3E2KC

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
160
Chain Sequence
b'AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSRGSAHLWFTDGVLQGKRQWDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 160
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3e2kC01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3e2kC02
3C7UB 3E2LC 3GMUB 4DM5A 1XXMC 5D0QE 3E2KC 2B5RC 2KM7A 3D4EA 5AYWE 1JTGB 5EKQE 2G2UB 2YH9A 2PXGA 3C4OB 5D0OE 3C7VB 1S0WC 3C4PB 2KXXA 2G2WB 3N4IB
chains in the Genus database with same CATH superfamily
3C7UB 3E2LC 3GMUB 4DM5A 3FVCA 1XXMC 5D0QE 3E2KC 2B5RC 3NWFA 2GUMA 2KM7A 3D4EA 5AYWE 3NWDA 1JTGB 5EKQE 2G2UB 2YH9A 2PXGA 3C4OB 3NW8A 5D0OE 3C7VB 1S0WC 3C4PB 2KXXA 2G2WB 3N4IB 4L1RA 4HSIA 3NWAA
chains in the Genus database with same CATH topology
3C7UB 3E2LC 3GMUB 4DM5A 3FVCA 1XXMC 5D0QE 3E2KC 2B5RC 3NWFA 2GUMA 2KM7A 3D4EA 5AYWE 3NWDA 1JTGB 5EKQE 2G2UB 2YH9A 2PXGA 3C4OB 3NW8A 5D0OE 3C7VB 1S0WC 3C4PB 2KXXA 2G2WB 3N4IB 4L1RA 4HSIA 3NWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7U B;  3E2L C;  3GMU B;  4DM5 A;  1XXM C;  5D0Q E;  3E2K C;  2B5R C;  2KM7 A;  3D4E A;  5AYW E;  1JTG B;  5EKQ E;  2G2U B;  2YH9 A;  2PXG A;  3C4O B;  5D0O E;  3C7V B;  1S0W C;  3C4P B;  2KXX A;  2G2W B;  3N4I B; 
#chains in the Genus database with same CATH topology
 3C7U B;  3E2L C;  3GMU B;  4DM5 A;  3FVC A;  1XXM C;  5D0Q E;  3E2K C;  2B5R C;  3NWF A;  2GUM A;  2KM7 A;  3D4E A;  5AYW E;  3NWD A;  1JTG B;  5EKQ E;  2G2U B;  2YH9 A;  2PXG A;  3C4O B;  3NW8 A;  5D0O E;  3C7V B;  1S0W C;  3C4P B;  2KXX A;  2G2W B;  3N4I B;  4L1R A;  4HSI A;  3NWA A; 
#chains in the Genus database with same CATH homology
 3C7U B;  3E2L C;  3GMU B;  4DM5 A;  3FVC A;  1XXM C;  5D0Q E;  3E2K C;  2B5R C;  3NWF A;  2GUM A;  2KM7 A;  3D4E A;  5AYW E;  3NWD A;  1JTG B;  5EKQ E;  2G2U B;  2YH9 A;  2PXG A;  3C4O B;  3NW8 A;  5D0O E;  3C7V B;  1S0W C;  3C4P B;  2KXX A;  2G2W B;  3N4I B;  4L1R A;  4HSI A;  3NWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...