3E2LC

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
164
Chain Sequence
AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSTGFYRGSAHLWFTDGVLQGKRQWDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 164
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3e2lC01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3e2lC02
1JTGB 3GMUB 3C7UB 2G2UB 5D0QE 2KXXA 2YH9A 1XXMC 3D4EA 2PXGA 3E2LC 3E2KC 4DM5A 1S0WC 3C4OB 5EKQE 3C4PB 2KM7A 2G2WB 2B5RC 5AYWE 3N4IB 5D0OE 3C7VB
chains in the Genus database with same CATH superfamily
1JTGB 3GMUB 2GUMA 3NWFA 3NW8A 3C7UB 2G2UB 4L1RA 4HSIA 5D0QE 2KXXA 2YH9A 1XXMC 3D4EA 2PXGA 3E2LC 3E2KC 4DM5A 1S0WC 3C4OB 5EKQE 3C4PB 3NWAA 3NWDA 3FVCA 2KM7A 2G2WB 2B5RC 5AYWE 3N4IB 5D0OE 3C7VB
chains in the Genus database with same CATH topology
1JTGB 3GMUB 2GUMA 3NWFA 3NW8A 3C7UB 2G2UB 4L1RA 4HSIA 5D0QE 2KXXA 2YH9A 1XXMC 3D4EA 2PXGA 3E2LC 3E2KC 4DM5A 1S0WC 3C4OB 5EKQE 3C4PB 3NWAA 3NWDA 3FVCA 2KM7A 2G2WB 2B5RC 5AYWE 3N4IB 5D0OE 3C7VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTG B;  3GMU B;  3C7U B;  2G2U B;  5D0Q E;  2KXX A;  2YH9 A;  1XXM C;  3D4E A;  2PXG A;  3E2L C;  3E2K C;  4DM5 A;  1S0W C;  3C4O B;  5EKQ E;  3C4P B;  2KM7 A;  2G2W B;  2B5R C;  5AYW E;  3N4I B;  5D0O E;  3C7V B; 
#chains in the Genus database with same CATH topology
 1JTG B;  3GMU B;  2GUM A;  3NWF A;  3NW8 A;  3C7U B;  2G2U B;  4L1R A;  4HSI A;  5D0Q E;  2KXX A;  2YH9 A;  1XXM C;  3D4E A;  2PXG A;  3E2L C;  3E2K C;  4DM5 A;  1S0W C;  3C4O B;  5EKQ E;  3C4P B;  3NWA A;  3NWD A;  3FVC A;  2KM7 A;  2G2W B;  2B5R C;  5AYW E;  3N4I B;  5D0O E;  3C7V B; 
#chains in the Genus database with same CATH homology
 1JTG B;  3GMU B;  2GUM A;  3NWF A;  3NW8 A;  3C7U B;  2G2U B;  4L1R A;  4HSI A;  5D0Q E;  2KXX A;  2YH9 A;  1XXM C;  3D4E A;  2PXG A;  3E2L C;  3E2K C;  4DM5 A;  1S0W C;  3C4O B;  5EKQ E;  3C4P B;  3NWA A;  3NWD A;  3FVC A;  2KM7 A;  2G2W B;  2B5R C;  5AYW E;  3N4I B;  5D0O E;  3C7V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...