3E2HB

Structure of the m67 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
b'SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSLERPYLTFGSGTKVIVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e2hB00
3I6GB 4FFZL 43C9A 4HS6A 4H5SB 2CIKA 3LEXA 1KLFA 3MMEB 1IM9B 1WTLA 2BNRE 3GNMH 3BRGC 2PO6A 3HI6H 3MSPA 1LK2B 3KXFB 3T77B 4MXWH 1KELH 5DWUH 1NC2D 3IDMA 2NY7L 4M61B 4YXKH 4A2MA 2IQ9L 1SM3L 2UY7A 2YKLL 5IOPB 4PG9B 4P5MA 5A16B 2V7HB 3FO0H 1CLCA 1OHQA 1WIUA 2XICA 4AT6B 1JF1B 1CVRA 4N9OB 5I30L 3PWNA 4OSUL 4MCYB 1UM6L 2IPTL 5JTWA 2BMKB 2XKNA 3VRLE 2BVQA 4IS6A 4JANB 5F7EL 1KN2H 2ZG2A 2VZTA 3CSGA 2PXYC 4HJ0C 1NBQA 2HJLB 5CP3A 1J05B 5F7DB 4B0MM 4U7SA 1Q72L 5DMGD 1Q1JL 1KGCE 2AJUH 4WDIA 4N0CD 1F2XK 4WV1B 1KNOA 1NC2B 4M4PA 3BKML 5I9QB 2DLFL 4NCC2 3RL1B 2Y23A 4PGDA 2V7NB 4APQC 5BQ7B 4M7LH 3MROB 4OAWA 1YNTB 4PP1D 4UZGA 5F3HB 5ALBL 5HVGB 4B7IA 1UACH 4QNPE 2B7DT 5JXAL 5AAWA 1AQKL 1E6OL 5ICZA 4CADB 2IWGA 5L2KA 3VJ6A 1DQQB 3GSOB 3IXAA 4LCWA 4MZ3A 4P4RA 5FYJD 1B0GA 2YPVH 5KSAD 5FYLE 1QR4A 1PLGH 2MHAB 1CDYA 3SDAD 4IDJL 4CJ0A 4F33A 1KCVL 2GTWA 3UTQB 3BKYL 4R4BA 4RQQB 5DRZA 1JZ5A 3UBXB 3RVUD 4JZOB 3DGGB 3V4VH 1YEHL 4ZPVA 1CN4A 1MH5B 2WBJD 4XP9H 1GGBL 2YSSA 1VERA 3A67H 3C9NB 3KPMA 3P4OB 4K8RL 5D7JA 3CMGA 5JDSB 3G04A 2P5EA 4WUUB 5DQJA 4AEHL 5IV2A 1UADC 3MRPB 2C7UB 2IPKA 1TJGL 3AS3A 3BJLA 1F97A 4UTBH 2B1HH 1MCBA 4RDQG 4R0LC 3RDTC 3U2SB 2GW5A 3MJ9A 1NAKH 3BWAA 3LSOB 1RD6A 3FFCB 3ZDXF 5KSAB 1FGVL 2V2WB 4QRRD 4KKBD 1E4XL 2E9BA 3D6GA 5BO1L 2G5RA 3HR5B 4GRWF 4U31A 1IFHH 2ILLA 4GKOA 1INQB 2FX9L 4LAJH 3KPOA 5D7KD 1G6RH 1FNGB 1JGVL 3ZE0F 3ZZ1A 3RGHA 1CLZL 2OBGA 3QQ9C 2WBJB 2QADB 3IFNH 3S3SA 4L5FH 3U36B 4NM4L 2DJ4A 4ELMF 3F7YA 1KT2A 3QUZA 1KXQE 2VXQH 4CU7A 2X4TA 5C0RH 4Z9KB 5IP4A 4FQXC 4U1GC 2R2EA 1GZPB 2BSRA 1MVUA 4KHXH 3HNVH 5CLWA 3PWVB 3GSQB 4G3YL 5EU7E 4NIKB 3P3YA 2C4XA 4QRPE 4QRRB 4JM2D 3OKLB 3IDYB 5K9KA 3BIKB 4Z76B 5FM5O 3JTSB 3TH4T 4OD2A 4U1IA 2Z31D 3ZLQC 1BJ1H 1NGZA 5DD1H 2FBJH 4LF3A 1H3GA 1KPVA 4UILH 1ND0A 1QO3B 3QJHB 4KJWC 4Q7DA 1XCQB 4HT1L 5T1DL 3BPOC 1AXTL 1TJIH 1YQVL 3AAZB 3O6KL 1C5BH 1CICD 4OGYH 4LIQH 2ZUUA 1F58H 3CSPA 1IAIM 4M1DH 4AZ8A 5BVPL 1TQCB 3RWHA 4MX7A 4S2SA 4XXCC 1M7IB 5KOMC 3K46A 3U9PL 3RTQA 4O2EA 3NCFB 3ULVC 1FFPB 4JO1L 4WW1A 4UQ2B 1D5XA 4GRMA 3TCXA 3P0YL 2Z31B 3QP3A 5C0IB 5HDQL 3O9WD 2IFGA 2OLDA 3MRMB 2E6QA 3UTZA 5E5MA 3QA3B 4YHOH 1WUNT 4LLDB 3BP6A 5CEZH 3MXVH 1ZV5A 2OXGA 1FL6B 1CIDA 2PW2B 1K8DB 3UZVB 4NHUA 1AP2A 1YYMH 2CKBL 1HHIA 2CLZA 3CAFA 1R3HA 3HE7A 4GRWE 1CICB 3DUHA 4HFWB 4JFHE 4YHPB 3X3FH 5F72S 3ZE0E 4BKLB 1KC5L 1U3YA 5IFHL 3UAJC 4P99A 4HS3B 4YK4C 1K4DA 2QQKH 5LGHH 3LEVH 4UQ3B 1NMCC 4ELME 4KK6C 3MJ6A 4V1DB 1R5WB 2DQCH 3JV4B 2EIZB 4MJID 2A6KA 4XNMB 3DUUA 3TT3H 4OM0L 5I75B 4IMLB 3HA0A 1WC7B 4WWID 2G75A 4OIBA 3O6MH 2AXFA 2X4SB 2Z91B 5B8CA 1JHLL 2JJUA 3ROLB 4UBDC 3ULSA 1AQDA 3VD4A 4ODHL 4RIRA 3NA9H 4U33A 4HIEB 1CLOH 4TUOA 1ZLWH 5C6TH 1H3XA 3DPBA 2HLAB 2PTVA 1U8IA 4I0PC 5GJTH 3L3OA 1NCBL 1KJ2A 4RISH 4NOBA 1MY7A 3BP5B 4Q0XH 3I75B 4X9BA 3G08B 1KIPA 4NQDB 4X5LA 4O58H 4RMWA 3VXPB 2DS4A 5CBAB 1FLRL 2JELH 3GMLB 4ETQB 1EHLL 3NABH 4MNHA 1KIRA 3WEXB 3DBXA 1JZ7A 5LXGH 1NBVL 3L9RA 4QHUB 2O5ZL 2JJVA 1LP9F 3KJ6H 1CK0H 3MRIA 4NYLA 4O02L 3L3GA 4Z0BH 1B88A 1M05B 1XF4B 2PF6A 4MZ2A 4JKMA 1V3LA 3BZ4B 1DEEB 3LIZL 3VXQA 2ZSWA 3OKEA 3SE3A 3OHXB 4NDMB 3RVTD 3RZCB 1ZK9A 5D1ZD 3B3IB 1ZWIB 3VGHA 1U58A 4PJFE 1JYWA 5MEQB 2JIXA 3QEGH 4LSQH 4JGMA 4MA7L 5BRZA 1NSNH 1SHMA 4U6XB 4XPBH 2X89A 3ZYOA 2ITDA 4BH8A 5CJXA 5EDXA 3QNYA 3DX9A 2H3NA 5IJKA 4RGNB 4MWFB 4S0TD 4X6BA 5GISL 3WHXA 4AL8L 3VFSA 3KPRE 2AGJL 3EW3B 3QFJD 3ES6B 4MB3A 5C0NC 1J1OL 2XY2A 2Y06L 3MLSL 3EOTL 1TTGA 2I5YH 3LPGA 5F9JB 4PRPE 2V5SA 5T3ZH 3TIEB 3ULUD 3QXDB 2F53D 3STZB 4Y7MA 4JPIA 1KUMA 4S1DC 1F4XH 3TBYB 1YMMA 5HY9A 3WN5C 1A02N 2KBGA 3QIBC 3S9DB 4DGIL 5C0BD 4QXTB 3CPLA 3K1DA 4KV5E 4MXQD 3VH8B 5E8EB 1OGTB 2DIJA 1FFNB 1FZJB 4C83A 2FL5A 2H1PL 4I9WD 2DL2A 4O2FA 5ADPH 5I1CL 3WE6B 4PLNC 2PCPA 4E0RB 3U7YL 4WI4A 1J8HE 3QSKB 2YPLD 3H2WA 2FZ3B 2YPKB 1OTSD 4LKCA 3EYQC 4ODVH 5IG7B 2YMXL 2XQBH 4ZFZB 3B83A 5DUPL 5DJDA 3WKNA 2JJTC 5SWSA 1S9WA 4JCLA 1HSAA 3V7AG 5IIEB 1H8OA 2HKFL 3WL9A 4HIJB 3HUJF 4QKXB 4XWOD 3P40A 4XVSL 4M7ZB 2DI7A 1UQSB 1LP9E 4GG8B 5GRXG 4PTUB 3T08A 2MFNA 1UGNA 1NCUA 4NJ9H 3D2UA 4PY7B 3BKJL 5HVHB 1VPOL 4J4PA 2J88H 4RRPG 5GS0C 1HXYB 5F6HI 4GAYA 1OL0A 2YPLB 3WXVL 1XIWA 4J3OC 2I9TB 1NUNB 1KCUL 5I2IB 4OIAA 2D3VA 4PRBA 4L8DB 4HF5H 4L3EE 5E08H 4ZUUA 1PQZB 2ZKHH 5EO0A 2CK2A 4WTWA 2KQNA 4XNQB 5SX5K 5GZNC 5FHAH 4NRYA 1EXUA 2IGFH 4ODXB 3LKSB 4TUJA 3VFMA 2OI9C 3IGAB 4DTGL 3FQUB 1GZQA 2NX5B 4JFYB 5JW4Q 3HTLX 4FXGA 3JTTA 1IGCH 5MERB 3CU7A 4KMLB 4MHHI 2HT4C 3W11C 5HYJD 3V2AR 1HHGA 3RWEB 4JKPH 1XMWA 3F7VB 3QULA 4X9HA 1YJDL 3C5SA 3OR7B 3DURB 1GGIL 3WDHA 4XP5L 5JW5A 5F93C 1NDMA 5F9WC 3G5XA 1JF6A 4AH2B 3SOBL 2ZJSH 4KTEL 3EIFA 2DKMA 5I1DA 2BY1A 1RU9H 4NZUL 5C0AE 3MNZA 4K2UH 4X4MA 5JNYA 2P8MA 3U82B 1T1WB 3MUGA 5HXMA 5I18L 4UOW1 4AG4L 1JFQH 43CAA 1T3FA 1F3JB 1Q9OB 4X99B 5HYQB 2IPUK 3WNMA 3BESR 1G9NC 2YXMA 3QDJA 4X4YA 3C08L 3L3KA 1MCWM 1T1ZB 4ZS7L 5IR1A 2NMSA 5I1KL 3O6FD 1NL0L 3K8LA 1AGFB 5E4EC 4OZGF 1B2WL 4JDZA 5DVMA 1IQWH 5JO5A 1CFNB 3MV8B 5E5RB 1B4JH 3ARRA 3HUJE 4U1KA 2R29H 1U95A 2A83A 5IFAL 2GSGB 2GJ6E 4U6YA 1CCZA 4YHLH 4Y0GA 1DBBL 4ZO8A 5L2KE 4P9HC 4HPOH 2GHWB 3FONA 1FVEA 3ZE2F 1YUHB 4QY8A 3R8BB 2AJ3A 5C0JA 5CINL 4Y16C 3CFCL 2YUZA 5L88L 5F7WC 1LEKA 3PGDB 1Y6NR 3MNWB 3L3DB 1OB1A 3NN8B 5H2BA 5IBTL 4CVZA 2R8SH 2XPGA 2DIAA 3WIHH 1XGRB 5FM5M 4ZTOL 5EBMA 3SKNB 2IBGA 2HH0L 1EO7A 1RUPH 3OQ3B 5TDOB 2D0FA 2A73A 4LVOB 3MBEB 1OPGH 4HGMA 1RUKL 4JDTL 5JMOC 5E94A 2ESVD 5D93B 2EDWA 2VZVA 3BPCB 4JFDE 5K33A 3C8HA 3BD4A 2SEBB 4N1CA 4M9PA 1LO5A 4P2RB 5MHSD 1A6UH 2VZUA 3BDYH 2DBJA 5KANG 3RWDA 3PWUB 3HC3L 3SE4A 1MI5E 3ARFC 2W60A 2QQLL 4F7TB 2B0SL 4MVBD 5A1AA 4PYGA 3EYOA 3WO3B 1U91A 3CX2A 5C0CA 2VLMD 1OARL 5TGBA 4LEOB 4UNTA 3FT2A 3KAAA 5KVEH 2E9WA 4D9LL 1SVCP 3DI2B 6CGTA 2D03H 3UC0L 2ESVB 4H8WL 5HGBA 1CGWA 4D0CA 2FIKA 1QPXA 3HN3A 4P2QA 2JCCA 4DW2H 5ACLA 5DD6B 4JHBA 3CC5B 1EGJA 2DN7A 4PJAF 3WD5H 2AK4E 1F6AB 2ZZUT 2VH5L 1IVLA 4HUXB 4XBEH 3VGAB 2BVOA 3MLXL 3IS0X 1ZA6A 5MP6L 3QUXD 4LDEB 1P4LB 4MJ6A 4DGYH 5FDWA 3CLFH 3RGVB 4XAWL 3LKPB 3BT2H 3BEWA 1I9IH 3MRRA 1JMXA 1Z0MA 3ZE2E 3SGEH 3STLB 4TSCH 1RMFH 1YEGH 3MRGA 1VFAA 3UTPE 4AM0B 5FK9B 2FSEB 4ONHB 5DJAA 5L9DL 4R2GC 5EU6D 2W92A 2CKBB 5IHUH 4NJAL 1GOGA 3V6FB 5CHNA 1OLLA 3UJIL 4CVXB 1VGEL 3HE6C 4KKCD 1QEWA 3MLPA 3ARVA 1EH9A 4OLZL 5HPOA 3IYLW 4M8QB 1RV6X 2RCSL 1NCWH 1OP3H 4OCNC 3KVQA 2FJHB 5HHXL 2BVPA 3QUXB 1PG7H 1I3RA 2RHEA 3K0WA 5EOCJ 3HHRB 4HUUA 4Y2DD 2VXVH 1SJHB 1DDHA 5E9DA 3GK8H 3KYAA 3BN9D 4ZOEA 5A2JH 2XI9A 1JGLH 3V0AC 5EU6B 3CFDA 1V5JA 4O2CB 5HDBF 3ZKQD 2YUXA 1CDIA 5D2NA 4DGVH 1HH9B 2MPAH 3CH1A 1WBXB 1QSFE 4Z7VE 2X9YA 1AHWB 4LNRB 1BZ9A 4L4VD 4JO3L 1U36A 3KWWB 3T2NH 5JIIA 1ZHBA 4J8RA 4N8CL 1MHEB 4N0FB 4HWZB 1BBJA 3ARSA 3G6JB 3MRCA 4I5BB 4X6FB 4JRXB 2GSIB 4JFEE 4Y88A 1R5VA 1EFXD 1KEML 5DK2B 5I1GL 3VXTB 4J3VA 1JJUA 3E1F1 5SX4H 3TVMC 1BBDH 4PJAE 3DARA 3VFVA 1QKZL 1JHTA 3S37H 1BM3L 1BF8A 1ONQA 2X4NA 3KLDA 2R1XA 2VABA 1MQKH 5CJ8A 2YK1H 4M6OL 3HZKA 2C1OB 1IGTA 5FUZH 1QP1A 1MCWW 4M1GH 4WEBH 3SJVB 1FFRA 1M7DB 2IBZX 4MA8L 2W59A 2IAMD 4ZUTB 4XMPH 1P7HL 5ICYB 1RHHB 4H1LG 4JREB 3V95A 5E2TH 4NQEE 5E8DL 1CG9A 2YD4A 4ZD3L 3KNBA 1EFXB 2V5TA 3KGRA 4Z8FL 1D6EB 2FO4B 4GW4B 3U4EB 5D8JH 1V3KA 1SEQH 4L9LA 3B9KC 2BDNL 4FQQA 4O9HL 4P5TD 3OB8A 1A7OL 3C6LC 1FC1A 1KB5L 5JUEH 4L4TD 3V5DA 1KCSL 1FVDA 2EECA 2NXYB 1EFQA 1SY6H 2OP4H 3DVNA 1AC0A 3MRBB 3CXDL 5FIEA 1MCRA 1OQOA 3O45B 4XC3H 4KI1A 1MREL 5TDNA 4KKAD 2CGRL 3P9LA 3LKNA 2GFBA 2Z92B 4PJ5A 1D9KD 4NP4L 1T1YB 1S7SA 4LSPH 2R9HD 4P3DA 4LLMA 4HXBH 2OZ4L 1LO2H 3ARXA 5IB5B 2IMNA 4X7TA 4LCCC 5HDBE 5JPNA 1J86A 4XH2A 4BYHA 4DN3H 5JW4M 1T22B 1OP5H 3LQAH 5I1HH 2WUBH 3HG1D 3BGMA 4FQHA 1U8KB 3VGEA 4P5TB 1CF8L 4XCCH 5AG8A 3WIFA 3UTTA 3X3GH 2P7TB 1MCHA 1CWVA 5GGRY 2ARJB 4R97C 4GSDL 3B4NA 4I0CC 4PJIF 1RJZA 4JFFB 4NQCE 4NT6B 3VGBA 3DRQA 3WIHA 2P8PA 2CK0L 2BFVL 3BPNC 4HBCH 2NY0C 3P2TA 4LSUH 3O4LB 3QUYD 1AGDB 3NTCL 3OAYK 3VMPA 1C5DB 4ONFL 1U92A 5BS0E 1NC4B 3ZE1F 2IG2H 4XC1H 3VMOA 2XA3A 4OZFA 3UJJH 3SQBA 5IM7A 5K93A 5IBUG 1C1EL 5C86A 2Z93B 6FABL 3SGDH 3S97C 4IOIB 3BP4B 3TV3H 1G9EA 4HUVA 3EOBA 3IJHB 3IT8D 4PB0L 3WHE1 1NGPH 4FP8L 3I50H 2HP4A 5C07D 3ULUH 3SE9H 4PY8J 4NZRL 3JWDC 3SO3B 2VDML 3SPVB 5HHQA 4YJZL 2YHGA 4TVSa 4MA3B 4HHAB 5HVFB 3QUYB 4QF1B 4Y1AA 5DC9B 5FYKE 3WFZA 5LCVL 2AERT 4LGRB 3VFRB 4U6VH 4OCSH 5D6DA 1KENH 3ZDYF 4NO0A 4Z0XA 1KEGL 2FEEI 4M6MH 3HAEG 1N0XL 3V79C 4KZEH 3T4YA 3D85B 3GBNH 3PG2A 4XP1L 1PYWA 1AGBA 3SDXF 3TPKA 3GUTA 2NNAB 5DFTA 5GGSY 4JB9L 2J3SA 5I71B 2AV1A 4QRUA 1H0DB 3I2CL 3L5IA 3ZT7A 4ZXBA 4JY5L 3GSUB 1BVLB 3DV4A 3WFCL 4GRLD 1RZ8A 4KDTC 4LLQA 2ZP0T 3DSFH 3L7FA 3DI3B 4I4WA 1V7MH 1CD0A 2UV3A 5IEKA 4NNYB 1QSED 1WGOA 2VSDA 4ZAKB 1ZANH 3O8XB 3BXNB 1RURH 2CLRB 2XA8H 3HZVB 4DZ8B 1CFQA 3AM8A 3QDGA 4PJIE 4X7DC 1MWAB 3OKKA 4LIQE 2ZOLB 3PHOB 1MRFH 1IT9H 3S36X 3TWCH 1FVCA 1YYLH 5FAAA 3QWRD 3UBXI 4LAQL 4IM8A 3IFOA 3WNNA 1RFDH 5EO1B 5AWNL 5IMKB 1VHPA 3QNZA 3V5HB 5DD0L 4KQ3H 3LS4L 1CFTB 1UM5L 3K74B 5IUSA 1QFHA 3ZE1E 5CKGA 2UVEA 5SWZB 5C08D 4OCRH 3GMOB 3WFHB 2A6JA 4ZUSB 1MFDH 3VI4E 1QSEB 2A9MH 2VLRD 1C7TA 4Z7WF 1BP3B 4FQCL 4EZMA 2A2QT 5ALCH 4NKMB 2X5PA 1PVHA 3S4SB 3KYKL 1FL5B 2F54A 5L8KB 4X8XA 1AKJD 1TENA 5IB1A 2PO6C 4M5ZH 4PJ7B 5KS9B 4GAGH 3O3AB 3QHZL 3CVIH 1D5MA 1YMHB 4M62L 1YEEH 3PJSB 4POZC 3ALXA 4FTVA 4JR9L 5HI3C 3EJYC 2NY4C 3P9WB 1EBAA 4WWKA 1MFAH 5J3HC 5DEGB 2EICA 1TQBC 4FQ2L 3FL7A 4YGVB 3S34L 3ZDYE 2JB6A 4HJ0D 5F1NB 1QA9B 2VLRB 3L3HA 3MJ7B 3QT2A 4RX4D 1WWBX 3MLYH 3SDXE 5FEBA 2V17H 2O93L 2P46B 2AKRB 5LQBL 4BFIB 5I76A 2NTFA 4LFHG 5GIRB 3B2VH 4KK9C 5DDHA 4F2MA 5F9AC 4K94H 1ES0A 3G5ZA 4PJBF 1EJOL 3BW9A 4HUWB 3RVVC 4APQD 4HX1A 4NRXB 3ZMRA 1ORSA 4TNWK 4MAUL 5KSVA 2XWBA 5HSFA 5AZ2L 1R24B 4QRQA 4R96A 4YHNA 1KLGA 3VD9A 5C1MB 3TT1H 5EZOH 1DUYA 2OR9H 4FNLL 4FQ1L 1FO0B 2PXYB 3LRHA 1FZOA 1A6AA 1AIFB 4PRHE 4YBQC 1IQDA 1PY4A 1QRKA 4G8GE 5I15H 4KK5C 5FKAB 4NC0B 4ZYKA 3U9UB 4PV9A 1TVHB 1FBIH 3T8XA 2DQTL 4APQB 3CK0L 3D3VA 3UEZA 1DLHA 4XMLL 4D0DB 1YEDB 4PR5A 4JRYA 5KW9L 3AGVA 3SQOH 4L29A 3V6OA 3WXWH 1E28A 1R5IB 4Z7WE 5ILTH 1D6VL 4KXZI 3RAJH 1L0QA 3BQUA 5DFVC 1YDPA 4C54A 1KULA 2DMBA 1S7UB 4DK6A 2HRPH 3INUL 5D7JC 4Z77B 2BXZA 4W4NA 1HKLL 3QUMH 2EDDA 4M1CC 3FQWA 3PP4H 4I3SL 2B39A 1OAYH 1Z5LB 3D39A 4D9QE 4U6TA 2BNUA 5KSBE 2E9IA 2WMPA 1MLBA 1ZHNB 3LB6C 3PWPE 3MRDB 5EOQH 3QQ9D 1XT5A 3IRPX 2K7PA 3HI5H 3OX8B 4DKAA 1ACYH 1EUUA 4R3SA 1FIGH 3O2DA 5K9OA 1B4RA 4HQQH 4G80A 2WWKO 1T4KA 3GMRB 3TBVB 1IAII 2B4CC 4NN5B 4N0UA 3JWOC 1SYVB 5CKAA 4YXLL 3I3BA 3GSRA 2DRUA 3RDTB 4BA8A 3TJEL 3IDJB 4MD4B 3FQTB 5T1MB 4JO4H 1SBBA 1ZT7B 2HTKC 4WUKL 5FV2A 4NQVB 3QUZC 2I07A 3ZKSD 1V3MA 3MYJA 5IVXB 3U4BH 4GG6A 5DHVA 5JHDE 4OQ1A 1FE8H 4XNUL 5ABDE 4NUGL 3O3BA 5F9OL 1PSKH 2UWEA 3PDGA 1FORL 5E6IC 4KJWD 2VAAA 3IDNA 4RFOL 2H32B 2NZIA 2ZOKA 2CH8A 5DEFB 1AI1H 1K3ZA 4GXUM 1AXSB 4FQXB 4U1GB 2IALB 2XN9B 4TOYL 1UXWA 3RA7H 4ELKA 3T3PF 1IE5A 3AB0C 2AK1H 2NLJB 1MRDL 4HZLB 1LEGA 2E6PA 2GJZA 3ULVD 1FAIH 1G0DA 1BQHG 4HLZH 1JYVA 4C55A 5BJTB 5MENA 5GGUA 5C8JB 4H1LB 3N1FC 3FB5B 3P4NA 5DR5L 3RTQC 4ZPTA 3QR2A 2MTPA 3B2UC 3CXHJ 5FYLL 4GMTL 3KYOA 4ACPA 3CFIC 5GJSH 1UWXH 4RFNC 3CXHK 2ZWLT 2DAVA 4HK3N 3BPOB 4TVPH 4OF0A 1BAFH 1PKQE 4P2OC 1N59A 4G8FB 4OD1H 3DX6A 4Y4HA 1KB5B 2X7LB 3MOAH 3LAFA 4OD3H 1N5AA 4X6DA 4D3CH 1E6JH 3MUHL 1A2YB 2GAZB 2W07A 3OF6A 4K3GA 1RUAH 3QHFL 4K3DH 3HE7C 3TJHC 4NPYA 1ZA3B 2QKIB 4HK3J 4KK6D 3LKQB 4GQ9H 1HEZA 3LV3B 4Q9RH 3SBWC 5EOTA 4ZDHB 4RWYH 4G6KH 3NCBB 5SV3A 1JYNA 5FCSH 3PP3K 4UBDD 3DMMA 4OM1L 3HKFA 5HD8C 4EN3A 1XZ0B 4KRLB 5I8CB 4WFHE 3O6LL 5KVFL 1G7JB 4TULH 5B8CC 3QDAA 5C9JB 4OZGA 3FMGH 2C1PA 5CCKL 4PJ5E 2BHUA 4I0PD 2ZUXA 1RIVL 4YK4B 3M8OH 5EA0H 1W0VB 2AEPL 4X7CC 3UYRH 2OL3H 4YR6B 4U1JA 4EVNA 4WI2A 4XXDB 5E1AA 3VG0H 2WZPD 4C4KT 3JVGC 3EGSA 2G2RB 2Q3AA 3CCHB 1P7QB 1W0YT 4GLRI 5H35B 2VLJA 2XWTA 3EDFA 5DFWH 3QIWD 4W70A 1WFTA 2O61A 5IBUB 2VC2L 1SBSL 2F19L 2HT3C 5AUMA 4XPFH 3H9YA 4O51A 2LQRA 1I8KB 3LRSB 1X5JA 1MJJB 1XGQA 1YN7B 1ADQA 3UROR 3GHBL 5AZEH 4PJ9A 1XAUA 4PREB 4DN4L 2QEJA 4UOJA 3SKJH 5HYIA 3SO5A 3QDMA 1J87A 3GDBA 2KL6A 4OZIB 3LQZB 1BOGA 1HSBA 1GC1H 3QPXL 4M48L 1LD9A 1REIA 2Q20A 3CFBB 1W0WB 4JM2F 1A4KB 1OGAD 2HN7A 3RIFF 3RBGA 1N5YH 2IQAB 5CSGA 1RUQL 3IAQA 1MIEH 2VLKA 5ERWA 3C5ZB 1ZGLP 1UZ6F 5CJXC 3SDDA 3HAEB 3V6BR 4PG2A 5I1AA 1QFWL 2FWOB 2Y5TA 3HPJB 3GMQB 5IJKC 4QT5A 4UV4L 4NM8H 4R7NB 5I1IH 1BD2B 4KC3B 3S96A 2I25N 4S1DD 1FDLH 1K5NA 2HWZH 5JOPE 3GBMH 4JHZA 5E70A 1AO7B 5FYJE 3CVHH 3QIBD 5EWIH 1RK1A 5ENWA 1A1OB 4WTXA 3WLBA 4OQTL 1FSKB 3UO1H 4Y1AE 1QRND 3LKOA 5I1LB 1NFKA 4P0DA 4ODSH 4KWUA 2HFEA 1HDMB 1FZMA 3BPLB 2NY3C 1J9CT 3WYRA 2CLVA 1LE9B 5EZLA 5DJ2A 2P24A 1OOAA 4JAMB 4ZUVA 4HG4J 5I8OH 5IW6A 2VDKL 4I1NB 3EYQD 3MFFA 1DLFH 3F5WA 4HG4K 3QG6B 1DVFA 3BIBX 4YPGA 4U1MA 3T0EA 3K1KC 2DM4A 3GEWB 2WINB 2CDGA 5BXFA 3GI9L 2BHYA 4H25B 2PW1B 3IETA 3QCTL 3TIDB 2VDRH 5TE6L 4OZHF 2Z35B 4NN6C 1FFQA 3P4MA 2IADA 5D7KE 3TYGH 3HS0B 4PRNB 3OG6B 1HZHL 3Q1SL 4G7YL 4OGXH 2R39A 1HKFA 4I77H 5GS0D 3FOMB 1Z9SA 4LFHD 1IKFL 3FT3B 1OAQL 4ODUA 5DJ8A 3QXUA 4YHZH 4TPRL 3CU1A 1YEKL 3ZKMC 3QEQB 1GGUA 1G1CA 4ZFGL 4G5ZH 2B2XL 4QRSB 4XCYB 2KH2B 4Y5XA 2FH6A 5HGGS 2PYFB 2YD5A 5GZND 5E00B 1G7LB 1UYWL 3CUPB 4NO3B 5TDPB 4N5UA 5BVJB 2Z8WC 4ZUWB 2F15A 3BN3B 4ERSL 1UCTA 1I8IA 3WKML 1UZ6E 2C4FU 2CRZA 3PQYA 1I1FA 4OJFL 4GXVL 1MCNA 2HT4D 5CUSL 4X8JB 5DURB 4PJ8A 1GGTA 2X41A 2HJFA 3GJFB 1I9RH 2GEEA 2PYED 3VG9C 4JG1L 1TPXC 1YECL 4DKFH 5D1QA 1H9VA 3I9GL 4X98A 5BMFL 5EBWA 5B3NA 2VKWA 4FXLA 3PXJA 5IW1B 5KBNC 4G9FA 4RBPK 5D7IF 5D7LA 5F89B 1CE1H 1G7MA 4CU8A 3GIZL 4LGSB 2F74B 2DYPD 2VXUL 4YDLC 4Z7UA 1EUTA 5I19L 1CR9L 1ZSDA 3OXSA 1RIHL 2OI9B 3DYOA 3NH7H 2AJSH 4JFQB 5F1OB 3S5LA 1JGEA 5DD5L 5IJVA 4P57A 3S98A 3P9MA 1PKOA 4C56D 4ZMAT 3V0VB 4NSKB 4YHML 5FKPA 4DQOL 3QRGH 5HYFA 4WHTA 2PYEB 3K2UH 1AR2A 5D7SH 3QWOA 2ADFL 5J06A 4UDUA 4R7DB 5F9WB 3FB8A 2FJFA 3B9DA 1PD6A 4OZHE 3G6DL 1JV5B 4I0KA 1ZHKA 2CUHA 3P30H 1EK3A 5T1LA 3WUWA 1A6VH 2HYMA 3BO8B 1YEJL 3IFPA 3KPSD 5ADOH 3QISA 3TH2T 3ULUF 4FZ8H 5C0FB 2R0KL 3UTSB 5J11C 2YA1A 5LAXA 3W9DB 1FJ1B 4MJIE 4Y16D 1HHJA 5DEZA 2UUDK 3W9EB 4C56B 4KQ4L 2LU3A 4HC1H 1A6WH 2A6IA 3L1OH 3V9FA 4CGTA 1HOCA 2CDFB 1C16A 5E4EB 5FOBB 1HILA 3IJSB 4MD5A 1YY8B 1BFSA 3EDJA 2BNRB 3R1GL 3ROOB 3KDMA 1Z9LA 3FHQA 3EO1B 4CNIA 4POYA 1CQYA 4MQSB 2YBRB 3PABA 4JVUA 4H20H 2Q8AL 5JW4R 32C2B 2AJZA 1JZ3A 3H3PL 2QSQA 3TFKC 5A2KH 3OJMB 1T83C 2A0LC 1DL7L 2W0KA 5CSZB 1Z3GH 3H7BB 3QQ4B 3M07A 1BGXL 3P11L 4Y16B 1AD9B 2XFXB 2XT1B 3ARFD 2UYLA 3VFNB 1W72A 3JV6A 5ITFA 1I8MB 3K3QA 5D7IE 5DRXA 2Y5EA 1C12B 4I2XE 3ZTJH 1CFBA 1ZAGA 3DX8A 1BFVL 4TNVK 3SE4C 3MLVH 1IGMH 2AQ3A 4LSRL 1V3JA 4Y4KA 5T1KB 1RZJH 2CIIA 4E42B 1XF5B 4XB8A 4LPTA 4H0GA 2MQCA 5HGHB 5TQ0H 2Q7NA 1AY1H 3PWJA 4Z5RA 2OJZL 3DHMA 1WZ1H 4FFYL 1F11A 3VXRA 1CGSL 2HFGH 1F3RB 2Q3ZA 1C5CH 3J7HA 3X17A 1WCBB 3JSSA 3FB6A 3ARFB 4ONOA 5FUCE 1YNKH 4J6RH 5EC1B 1JBJA 3Q48A 4P59H 1BQHB 1V7NH 4ZO9A 4U1LA 2VUOA 3QFJE 5IK3B 5F88B 3BP7A 1Z2KA 1OAKH 3VCLA 2UZYB 5F6IC 2F58H 5ANMA 2HVKA 3DO3A 3QNXB 2UZIH 3T4AB 3ULUE 4NGHH 5IFJA 3H6JA 2F53E 3NCEB 4PRAA 1L7IL 2OM5A 3SDCC 1G7PA 3MRJA 4R2GD 3VXNA 1NAMB 3RPIB 4HKXA 4ZO7A 5C0BE 4AQ1B 1PBYA 2YN5A 3HE6D 1WBYB 4I9WE 1UA6H 4MCZB 4PJCE 4KZDH 4HKBB 1JPFA 4UV7H 2Y36L 5GGVH 4RDQF 2ZUYA 5MENE 2IAND 3PWLA 4LPVA 2JLLA 3VRJA 4HH9A 3MGTB 3TYFA 5IHZA 3E6FA 3GJFK 2YPLE 5GRUH 8CGTA 3WS3A 1KPUB 4M5YL 5DS8A 5E8PA 1MVFA 1PEWA 1TZGH 2AQ1A 1XGUA 5HHVL 5BW7A 3MV7D 4UINH 2EIBA 1TVDA 3F12A 3BVNA 2Z4QB 3VXSA 4ALAH 1BVKA 4M6NL 3A6BL 1P69B 4BZ2H 4R2GB 4XNXH 5E8NA 3EJJX 4WO4A 5EBLB 4XNYH 2IH1A 1LNUB 1QFWM 3G5YB 1D5BB 1QQDA 3OXRA 1MJ7L 2ZG1A 4Y5YB 1G7HA 1I9JL 2G5BB 5TFSL 4U1NB 3V4PL 1T2JA 2Y7QA 4HWBH 1MELA 5GRVL 4N8VB 5CP7A 3H9SA 1MHHA 2D0GA 2EH8H 3Q6GH 1TETL 2H2PC 3RFZC 3MC0A 5DYOB 2DKSA 3SHSA 1N4XH 4IJ3C 4YFDB 2Y72A 3VXMD 4LHUB 1LK3L 3C87A 4F37K 1ITBB 2NW3B 4MNQA 3FRUA 4NWUH 2ADJA 2BERA 1RJLA 3TVMD 2VTFA 3PHQA 5GSRB 3NIDF 2WQ8A 4BM7A 3MCLL 1NFIA 3LH2L 1G9MH 1X5XA 1LEIA 5EBGA 4G8EB 4UOW0 3WDIA 2XRAL 1KBGH 1DBML 5HYJE 2WQRA 2J4WL 3GSVA 3ARDA 1ZS8A 4Y19A 1KG0A 5FA3A 5LVEA 4J7RA 1U8PA 2R1YB 3SKOB 1CL7I 3L5WA 2P43B 1S7WA 4AIZA 4JFZL 3TNMB 3RWCB 4E9LA 4WEUD 5F7FA 3FCTB 1UXSB 3PGCA 4OCXH 3VXMB 1CT8B 3NZHH 4H88H 1I75A 3EDKA 3D0LA 1XF3B 1KJMB 5DUML 1QLFB 1U3HB 3B9KD 4MNGA 4BQ8A 4YQXL 3IDGB 3C6LD 5H94B 2X10A 3W0WA 1H15B 5E8OB 3L3JA 2EC9T 4PJBA 3PL6D 3ZL4L 3EYSH 2FR4A 3MRQB 1DN0B 2C9AA 4L9LC 3IXTB 3U79A 5FA4B 1ZLSL 3VRIB 1DR9A 3HNTH 3ILPB 2X1WL 2HLFC 1S9KC 4Z7NF 1TJHL 5L6YL 1FG2B 4KY1L 1EJ6A 3O81A 1ADQL 3GMNB 2FX8L 4K3JL 1GGCH 4PGCA 3EZJB 1KACB 1PG7X 4G6MH 2ZSVB 4PRID 3REVB 3FTGA 4ZQKA 4OUUA 4NZJA 5C09A 4ZFOB 4ODTH 4JQXC 3KR3H 1DSFL 1VFMA 3B9KB 3VFWA 1FYTA 3EYVA 4ELMB 4LLUA 2MCPL 3CFEA 1IEAB 4JN1H 2QV2A 3MV9D 3QIUB 2RR3A 4MD0B 5HHOD 3N1PC 3TO4B 4OFDA 3L5HA 5BV7H 3JUZA 4PGBB 4K7PY 2ADGA 5BZWB 2DL9A 3IU4H 5FYKU 3GJEB 3TM6A 3ARBB 2CDEA 4U6HB 1FV1B 4ZSOA 4AEIL 3TNNB 5GGRA 2W38A 4I13B 3O0RL 3NIDE 4UIKH 5KAQG 2NY6B 4PRIB 2ESVE 5IQ9A 1SEBB 2IEPA 1JYXA 3G6JF 2Q7YB 4WRLA 5D6CB 5DK0B 3MMEA 1IM9A 1YPZB 5MHSE 3RU8L 1WZMA 1UVQB 1LK2A 3KXFA 3T77A 1FH5H 1TFHA 1DBJH 3S37X 2RJMA 1QBAA 2VXSH 5CIPB 2P8LB 1YC8A 1K4CB 4M61A 4MS8C 1U42A 1NKOA 3BPNB 3F58H 4QEGA 2NY0B 3E2HC 2VLME 3MXWH 2EKSB 3HI6L 3VXUD 2V7HA 2Z0BA 4MXWL 4Z95L 1KELL 3U7WL 5DWUL 4LPYA 4PJFB 1I4FB 5EN2B 1FG9C 4MCYA 3SE8H 4YXKL 1GSMA 1IC1A 5HDLA 3S35H 2BMKA 3SDAC 1S9VB 4PLOB 4JANA 5IF0B 4EEEA 4X6CA 1MNUL 2DQHH 1WBZB 2OTWB 5HVWA 2BJML 5B38B 1CLYH 4QHMB 2HJLA 5D6DC 3WSQL 1J05A 4Z7NE 2F8VA 3VFGH 3KPRB 1KN2L 3FOLB 2F9BT 4OCWH 1JMZA 2DLHA 3TBWB 4EIZC 2D2OA 4PRPB 4LSVH 3RL1A 3H0TA 3VDCA 3GSNB 1FGNH 1NGYB 1G7QA 3VXUB 3AMKA 1U8MA 1W2KT 2VL5A 2C4FT 1S9YB 3MROA 1YNTA 4ZXBC 5F3HA 5TF1H 4X7SH 2Q8BH 3MGAA 4MMXC 3E6HB 5JIKA 2AABH 5EUKB 2JB5L 4LBEB 3FAWA 5JOFB 4P46B 4PJXA 5EU6E 2P5WD 4CADA 3W2DH 4UIMA 1DQQA 3RUGB 4OB5H 1I7ZB 3GSOA 4S10A 1UACL 2IFFH 1Q9KB 2JK5B 1IL1B 3AM8C 4RMRA 3VGDA 2MHAA 4TNWF 2GK0B 3DIFA 1N6QH 1J8HB 2V9QA 3UTQA 4S1RH 1AE6L 5FECB 4LPXA 4RQQA 3UBXA 4JZOA 3DGGA 3RI5F 1MH5A 1BJ8A 3FO9B 5E7BA 4I3RH 5ESVB 3RNKA 3C9NA 3GFUA 1HXMA 3P4OA 5E03A 4LCYB 3TA3B 1SYSA 3EO0A 5JDSA 4WUUA 1X5GA 5I74B 3MRPA 1F00I 2C7UA 4Q97A 4JN2A 1OCWH 5FO9B 1T2QL 1TTFA 2P5WB 1UT9A 3V4VL 3WO4C 1JF5A 4QHLB 2FECI 1I7UB 1TMCB 2PO6D 3U2SA 1LP9B 2NXZD 3A67L 1GHFL 5DRNB 3LSOA 3FFCA 5JDJA 2V2WA 3LS5H 3NFNA 4POZD 5HI3D 3EJYD 1NGWB 1ZHLB 2NY4D 2B1HL 4L4VE 1DQMH 3K7UA 1FNGA 2H6PA 2NTSP 4EI6B 5J3HD 5ECJE 3VA2C 4KJYA 1X5FA 4U3CA 3N9GL 4L3EB 4XPGL 3U36A 2YA2A 4WWKC 5I8EB 1G6RL 4P4KB 4HS6B 4W6XB 4KK9D 1PY9A 1SM3H 1GZPA 3U30C 4EI5A 3FN0L 3RVVD 1EZVY 3OL2A 3PWVA 4QXUL 5FYKL 5HHNB 2VXQL 3OKLA 3BIKA 4Z76A 1A64A 3JTSA 1RK0A 4K71C 1UM6H 2IPTH 2QJDA 4C59B 3FO1B 4KHXL 4DVRH 3HNVL 1Q9WB 5KN5B 5I16B 2AVGA 3B5TA 5C0AB 5FUOL 3SCMA 5DRWB 1LGVA 1Q72H 1S78C 1IRAY 1KN4L 3L5JA 2GJ6D 1QO3A 3QJHA 5CD5C 1KYOJ 1Q1JH 1XCQA 3OKOA 3QYCA 4KK5D 2BVQB 3VFOB 1N6UA 1CTNA 5DC0A 1KYOK 5L2KD 4NOFA 1JK8B 2DLFH 4LCWD 4AK1A 4RA3A 4YC2C 4UILL 4L4TE 1DQDH 1ACZA 3FO2B 3QH3B 5DJZA 1XCTB 4IRJA 1KNOB 4KUCD 3OTTA 1FFPA 5JXAH 4UQ2A 1C5BL 1W72L 1AQKH 1E6OH 1DBAL 3VXRE 1CGYA 2BZDA 1CGXA 5C0IA 4MSWA 5BZDB 3S8WA 4LIQL 4PGDB 3MRMA 1AGEB 5DFVD 4MQTB 3B9EA 3G5VB 3HUJB 3ZSSA 5GS1A 1FL6A 5D7JD 3V6OC 3VFPA 2GJ6B 1K8DA 2P5ED 4UT9H 4I48B 5J89A 5ICZB 3C6SB 1F8TH 3BQUC 4M1CD 5K59F 5L2KB 3HG1E 3P73A 4TRPL 4OKVA 2BC4B 3ZT5A 4CN6A 1MFBL 4HFWA 1OAXH 1S7QB 4YHPA 5J6GB 1B0GB 2YS4A 3LB6D 4JFPB 1QBLH 4BKLA 4WIQA 1NCTA 3LQAC 4JHWH 4F33B 1IKNA 4HS3A 2GTWB 1X5YA 4AEHH 4HJJL 4PJ7F 5KS9F 4UQ3A 1TJGH 1GOHA 5CGTA 3EAKA 3EDDA 4V1DA 1R5WA 3JV4A 4XNMA 3ARYA 3D18B 3X3FL 4IMLA 1ZGLM 1WC7A 2AP2A 1C08B 3ALWA 2X4SA 2Z91A 2HTKD 4BFGA 2R1WB 4HGKC 3QUZD 1I3VA 1E4XH 5IV2B 3ROLA 2FO1A 1MFEL 4K7FB 3E3QE 3KLHC 4KKNA 4JFDB 2FX9H 3TT3L 1JGVH 1A5FH 1D7FA 1FFOB 3BWAB 4HIEA 1CLZH 4EDWL 4KMQA 1VACB 1BWWA 35C8H 1IAOB 1MI5B 1P84K 2HLAA 1HHKB 4NM4H 1QLRB 2VR4A 5E6ID 2E3VA 5AG9A 1KJVB 3KPOB 5C07E 5J9PB 4KUZL 3O4OB 4YBLC 3I75A 1CXIA 2WAHA 2UY6A 1ZLVH 3G08A 3NA9L 4NQDA 3VXPA 3BKCH 4G6FB 5CBAA 5JQ6H 3EBAA 3Q3GA 4UT6L 1IZJA 3GMLA 4Q58C 4ETQA 5GJTL 1A3RH 3F7YB 4RISL 4G3YH 1G6VK 3EFFB 4Q0XL 2X4TB 4QHUA 2R2EB 1T0NB 5DUBA 4O58L 5EUOE 3LRGA 1M05A 1XF4A 4AEFA 4RMTA 2JELL 3BZ4A 4ENEC 4D0BB 5TF0A 4HJGA 3OHXA 1BZ7A 3RTQD 3RZCA 4GKNA 4F8TA 3B2UD 4MNQE 3NAAL 1ZWIA 2ZCLH 5MEQA 5T1DH 5E6IB 2AK4B 4HT1H 4Z0BL 1AXTH 2XNAB 1YQVH 4U6XA 2C26A 3O6KH 4LPWA 1UJ3B 4TTDC 2H45A 4NO2A 4HUNB 4QOKA 1KPVB 4FZEH 1JPGB 1NFDE 2LAGB 5CJQL 2ITCA 5BVPH 5K59E 5ACZB 1ND0B 1MCJA 4MWFA 2CSPA 3QEGL 4M3KB 3LZFL 4M7LT 4KI5C 1ZKAA 3PV7A 4LSQL 4POUB 3M45A 3V7MA 2AEIT 1NSNL 3ES6A 4JO1H 1P6FA 4PPTA 1IGIL 3HE7D 3TJHD 3P0YH 4Y4HC 1II4E 1JRHI 2OK0L 4XWOC 1WSST 3TIEA 3RWHB 1P7KB 4MX7B 3QXDA 5LKNA 3STZA 4PJ7E 1ZTXH 2BVEA 3AC0A 4BFBD 2IF7A 3TBYA 4P23B 1D5XB 2ORBL 2DQUL 5HD8D 5INCB 4QXTA 3UTZB 5E5MB 3VH8A 2DIBA 5E8EA 1OGTA 5B39B 2PETA 3BP6B 4P2OB 2HKHL 3MGOB 5C08E 5F3BB 2PTTB 3DMMC 4TSAL 4EN3C 3WE6A 2J8OA 2VLRE 2XZZA 4LCUA 4TTGA 3BAEL 4UUJB 1HHIB 4CUCA 2CLZB 1S7VB 2FZ3A 3JUYA 2JJWA 2OMBA 3QWQB 4ZFZA 4OM0H 1L9MA 1OSPL 3BIAX 1QSFB 1K4DB 4YWGL 4Z7VB 5IIEA 1O7VA 2EE9A 15C8L 4ODVL 4HIJA 2XQBL 2A6KB 1OY3B 2J2ZA 2HT3D 5E1HB 3BEVB 3RIAF 1UQSA 4HCRL 4GG8A 4K9EC 1S8DB 5IMOB 4PTUA 3ULSB 4JFEB 4PY7A 2DI9A 5T5NG 2P49B 4WGWB 1AH1A 4XRCB 4PJAB 4H26A 2G60L 4KH2A 3CX5J 2I9TA 3U0PB 5I2IA 1FLRH 4KRPC 1EHLH 3CX5K 4NJ9L 1U8IB 4PJ9C 4L8DA 2JIXD 3BZEA 3L3OB 5CEYB 4LASL 3PF2A 1PQZA 2J88L 5DQ9A 1EAJA 4BQ6A 1HYSC 4XNQA 1NBVH 5BRZD 2O5ZH 1OQXA 4ODXA 3W5NA 2X89D 3LKSA 2VDLL 2GT9A 4O02H 2EEAA 4ODBD 2NX5A 4JFYA 4HF5L 3FQNB 5B21A 2VZSA 3SKMB 3FN3A 2ZKHL 5JZ7C 5GGTL 4NQEB 2BCKB 1J8KA 3SDDC 3MRIB 4I18A 4WU7B 4NYLB 3RWEA 4PG2C 3KPLB 4FQJH 2KKQA 5CBEA 3MRKA 4HWNA 3OR7A 4MA7H 4EOWH 1BHGA 2D7TL 1IGCL 2O5YH 5D9SB 1P1ZB 1CI5A 3MLUH 4HD9A 1YMMD 3CSBA 2XZQL 3ULVF 5GRVK 1CFSB 4JKPL 4LVHC 4OZ4B 3QDHA 1UCBH 2NY3D 2AGJH 5JHLL 4KHTH 4FQLL 3TCLB 1T1WA 1J1OH 4BH8B 1MAJA 4HKZB 2APWA 1MLCB 1NMAH 4JZJB 3DX9B 5INDA 5ID1A 2H3NB 4X7FC 2K3TA 1P9MA 1A14H 4X6BB 3WHXB 1Q9OA 5HYQA 3L7EA 4FRWA 2EO1A 4L8SB 2L0DA 2P4AB 4HWEH 1JFQL 1T1ZA 5ETUB 5CILH 2WIIA 4FOMA 3RNQB 4XCEB 1AGFA 1DVFC 4CRPA 1FAKT 2FHFA 1N7ML 3JWDH 4XWGL 3T0EC 1CFNA 3MV8A 2H1PH 4UI2A 2A6DB 4LKXB 5SWSD 5HY9B 3VW3H 3T0BA 3FN9A 2OS7A 2GSGA 4X9GA 1XF1A 2NY3B 3N1QC 4P9MH 4GAJH 2LV4A 1MEXL 3J8F7 2FEEL 2D7OA 4C83B 1B4JL 3ZKMD 1YUHA 4RZCB 4O2FB 1AC6A 1EHXA 5AYQA 3D2UD 3OAZH 1A1NB 4OLXL 5DSCB 3V4UL 1WT5A 4J4PD 4XPTL 5BS0B 2OXHA 3PGDA 3MNWA 3L3DA 3GKWL 4O4YL 3NN8A 1CU4H 1XIWD 4LKCB 2HKFH 1XGRA 4HGWB 3M17B 3NMEA 4XVSH 4K23H 2QSVA 4NN6B 3SKNA 1M6OA 3JZ7A 5DJDB 4Y5XC 1GPOL 2ERJB 5TDOA 4ZNEA 5FO7B 5SWSB 3MBEA 4O5LL 4U3HA 3RWIA 3BKJH 2R8SL 4IDLA 4EBQL 4ZFFB 1VPOH 5L0QC 3BPCA 1G6RB 3MO1B 2ED7A 4YDKL 2MMXA 4P2RA 2EXWC 4KGLA 4CBPA 4PJ8C 1A4JA 4CU6A 1A6TA 1J5OL 4JPVL 4F7TA 1GIGH 4PJEE 5D1QC 3ULVE 4PBVC 3TGXA 5ESAB 4X5XB 3PV6B 4BJLA 4DTGH 2FJGB 1B0RB 3BDYL 5B4MD 4PRBB 5IMLB 2FX7L 2KPNA 5EO0B 4NQUA 1JHKH 4L1HA 1EXUB 5FYJL 2BNQA 3WLWC 3VG9B 4XP5H 3DUSB 3Q2CA 5KVEL 2E7CA 5D1XA 1L6XA 3HZMA 5ACMA 1T6WA 5CEZD 5GSVA 5DD6A 3QDJD 4NZUH 4TNVF 3CC5A 4TUKH 2J1KA 4WI8A 3C5SB 1CYGA 1EMTL 2H41A 4AENB 2VDOH 4HUXA 4AG4H 1NDMB 3BUYB 3MFGB 4PJIB 1CDHA 3EZ8A 3VFUB 1T7ZA 4MLSA 4A2LA 3RGVA 2WWMC 3LKPA 1HH6A 2P8MB 3VD5A 3MUGB 3STLA 4EUPH 5CD3B 3C08H 4AM0A 1EBPA 5FK9A 4ONHA 4J3WA 4DGYL 1T3FB 3CLFL 2CKBA 2FBOJ 3BT2L 3V6FA 5DVNA 4CVXA 2APTA 1FP5A 2Z8RA 1RMFL 3QDJB 4X4YB 5IFAH 5CP3H 1NUGA 5IR1B 4OI8A 3VD3A 1DBBH 5JO5B 3TFKD 4U1KB 5J11B 1U95B 2A0LD 2X6MA 5CINH 2WLZA 1Q0YL 5IHLB 1FNHA 4KJPC 3D1MC 5L88H 5H37G 5IHBA 5DJ0A 4JGUA 1FVEB 4O2CA 1D5ZB 2E8ZA 4ZTOH 5CS7A 2RAMA 1EVUA 5F6HJ 1JE6A 1UG9A 2HH0H 1WWWX 3GK8L 4GBXB 2IAMC 2DQDL 3SKUD 4F7CB 3BSZL 1OB1B 1JGLL 1RUKH 4CVZB 1HI6B 2XPGB 3SDXB 4JM4H 1AHWA 4LNRA 5DZNA 3T0WA 5C0CD 5IESL 3GRWL 3RHWK 2PN5A 1MHEA 2XKSA 4DGVL 4HWZA 4GKZA 3G6JA 4JRXA 3NPSC 5TH2B 2X1XR 2J6EA 1OGAE 3OKNB 2BXYA 2R69L 1OWWA 4MA1B 3OR6B 5DK2A 4P2QD 3VXTA 5JIHA 1DBKH 3T2NL 2WNGA 1T21B 5AD0B 4KKAC 3HRPA 1T1XB 2A74A 2X70A 4LEXL 1GC1C 2DDQH 4X7EC 3RWDB 1RZKL 4JQVC 4D9LH 2DD8H 4E41A 5DQDH 1EO8L 3MJ9H 2NR6C 3N85H 2ED9A 2C1OA 3UC0H 4H8WH 1LE5A 1MCDA 1U91B 5C0CB 3SJVA 2AS5M 4IOFC 5T3ZD 4F37F 1JZ2A 1M7DA 1R3LB 1U8OB 3QPQC 3REWB 5DXWA 1OM3L 1MY5A 4ZUTA 2EYRB 1RHHA 1QRNE 1MQKL 2YK1L 5HGBB 2ZCKH 3JWOH 4M1GL 2FIKB 2K7QA 4WEBL 1ZT1B 3MRHB 2FO4A 5EZJB 2VH5H 4GW4A 3U4EA 1JNHB 2VE6B 2YD2A 3WIIH 4Z7WB 4NC2B 5MP6H 5F6IB 4PRDB 5TJWK 1KFAL 4XAWH 4OFPA 1BWMA 4LDOB 3MRBA 1JI2A 4B50A 3O45A 4YHKH 4WVRA 3SDCB 1T1YA 4JG0H 5KZCD 5JUEL 5IB5A 5BW7C 1SY6L 3MRRB 3UJIH 5KSBB 5E9DD 2OP4L 3NCYP 3VGFA 1OVZA 1VGEH 1J88A 1MUJB 4XC3L 2J5LB 3MRGB 2E5EA 5DJAB 1KCRL 4OLZH 5EU4B 1VFOA 4WO4C 2ICWB 2RCSH 3CLEL 1MCPH 4E5XB 1BJ1J 2OSLA 1A9BB 1U8KA 5CHNB 3D0VA 4F7EA 5HHXH 3MJGX 1WITA 4OLWL 2P7TA 4GMSH 2H2PD 4XCNB 1TIUA 3FRPA 3UDWA 2WUBL 4HIHB 3S7GA 4JFFA 3PUCA 4XCCL 4X6EB 3X3GL 5JHDB 2NY1C 1QUNA 1MCIA 1ZVSB 3DOSA 3RY5A 3O4LA 5E9DB 1AGDA 4HLJA 5IMMA 4DAGH 3UXFA 3KS0H 4FQIL 3C09C 1KSRA 1NC4A 3MNVB 4RRPA 4WFFD 4YDIL 1KIQB 4IBLT 4IEFB 4HBCL 2PYEE 1F4WL 2Z93A 3DSNA 2YD6A 1L6ZA 4KJQC 3SGJA 4CKVX 4IOIA 3BP4A 2C3WA 3EYFA 4U1SB 4JQIL 2IG2L 4XC1L 4ZG1A 4IJ3B 1BZ9B 1KEMH 2HVJB 5I1GH 1ITCA 4FFVC 1BMGA 4OF8A 1DTUA 3BZFA 4FHBD 4X4ZA 4W81A 3TV3L 1P2CB 5ISZA 1RAMA 4Q74A 2H8PB 4MA3A 1BM3H 4JRWA 4QF1A 5J12C 3ULUL 1CXKA 5CZVL 2BRRH 4M6OH 3RY6A 2ZPKH 4TQEH 4OV5B 4AQOA 4JLRA 1MF2L 2V5RA 1JHTB 5IKCA 2HLFD 5JLZB 2Q86B 3D85A 3BYTA 1PKQB 1MRCH 2X4NB 3NCYS 2VABB 2NNAA 4G43A 4OUOA 4OCSL 4Y4FA 4ZD3H 1NUFA 4PJ5D 4R6UA 4Z8FH 3M1BB 1Q38A 2JJSA 1KJ2H 4KZEL 3GSUA 1BVLA 3KPSE 2L7UA 2LTQC 4O9HH 5TE7H 4NNYA 2DQFA 3QFDA 5IB4A 4ZAKA 1ZLWK 4D9RD 5KTEL 4EUPA 2PUQT 3O8XA 3B9AA 4FQQB 3MCKA 2CLRA 4DZ8A 3DSFL 1NGXB 2VWEC 4NP4H 1OD7A 3UTTD 1IC5H 3X12B 1V7ML 4HUMB 2ZOLA 3PHOA 1E27B 4BFEA 2LU4A 1ZANL 3C60A 1IM3B 4OTXL 5EO1A 5IMKA 1HINH 3LKNB 4M93C 2IBZY 2GFBB 1RURL 2XA8L 4KTDH 2WM0A 3V5HA 4PJ5B 2GY5A 4P3DB 5A2FA 4LLMB 1F3DH 1O5DT 1CFTA 1IT9L 3TWCL 1YYLL 2GITA 1CF8H 5D5MF 5SWZA 2NZ9D 5EOCL 1RFDL 4Q2ZB 5JPNB 3GMOA 3WFHA 3V6ZB 2VITB 5HTSA 4ZUSA 2NQCA 5HHMD 1QSEA 4GSDH 4RMVA 2DQIL 5D2LA 1WQVT 5GGSB 4U2ZA 3TP4A 4NKMA 3S4SA 2AXGA 4RAUB 2QR0A 1FL5A 1ZOXA 2DKUA 2CK0H 2BFVH 4MS8D 3LD8B 1GXEA 3NTCH 1TNNA 1EEYB 5ALCL 4ONFH 1YMHA 5JOPD 1HNGA 1XR9B 2DJSA 4B53A 1C1EH 4TSBL 5J4MA 1J0HA 2ZUQC 5EB9A 5DEGA 4NWTH 4LARH 4Y1AD 3ELAT 3Q5OA 1P5VA 4DVBA 1RZJC 5F1NA 1YEEL 5HHMB 1QA9A 3MJ7A 1H8SA 4NO0D 1MFAL 2VDMH 2AKRA 3H42H 5GIRA 4NKIH 3UYPA 1QG3A 2ICWJ 1ERNA 4HUVB 3E2HB 2HTLC 4HUWA 3GGWA 3X11B 4QCIB 4NRXA 3MLYL 1NCDL 5EFIB 5CLTA 4F15B 4ZXBD 4LQ1A 1NQBA 2KUTA 1N26A 3DRTB 1R24A 1JUFB 3KLSA 1KEGH 4IIQA 4K94L 1N0XH 4P5KB 3MLWH 3SDAB 4R4NC 4Y1AB 1V8HA 2PXYA 1MCOL 5BOZG 2VKXA 2YEZA 4JB9H 1PGRB 4NO0B 5C0GB 4FN0A 3QDGD 5FKAA 3TT1L 2VSCA 5EZOL 4BH7B 1R6VA 1T7XA 3WFCH 1PYWB 3KPNA 1AGBB 2IANE 1K6QL 3U9UA 2OTPA 3FB7A 4U05A 4XPHL 4IHOA 1TVHA 2BHZA 1HK6A 5KVDH 2AW2A 2YR3A 2BSSB 2AV1B 2BNQE 4QRUB 4ZXBB 2DQGH 5D5ME 4U7KA 4D0DA 1YEDA 5EU5B 3MV7E 3DV4B 1FNAA 1RZ8B 3L7FB 5J1TC 1XH3B 4I4WB 4V2CB 2QHRL 3C5JB 1NCCH 1S7UA 4LOUC 5I8KH 3SQOL 4Z77A 4KTYA 1QBMH 1TVBA 2F54D 3QO1B 3RX5A 5ILTL 1MPAL 3RAJL 3ISWA 1UM5H 4M6AA 1YPZF 3DV6B 1P4BH 1UJTA 1Z5LA 3IFOB 4ONGH 1WAAA 2FIRT 1ZHNA 2N7BA 2H2SC 5GS3A 4FTVD 5SV4A 1DCLA 4O00A 1KV3A 1TXKA 4BK5A 4JCMA 4N90E 1E4KC 3VXME 3PP4L 4WWKD 3WS6A 4XVUC 4JM2B 3KYKH 1OAYL 1ZE3C 3GMRA 3MQIA 3F8UB 3TBVA 1A6PA 1SYVA 5F7HA 2QADC 3RDTA 1U8HB 3HI5L 3S35X 3IDJA 1ACYL 4PJFF 3QHZH 3QO0B 5T1MA 5C7XH 1UENA 3NCJL 1FIGL 1ZT7A 3K81A 5F96L 4NQVA 1S5IH 2XYCA 4HQQL 5IVXA 4JR9H 4PJHE 4L8BB 4EI5C 2GKIA 4K3EL 2ADIA 3NACH 1G9MC 3ZO0A 2W9EL 3S34H 1F90L 1KB9J 1D5MB 4RGMB 3IDYC 1IBGL 4JE4B 1KB9K 4FTVB 4JVWA 3QCUL 1S78D 1R0AH 5CD5D 1TZIB 3QJFB 1FE8L 1BPVA 4WWKB 1I1YB 2H32A 4W68A 5I1EH 1LWRA 4PJGE 5FOJA 4S0SD 4FQXA 3TH3T 2XN9A 1PSKL 4JJ5B 3SCMC 2R0ZL 3L3HB 3O9WB 2NLJA 3T0AA 4KDWA 4HW6A 4MAUH 4QHKJ 3H3KA 5MEOA 3B43A 2NTFB 4KV5F 5AZ2H 3SGKA 1UKSA 4YIQA 4F2MB 4K71B 2GI7A 2DLIA 3RA7L 2R2BB 3RUGF 4FNLH 4MDJB 5BJTA 3S88L 3RKDC 5C8JA 1TQCC 4H1LA 1ORSB 3D3VD 2MKLC 2XWBB 4HPYH 4IRJC 4OZHB 4JRYD 1FAIL 4R96B 4YHNB 1CDGA 1KLGB 3C2AL 5IVZB 3IJYB 3DTXA 1B6DA 1DUYB 4PRIE 3BQUD 4YNYB 4HLZG 4QLRA 5IWLA 3S5LG 3UMTA 1A6AB 4HIXL 2RFXB 3HLAB 4E41E 2OQJB 2DQTH 5GS1C 1KB5A 2P44B 2X7LA 4MJIB 1YPZE 3MV9E 3CK0H 4GW1B 4XCFH 1E4WH 4KKLC 4HS8L 5HHOE 1NEZA 4XXCA 4XMLH 2J6EL 4ZYKB 1UH2A 1U6AH 3KHQA 4M7JL 3MREB 2BOCA 1BAFL 1ZA3A 1QOKA 3QIWC 4NN7C 3T8XB 4OGZA 3QQ3B 2OZ4A 3MOAL 4OD3L 4HFUL 3QAZC 3LV3A 1E6JL 5BV7C 1XGYH 4ZDHA 1IKNC 4PR5B 1RULL 4L29B 5E2UL 1JPST 1HKLH 2J8UE 4AMKH 1E28B 3KLHD 1XZ0A 5I8CA 5IGXL 1R3JB 3TPUB 4I3SH 5I75C 3HNSH 1YDPB 1G7JA 2V5MA 4V2BA 3MACH 2I60H 5FB8B 4G6KL 2FGWH 5DJCB 1BF2A 1JI1A 1EGJH 3EHBC 4XHQA 3FQWB 3FZUC 1W0VA 4L4JA 3U0WL 1QTYT 5D7IB 4YR6A 4I2XB 4TULL 1WCQA 5E99H 2A77L 2XG5A 5MI0B 3FMGL 4YXLH 5DVLA 3VXOA 1KF9B 3VXUE 1P7QA 1FCGA 5EA0L 1KLUB 3UYRL 5H35A 2OL3L 5D1ZB 5GHWL 5ICXA 2VZOA 3S6CA 3VG0L 3HC4L 3GSRB 3LRSA 4ENED 2V2TB 3QXAB 1MJJA 4G6JH 3RUGE 4Z78A 3IKCB 2ICCA 3MLRH 4RFOH 5MEND 3QFJB 5CEXA 3O3BB 4TTDD 5TE4L 4TOYH 4OZIA 3RZCC 2EDJA 3LQZA 4JDVA 5AZEL 1F02I 3CFBA 4MDIA 4XBPB 2ARJQ 1A4KA 4PJDA 1MRDH 2IQAA 3BE1L 2F53B 1AR1D 3IDNB 2EDXA 3SKJL 4IRSA 4KI5D 4RFEB 3C5ZA 4JKLA 5C0DB 3C8KB 4XAKD 1UM4H 2FWOA 3GMQA 4Y4HD 5C0BB 2QLVB 4RGNC 3HFML 1OP3K 2P5WE 3RIFK 4B41A 1N5YL 2AJVH 4R7NA 2QSTA 4LQFL 1BD2A 5DR5H 2D7PA 1MIEL 3BWUC 4Q9QH 3OF6D 3WFDH 5FYLH 4PJCB 1AO7A 3ECBB 1NDGB 2GQHA 4F3FA 5MENB 2YUVA 3UZQA 1K9TA 4NM8L 4YFLI 3TESA 5I1IL 1FNEB 1JWMB 5I1LA 1U8QB 2HWZL 1HDMA 3GBML 3CVHL 5I0DA 3DMMD 5EWIL 4EN3D 2FNBA 4KRNA 2EDOA 3QHFH 3RVXC 1LE9A 1GVIA 3QEUA 1RJCA 1OW0A 4HAGA 4Y4HB 4YXHL 1CL7L 1NGQL 4M4RA 2BK8A 3QG6A 1IC4H 3PXHA 3T2QA 2WINA 3R4DA 3EO9L 5KVMC 4WY7L 4H25A 2PW1A 5JORB 4OM1H 3TIDA 3ORJA 1JPTH 2Z35A 1HEZB 4YO0A 2ENSA 1IAKA 5EOTB 3HS0A 4MQ7B 2VLJD 4P3CL 4A6YL 2F8XC 2NY5C 4EN3B 3BH8B 1A3LH 1OAUL 1I1AA 4WCYH 2ZCHH 3FT3A 3QEQA 5F7NC 3MV11 4Y5VB 1RVFH 3OPZH 4KRPD 4PJ9D 3DXAA 4JFOB 4XCYA 3IDIB 3UJTH 4XTRC 1HYSD 5HYJB 5E00A 4KK8C 1G7LA 3CUPA 4NO3A 4EVNB 5TDPA 5JQHC 5E1AB 4ZUWA 1SBSH 3ET9F 4D8PB 3VMNA 1MWAL 4LVEA 4XMKL 2C3HA 5JZ7D 2VLKD 4D94A 1Y0LB 2A1WH 3DWTA 4FQPA 3SDDD 2XWTB 3QUKB 5L7XL 4X8JA 4K7PL 1F13A 2Z8SA 5TQ2L 4DN4H 3GJFA 2VXTH 4YDVA 1H3PH 2C5DC 5JIPA 3ZHKA 1XGQB 3O3UN 4M48H 4LCWE 5IW1A 3L6FA 4KRPB 4I18C 5F7MC 5DTFB 1YN6A 1RUQH 4JY4A 3S3JA 4ODWA 5DF0A 4HEPG 5SWQB 3UCRA 4OF7A 2XTJD 1OP5K 4M3JA 1QFWH 2W91A 1ZXQA 1HSBB 3O6FB 3OZ9H 4M43L 3B5GA 1G1YA 3F7RA 5HYSG 5J0BA 3V0VA 4OFYA 3SDDB 4NSKA 5A2IH 5I1AB 2P5EE 5JXEC 5EZIL 2AJSL 1D5IH 4QT5B 4OZFH 1VADB 1HWHB 1P9MC 1DVFD 2YD9A 4P48A 4GRWH 3T0ED 3HPLB 4XVTL 4OFKA 1JV5A 4AYFA 3K2UL 3BO8A 5D7SL 3WLBB 1SVZA 2DQJL 1D3CA 1I7TA 3ZHLA 2XOTA 1QFUL 2VDKH 5KAQF 5C0FA 1FQ9C 3UTSA 2OYPA 1DQJB 3O11B 2J12B 1PX4A 3W9DA 1FJ1A 1YNLL 3UPRB 4Z7VF 2MWCA 1VCAA 1A6VL 2EDKA 4J1UB 3W9EA 4C56A 3GIVB 3QCTH 4FZ8L 5IW6B 1T0MB 3RBSA 5TPWH 5TE6H 3WJLA 2FRGP 3MFFB 3I84A 3F5WB 1UB5A 5DJXA 5FOBA 1DVFB 1DQLH 3RX7A 3TN0A 4FFWC 1YY8A 1WT5C 2BNRA 1FO0L 1KJ3H 1HZHH 3Q1SH 3ROOA 1FN4A 5T5FH 2LAAA 1S7RA 3ABZA 3QUMB 4HC1L 1A6WL 3L1OL 4R26L 5DA0B 4WENB 3P4MB 2CJUH 3D9AL 4F7PA 2XWJB 2YBRA 1OAQH 32C2A 1A7BA 3PQYD 4TPRH 1YEKH 2EXWD 4LVOC 3MBEC 1FPTL 2KQMA 3MYZA 5CSZA 3H7BA 3QQ4A 1GCFA 4NQSA 4PJ8D 2XFXA 2VIRB 3IF1B 5ID0B 3VFNA 3AS1A 3DX7A 1I8MA 1UWEH 5D1QD 4ERSH 3DVFA 1Z3GL 4G9FD 5D7LD 2C3VA 3FT4A 4OJFH 4GXVH 2KZWA 5T1KA 4NBYB 4H0IA 4OBSA 4WNQB 1XF5A 4E42A 5GQBA 5HGHA 3ZTJG 5H37H 3WLWD 1IGJB 1LILA 4JG1H 3CDGB 3MLVL 1I1FB 4LLAA 4XZUB 4YAQB 2HG5B 2CKNA 2FECL 1F4YH 4HV8A 1WCBA 4G9DB 5LBSL 4TVPD 3IB4A 4MJ2A 4YFLF 1AY1L 1ORQA 5D1QB 5I19H 4X98B 5D1XC 5F88A 1RIHH 3P4LA 2QQNH 4LLWA 3WFEH 3O41A 4LU5L 4DEPC 3RHWF 2VDQL 2WWMD 3AS2A 1YNKL 5T1LD 4DK3A 3RWJA 1T66C 3G9VA 1V7NL 3X14B 4OCLC 4YHMH 1ZSDB 3OJ2C 4DQOH 3OXSB 3B8YA 4CN4A 1VB9A 2O5XH 7CGTA 2FD6L 4WI5A 5KVGL 2F58L 1V05A 1NAMA 3RPIA 3ILQC 3OGCA 3RGVC 4P57B 2ADFH 5HGAA 2UZIL 1F45A 1WBYA 2YD1A 1I1RA 4Z7OE 4Y2DB 4K3HA 1RZGB 3T0VA 1KIUA 4WHTB 2DMCA 5M94B 1YEJH 1IARB 4UTAH 1VKXA 4DCQB 5GPRA 3FFDB 2O26U 3MGTA 3CMOH 2EH7H 1KPRB 3L5XL 2R0KH 4OV6F 1JNLL 1KPUA 4UU9A 1UA6L 3TC9A 4OLVL 5T1LB 4UV7L 4KJPD 4P2YA 4KQ4H 5GGVL 4DKEH 2Z4QA 1K2DB 5I66B 1YZZA 3IS1X 1TLKA 5D72H 2ICWI 5GRUL 4CJ1A 4YHYC 4L4VB 1ZT4A 3UBXG 1TZGL 2VN4A 1YY9C 1X4XA 4UINL 1VSCA 1LNUA 3G5YA 2GIYA 1D5BA 3R1GH 4ALAL 3RJDA 2KDGA 4Y5YA 1AGCB 1HCFX 4DUWA 1JWUB 4U1NA 2JE8A 3VFTB 2Q8AH 2L7JA 3Q5TA 3H3PH 4XNYL 4N8VA 4NRZB 1VEPA 2W9DH 1BGXH 3GSXB 2FEDD 4LPUA 5DYOA 2DM3A 4CNIB 1AHWC 5FGSA 2PR4L 4LHUA 3PL6C 4QRPA 4XNZC 2NW3A 4HWBL 2OL3B 2AJZB 4R90L 3ULVL 5BRZE 2Q87A 5FV1L 1F6LL 1RZFH 3VXRD 2VN7A 1X9QA 1AFVH 1CFVH 1N4XL 2IAMB 4XHJC 2UYLB 1DFBH 2NR6D 5ITFB 1QR1B 4U0RC 2J8HA 3LY6A 4MJ5A 2APFA 4Q6IB 2B5IC 4IOFD 2D31B 1CQKA 2R1YA 2OJZH 3QPQD 4PS4L 4FFYH 1IILE 3TNMA 3DVGA 1KBGL 2CIIB 3RWCA 3NPSB 3LKRB 1YMME 4L4TB 3FCTA 1UXSA 4KPHL 2F5AH 1CT8A 5I73C 3PWJB 4GOSA 4Z5RB 4J3XA 3O2DH 1R3IH 3PNWB 4FMFA 1KJMA 5DI8B 2MNUA 4YLQT 1U3HA 3VXRB 4LRNH 1X5IA 1D9KB 3IDGA 5H94A 1JN6B 2QSCH 3BMWA 1SMOA 4YUEH 1QYGH 1ZLUH 3FB6B 3IAPA 3NFPB 4FG6C 3NZHL 4H88L 5CJBA 3MRQA 4R4FH 4EDXB 1A3QA 2YRLA 4HDIB 3BYYA 3VCLB 3ESVF 3VRIA 1CDCA 5ANMB 5DHVH 1GGYA 3ILPA 4OQTA 1S3KL 3HG1B 3VI4F 2NXYC 5IFJB 1FG2A 3KG5A 1R3KA 3VXSD 5SWSE 3CVHB 4M7KL 4HMCA 1T04B 1CXLA 1G7PB 2EO9A 3MRJB 3VXNB 3REVA 3HNTL 4DFHA 4WO4D 1KCLA 4ELMA 2BSTA 1IEAA 4JKKA 1GGCL 3QIUA 1GH7A 4MD0A 5HHVH 1JPFB 3TO4A 1H5BA 3ARWA 4PGBA 1TCRA 5BZWA 3PWLB 1PZ5B 1DEDA 4M6NH 1RI8A 2VISB 3GSWB 3ARBA 4PUBH 3H9SD 5DS8B 3BMVA 2NY1D 3IAGC 1XGUB 4QTIH 1FV1A 1EAPB 3TNNA 1Q94B 1MJ8L 3UDWC 4X4XB 1MJ7H 3V52H 2YD3A 4QHKI 4MNQD 3IU4L 4KAQH 4A6YB 4HMEA 1I9JH 2P47B 2XZCH 5E8NB 1SEBA 5TFSH 5C07B 4WO4B 4GQPH 1A0QH 3VWJC 2Q7YA 2IH1B 4KJQD 3WFBH 1JRHL 2AXHA 5D6CA 3X13B 2FGZA 1JVKA 1TETH 5CJ5A 1UVQA 1LK3H 4Y19D 9CGTA 2VZ1A 4FFVD 5CIPA 1MCFA 2P8LA 2VRAA 1UWXK 5EUOB 1K4CA 4NHCL 4HK0B 5FGRA 2NY1B 2EKSA 2W65B 1FH5L 4X4ME 2DWEB 2VXSL 4MNQB 3U0TB 1JPSH 2J4WH 4PJFA 1I4FA 3PHQB 4Z7QF 2EDQA 3MRLB 4BK4A 3F58L 3BX7C 3W0WD 3MXWL 2IPUG 1MCSA 3DXAE 4GRLB 2FDBP 4C4KO 3MR9B 4JFZH 1NFDB 2OTWA 1L9NA 3CIQA 4KROC 4QHMA 3RY6C 3ZTNH 5B38A 2JCCF 5CEZE 4FS0A 4FXKB 1FLTX 5FHBH 1ED3B 3LHPH 3QDJE 3SE8L 4RGOH 3W39B 1YJDC 3KPRA 3CSYB 5EH1A 1U8PB 3TZVA 1QD0A 3FOLA 3OKYA 2DQHL 5DUMH 4YQXH 1VA9A 4PRPA 4P49A 3LEYL 1CLYL 4AY0A 3GSNA 1MAML 1NGYA 2D4FA 4Y4FC 3PGCB 5I71C 5HYSB 1K8IB 1S9YA 5C0EA 3IDUA 2JJSC 2NXZC 3SY0A 1J1XH 5C09D 4K9EH 4WW2B 2DBLH 3E6HA 1ZLSH 1FYTD 4IRZL 4QHNB 1UH4A 5EUKA 4OGAD 5A43C 5KSBF 4LBEA 1YEFH 4LSVL 1GJIA 4P46A 1FGNL 3NIFF 4KY1H 4ZAKC 1I7ZA 2F5BL 4X7SL 5TF1L 5C08B 5JMRA 1ADQH 2X9XA 3O8XC 4RNRB 1FRGL 3DO7A 2WP3T 2JK5A 1IL1A 3OJDB 1T5WA 1QVOB 2GK0A 2H9GA 2D7NA 1J8HA 5GS0L 2LTQB 1W8NA 1WFNA 5EC2A 3RY4A 1NLBH 3KPTA 4KDTA 5FECA 2MCPH 3C60C 1AKJB 2R56L 2IFFL 2AJYL 2CRYA 4PGCB 3LPFA 3DJ9A 3HMXL 2DWDB 1GRWA 2E27H 3SGEI 3FO9A 5ESVA 4NUJB 4KMTL 4QRTB 4OUUB 1N6QL 4LCYA 5DMYA 3TA3A 2XXMB 1FYTB 2VJXA 4UAOC 3VH8G 3PIQA 2OJEB 3CFEB 3D25B 1IM9D 1IEBB 2CMRH 3TBTA 3O2VL 4QHLA 3RI5K 1LP9A 2ATKB 5T5NF 3KXFD 3O0RH 2ADGB 5DRNA 1Q0XL 1I3GL 4F58H 4M93B 5F1IB 1MHPL 1TNMA 5HPMB 3I85A 3B8SA 3VGGA 1OCWL 1NGWA 1ZHLA 3AREA 5HGDB 3MUZ1 2AV7B 5C0CE 4EI6A 5F1SA 2FATL 4NNXA 4Z7QE 3NZ8A 5D71H 3RU8H 2D4DA 3HMWH 4L3EA 2Y4SA 1A47A 5I8EA 1DQML 3D69B 4P2QE 2JCCE 4P4KA 3E0GA 1T5XB 2Q6WB 4JGJA 4JO2L 3VD7A 1M7XA 4W4OA 2HTLD 2KZ1B 2J7LA 4F57H 1DP0A 1TTUA 4Z95H 3IU3A 4HSQA 3U7WH 3U46B 5HHNA 2C3XA 3AS0A 2WIMA 2CO6B 2WBWB 1G9NL 2N7AA 3PDDA 1JTPA 1TZHB 2R2HB 3OB0H 3FO1A 5KSUA 3FKUS 4R4ND 2ZUQB 1MNUH 1Q9WA 4YHIB 5T3ZE 3LCYA 5KN5A 5I16A 5DMIL 4L8CB 1UKQA 2BJMH 2I24N 4F9PA 1M71A 1JTOA 1U93B 3WSQH 1KOAA 4H8WC 5C0AA 1GYAA 5DRWA 3NIFE 1SJEB 4IIQC 3EFDH 5FF6B 3IVKB 5SX4I 3VFOA 4X6CB 4DVRL 4N0YL 1A7RL 1JK8A 4X9FA 3GMPB 2V5YA 4P9HL 2DTML 1T89A 3A6CH 2Q76B 4R0LB 3CH8A 5IEHB 5IT2H 3FO2A 5E2JA 3QH3A 1XCTA 1X6NA 3KYMB 4IOSD 3OAUH 2ZUVA 2JB5H 2MQ0A 3K4ZA 4ZOBA 4EQ2A 3H0TB 4CMMB 5BZDA 3T0XA 1G7QB 1U8MB 4HEME 2VL5B 3TBSA 3N50A 1AGEA 1DQDL 4LSDA 3G5VA 4PTTB 3W82A 5E9DE 3HUJA 4OLYL 4LOUD 4EIGB 4FMKA 2CXKA 2GJ6A 4WUUD 4KU1A 3SDYH 4I48A 1JWSB 5DK3A 4XX1E 4PJXB 7FABH 3C6SA 4UT7L 4UIMB 1AE6H 2R23B 3UYOD 2BC4A 5D2NE 3ARTA 1S7QA 5J6GA 3FFCD 3WNLA 4JFPA 4UT9L 2H2SD 3GMMA 3DIFB 1F8TL 4LLVB 4U1HB 4XVUD 1VGKB 1OAXL 1T2QH 4DOHE 5HBBA 1QBLL 1X5KA 3D18A 2QADD 2XKUA 1CD1A 1C08A 3RNKB 4JHWL 1HXMB 1GHFH 2R0WH 3L3IB 3WS6C 2R1WA 2WBKA 1SYSB 1N3NB 3EO0B 3GO1H 3FHAA 3AU1B 3BI9X 1RIUL 3K8MA 4QWWC 4K7FA 4JN2B 4JFDA 2X09A 4NN5C 4WFFE 1FCCA 1AXIB 3RL2B 1NJ9B 4EI5D 1NAML 4Q9CA 2I9LB 1FFOA 4M02A 5DC4B 1A9EA 3K4DA 3ARUA 3BH9A 3N9GH 1VACA 3NFNB 4LCIH 1IAOA 1MI5A 4XPGH 1HHKA 1N0LA 2GY7B 1QLRA 5IQ7L 1KJVA 3T65A 5J9PA 5E7FA 2H6PB 4PJEB 1A5FL 1BX2A 5GRJL 4KJYB 2B1AL 4PGEB 4UB0H 3FN0H 35C8L 3SCMD 1L7TH 1U8JA 1OT2A 4QXUH 5FYKH 2DM7A 1U8NB 3AMLA 3EFFA 1T0NA 4LMQI 3BKCL 3SGDI 4EI5B 5I17B 5JQ6L 3PE9A 4BZ1L 3RKDD 3IFLH 5EORH 1A3RL 4D0BA 2R0LL 5C70A 2K9UA 3LN5B 2X4UA 4IRJD 5FUOH 3SGKC 3L95B 1RK0B 1KN4H 3P77B 4J3UA 1BLNB 5E6IA 2AK4A 2OMNA 3RZWA 4YEEA 2E8YA 2XNAA 2X4QB 1EO5A 4KVCH 1ZGLA 1UJ3A 4UDTA 4OKDA 1JPGA 2VQTA 1NMCB 3SCMB 5JPMB 5ACZA 2ZCLL 4GFTB 4KKLD 3OKOB 3N0PB 4U0QB 1XF2B 4GUPA 3F62A 5DJYB 1VFBA 4D9RE 1FL3B 1W72H 5IWLC 3FQXB 2AJXL 5GS2D 3P0VL 1U3ZA 1DBAH 4FZEL 2NW2A 4JPKL 3UTTE 1OAZH 1A1MB 1NEUA 1P7KA 5DJZB 4IRJB 5J6HA 2EC9U 4GW5A 4Y2OA 4P23A 1G7IB 4BSVB 4I0PB 2E7BA 4N9GB 4MSWB 4V1DD 5INCA 4AJ0A 4TRPH 5B39A 3THMH 4N68A 4P2OA 3MGOA 1MFBH 2E7MA 1ZTXL 4CDHA 3SE3C 1N8ZB 5GS1B 5F3BA 3VFPB 3VWKA 4X5WB 1P6AB 3VI3F 2PTTA 5HHME 4UUJA 3EHBD 3ZDXE 5F7UA 3FZUD 3P73B 1S7VA 4OKVB 4HJJH 1WVZA 1T20B 2E9JA 3QIWB 4NN7B 5CGYC 1BOYA 4JFXB 1KTLB 4F9LA 3QAZB 4G7VL 4LRIA 5BV7B 3SBWA 1HIMH 2CR6A 2G9HB 2VDPL 1QSFA 5IW3A 1EHNA 5DHYB 3TO2A 2GUOB 4Z7VA 1MFEH 3QI9A 4NQDD 1QNZL 4URTB 1JTTA 5EO9B 3N06B 5T3XD 3BEVA 5D70H 5DHXB 1S8DA 3ME0A 4EDWH 5IMOA 2VOTA 1OGAB 5ESQA 4JFEA 1A7QH 1P4IL 5LGKA 4DZBB 4KUZH 1MIMH 3RIAK 4ZFOL 4XRCA 4PJAA 1KTKE 4UNUA 3R06A 3RZCD 3U0PA 4XPAL 4PP2A 1CZ8H 4UT6H 3JVGA 5CEYA 2VO5A 1FZKB 1WICA 2X1QA 3DROA 1INEL 3WNOA 3WN5B 5F8RC 3DYPA 3QIBB 4QOKD 1SJVA 3R0MA 3NFSH 3Q3GB 3QZWA 1LO3H 1CE6B 4RGND 3FQNA 3SKMA 2R4SH 1A7PL 4WTZG 4TN9A 4IRSC 1QRNB 5DT1L 1ZEAH 3C5ZC 4X0KB 4NQEA 2BCKA 1X6LA 5F7KC 1PW3A 2D7QA 3NAAH 4XVJL 4WU7A 5DUBB 3V5KA 2HFFB 3B9VA 3KPLA 2XXCB 1KXVC 3QDGE 4JPWH 3T3MF 3EYUH 2DQEH 3OBAA 1XR8A 5DLMH 5FGBA 4HJGB 5D9SA 1P1ZA 1BZ7B 3ZYJA 4GKNB 3HZYB 4PFEA 5CJQH 3T1FA 1MCQA 1LO4H 1CFSA 4OZ4A 4FQJL 1LVEA 3LZFH 1OSZA 2HAZA 4J4PC 5LGJB 1AD0B 2Q1EA 5CJOL 4EOWL 2YUWA 3TCLA 5T33L 1FSKC 3RVXD 4HKZA 4QTHB 3VI3E 4NO2B 1IGIH 2O5YL 4QOKB 4YDJB 1MLCA 4JZJA 1XIWC 3MLUL 2OK0H 2ITCB 3BPLC 4NFDA 1UCBL 5GGQH 4KHTL 1FNSH 2H26A 5A2LH 3T0DA 4L8SA 4EXKA 5HHPB 25C8H 2ORBH 2DQUH 2IH3B 1NMAL 1OW0C 5ETUA 2F54E 3OKMA 3RNQA 4XCEA 1A14L 4GAFB 2HKHH 3MA9H 1HQ4A 4YE4L 2A6DA 4LKXA 4HWEL 4MMZC 4TSAH 1CVSC 4L3CB 5CILL 5I0ZA 4FTVE 3BAEH 4QYOB 2MCG1 3MA7A 3E8UH 5KG9B 4NQCA 3JWDL 4QXGL 2EDYA 4H0HB 1A6ZB 4RZCA 3VW3L 5B4MC 3QQNA 1OSPH 3GSNL 1A1NA 4LCUB 5DSCA 3UTOA 4P9ML 1I9EA 4N0RA 1INDH 1X7QA 4GAJL 4YWGH 4XTRD 1I1AC 3D48R 3KPPA 1S7XB 4X9IA 5BS0A 2BRQA 5C2BL 4KK8D 2FHBA 2R4RL 2VLLB 1UB6B 3LMJL 4OCYL 15C8H 1IGFL 4HGWA 3MV01 3M17A 1QPPA 2X4RA 4OT1L 4LSTL 4XGZA 2VDNH 4HCRH 4GG6F 3FRPG 3BD5A 4HIIB 5FO7A 5JA8B 1JGUL 1U8LB 1IGYA 1CU4L 2IMMA 4ZFFA 3ARGA 5CMAB 1XGTB 2W0FB 2X1OA 4K23L 2NX5D 1G6RA 5J7CC 1MFCL 4JVPA 2UWEF 2DYPB 3MO1A 4G42A 2G60H 2X4PB 3GKZA 1YEIH 3SEPA 1WEJL 3T3ME 5JW3H 1LDPH 2I26N 2WLYA 4LASH 5GRZA 1TITA 5L8LB 2WK2A 1TCMA 2VDLH 4H26B 5ESAA 4X5XA 4BSWB 3PV6A 4JHAH 2FJGA 1B0RA 1MJUH 3CFJA 5FXCH 3V0WL 2QTEA 2XTLA 1IZKA 3BZEB 5IMLA 1XGPB 4PJCF 5HI5C 5IB2B 5DQ9B 4GS7C 3D3VE 3VE0B 5GGTH 2XIDA 1BFTA 1GIGL 4GKSB 4JRYE 3V8OA 3MRNB 2GT9B 3V6OE 5JXED 4LLYB 3VDBA 3DUSA 3H9HA 3KPSB 1JNNL 2D7TH