPA 3VWKA 1ONQA 4U1JA 4WU7A 1C16A 5BRZA 3V5DA 4ZUUA 3M17A 3T8XA 3BEWA 3VFOA 4QRUA 1YN6A 3VXNA 4PJCA 2AXGA 3DTXA 1T0MA 3REWA 1N3NA 2GJ6A 4Z76A 1K8DA 3ARBA 3P9MA 5IB2A 3KPNA 4FFEX 3TJHA 5E9DA 4L8SC 4NO5A 4PRIA 3SKOA 3UTQA 1QSFA 2GAZA 4HUXA 3AU1A 5C0BA 1QSEA 3I0TA 2FYYA 3TBSA 2PO6A 4PGBA 4S0UC 3P4MA 4PV8A 1HHJA 3LN5A 4G9DA 5F9JA 4PJHA 3RWIA 3VFPA 1N59A 3FQRA 2X4PA 5EU5A 3QFDA 1LQVA 1ZT1A 5EO0A 5EU6A 4Y2DA 4LCYA 4HUUA 3L9RA 1SYSA 5EU3A 1HSAA 3D2UA 1P1ZA 1RK1A 3HG1A 4L8BA 4L8DA 4ZUTA 5C0IA 4IRJA 4PR5A 2XPGA 4HV8A 3B3IA 4WW2C 4JRYA 3O3BA 3O8XA 1QRNA 3VXRA 5HGHA 1S8DA 4EI5A 4U6YA 5EOTA 3UTSA 1CE6A 3KPQA 3VRJA 5IVXA 2F54A 4G9FA 3I6GA 5MEPA 1JGDA 2VLJA 4PJ7A 5IB1A 5D9SA 4ZAKA 4PG9A 3E2HA 3D25A 3QUYA 3GSNH 1S7WA 2BSRA 1S7TA 1ZVSA 3MV7A 4HKJA 5HHMA 3TBVA 3GMLA 5EO1A 4NO0A 3GMNA 3LKOA 3W0WA 3MRIA 4PJIA 4PRHA 3GJFA 4MJ6A 3RWGA 4E5XA 3HE6A 1I4FA 1S7VA 4LHUA 3LKRA 2H6PA 5L2KA 3PABA 1T21A 4V3DB 3DX7A 3QZWA 5INDA 3KPSA 1RJYA 1EEYA 1S7UA 2X70A 2CKBH 1JE6A 4WDIA 3WL9A 3MV8A 3VFRA 4EUPA 5B39A 2IA1A 1W0WA 5IB3A 2C7UA 4L3EA 5HHNA 2XFXA 1GZQA 1MI5A 4N0FA 1GZPA 1R3HA 2HLAA 2O5NA 3GMRA 1T22A 5HGDA 3HUJA 4F7TA 3D18A 3ROLA 3L3JA 3BZEA 3ECBA 3JTSA 3TA3A 1AGBA 1B0RA 3L3KA 3MRKA 4U1SA 3E6FA 3FOMA 1M05A 3WS6A 5B38A 3ARFA 3S6CA 1IM3A 3JTCA 1AGEA 1LDPH 2FZ3A 1KPVA 4X6CA 4BKWA 1K5NA 5F7DA 3P9LA 1KTLA 1T7WA 5J1AA 3D39A 1BIIA 4ZUSA 4F7PA 3OXRA 5EFIA 4JQVA 3SJVA 5MERA 2X4SA 3DBXA 1LP9A 4PJ8A 1KJVA 2HN7A 4HUWA 3QUKA 3FRUA 4NO2A 1KBGH 3G08A 3MGOA 4JFQA 3TZVC 4CVZA 3KPLA 2X4RA 5IM7A 3RWEA 2HJKA 3KPOA 5DEGA 2ZSVA 3DXAA 1N5AA 3SDDA 4PGEA 3P4NA 4Y4FA 2FIKA 1I1FA 4N0UA 1RK0A 2BCKA 1ZHLA 1HSBA 3KXFA 4G43A 2AKRA 3VXOA 3QQ3A 3KPRA 4F7MA 5C0JA 1VADA 3O4LA 5C08A 5ISZA 4FTVA 3GMQA 3D3VA 2V2XA 4LCCC 5J6GA 3SDXA 3WUWA 3C8KA 1XR9A 4JRXA 1I7TA 3H7BA 3O9WA 4XXCA 5L2JA 1TVHA 3VXUA 5D7LA 5E8NA 5DDHA 2ESVA 1KPRA 3MRHA 4U1HA 3VFWA 1QR1A 1RJZA 3UPRA 5H94A 5J6HA 4PV9A 5D5MA 4JO8A 5ACZA 5EUOA 2YPKA 1FZMA 3GSWA 5C07A 5C9JA 4L9LC 3DX8A 1LEGA 4G42A 1E28A 2ZOLA 4EN3C 2WY3A 3OX8A 2BVOA 4I48A 5SWQA 2ZOKA 3MREA 2P5EA 3L3DA 2FO4A 4JQXA 2CLRA 4D0DA 4L3CA 1MWAH 3FQWA 1XR8A 4WJ5A 4G59C 3FQTA 4V3EB 1KCGC 3ROOA 4L8CA 2X4UA 3QDMA 3O3AA 5F1NA 4F7CA 4QOKA 1I1AA 3RWHA 1T80A 1HHKA 4ELMA 3FFCA 3SKMA 3JVGA 4G8GA 3VFTA 4MXQA 5BS0A 1OSZA 3TPUE 3B6SA 3GSXA 3PWVA 3QQ4A 4K7FA 1ZHKA 4X6DA 4LCWA 3LKQA 2GT9A 2F74A 5HHQA 1VGKA 1B0GA 1UQSA 3CVHA 4HUVA 2GTWA 1A9EA 2CLVA 1S7SA 2CIIA 4U1IA 4PJAA 3OV6A 3RWJA 4ZUWA 1EXUA 3TBTA 3DMMA 3TIEA 3H9SA 3NFNA 1FZOA 4PRBA 5MEQA 3BO8A 3CDGA 2F53A 2OI9A 3KYNA 4NQDA 1YN7A 3L3HA 1FFOA 1Z5LA 5GSRA 3GIVA 1ZHBA 3CPLA 2X4OA 4F7EA 5C09A 3C9NA 3SCMA 3VWJA 1KJ2H 3RTQA 5BXFA 4MJIA 5HGBA 4N0CA 4U1NA 2OL3H 5C0GA 1QLFA 1S7XA 4PRDA 1INQA 1MHEA 3BH8A 5D2LA 4JFFA 1IM9A 5E8OA 3MRFA 4O2CA 5IB5A 1SYVA 1HHHA 2BNQA 1OGAA 2VAAA 1W72A 1LEKA 2NW3A 1XH3A 3PWLA 1UXSA 4QRTA 3FT2A 3WLBA 5HHOA 3BP4A 4PJGA 3L3GA 4NQVA 1HHIA 1T0NA 1ZSDA 1QEWA 1AGDA 1XZ0A 2UWEA 5IB4A 1S9WA 3VH8A 1ZHNA 4L4TA 3IT8D 1CG9A 3DX6A 5SWZA 3VFSA 4Y4KA 3MRNA 5HGAA 2P5WA 5MEOA 4U1LA 3E3QA 1NANH 4Y4HA 4CVXA 3RUGA 3L3IA 4NHUE 3TIDA 1I1YA 1NEZA 4NSKA 1L8JA 1AKJA 2X4TA 1T1XA 1A1MA 3U0PA 4L29A 4PJFA 4WU5A 3TO4A 1DUYA 4UQ3A 1G7QA 1ZT4A 1WBXA 1ZAGA 3TBYA 5MENA 2BVPA 3ILQC 1FFPA 3BGMA 4QRQA 2V2WA 2AK4A 2VLRA 3QI9A 4LNRA 1MHCA 1S7RA 5IROA 4NT6A 1A1OA 2X4QA 4WUUA 4X6EA 5E00A 3FONA 4O2EA 1ED3A 3BUYA 3JTTA 4G59A 4IHOA 3VXMA 4JFEA 5BJTA 2GITA 3BW9A 4X6FA 5D7IA 1HYRC 4PREA 2AXFA 3MROA 1ZS8A 1T1ZA 3RWCA 3GMOA 3CCHA 3VCLA 4K71B 5D2NA 1TMCA 4ZFZA 4HWZA 1S7QA 4NQCA 1KJMA 3FOLA 3MA7A 3QDJA 1T7ZA 1BD2A 4PRNA 3FQNA 1VACA 2AV1A 4MX7A 3IXAA 3E6HA 3HE7A 3ARDA 1CD1A 1FZJA 3MYJA 1FO0H 4JFPA 3QUXA 4O2FA 3FQUA 2VLLA 3LKSA 2GUOA 4PGCA 5C0EA 4MQ7A 1N2RA 4D0BA 4PJBA 4U1KA 3OXSA 3TFKA 2X4NA 3BZFA 3UTTA 3BEVA 3MRRA 3P77A 1EEZA 3PWPA 4JFOA 2NYKA 4MNQA 2VABA
chains in the Genus database with same CATH topology
3V5KA 1LK2A 3MRLA 3MRJA 4N5EA 5E6IC 2RFXA 3RGVC 5C0AA 3MRCA 3GSRA 4APQA 4JFDA 4MNGA 1BQHA 1T7VA 3CH1A 3HPJA 3X13A 1TVBA 1AO7A 1JPGA 3LKPA 1ZT7A 1I7UA 1G6RH 3CZFA 3PWJA 1DDHA 1T7YA 3VXSA 4HX1A 5HHPA 5IEHA 3GSVA 4NQEA 1QVOA 3P4OA 5C0CA 3I6LD 5HYJA 4I4WA 1S9XA 4PP8C 1FZKA 3MRBA 3VJ6A 3MR9A 3KPMA 1KJ3H 4HS3A 4Z78A 2BSSA 3M1BA 2Q7YA 5E8PA 5FA3A 4GKNA 1HOCA 5EU4A 1DUZA 3T1FA 3VFMA 3VFUA 5DEFA 2D31A 2VLKA 3X12A 1E27A 3HCVA 1A1NA 3MGTA 4NNXA 3X14A 3BH9A 3KYOA 3P73A 4ZUVA 1T1WA 3VFNA 2NX5A 1AGFA 3O3DA 4NNYA 4QRRA 1B3JA 1QQDA 4U1MA 2ZSWA 2YPLA 1AGCA 5ENWA 3FTGA 5AD0A 3LN4A 1HHGA 1M6OA 3QEQA 4PG2A 1KPUA 1U58A 4PJXA 3UBXA 3PWUA 4PRAA 2MHAA 4U6XA 5IEKA 2HJLA 3AM8A 2GTZA 4WO4A 3QULA 3FT4A 3I6KA 4N8VA 1A6ZA 3TBWA 3GSOA 1JHTA 2BNRA 5F1IA 3GSQA 1JGEA 3RL1A 3BVNA 3BHBA 4PJ9A 5D7JC 4PDCE 3V5HA 2BSTA 3BP7A 1YDPA 1WBYA 3FT3A 3MV9A 1A9BA 3RZCA 1UXWA 2PYEA 3KWWA 1P4LA 3ILPA 3KLAA 3SPVA 3PWNA 3GMPA 3VRIA 5FDWA 2AV7A 1JPFA 3BXNA 4MS8A 3AREA 3MRGA 1OF2A 2JCCA 3WS3A 1G7PA 4CW1A 3MRDA 3QUZA 4NQXA 5FKPA 4IRSA 1JFMA 1JUFA 3RWFA 3MRQA 4MVBA 5GSVA 5INCA 2CLZA 3ARGA 3SDCA 3TN0A 3VFVA 1QO3A 4WWKC 5SWSA 4QRPA 3QDGA 1T20A 3LV3A 1OGTA 1T1YA 2VE6A 2YEZA 3QFJA 1X7QA 3GMMA 1PQZA 4QRSA 5FA4A 4D0CA 2J8UA 2A83A 1T7XA 1FFNA 3ERYA 1DE4A 4PJDA 4NO3A 2FWOA 3TO2A 3W39A 4G8IA 1LD9A 5JHDA 1P7QA 1Q94A 4GUPA 3X11A 3PQYA 5C0DA 2CIKA 4ONOA 1NAMH 1YPZA 3FQXA 1I7RA 3H9HA 3SDAA 4E0RA 4PGDA 4L4VA 1W0VA 4UQ2A 3TF7A 1WBZA 2H26A 3KPPA 3RWDA 3HAEA 2BVQA 3BWAA 3HLAA 3MRMA 3RL2A 1S9YA 3VXPA 3O3EA 5C0FA 1EFXA 4MJ5A 4PJ5A 1JF1A 4Z77A 4PJEA 4IIQC 3MRPA 3LKNA 2E7LE 4Y16A 1FG2A 3CC5A 3TVMA 3GSUA 1BZ9A 2DYPA 3ES6A 4GKSA 4PRPA 3VWKA 1ONQA 4U1JA 4WU7A 1C16A 5BRZA 3V5DA 4ZUUA 3M17A 3T8XA 3BEWA 3VFOA 4QRUA 1YN6A 3VXNA 4PJCA 2AXGA 3DTXA 1T0MA 3REWA 1N3NA 2GJ6A 4Z76A 1K8DA 3ARBA 3P9MA 5IB2A 3KPNA 4FFEX 3TJHA 5E9DA 4L8SC 4NO5A 4PRIA 3SKOA 3UTQA 1QSFA 2GAZA 4HUXA 3AU1A 5C0BA 1QSEA 2FYYA 3TBSA 2PO6A 4PGBA 4S0UC 3P4MA 4PV8A 1HHJA 3LN5A 4G9DA 5F9JA 4PJHA 3RWIA 3VFPA 1N59A 3FQRA 2X4PA 5EU5A 3QFDA 1LQVA 1ZT1A 5EO0A 5EU6A 4Y2DA 4LCYA 4HUUA 3L9RA 1SYSA 5EU3A 1HSAA 3D2UA 1P1ZA 1RK1A 3HG1A 4L8BA 4L8DA 4ZUTA 5C0IA 4IRJA 4PR5A 2XPGA 4HV8A 3B3IA 4WW2C 4JRYA 3O3BA 3O8XA 1QRNA 3VXRA 5HGHA 1S8DA 4EI5A 4U6YA 5EOTA 3UTSA 1CE6A 3KPQA 3VRJA 5IVXA 2F54A 4G9FA 3I6GA 5MEPA 1JGDA 2VLJA 4PJ7A 5IB1A 5D9SA 4ZAKA 4PG9A 3E2HA 3D25A 3QUYA 3GSNH 1S7WA 2BSRA 1S7TA 1ZVSA 3MV7A 4HKJA 5HHMA 3TBVA 3GMLA 5EO1A 4NO0A 3GMNA 3LKOA 3W0WA 3MRIA 4PJIA 4PRHA 3GJFA 4MJ6A 3RWGA 4E5XA 3HE6A 1I4FA 1S7VA 4LHUA 3LKRA 2H6PA 5L2KA 3PABA 1T21A 4V3DB 3DX7A 3QZWA 5INDA 3KPSA 1RJYA 1EEYA 1S7UA 2X70A 2CKBH 1JE6A 4WDIA 3WL9A 3MV8A 3VFRA 4EUPA 5B39A 5IB3A 1W0WA 2C7UA 4L3EA 5HHNA 2XFXA 1GZQA 1MI5A 4N0FA 1GZPA 1R3HA 2HLAA 3GMRA 1T22A 5HGDA 3HUJA 4F7TA 3D18A 3ROLA 3L3JA 3BZEA 3ECBA 3JTSA 3TA3A 1AGBA 1B0RA 3L3KA 3MRKA 4U1SA 3E6FA 3FOMA 1M05A 3WS6A 5B38A 3ARFA 3S6CA 1IM3A 3JTCA 1AGEA 1LDPH 2FZ3A 1KPVA 4X6CA 1K5NA 5F7DA 3P9LA 1KTLA 1T7WA 5J1AA 3D39A 1BIIA 4ZUSA 4F7PA 3OXRA 5EFIA 4JQVA 3SJVA 5MERA 2X4SA 3DBXA 1LP9A 4PJ8A 1KJVA 2HN7A 4HUWA 3QUKA 3FRUA 4NO2A 1KBGH 3G08A 3MGOA 4JFQA 3TZVC 4CVZA 3KPLA 2X4RA 5IM7A 3RWEA 2HJKA 3KPOA 5DEGA 2ZSVA 3DXAA 1N5AA 3SDDA 4PGEA 3P4NA 4Y4FA 2FIKA 1I1FA 4N0UA 1RK0A 2BCKA 1ZHLA 1HSBA 3KXFA 4G43A 2AKRA 3VXOA 3QQ3A 3KPRA 4F7MA 5C0JA 1VADA 3O4LA 5C08A 5ISZA 4FTVA 3GMQA 3D3VA 2V2XA 4LCCC 5J6GA 3SDXA 3WUWA 3C8KA 1XR9A 4JRXA 1I7TA 3H7BA 3O9WA 4XXCA 5L2JA 1TVHA 3VXUA 5D7LA 5E8NA 5DDHA 2ESVA 1KPRA 3MRHA 4U1HA 3VFWA 1QR1A 1RJZA 3UPRA 5H94A 5J6HA 4PV9A 5D5MA 5ACZA 5EUOA 2YPKA 1FZMA 3GSWA 5C07A 5C9JA 4L9LC 3DX8A 1LEGA 4G42A 1E28A 2ZOLA 4EN3C 2WY3A 3OX8A 2BVOA 4I48A 5SWQA 2ZOKA 3MREA 2P5EA 3L3DA 2FO4A 4JQXA 2CLRA 4D0DA 4L3CA 1MWAH 3FQWA 1XR8A 4WJ5A 3FQTA 4V3EB 1KCGC 3ROOA 4L8CA 2X4UA 3QDMA 3O3AA 5F1NA 4F7CA 4QOKA 1I1AA 3RWHA 1T80A 1HHKA 4ELMA 3FFCA 3SKMA 3JVGA 4G8GA 3VFTA 4MXQA 5BS0A 1OSZA 3TPUE 3B6SA 3GSXA 3PWVA 3QQ4A 4K7FA 1ZHKA 4X6DA 4LCWA 3LKQA 2GT9A 2F74A 5HHQA 1VGKA 1B0GA 1UQSA 3CVHA 4HUVA 2GTWA 1A9EA 2CLVA 1S7SA 2CIIA 4U1IA 4PJAA 3OV6A 3RWJA 4ZUWA 1EXUA 3TBTA 3DMMA 3TIEA 3H9SA 3NFNA 1FZOA 4PRBA 5MEQA 3BO8A 3CDGA 2F53A 2OI9A 3KYNA 4NQDA 1YN7A 3L3HA 1FFOA 1Z5LA 5GSRA 3GIVA 1ZHBA 3CPLA 2X4OA 4F7EA 5C09A 3C9NA 3SCMA 3VWJA 1KJ2H 3RTQA 5BXFA 4MJIA 5HGBA 4N0CA 4U1NA 2OL3H 5C0GA 1QLFA 1S7XA 4PRDA 1INQA 1MHEA 3BH8A 5D2LA 4JFFA 1IM9A 5E8OA 3MRFA 4O2CA 5IB5A 1SYVA 1HHHA 2BNQA 1OGAA 2VAAA 1W72A 1LEKA 2NW3A 1XH3A 3PWLA 1UXSA 4QRTA 3FT2A 3WLBA 5HHOA 3BP4A 4PJGA 3L3GA 4NQVA 1HHIA 1T0NA 1ZSDA 1QEWA 1AGDA 1XZ0A 2UWEA 5IB4A 1S9WA 3VH8A 1ZHNA 4L4TA 3IT8D 1CG9A 3DX6A 5SWZA 3VFSA 4Y4KA 3MRNA 5HGAA 2P5WA 5MEOA 4U1LA 3E3QA 1NANH 4Y4HA 4CVXA 3RUGA 3L3IA 4NHUE 3TIDA 1I1YA 1NEZA 4NSKA 1L8JA 1AKJA 2X4TA 1T1XA 1A1MA 3U0PA 4L29A 4PJFA 4WU5A 3TO4A 1DUYA 4UQ3A 1G7QA 1ZT4A 1WBXA 1ZAGA 3TBYA 5MENA 2BVPA 3ILQC 1FFPA 3BGMA 4QRQA 2V2WA 2AK4A 2VLRA 3QI9A 4LNRA 1MHCA 1S7RA 5IROA 4NT6A 1A1OA 2X4QA 4WUUA 4X6EA 5E00A 3FONA 4O2EA 1ED3A 3BUYA 3JTTA 4G59A 4IHOA 3VXMA 4JFEA 5BJTA 2GITA 3BW9A 4X6FA 5D7IA 1HYRC 4PREA 2AXFA 3MROA 1ZS8A 1T1ZA 3RWCA 3GMOA 3CCHA 3VCLA 4K71B 5D2NA 1TMCA 4ZFZA 4HWZA 1S7QA 4NQCA 1KJMA 3FOLA 3MA7A 3QDJA 1T7ZA 1BD2A 4PRNA 3FQNA 1VACA 2AV1A 4MX7A 3IXAA 3E6HA 3HE7A 3ARDA 1CD1A 1FZJA 3MYJA 1FO0H 4JFPA 3QUXA 4O2FA 3FQUA 2VLLA 3LKSA 2GUOA 4PGCA 5C0EA 4MQ7A 1N2RA 4D0BA 4PJBA 4U1KA 3OXSA 3TFKA 2X4NA 3BZFA 3UTTA 3BEVA 3MRRA 3P77A 1EEZA 3PWPA 4JFOA 4MNQA 2VABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5K A;  1LK2 A;  3MRL A;  3MRJ A;  4N5E A;  5E6I C;  2RFX A;  3RGV C;  5C0A A;  3MRC A;  3GSR A;  4APQ A;  4JFD A;  4MNG A;  1BQH A;  1T7V A;  3CH1 A;  3HPJ A;  3X13 A;  1TVB A;  1AO7 A;  1JPG A;  3LKP A;  1ZT7 A;  1I7U A;  1G6R H;  3CZF A;  3PWJ A;  1DDH A;  1T7Y A;  3VXS A;  4HX1 A;  5HHP A;  5IEH A;  3GSV A;  4NQE A;  1QVO A;  3P4O A;  5C0C A;  3I6L D;  5HYJ A;  4I4W A;  1S9X A;  4PP8 C;  1FZK A;  3MRB A;  3VJ6 A;  3MR9 A;  3KPM A;  1KJ3 H;  4HS3 A;  4Z78 A;  2BSS A;  3M1B A;  2Q7Y A;  5E8P A;  5FA3 A;  4GKN A;  1HOC A;  5EU4 A;  1DUZ A;  3T1F A;  3VFM A;  3VFU A;  5DEF A;  2D31 A;  2VLK A;  3X12 A;  1E27 A;  3HCV A;  1A1N A;  3MGT A;  4NNX A;  3X14 A;  3BH9 A;  3KYO A;  3P73 A;  4ZUV A;  1T1W A;  3VFN A;  2NX5 A;  1AGF A;  3O3D A;  4NNY A;  4QRR A;  1B3J A;  1QQD A;  4U1M A;  2ZSW A;  2YPL A;  1AGC A;  5ENW A;  3FTG A;  5AD0 A;  3LN4 A;  1HHG A;  1M6O A;  3QEQ A;  4PG2 A;  1KPU A;  1U58 A;  4PJX A;  3UBX A;  3PWU A;  4PRA A;  2MHA A;  4U6X A;  5IEK A;  2HJL A;  3AM8 A;  2GTZ A;  4WO4 A;  3QUL A;  3FT4 A;  3I6K A;  4N8V A;  1A6Z A;  3TBW A;  3GSO A;  1JHT A;  2BNR A;  5F1I A;  3GSQ A;  1JGE A;  3RL1 A;  3BVN A;  3BHB A;  4PJ9 A;  5D7J C;  4PDC E;  3V5H A;  2BST A;  3BP7 A;  1YDP A;  1WBY A;  3FT3 A;  3MV9 A;  1A9B A;  3RZC A;  1UXW A;  2PYE A;  3KWW A;  1P4L A;  3ILP A;  3KLA A;  3SPV A;  3PWN A;  3GMP A;  3VRI A;  5FDW A;  2AV7 A;  1JPF A;  3BXN A;  4MS8 A;  3ARE A;  3MRG A;  1OF2 A;  2JCC A;  3WS3 A;  1G7P A;  4CW1 A;  3MRD A;  3QUZ A;  4NQX A;  5FKP A;  4IRS A;  1JFM A;  1JUF A;  3RWF A;  3MRQ A;  4MVB A;  5GSV A;  5INC A;  2CLZ A;  3ARG A;  3SDC A;  3TN0 A;  3VFV A;  1QO3 A;  4WWK C;  5SWS A;  4QRP A;  3QDG A;  1T20 A;  3LV3 A;  1OGT A;  1T1Y A;  2VE6 A;  2YEZ A;  3QFJ A;  1X7Q A;  3GMM A;  1PQZ A;  4QRS A;  5FA4 A;  4D0C A;  2J8U A;  2A83 A;  1T7X A;  1FFN A;  3ERY A;  1DE4 A;  4PJD A;  4NO3 A;  2FWO A;  3TO2 A;  3W39 A;  4G8I A;  1LD9 A;  5JHD A;  1P7Q A;  1Q94 A;  4GUP A;  3X11 A;  3PQY A;  5C0D A;  2CIK A;  4ONO A;  1NAM H;  1YPZ A;  3FQX A;  1I7R A;  3H9H A;  3SDA A;  4E0R A;  4PGD A;  4L4V A;  1W0V A;  4UQ2 A;  3TF7 A;  1WBZ A;  2H26 A;  3KPP A;  3RWD A;  3HAE A;  2BVQ A;  3BWA A;  3HLA A;  3MRM A;  3RL2 A;  1S9Y A;  3VXP A;  3O3E A;  5C0F A;  1EFX A;  4MJ5 A;  4PJ5 A;  1JF1 A;  4Z77 A;  4PJE A;  4IIQ C;  3MRP A;  3LKN A;  2E7L E;  4Y16 A;  1FG2 A;  3CC5 A;  3TVM A;  3GSU A;  1BZ9 A;  2DYP A;  3ES6 A;  4GKS A;  4PRP A;  3VWK A;  1ONQ A;  4U1J A;  4WU7 A;  1C16 A;  5BRZ A;  3V5D A;  4ZUU A;  3M17 A;  3T8X A;  3BEW A;  3VFO A;  4QRU A;  1YN6 A;  3VXN A;  4PJC A;  2AXG A;  3DTX A;  1T0M A;  3REW A;  1N3N A;  2GJ6 A;  4Z76 A;  1K8D A;  3ARB A;  3P9M A;  5IB2 A;  3KPN A;  4FFE X;  3TJH A;  5E9D A;  4L8S C;  4NO5 A;  4PRI A;  3SKO A;  3UTQ A;  1QSF A;  2GAZ A;  4HUX A;  3AU1 A;  5C0B A;  1QSE A;  2FYY A;  3TBS A;  2PO6 A;  4PGB A;  4S0U C;  3P4M A;  4PV8 A;  1HHJ A;  3LN5 A;  4G9D A;  5F9J A;  4PJH A;  3RWI A;  3VFP A;  1N59 A;  3FQR A;  2X4P A;  5EU5 A;  3QFD A;  1LQV A;  1ZT1 A;  5EO0 A;  5EU6 A;  4Y2D A;  4LCY A;  4HUU A;  3L9R A;  1SYS A;  5EU3 A;  1HSA A;  3D2U A;  1P1Z A;  1RK1 A;  3HG1 A;  4L8B A;  4L8D A;  4ZUT A;  5C0I A;  4IRJ A;  4PR5 A;  2XPG A;  4HV8 A;  3B3I A;  4WW2 C;  4JRY A;  3O3B A;  3O8X A;  1QRN A;  3VXR A;  5HGH A;  1S8D A;  4EI5 A;  4U6Y A;  5EOT A;  3UTS A;  1CE6 A;  3KPQ A;  3VRJ A;  5IVX A;  2F54 A;  4G9F A;  3I6G A;  5MEP A;  1JGD A;  2VLJ A;  4PJ7 A;  5IB1 A;  5D9S A;  4ZAK A;  4PG9 A;  3E2H A;  3D25 A;  3QUY A;  3GSN H;  1S7W A;  2BSR A;  1S7T A;  1ZVS A;  3MV7 A;  4HKJ A;  5HHM A;  3TBV A;  3GML A;  5EO1 A;  4NO0 A;  3GMN A;  3LKO A;  3W0W A;  3MRI A;  4PJI A;  4PRH A;  3GJF A;  4MJ6 A;  3RWG A;  4E5X A;  3HE6 A;  1I4F A;  1S7V A;  4LHU A;  3LKR A;  2H6P A;  5L2K A;  3PAB A;  1T21 A;  4V3D B;  3DX7 A;  3QZW A;  5IND A;  3KPS A;  1RJY A;  1EEY A;  1S7U A;  2X70 A;  2CKB H;  1JE6 A;  4WDI A;  3WL9 A;  3MV8 A;  3VFR A;  4EUP A;  5B39 A;  5IB3 A;  1W0W A;  2C7U A;  4L3E A;  5HHN A;  2XFX A;  1GZQ A;  1MI5 A;  4N0F A;  1GZP A;  1R3H A;  2HLA A;  3GMR A;  1T22 A;  5HGD A;  3HUJ A;  4F7T A;  3D18 A;  3ROL A;  3L3J A;  3BZE A;  3ECB A;  3JTS A;  3TA3 A;  1AGB A;  1B0R A;  3L3K A;  3MRK A;  4U1S A;  3E6F A;  3FOM A;  1M05 A;  3WS6 A;  5B38 A;  3ARF A;  3S6C A;  1IM3 A;  3JTC A;  1AGE A;  1LDP H;  2FZ3 A;  1KPV A;  4X6C A;  1K5N A;  5F7D A;  3P9L A;  1KTL A;  1T7W A;  5J1A A;  3D39 A;  1BII A;  4ZUS A;  4F7P A;  3OXR A;  5EFI A;  4JQV A;  3SJV A;  5MER A;  2X4S A;  3DBX A;  1LP9 A;  4PJ8 A;  1KJV A;  2HN7 A;  4HUW A;  3QUK A;  3FRU A;  4NO2 A;  1KBG H;  3G08 A;  3MGO A;  4JFQ A;  3TZV C;  4CVZ A;  3KPL A;  2X4R A;  5IM7 A;  3RWE A;  2HJK A;  3KPO A;  5DEG A;  2ZSV A;  3DXA A;  1N5A A;  3SDD A;  4PGE A;  3P4N A;  4Y4F A;  2FIK A;  1I1F A;  4N0U A;  1RK0 A;  2BCK A;  1ZHL A;  1HSB A;  3KXF A;  4G43 A;  2AKR A;  3VXO A;  3QQ3 A;  3KPR A;  4F7M A;  5C0J A;  1VAD A;  3O4L A;  5C08 A;  5ISZ A;  4FTV A;  3GMQ A;  3D3V A;  2V2X A;  4LCC C;  5J6G A;  3SDX A;  3WUW A;  3C8K A;  1XR9 A;  4JRX A;  1I7T A;  3H7B A;  3O9W A;  4XXC A;  5L2J A;  1TVH A;  3VXU A;  5D7L A;  5E8N A;  5DDH A;  2ESV A;  1KPR A;  3MRH A;  4U1H A;  3VFW A;  1QR1 A;  1RJZ A;  3UPR A;  5H94 A;  5J6H A;  4PV9 A;  5D5M A;  5ACZ A;  5EUO A;  2YPK A;  1FZM A;  3GSW A;  5C07 A;  5C9J A;  4L9L C;  3DX8 A;  1LEG A;  4G42 A;  1E28 A;  2ZOL A;  4EN3 C;  2WY3 A;  3OX8 A;  2BVO A;  4I48 A;  5SWQ A;  2ZOK A;  3MRE A;  2P5E A;  3L3D A;  2FO4 A;  4JQX A;  2CLR A;  4D0D A;  4L3C A;  1MWA H;  3FQW A;  1XR8 A;  4WJ5 A;  3FQT A;  4V3E B;  1KCG C;  3ROO A;  4L8C A;  2X4U A;  3QDM A;  3O3A A;  5F1N A;  4F7C A;  4QOK A;  1I1A A;  3RWH A;  1T80 A;  1HHK A;  4ELM A;  3FFC A;  3SKM A;  3JVG A;  4G8G A;  3VFT A;  4MXQ A;  5BS0 A;  1OSZ A;  3TPU E;  3B6S A;  3GSX A;  3PWV A;  3QQ4 A;  4K7F A;  1ZHK A;  4X6D A;  4LCW A;  3LKQ A;  2GT9 A;  2F74 A;  5HHQ A;  1VGK A;  1B0G A;  1UQS A;  3CVH A;  4HUV A;  2GTW A;  1A9E A;  2CLV A;  1S7S A;  2CII A;  4U1I A;  4PJA A;  3OV6 A;  3RWJ A;  4ZUW A;  1EXU A;  3TBT A;  3DMM A;  3TIE A;  3H9S A;  3NFN A;  1FZO A;  4PRB A;  5MEQ A;  3BO8 A;  3CDG A;  2F53 A;  2OI9 A;  3KYN A;  4NQD A;  1YN7 A;  3L3H A;  1FFO A;  1Z5L A;  5GSR A;  3GIV A;  1ZHB A;  3CPL A;  2X4O A;  4F7E A;  5C09 A;  3C9N A;  3SCM A;  3VWJ A;  1KJ2 H;  3RTQ A;  5BXF A;  4MJI A;  5HGB A;  4N0C A;  4U1N A;  2OL3 H;  5C0G A;  1QLF A;  1S7X A;  4PRD A;  1INQ A;  1MHE A;  3BH8 A;  5D2L A;  4JFF A;  1IM9 A;  5E8O A;  3MRF A;  4O2C A;  5IB5 A;  1SYV A;  1HHH A;  2BNQ A;  1OGA A;  2VAA A;  1W72 A;  1LEK A;  2NW3 A;  1XH3 A;  3PWL A;  1UXS A;  4QRT A;  3FT2 A;  3WLB A;  5HHO A;  3BP4 A;  4PJG A;  3L3G A;  4NQV A;  1HHI A;  1T0N A;  1ZSD A;  1QEW A;  1AGD A;  1XZ0 A;  2UWE A;  5IB4 A;  1S9W A;  3VH8 A;  1ZHN A;  4L4T A;  3IT8 D;  1CG9 A;  3DX6 A;  5SWZ A;  3VFS A;  4Y4K A;  3MRN A;  5HGA A;  2P5W A;  5MEO A;  4U1L A;  3E3Q A;  1NAN H;  4Y4H A;  4CVX A;  3RUG A;  3L3I A;  4NHU E;  3TID A;  1I1Y A;  1NEZ A;  4NSK A;  1L8J A;  1AKJ A;  2X4T A;  1T1X A;  1A1M A;  3U0P A;  4L29 A;  4PJF A;  4WU5 A;  3TO4 A;  1DUY A;  4UQ3 A;  1G7Q A;  1ZT4 A;  1WBX A;  1ZAG A;  3TBY A;  5MEN A;  2BVP A;  3ILQ C;  1FFP A;  3BGM A;  4QRQ A;  2V2W A;  2AK4 A;  2VLR A;  3QI9 A;  4LNR A;  1MHC A;  1S7R A;  5IRO A;  4NT6 A;  1A1O A;  2X4Q A;  4WUU A;  4X6E A;  5E00 A;  3FON A;  4O2E A;  1ED3 A;  3BUY A;  3JTT A;  4G59 A;  4IHO A;  3VXM A;  4JFE A;  5BJT A;  2GIT A;  3BW9 A;  4X6F A;  5D7I A;  1HYR C;  4PRE A;  2AXF A;  3MRO A;  1ZS8 A;  1T1Z A;  3RWC A;  3GMO A;  3CCH A;  3VCL A;  4K71 B;  5D2N A;  1TMC A;  4ZFZ A;  4HWZ A;  1S7Q A;  4NQC A;  1KJM A;  3FOL A;  3MA7 A;  3QDJ A;  1T7Z A;  1BD2 A;  4PRN A;  3FQN A;  1VAC A;  2AV1 A;  4MX7 A;  3IXA A;  3E6H A;  3HE7 A;  3ARD A;  1CD1 A;  1FZJ A;  3MYJ A;  1FO0 H;  4JFP A;  3QUX A;  4O2F A;  3FQU A;  2VLL A;  3LKS A;  2GUO A;  4PGC A;  5C0E A;  4MQ7 A;  1N2R A;  4D0B A;  4PJB A;  4U1K A;  3OXS A;  3TFK A;  2X4N A;  3BZF A;  3UTT A;  3BEV A;  3MRR A;  3P77 A;  1EEZ A;  3PWP A;  4JFO A;  4MNQ A;  2VAB A; 
#chains in the Genus database with same CATH topology
 3V5K A;  1LK2 A;  3MRL A;  3MRJ A;  4N5E A;  5E6I C;  2RFX A;  3RGV C;  5C0A A;  3MRC A;  3GSR A;  4APQ A;  4JFD A;  4MNG A;  1BQH A;  1T7V A;  3CH1 A;  3HPJ A;  3X13 A;  1TVB A;  1AO7 A;  1JPG A;  3LKP A;  1ZT7 A;  1I7U A;  1G6R H;  3CZF A;  3PWJ A;  1DDH A;  1T7Y A;  3VXS A;  4HX1 A;  5HHP A;  5IEH A;  3GSV A;  4NQE A;  1QVO A;  3P4O A;  5C0C A;  3I6L D;  5HYJ A;  4I4W A;  1S9X A;  4PP8 C;  1FZK A;  3MRB A;  3VJ6 A;  3MR9 A;  3KPM A;  1KJ3 H;  4HS3 A;  4Z78 A;  2BSS A;  3M1B A;  2Q7Y A;  5E8P A;  5FA3 A;  4GKN A;  1HOC A;  5EU4 A;  1DUZ A;  3T1F A;  3VFM A;  3VFU A;  5DEF A;  2D31 A;  2VLK A;  3X12 A;  1E27 A;  3HCV A;  1A1N A;  3MGT A;  4NNX A;  3X14 A;  3BH9 A;  3KYO A;  3P73 A;  4ZUV A;  1T1W A;  3VFN A;  2NX5 A;  1AGF A;  3O3D A;  4NNY A;  4QRR A;  1B3J A;  1QQD A;  4U1M A;  2ZSW A;  2YPL A;  1AGC A;  5ENW A;  3FTG A;  5AD0 A;  3LN4 A;  1HHG A;  1M6O A;  3QEQ A;  4PG2 A;  1KPU A;  1U58 A;  4PJX A;  3UBX A;  3PWU A;  4PRA A;  2MHA A;  4U6X A;  5IEK A;  2HJL A;  3AM8 A;  2GTZ A;  4WO4 A;  3QUL A;  3FT4 A;  3I6K A;  4N8V A;  1A6Z A;  3TBW A;  3GSO A;  1JHT A;  2BNR A;  5F1I A;  3GSQ A;  1JGE A;  3RL1 A;  3BVN A;  3BHB A;  4PJ9 A;  5D7J C;  4PDC E;  3V5H A;  2BST A;  3BP7 A;  1YDP A;  1WBY A;  3FT3 A;  3MV9 A;  1A9B A;  3RZC A;  1UXW A;  2PYE A;  3KWW A;  1P4L A;  3ILP A;  3KLA A;  3SPV A;  3PWN A;  3GMP A;  3VRI A;  5FDW A;  2AV7 A;  1JPF A;  3BXN A;  4MS8 A;  3ARE A;  3MRG A;  1OF2 A;  2JCC A;  3WS3 A;  1G7P A;  4CW1 A;  3MRD A;  3QUZ A;  4NQX A;  5FKP A;  4IRS A;  1JFM A;  1JUF A;  3RWF A;  3MRQ A;  4MVB A;  5GSV A;  5INC A;  2CLZ A;  3ARG A;  3SDC A;  3TN0 A;  3VFV A;  1QO3 A;  4WWK C;  5SWS A;  4QRP A;  3QDG A;  1T20 A;  3LV3 A;  1OGT A;  1T1Y A;  2VE6 A;  2YEZ A;  3QFJ A;  1X7Q A;  3GMM A;  1PQZ A;  4QRS A;  5FA4 A;  4D0C A;  2J8U A;  2A83 A;  1T7X A;  1FFN A;  3ERY A;  1DE4 A;  4PJD A;  4NO3 A;  2FWO A;  3TO2 A;  3W39 A;  4G8I A;  1LD9 A;  5JHD A;  1P7Q A;  1Q94 A;  4GUP A;  3X11 A;  3PQY A;  5C0D A;  2CIK A;  4ONO A;  1NAM H;  1YPZ A;  3FQX A;  1I7R A;  3H9H A;  3SDA A;  4E0R A;  4PGD A;  4L4V A;  1W0V A;  4UQ2 A;  3TF7 A;  1WBZ A;  2H26 A;  3KPP A;  3RWD A;  3HAE A;  2BVQ A;  3BWA A;  3HLA A;  3MRM A;  3RL2 A;  1S9Y A;  3VXP A;  3O3E A;  5C0F A;  1EFX A;  4MJ5 A;  4PJ5 A;  1JF1 A;  4Z77 A;  4PJE A;  4IIQ C;  3MRP A;  3LKN A;  2E7L E;  4Y16 A;  1FG2 A;  3CC5 A;  3TVM A;  3GSU A;  1BZ9 A;  2DYP A;  3ES6 A;  4GKS A;  4PRP A;  3VWK A;  1ONQ A;  4U1J A;  4WU7 A;  1C16 A;  5BRZ A;  3V5D A;  4ZUU A;  3M17 A;  3T8X A;  3BEW A;  3VFO A;  4QRU A;  1YN6 A;  3VXN A;  4PJC A;  2AXG A;  3DTX A;  1T0M A;  3REW A;  1N3N A;  2GJ6 A;  4Z76 A;  1K8D A;  3ARB A;  3P9M A;  5IB2 A;  3KPN A;  4FFE X;  3TJH A;  5E9D A;  4L8S C;  4NO5 A;  4PRI A;  3SKO A;  3UTQ A;  1QSF A;  2GAZ A;  4HUX A;  3AU1 A;  5C0B A;  1QSE A;  3I0T A;  2FYY A;  3TBS A;  2PO6 A;  4PGB A;  4S0U C;  3P4M A;  4PV8 A;  1HHJ A;  3LN5 A;  4G9D A;  5F9J A;  4PJH A;  3RWI A;  3VFP A;  1N59 A;  3FQR A;  2X4P A;  5EU5 A;  3QFD A;  1LQV A;  1ZT1 A;  5EO0 A;  5EU6 A;  4Y2D A;  4LCY A;  4HUU A;  3L9R A;  1SYS A;  5EU3 A;  1HSA A;  3D2U A;  1P1Z A;  1RK1 A;  3HG1 A;  4L8B A;  4L8D A;  4ZUT A;  5C0I A;  4IRJ A;  4PR5 A;  2XPG A;  4HV8 A;  3B3I A;  4WW2 C;  4JRY A;  3O3B A;  3O8X A;  1QRN A;  3VXR A;  5HGH A;  1S8D A;  4EI5 A;  4U6Y A;  5EOT A;  3UTS A;  1CE6 A;  3KPQ A;  3VRJ A;  5IVX A;  2F54 A;  4G9F A;  3I6G A;  5MEP A;  1JGD A;  2VLJ A;  4PJ7 A;  5IB1 A;  5D9S A;  4ZAK A;  4PG9 A;  3E2H A;  3D25 A;  3QUY A;  3GSN H;  1S7W A;  2BSR A;  1S7T A;  1ZVS A;  3MV7 A;  4HKJ A;  5HHM A;  3TBV A;  3GML A;  5EO1 A;  4NO0 A;  3GMN A;  3LKO A;  3W0W A;  3MRI A;  4PJI A;  4PRH A;  3GJF A;  4MJ6 A;  3RWG A;  4E5X A;  3HE6 A;  1I4F A;  1S7V A;  4LHU A;  3LKR A;  2H6P A;  5L2K A;  3PAB A;  1T21 A;  4V3D B;  3DX7 A;  3QZW A;  5IND A;  3KPS A;  1RJY A;  1EEY A;  1S7U A;  2X70 A;  2CKB H;  1JE6 A;  4WDI A;  3WL9 A;  3MV8 A;  3VFR A;  4EUP A;  5B39 A;  2IA1 A;  1W0W A;  5IB3 A;  2C7U A;  4L3E A;  5HHN A;  2XFX A;  1GZQ A;  1MI5 A;  4N0F A;  1GZP A;  1R3H A;  2HLA A;  2O5N A;  3GMR A;  1T22 A;  5HGD A;  3HUJ A;  4F7T A;  3D18 A;  3ROL A;  3L3J A;  3BZE A;  3ECB A;  3JTS A;  3TA3 A;  1AGB A;  1B0R A;  3L3K A;  3MRK A;  4U1S A;  3E6F A;  3FOM A;  1M05 A;  3WS6 A;  5B38 A;  3ARF A;  3S6C A;  1IM3 A;  3JTC A;  1AGE A;  1LDP H;  2FZ3 A;  1KPV A;  4X6C A;  4BKW A;  1K5N A;  5F7D A;  3P9L A;  1KTL A;  1T7W A;  5J1A A;  3D39 A;  1BII A;  4ZUS A;  4F7P A;  3OXR A;  5EFI A;  4JQV A;  3SJV A;  5MER A;  2X4S A;  3DBX A;  1LP9 A;  4PJ8 A;  1KJV A;  2HN7 A;  4HUW A;  3QUK A;  3FRU A;  4NO2 A;  1KBG H;  3G08 A;  3MGO A;  4JFQ A;  3TZV C;  4CVZ A;  3KPL A;  2X4R A;  5IM7 A;  3RWE A;  2HJK A;  3KPO A;  5DEG A;  2ZSV A;  3DXA A;  1N5A A;  3SDD A;  4PGE A;  3P4N A;  4Y4F A;  2FIK A;  1I1F A;  4N0U A;  1RK0 A;  2BCK A;  1ZHL A;  1HSB A;  3KXF A;  4G43 A;  2AKR A;  3VXO A;  3QQ3 A;  3KPR A;  4F7M A;  5C0J A;  1VAD A;  3O4L A;  5C08 A;  5ISZ A;  4FTV A;  3GMQ A;  3D3V A;  2V2X A;  4LCC C;  5J6G A;  3SDX A;  3WUW A;  3C8K A;  1XR9 A;  4JRX A;  1I7T A;  3H7B A;  3O9W A;  4XXC A;  5L2J A;  1TVH A;  3VXU A;  5D7L A;  5E8N A;  5DDH A;  2ESV A;  1KPR A;  3MRH A;  4U1H A;  3VFW A;  1QR1 A;  1RJZ A;  3UPR A;  5H94 A;  5J6H A;  4PV9 A;  5D5M A;  4JO8 A;  5ACZ A;  5EUO A;  2YPK A;  1FZM A;  3GSW A;  5C07 A;  5C9J A;  4L9L C;  3DX8 A;  1LEG A;  4G42 A;  1E28 A;  2ZOL A;  4EN3 C;  2WY3 A;  3OX8 A;  2BVO A;  4I48 A;  5SWQ A;  2ZOK A;  3MRE A;  2P5E A;  3L3D A;  2FO4 A;  4JQX A;  2CLR A;  4D0D A;  4L3C A;  1MWA H;  3FQW A;  1XR8 A;  4WJ5 A;  4G59 C;  3FQT A;  4V3E B;  1KCG C;  3ROO A;  4L8C A;  2X4U A;  3QDM A;  3O3A A;  5F1N A;  4F7C A;  4QOK A;  1I1A A;  3RWH A;  1T80 A;  1HHK A;  4ELM A;  3FFC A;  3SKM A;  3JVG A;  4G8G A;  3VFT A;  4MXQ A;  5BS0 A;  1OSZ A;  3TPU E;  3B6S A;  3GSX A;  3PWV A;  3QQ4 A;  4K7F A;  1ZHK A;  4X6D A;  4LCW A;  3LKQ A;  2GT9 A;  2F74 A;  5HHQ A;  1VGK A;  1B0G A;  1UQS A;  3CVH A;  4HUV A;  2GTW A;  1A9E A;  2CLV A;  1S7S A;  2CII A;  4U1I A;  4PJA A;  3OV6 A;  3RWJ A;  4ZUW A;  1EXU A;  3TBT A;  3DMM A;  3TIE A;  3H9S A;  3NFN A;  1FZO A;  4PRB A;  5MEQ A;  3BO8 A;  3CDG A;  2F53 A;  2OI9 A;  3KYN A;  4NQD A;  1YN7 A;  3L3H A;  1FFO A;  1Z5L A;  5GSR A;  3GIV A;  1ZHB A;  3CPL A;  2X4O A;  4F7E A;  5C09 A;  3C9N A;  3SCM A;  3VWJ A;  1KJ2 H;  3RTQ A;  5BXF A;  4MJI A;  5HGB A;  4N0C A;  4U1N A;  2OL3 H;  5C0G A;  1QLF A;  1S7X A;  4PRD A;  1INQ A;  1MHE A;  3BH8 A;  5D2L A;  4JFF A;  1IM9 A;  5E8O A;  3MRF A;  4O2C A;  5IB5 A;  1SYV A;  1HHH A;  2BNQ A;  1OGA A;  2VAA A;  1W72 A;  1LEK A;  2NW3 A;  1XH3 A;  3PWL A;  1UXS A;  4QRT A;  3FT2 A;  3WLB A;  5HHO A;  3BP4 A;  4PJG A;  3L3G A;  4NQV A;  1HHI A;  1T0N A;  1ZSD A;  1QEW A;  1AGD A;  1XZ0 A;  2UWE A;  5IB4 A;  1S9W A;  3VH8 A;  1ZHN A;  4L4T A;  3IT8 D;  1CG9 A;  3DX6 A;  5SWZ A;  3VFS A;  4Y4K A;  3MRN A;  5HGA A;  2P5W A;  5MEO A;  4U1L A;  3E3Q A;  1NAN H;  4Y4H A;  4CVX A;  3RUG A;  3L3I A;  4NHU E;  3TID A;  1I1Y A;  1NEZ A;  4NSK A;  1L8J A;  1AKJ A;  2X4T A;  1T1X A;  1A1M A;  3U0P A;  4L29 A;  4PJF A;  4WU5 A;  3TO4 A;  1DUY A;  4UQ3 A;  1G7Q A;  1ZT4 A;  1WBX A;  1ZAG A;  3TBY A;  5MEN A;  2BVP A;  3ILQ C;  1FFP A;  3BGM A;  4QRQ A;  2V2W A;  2AK4 A;  2VLR A;  3QI9 A;  4LNR A;  1MHC A;  1S7R A;  5IRO A;  4NT6 A;  1A1O A;  2X4Q A;  4WUU A;  4X6E A;  5E00 A;  3FON A;  4O2E A;  1ED3 A;  3BUY A;  3JTT A;  4G59 A;  4IHO A;  3VXM A;  4JFE A;  5BJT A;  2GIT A;  3BW9 A;  4X6F A;  5D7I A;  1HYR C;  4PRE A;  2AXF A;  3MRO A;  1ZS8 A;  1T1Z A;  3RWC A;  3GMO A;  3CCH A;  3VCL A;  4K71 B;  5D2N A;  1TMC A;  4ZFZ A;  4HWZ A;  1S7Q A;  4NQC A;  1KJM A;  3FOL A;  3MA7 A;  3QDJ A;  1T7Z A;  1BD2 A;  4PRN A;  3FQN A;  1VAC A;  2AV1 A;  4MX7 A;  3IXA A;  3E6H A;  3HE7 A;  3ARD A;  1CD1 A;  1FZJ A;  3MYJ A;  1FO0 H;  4JFP A;  3QUX A;  4O2F A;  3FQU A;  2VLL A;  3LKS A;  2GUO A;  4PGC A;  5C0E A;  4MQ7 A;  1N2R A;  4D0B A;  4PJB A;  4U1K A;  3OXS A;  3TFK A;  2X4N A;  3BZF A;  3UTT A;  3BEV A;  3MRR A;  3P77 A;  1EEZ A;  3PWP A;  4JFO A;  2NYK A;  4MNQ A;  2VAB A; 
#chains in the Genus database with same CATH homology
 3V5K A;  1LK2 A;  3MRL A;  3MRJ A;  4N5E A;  5E6I C;  2RFX A;  3RGV C;  5C0A A;  3MRC A;  3GSR A;  4APQ A;  4JFD A;  4MNG A;  1BQH A;  1T7V A;  3CH1 A;  3HPJ A;  3X13 A;  1TVB A;  1AO7 A;  1JPG A;  3LKP A;  1ZT7 A;  1I7U A;  1G6R H;  3CZF A;  3PWJ A;  1DDH A;  1T7Y A;  3VXS A;  4HX1 A;  5HHP A;  5IEH A;  3GSV A;  4NQE A;  1QVO A;  3P4O A;  5C0C A;  3I6L D;  5HYJ A;  4I4W A;  1S9X A;  4PP8 C;  1FZK A;  3MRB A;  3VJ6 A;  3MR9 A;  3KPM A;  1KJ3 H;  4HS3 A;  4Z78 A;  2BSS A;  3M1B A;  2Q7Y A;  5E8P A;  5FA3 A;  4GKN A;  1HOC A;  5EU4 A;  1DUZ A;  3T1F A;  3VFM A;  3VFU A;  5DEF A;  2D31 A;  2VLK A;  3X12 A;  1E27 A;  3HCV A;  1A1N A;  3MGT A;  4NNX A;  3X14 A;  3BH9 A;  3KYO A;  3P73 A;  4ZUV A;  1T1W A;  3VFN A;  2NX5 A;  1AGF A;  3O3D A;  4NNY A;  4QRR A;  1B3J A;  1QQD A;  4U1M A;  2ZSW A;  2YPL A;  1AGC A;  5ENW A;  3FTG A;  5AD0 A;  3LN4 A;  1HHG A;  1M6O A;  3QEQ A;  4PG2 A;  1KPU A;  1U58 A;  4PJX A;  3UBX A;  3PWU A;  4PRA A;  2MHA A;  4U6X A;  5IEK A;  2HJL A;  3AM8 A;  2GTZ A;  4WO4 A;  3QUL A;  3FT4 A;  3I6K A;  4N8V A;  1A6Z A;  3TBW A;  3GSO A;  1JHT A;  2BNR A;  5F1I A;  3GSQ A;  1JGE A;  3RL1 A;  3BVN A;  3BHB A;  4PJ9 A;  5D7J C;  4PDC E;  3V5H A;  2BST A;  3BP7 A;  1YDP A;  1WBY A;  3FT3 A;  3MV9 A;  1A9B A;  3RZC A;  1UXW A;  2PYE A;  3KWW A;  1P4L A;  3ILP A;  3KLA A;  3SPV A;  3PWN A;  3GMP A;  3VRI A;  5FDW A;  2AV7 A;  1JPF A;  3BXN A;  4MS8 A;  3ARE A;  3MRG A;  1OF2 A;  2JCC A;  3WS3 A;  1G7P A;  4CW1 A;  3MRD A;  3QUZ A;  4NQX A;  5FKP A;  4IRS A;  1JFM A;  1JUF A;  3RWF A;  3MRQ A;  4MVB A;  5GSV A;  5INC A;  2CLZ A;  3ARG A;  3SDC A;  3TN0 A;  3VFV A;  1QO3 A;  4WWK C;  5SWS A;  4QRP A;  3QDG A;  1T20 A;  3LV3 A;  1OGT A;  1T1Y A;  2VE6 A;  2YEZ A;  3QFJ A;  1X7Q A;  3GMM A;  1PQZ A;  4QRS A;  5FA4 A;  4D0C A;  2J8U A;  2A83 A;  1T7X A;  1FFN A;  3ERY A;  1DE4 A;  4PJD A;  4NO3 A;  2FWO A;  3TO2 A;  3W39 A;  4G8I A;  1LD9 A;  5JHD A;  1P7Q A;  1Q94 A;  4GUP A;  3X11 A;  3PQY A;  5C0D A;  2CIK A;  4ONO A;  1NAM H;  1YPZ A;  3FQX A;  1I7R A;  3H9H A;  3SDA A;  4E0R A;  4PGD A;  4L4V A;  1W0V A;  4UQ2 A;  3TF7 A;  1WBZ A;  2H26 A;  3KPP A;  3RWD A;  3HAE A;  2BVQ A;  3BWA A;  3HLA A;  3MRM A;  3RL2 A;  1S9Y A;  3VXP A;  3O3E A;  5C0F A;  1EFX A;  4MJ5 A;  4PJ5 A;  1JF1 A;  4Z77 A;  4PJE A;  4IIQ C;  3MRP A;  3LKN A;  2E7L E;  4Y16 A;  1FG2 A;  3CC5 A;  3TVM A;  3GSU A;  1BZ9 A;  2DYP A;  3ES6 A;  4GKS A;  4PRP A;  3VWK A;  1ONQ A;  4U1J A;  4WU7 A;  1C16 A;  5BRZ A;  3V5D A;  4ZUU A;  3M17 A;  3T8X A;  3BEW A;  3VFO A;  4QRU A;  1YN6 A;  3VXN A;  4PJC A;  2AXG A;  3DTX A;  1T0M A;  3REW A;  1N3N A;  2GJ6 A;  4Z76 A;  1K8D A;  3ARB A;  3P9M A;  5IB2 A;  3KPN A;  4FFE X;  3TJH A;  5E9D A;  4L8S C;  4NO5 A;  4PRI A;  3SKO A;  3UTQ A;  1QSF A;  2GAZ A;  4HUX A;  3AU1 A;  5C0B A;  1QSE A;  2FYY A;  3TBS A;  2PO6 A;  4PGB A;  4S0U C;  3P4M A;  4PV8 A;  1HHJ A;  3LN5 A;  4G9D A;  5F9J A;  4PJH A;  3RWI A;  3VFP A;  1N59 A;  3FQR A;  2X4P A;  5EU5 A;  3QFD A;  1LQV A;  1ZT1 A;  5EO0 A;  5EU6 A;  4Y2D A;  4LCY A;  4HUU A;  3L9R A;  1SYS A;  5EU3 A;  1HSA A;  3D2U A;  1P1Z A;  1RK1 A;  3HG1 A;  4L8B A;  4L8D A;  4ZUT A;  5C0I A;  4IRJ A;  4PR5 A;  2XPG A;  4HV8 A;  3B3I A;  4WW2 C;  4JRY A;  3O3B A;  3O8X A;  1QRN A;  3VXR A;  5HGH A;  1S8D A;  4EI5 A;  4U6Y A;  5EOT A;  3UTS A;  1CE6 A;  3KPQ A;  3VRJ A;  5IVX A;  2F54 A;  4G9F A;  3I6G A;  5MEP A;  1JGD A;  2VLJ A;  4PJ7 A;  5IB1 A;  5D9S A;  4ZAK A;  4PG9 A;  3E2H A;  3D25 A;  3QUY A;  3GSN H;  1S7W A;  2BSR A;  1S7T A;  1ZVS A;  3MV7 A;  4HKJ A;  5HHM A;  3TBV A;  3GML A;  5EO1 A;  4NO0 A;  3GMN A;  3LKO A;  3W0W A;  3MRI A;  4PJI A;  4PRH A;  3GJF A;  4MJ6 A;  3RWG A;  4E5X A;  3HE6 A;  1I4F A;  1S7V A;  4LHU A;  3LKR A;  2H6P A;  5L2K A;  3PAB A;  1T21 A;  4V3D B;  3DX7 A;  3QZW A;  5IND A;  3KPS A;  1RJY A;  1EEY A;  1S7U A;  2X70 A;  2CKB H;  1JE6 A;  4WDI A;  3WL9 A;  3MV8 A;  3VFR A;  4EUP A;  5B39 A;  5IB3 A;  1W0W A;  2C7U A;  4L3E A;  5HHN A;  2XFX A;  1GZQ A;  1MI5 A;  4N0F A;  1GZP A;  1R3H A;  2HLA A;  3GMR A;  1T22 A;  5HGD A;  3HUJ A;  4F7T A;  3D18 A;  3ROL A;  3L3J A;  3BZE A;  3ECB A;  3JTS A;  3TA3 A;  1AGB A;  1B0R A;  3L3K A;  3MRK A;  4U1S A;  3E6F A;  3FOM A;  1M05 A;  3WS6 A;  5B38 A;  3ARF A;  3S6C A;  1IM3 A;  3JTC A;  1AGE A;  1LDP H;  2FZ3 A;  1KPV A;  4X6C A;  1K5N A;  5F7D A;  3P9L A;  1KTL A;  1T7W A;  5J1A A;  3D39 A;  1BII A;  4ZUS A;  4F7P A;  3OXR A;  5EFI A;  4JQV A;  3SJV A;  5MER A;  2X4S A;  3DBX A;  1LP9 A;  4PJ8 A;  1KJV A;  2HN7 A;  4HUW A;  3QUK A;  3FRU A;  4NO2 A;  1KBG H;  3G08 A;  3MGO A;  4JFQ A;  3TZV C;  4CVZ A;  3KPL A;  2X4R A;  5IM7 A;  3RWE A;  2HJK A;  3KPO A;  5DEG A;  2ZSV A;  3DXA A;  1N5A A;  3SDD A;  4PGE A;  3P4N A;  4Y4F A;  2FIK A;  1I1F A;  4N0U A;  1RK0 A;  2BCK A;  1ZHL A;  1HSB A;  3KXF A;  4G43 A;  2AKR A;  3VXO A;  3QQ3 A;  3KPR A;  4F7M A;  5C0J A;  1VAD A;  3O4L A;  5C08 A;  5ISZ A;  4FTV A;  3GMQ A;  3D3V A;  2V2X A;  4LCC C;  5J6G A;  3SDX A;  3WUW A;  3C8K A;  1XR9 A;  4JRX A;  1I7T A;  3H7B A;  3O9W A;  4XXC A;  5L2J A;  1TVH A;  3VXU A;  5D7L A;  5E8N A;  5DDH A;  2ESV A;  1KPR A;  3MRH A;  4U1H A;  3VFW A;  1QR1 A;  1RJZ A;  3UPR A;  5H94 A;  5J6H A;  4PV9 A;  5D5M A;  5ACZ A;  5EUO A;  2YPK A;  1FZM A;  3GSW A;  5C07 A;  5C9J A;  4L9L C;  3DX8 A;  1LEG A;  4G42 A;  1E28 A;  2ZOL A;  4EN3 C;  2WY3 A;  3OX8 A;  2BVO A;  4I48 A;  5SWQ A;  2ZOK A;  3MRE A;  2P5E A;  3L3D A;  2FO4 A;  4JQX A;  2CLR A;  4D0D A;  4L3C A;  1MWA H;  3FQW A;  1XR8 A;  4WJ5 A;  3FQT A;  4V3E B;  1KCG C;  3ROO A;  4L8C A;  2X4U A;  3QDM A;  3O3A A;  5F1N A;  4F7C A;  4QOK A;  1I1A A;  3RWH A;  1T80 A;  1HHK A;  4ELM A;  3FFC A;  3SKM A;  3JVG A;  4G8G A;  3VFT A;  4MXQ A;  5BS0 A;  1OSZ A;  3TPU E;  3B6S A;  3GSX A;  3PWV A;  3QQ4 A;  4K7F A;  1ZHK A;  4X6D A;  4LCW A;  3LKQ A;  2GT9 A;  2F74 A;  5HHQ A;  1VGK A;  1B0G A;  1UQS A;  3CVH A;  4HUV A;  2GTW A;  1A9E A;  2CLV A;  1S7S A;  2CII A;  4U1I A;  4PJA A;  3OV6 A;  3RWJ A;  4ZUW A;  1EXU A;  3TBT A;  3DMM A;  3TIE A;  3H9S A;  3NFN A;  1FZO A;  4PRB A;  5MEQ A;  3BO8 A;  3CDG A;  2F53 A;  2OI9 A;  3KYN A;  4NQD A;  1YN7 A;  3L3H A;  1FFO A;  1Z5L A;  5GSR A;  3GIV A;  1ZHB A;  3CPL A;  2X4O A;  4F7E A;  5C09 A;  3C9N A;  3SCM A;  3VWJ A;  1KJ2 H;  3RTQ A;  5BXF A;  4MJI A;  5HGB A;  4N0C A;  4U1N A;  2OL3 H;  5C0G A;  1QLF A;  1S7X A;  4PRD A;  1INQ A;  1MHE A;  3BH8 A;  5D2L A;  4JFF A;  1IM9 A;  5E8O A;  3MRF A;  4O2C A;  5IB5 A;  1SYV A;  1HHH A;  2BNQ A;  1OGA A;  2VAA A;  1W72 A;  1LEK A;  2NW3 A;  1XH3 A;  3PWL A;  1UXS A;  4QRT A;  3FT2 A;  3WLB A;  5HHO A;  3BP4 A;  4PJG A;  3L3G A;  4NQV A;  1HHI A;  1T0N A;  1ZSD A;  1QEW A;  1AGD A;  1XZ0 A;  2UWE A;  5IB4 A;  1S9W A;  3VH8 A;  1ZHN A;  4L4T A;  3IT8 D;  1CG9 A;  3DX6 A;  5SWZ A;  3VFS A;  4Y4K A;  3MRN A;  5HGA A;  2P5W A;  5MEO A;  4U1L A;  3E3Q A;  1NAN H;  4Y4H A;  4CVX A;  3RUG A;  3L3I A;  4NHU E;  3TID A;  1I1Y A;  1NEZ A;  4NSK A;  1L8J A;  1AKJ A;  2X4T A;  1T1X A;  1A1M A;  3U0P A;  4L29 A;  4PJF A;  4WU5 A;  3TO4 A;  1DUY A;  4UQ3 A;  1G7Q A;  1ZT4 A;  1WBX A;  1ZAG A;  3TBY A;  5MEN A;  2BVP A;  3ILQ C;  1FFP A;  3BGM A;  4QRQ A;  2V2W A;  2AK4 A;  2VLR A;  3QI9 A;  4LNR A;  1MHC A;  1S7R A;  5IRO A;  4NT6 A;  1A1O A;  2X4Q A;  4WUU A;  4X6E A;  5E00 A;  3FON A;  4O2E A;  1ED3 A;  3BUY A;  3JTT A;  4G59 A;  4IHO A;  3VXM A;  4JFE A;  5BJT A;  2GIT A;  3BW9 A;  4X6F A;  5D7I A;  1HYR C;  4PRE A;  2AXF A;  3MRO A;  1ZS8 A;  1T1Z A;  3RWC A;  3GMO A;  3CCH A;  3VCL A;  4K71 B;  5D2N A;  1TMC A;  4ZFZ A;  4HWZ A;  1S7Q A;  4NQC A;  1KJM A;  3FOL A;  3MA7 A;  3QDJ A;  1T7Z A;  1BD2 A;  4PRN A;  3FQN A;  1VAC A;  2AV1 A;  4MX7 A;  3IXA A;  3E6H A;  3HE7 A;  3ARD A;  1CD1 A;  1FZJ A;  3MYJ A;  1FO0 H;  4JFP A;  3QUX A;  4O2F A;  3FQU A;  2VLL A;  3LKS A;  2GUO A;  4PGC A;  5C0E A;  4MQ7 A;  1N2R A;  4D0B A;  4PJB A;  4U1K A;  3OXS A;  3TFK A;  2X4N A;  3BZF A;  3UTT A;  3BEV A;  3MRR A;  3P77 A;  1EEZ A;  3PWP A;  4JFO A;  4MNQ A;  2VAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...