3E2UA

Crystal structure of the zink-knuckle 2 domain of human clip-170 in complex with cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 1
publication title Structure-function relationship of CAP-Gly domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3e2uA00
2E3IA 2E4HA 1LPLA 1WHHA 1WHMA 2QK0A 2Z0WA 2CP0A 2COWA 3TQ7P 2MPXC 2HKNA 2CP7A 2HKQB 2M02A 3E2UA 2E3HA 3RDVA 1IXDA 1WHKA 2HL5C 2HQHA 1WHGA 2COYA 2HL3A 1TOVA 1WHJA 1WHLA 2COZA 2CP2A 4B6MA 2CP3A 1TXQA 2CP5A 2CP6A
chains in the Genus database with same CATH superfamily
2KQWA 4M78C 3EFSA 3GP8A 1D0XA 2QQRA 1WHMA 3HRUA 2RNAA 1EFNA 2D9TA 1N9RA 2X4JA 1VQMA 2QGFB 3JCMV 5M9OA 4OF1A 4C92G 2CYZB 3CXCA 1FX7A 4M78G 4M77B 3EG2A 1VQLQ 2RQVA 2RA2A 2LX9A 3A98A 1MGQA 1Y0MA 2O9VA 2O4XA 1FMVA 2FPFA 4UC4A 1B34A 1WIEA 5GAOq 1C0MA 1N9SA 2QDYB 4P5NA 2XICA 2GF7A 3NHNA 3EGXA 3OYBA 1CKAA 3X28B 4FYYB 4C8QD 3A5ZB 1QVFA 3OMCA 1YWOA 3CCQQ 4JJBA 3QZ9B 1W1FA 5CAIA 1KC8U 3JB9D 2RHZA 3G4SA 4ELZC 1QKWA 2NWMA 2OTJA 2X51A 4FU6A 2RHXA 3LLRA 2M0OA 2KBTA 2GNCA 4J6YA 1UTIA 3OYAA 1YJ9A 2LNVA 3LGFA 3C12A 1VQ4T 2CP3A 1TXQA 3CCVT 1KQSS 5FRNA 1G5VA 1ZSZB 2P0KA 2DTIA 2RJEA 3NTIA 2CREA 1F1BB 1MHNA 2FPDA 2QK0A 1D1BA 4DQ2A 3OYJA 4XK8E 3H6ZA 1VQPQ 4J9GA 1YITA 2YSQA 4C8QC 3EGDB 2PUKB 1U5SA 2WSCE 4M77F 1UJ0A 4LUDA 5GANe 1RI9A 4DEXA 2LQ8A 1QKXA 4OGEA 1GCQC 3V8LA 5IHIA 1LPLA 4O6JA 1MMDA 4ESRA 4FL6A 2KEAA 3TSZA 1NEBA 3CCSQ 1W2BA 1UUEA 2EVRA 2DXUA 3DB3A 4J7IA 1BKBA 1VQ8Q 5HKCA 5GAOm 4ME7A 5GAOp 2K3BA 3FIFA 3SHWA 2QA4T 3CCMQ 4F7UE 4CC4B 1S72Q 5D6WA 1TU0B 3S6WA 1Q82C 2GTJA 3I56Q 1FMKA 2RI2A 3MP1A 5KYUA 1JXOA 1KQSA 1B7TA 1X01A 2EJGA 1O9SA 4JRPA 2HBWA 2GTOA 2W10A 3EG0A 3L2QA 1WJRA 2HDAA 2DRKA 2YXYA 3M56A 2Y90A 1YI2Q 1ZUKA 3N5BB 5KCOA 2CP5A 1PRLC 1N8RC 2DXCA 3REBB 1VQ9T 4KUDK 4C8QA 1BU1A 3M54A 3ZFJA 2H3EB 4XTWA 2RN8A 5J26A 1VQ5A 4CC3A 1G3WA 5I11A 2DNUA 1GCQA 3QUIA 4M7DB 2HL5C 2DXBA 2QQSA 1WHJA 2VGMA 4JJDA 3OYLA 1YJWT 1X6GA 4R55A 1JJ2P 2DJQA 2BZ8A 4RCCA 3VUBA 1UDLA 4A53A 4F7UG 4CC7A 1M1KU 4LDWA 3SEMA 3KXTA 2WSEE 8ATCB 2GBQA 2J6FA 1PC0A 1NYGA 2H3JA 3OYEA 4HT8A 2OAUA 2BKDN 2COYA 2WSFE 4LXCA 2CDTA 4BE2A 5FW9A 2VUBA 4IURA 1M8VA 3GBQA 4BE0A 3OW2S 3G7ZA 2XIDA 5J3BA 2A3LA 2J06A 3NPFA 1NYFA 3ULRB 2CS7A 1AWOA 1VQ7A 2FRYA 2OTJQ 2DIGA 2VV5A 1LNXA 5HY6A 2DEQA 2NUPB 2D0NA 4BI4A 3G6EA 1UE9A 2KE9A 1VQLT 3GNFB 5IXFA 3S3MA 3DLMA 2L8DA 5FU7B 4E7JA 4HCKA 1K8AC 4OMNA 3H0HA 2HSPA 2CSIA 1QVGP 4XTYA 1YBYA 5GAN3 2KGTA 2MYSA 2K5LA 5CIUA 1CSKA 1Q81R 3OYNA 1YIJA 5CKFA 4DBQA 4KH1B 1KQ1A 3RKYA 4PJOB 4JUVA 3CCQT 3CMAQ 2JUFA 4A4KA 1BK2A 3CC7A 3X25B 3H0IA 5LJ3d 4M7DF 4F17A 4DOVA 1ACMB 2SEMA 4RTVA 1I5OB 1SEMA 2XHCA 2ZAEA 5A0LA 1WLPB 1WYXA 2KAFA 4ZTFA 2KDSA 3OYKA 3LWHA 1XQHA 1BCMA 2XU8A 4JRQA 3UDCA 3UA7A 2DJZA 3KFVA 2EYYA 4EIKA 5GAMg 3CMEA 1K73R 2DL3A 3OS1A 3QPHA 1TS9A 2LDMA 4Y92A 3O8VA 3M0SA 2RK2A 1VQPT 3RESA 4C5GA 4E7HA 2HD0A 4OP0A 3L2UA 1E6GA 2RQWA 5CR2A 3EH2A 2CZ0B 4RG8A 2QTXA 4FM4B 5A0GA 3CCST 4LN2A 3RIRA 2QYZA 4M4ZA 3P8DA 3DLLA 3C4SA 1K9MR 2HEQA 3H0FA 3JRZA 1UGSB 5CQXA 1VQ5Q 2RQTA 1A0NB 1XNIA 2CUDA 3L2RA 3CCMT 3FJPA 3CCET 4PNOA 4PJOF 1S72T 1XOVA 3OYHA 3HSBA 4J7FA 5DY9A 1NLPC 3I56T 2RO0A 2QXFA 2KR3A 3E9FA 2E3IA 3QG1A 3OB9A 1PG5B 4E7KA 3CD6Q 3EH1A 1AVZC 2ED1A 1WHHA 1SKUB 4PK4A 2FO0A 3UT1A 3ASKA 4AG1C 5KE2A 1YI2T 4JS5A 3JCMd 4C92B 4M75B 2BZYA 4JJCA 2CZ7B 1K76A 1NPRA 5KCHA 5GAMd 2DVEA 2F5KA 5I22A 3C95A 3V7CA 1G3TA 2EQUA 3M0TA 3H9NA 2VXFA 3R6OA 4C5IA 4J9HA 1VQ7Q 1M1GA 1OU8A 4D6WA 1I1JA 3NMZC 2MI6A 4MMLA 2HKQB 2M02A 2QQBA 2G6FX 2ABLA 3RDVA 1IXDA 4JLIA 3ZL7C 5DLOA 3FRNA 2IIMA 1QCNA 2K7AA 3EFRA 3PFSA 1UFFA 2R5AA 3RR6A 5IHNA 3OY9A 3VS3A 2KSSA 4AFZC 3MCAB 3SDZA 3BW1A 1W4SA 2ZPEB 2ZCFB 2ECZA 1H3ZA 1JU5C 2OI3A 5ECAA 2RQRA 2NLUA 2LP5A 4AT1B 4MZMA 4XU0A 4PFZA 3UF4A 1T3SA 4F14A 2ZGWA 1M3BA 3QXEB 1SHGA 3MPUB 2OAWA 3CQTA 1UHCA 4BI8B 2JM8A 1AT1B 4FT4A 2KRSA 2VWFA 8AT1B 1WJSA 2FG0A 2O2OA 1QQJA 3EG9B 4DEYA 2RB6A 3JCMb 1JQQA 2QQAA 3CCLA 4NS5A 1I4K1 1VQOA 4C92F 4M75F 4DBFA 2F2VA 2ENMA 5CKDA 4M78F 2E12A 1TWBA 2X4YA 1M8MA 4RTXA 1AZGB 4ATOA 4PFOA 4LD6A 3OYFA 3QJYA 3CMAT 1WXBA 3BE3A 2DAQA 2CGHA 3OW2P 2VGNA 4M7AD 2KYMA 1VQNT 3PE0A 1V76A 4OMQA 1WZOA 2D8JA 2E5KA 3A1PA 1R0CB 3SWNB 1GBRA 1R8OB 4OMOA 3VS6A 4XU1A 4LDYA 4WTOB 2RK1A 2P4TA 2K9GA 2K2VA 2V8KA 4IKFA 2LCLA 2PTKA 2LX7A 2E10A 1OPLA 2RPNA 4D8KA 1OX9A 3RERA 2XKOC 2L3RA 3EHQA 4LUEA 1XJWB 4OMLA 3RMSA 2QDLA 3CC2T 2MPXC 4M78E 3VS1A 1K0SA 2DERA 2NUZA 2R58A 4MMKA 1ZLMA 2BUDA 2DL8A 1AWXA 4M7AC 1R0BG 2QASA 4II1A 1P92A 4FCYA 4FW1A 5KYWB 1Q82R 4EMKB 1WXTA 3LX7A 1VQ5T 4PJOA 1R77A 2H8HA 3PVQA 2XDDA 3CCJT 2CP0A 2HZYA 5IAYA 4E6RA 4F7UB 1IRXA 2IPOB 5CO7A 4E2FB 4BY6C 5GAMj 2KYBA 5LJ3f 2BTTA 1I8FA 1OU9A 1JJ2A 6AT1B 1N8RR 3CD6T 3J7AF 3VYHB 2RJFA 1ZUYA 9ATCB 2EGAA 4D8DA 5IHKA 2HQEA 4LE9A 2XDBA 2PQWA 2YUOA 4R56A 1HSQA 4OB1B 5HK3A 1T0JA 1HYOA 4PFPA 3V8JA 3VRYA 1NG2A 1D3BB 1WFWA 3MP8A 3HHTB 5HCKA 3G71A 1UHFA 2DD4A 4AMCA 3CC4A 2V1QA 2EYZA 5LJ5d 3EHRA 1BIBA 5GAN6 2V8IA 4M7AA 2OTLT 4MZPA 4KBMB 4NL3A 2XK0A 4L5GA 5LL6S 3CCLQ 2HMAA 1OPKA 1Q7YC 3JB9J 3I55A 1QW1A 1VQOQ 1HK9A 3CCRA 2RQUA 1QVGA 1YCYA 2HAXA 2RD1A 1E6HA 4QVCA 4KULA 3P8BB 3HKSA 1QWFA 3M9QA 2NYSA 3BFMA 1NLOC 3EG1A 1VQKA 2D0QB 2KVQG 1ZUUA 4F7UF 1IB8A 1M5Q1 2LT1A 2GFAA 2KRMA 2MF2A 3NTKA 1VQ6A 1NJIU 3S3NA 1K8AR 2ZPHB 3MEAA 1AD5A 3JCMP 2EGCA 2A36A 2JJ9A 1MMNA 4M75A 3PNWC 2CH4W 2EAYA 3EGUA 3JCMf 3QYHB 2DMOA 5GAN5 5KYXB 3EFOA 2ZPGB 2E3HA 5GAMf 3QO3A 2LQNA 4XAXB 1KC8C 2AT1B 1BI3A 2DE0X 4F16A 4C8QG 1U06A 1I07A 3KUFA 4PJNA 3OYDA 1NM7A 1OOTA 3M55A 1FYNA 1EIFA 4X9DA 5FU6C 3JB9G 2CT4A 1RAGB 5GMKl 1KJWA 5C0MA 2BE7D 2JVVA 1Q86U 2AZVA 1YHQA 1YJNT 3HFOA 2AK5A 2DXTA 5GAOr 1AEYA 2AHJB 5EC7A 4TVRA 2IVWA 2K6DA 4ZN3A 2JTEA 4Z89A 3RBBB 1YN8A 2Y4XA 1HXDA 1JB0E 4HA8A 3PIOA 5IH2A 3QKJA 3M0UA 1M4ZA 3QDFA 1H8KA 1X6BA 5GAN2 1M27C 2DBKA 3TEEA 1AOJA 2D8HA 3L2ZA 1VQMQ 2X4WA 1PSFA 1MMGA 1PHTA 2ZPFB 4Z88A 3OYYA 3CBOA 2JMCA 5LJ3g 1M1FA 4WCIA 3JSCA 3CCUT 3DB4A 3IQLA 2DILA 4M77D 2QEXT 1K1ZA 1N6AA 3Q1JA 1TH7A 3HRTA 3UPUA 1UGQB 2LCCA 1NPPA 3OA6A 2J6KA 1T3LA 1SRLA 1RACB 4J9DA 2LCSA 1AWJA 1RAFB 1LCKA 3CCRQ 3SWNA 2EJ9A 1RAEB 2FPEA 2E5QA 5CCAA 5I2MA 1QLYA 2LJ3A 1RADB 4PKCC 1N5ZA 1VQKQ 3G4SQ 1ZBJA 2RHUA 1NBEB 2F2WA 2YLBA 4AFUC 1LVKA 1C6VX 1UEBA 2VYTA 2PVDB 3PMTA 1VQ6Q 1YJ9Q 4M77C 4OB2B 1E7OA 4J9EA 1M1KC 2EIFA 3PMIA 1Y96B 5DM7R 2K3YA 2P4RA 3PGGA 3H41A 4LD9K 3M57A 3PT9A 2B86A 1VQOT 3LYIA 1M2VB 1YITQ 1G3YA 4EMGA 5KYWA 4ZN1A 2EBPA 1MNEA 3L2VA 2HNIA 4F04B 5A0DA 4X1VA 4KRTA 4C0DB 4GLKA 3CBPA 2AIRB 2DO3A 1H641 5CQYA 1WPYA 1M3AA 3FB9A 1VYUA 1KSWA 1KHIA 4XU3A 3OYCA 3JCMg 3OW2A 4HT9A 2QQ9A 2DZ9A 1WDXA 2HQHA 1SHFA 4PJMA 2RJCA 3MHXA 1PRMC 3D7SB 1VQ4A 3CCVA 1ZSZC 3VKIA 4FT2A 2ROTA 4FYXB 4DBHA 5GAOn 2EGEA 2JW4A 2EWNA 3EAEA 1D3BA 2OJ2A 4M77A 1JO8A 3QYGB 1VYTA 2EKOA 2ZPIB 3VYGA 1ZHIA 1WQ7A 2O01E 5FRMA 3VJPA 3URGA 4DOWA 2VASA 3WVEB 2KRNA 5IN1A 5LJ5f 3THKA 4N4HA 1YWPA 3JCMJ 1XTDA 2O4XB 1VQ8T 2K79A 5LJ3h 3ZBDA 4OB0B 1B34B 5CK9A 3OYIA 4X34A 1LJOA 2DKGA 4FSSA 1K9AA 5CKBA 3ZEHA 2JT4A 2YUQA 2P0PA 2RMOA 1I81A 4ORZA 3JB9H 4M7DD 1WXUA 1RUWA 3V8KA 3SD4A 5GMKj 5GMKm 2DZCA 1G3SA 3GPLA 2R5MA 4OVAA 4BD3A 2YRDA 3J81E 3S3OA 5GANg 3JCMX 2XD0A 2O88A 2A0FB 4Z02A 2WACA 2HSEB 1ZSZA 3ER0A 4FIBA 4J6WA 2F2XA 3CBMA 1U3OA 1ZA1B 4M78B 1VOMA 2DK3A 2D6FA 2AZSA 4IIMA 1VQMT 1H3HA 1VQ9A 3L2WA 1SSFA 3FDRA 4RTTA 3EGDA 3NGPA 2YT6A 2A7YA 1M90U 1C1AA 3G6EQ 1ARKA 1Q81U 3RNJA 4XTVA 2DD5A 3I5SA 2L5QA 3CPFA 2FZKB 1OYXA 4M7DC 1Y57A 4DBRA 4JZ4A 4A63B 1KHCA 4KUIA 4JRIA 4JJNK 4L6V5 5FLXE 1YJWA 1BYMA 4J9BA 1Z9QA 2NUTB 3TQ7P 1YIJQ 4AG2C 5J39A 1S1NA 3HPWA 3LH0A 4MZTA 3CC7Q 1TOVA 4PJOD 1VYVA 1YFNA 2RF0A 1K73U 3G4ST 5AYFA 1FXXA 2F1LA 2LQWA 2OTJT 3JCMh 1HJDA 1JRIA 3QDRB 5GAMh 5GANd 1VQ6T 2EQMA 1Q7YR 1YJ9T 2CUBA 5LJ3j 1WHKA 1QMCA 3CMEQ 4N0AA 1CKBA 1VQLA 2COZA 1VIEA 1ZQ1A 3QJ6A 3QHSA 4CC2A 4QQDA 2K5IA 3QBYA 1VQ4Q 5FU7C 3CCVQ 2HBPA 1YITT 2C0IA 4M7DA 4C8QB 1MUZA 1PKSA 1UECA 1K9MU 2MWOA 4PJOC 3MKDA 2ZPBB 3CCQA 1NEGA 2RI5A 4JDSA 2YHTA 3V7RA 4RCBA 4RTWA 4HCCA 2DETA 2ZZDA 5GAOl 2E4HA 3INZA 1U1SA 2ATCB 4XU2A 4PJOG 2COWA 1PKTA 5DLQE 3JV3A 3GLXA 2P0QA 2JN0A 2FB7A 1OX8A 2FEIA 1IO6A 2DYIA 4PLIA 4HVUA 2O31A 4Y28E 1KC8R 3CEYA 3I35A 2ED0A 1PWTA 3MP6A 1SRMA 4IUUA 5LJ5g 4LNPA 4JPBW 3RKXA 2NUPA 2JOYA 3HL8A 1U8RA 3LGLA 3OBYA 5LJ3e 1OI1A 4ZGJB 2EQKA 2HKNA 3M0PA 5CKHA 5D6YA 2K57A 1D09B 4HXJA 3RKWA 3NFCA 4J8OA 4V2SA 1X75C 4J6XA 2LZ6B 4C92D 4M75D 4E7LA 4MDWA 3OSSC 1AWWA 2QAZA 3UWNA 2MWPA 2GCXA 3MJXA 4M78D 1M2VA 3SB2A 3CCSA 3I5RA 3VRZA 4M7AG 4XTXA 3X26B 4C8QF 2MOXA 2KXCA 5KYYB 1M3CA 3CCMA 2CP2A 3CCEA 2V1RA 1S72A 3QWYA 2RHYA 2VB6A 4XQ3A 3I56A 1RLPC 4J5YA 5EG2A 4QQ6A 4K11A 2OX7A 2EQJA 1TSFA 1QCFA 2CP7A 2CZ1B 3TVTA 2C0TA 4JLGA 4PJLA 1Q86R 2LNHB 1M2OA 3LH5A 4IIOA 4N4IA 1PNJA 2X3WD 3M59A 2QG9B 1YI2A 1X6OA 4C92C 2MMPA 1PSEA 4M75C 1PD1A 5A2QE 1WA7A 1DJ7B 3J80E 1KD1U 3QWXX 1KG1A 2E6ZA 1ZSGA 3CPWS 1VQ7T 2DF6A 4RTYA 1WQWA 1BB9A 2VVKA 1WX6A 1X69A 4QVZA 3G6ET 1D1CA 2HCKA 4M75G 1WI7A 3U23A 2X4XA 1ABQA 4OMPA 1SPKA 1JBMA 2DX1A 1M9SA 2A37A 2G3RA 2PU9B 3TU4K 2DM1A 4C8QE 3JCMQ 3DKMA 4C0GA 2DVJA 4A54A 2C06A 3JCMe 1YIJT 1RLQC 2LJ1A 1J3TA 5GANj 1GFDA 3LWIA 3BDUA 2EFIA 5GAMe 3X20B 1OZ2A 2LC4A 1T0HA 3CC7T 1IREB 2JXBA 3GOXA 4J9CA 5L8RE 3VU3C 2FZCB 3HTRA 1KD1C 1UJYA 3OBWA 4PLLA 1W2BS 3VS5A 2MCNA 1M1KR 4ELYC 3OSVA 2B8AA 1VA7A 1BIAA 2EYXA 4VUBA 3L42A 3TSWA 4GLMA 4C0FA 3C0CA 4C92A 5CVIA 1RI0A 3I9QA 2F69A 4M78A 3CMET 2I0NA 2J05A 3A8LB 3CPWA 3OS0A 2KXDA 5LJ5h 1YP5A 5FWBA 4LDXA 1NZ9A 4FYWB 4BDYA 2J7IA 1QCOA 4KT0E 1N27A 1AZEA 3M0QA 1LOJA 2E70A 1GL5A 2P84A 1QWEA 2QI2A 2DYBA 3F70A 1Q82U 4J9FA 2CT3A 4A4HA 3CMAA 1NJIC 2KI7A 3OQ5A 1IZ6A 3G1JA 2YDLA 4J9IA 4WF2A 3FC3A 2VXEA 3A8GB 3WXMB 2NUTA 3VS0A 4X9CA 1SF9A 1VQNA 1N8RU 2FL7A 3OYMA 3JCMW 4CI0C 2KMTA 2X3XD 2KT1A 2L3QA 3SWNC 5KH6A 4FSXA 1GXIE 1M30A 3R6NA 1IHWA 2JM9A 4ZTJA 2DA9A 4E7SA 3CCEQ 1BI1A 2PVGB 4IUTA 2EKHA 7AT1B 1KK7A 5IT9E 2GQIA 3EG9A 1VUBA 3PIPA 3GNGA 5GANf 4MDXA 4PL6A 1KQ2A 2E65A 4LDVA 2YRCA 3CC2A 1QP2A 1D1AA 1Q86C 1OZ3A 4C5EA 3L1AA 3G71Q 2V26A 2QTVA 3CC4Q 1IGQA 1V29B 2MK5A 2M0YA 2R57A 2YWWA 3ME9A 5CKEA 5I2SA 4EMKC 4M77E 2LVMA 3VV0A 4BACA 3C94A 1G2BA 1MV0B 3TCJA 3CCJA 2DEUA 2L2PA 4ZGDB 3A8HB 3UA6A 1RABB 3I55Q 3LW5E 3QSUA 1G83A 2LJ0A 3VUZA 4OGCA 5LJ5j 1YNZA 1O75A 1NE8A 3CD6A 2BE9B 3TREA 3EG3A 1K8AU 5GJWB 2AKLA 4J83A 2LTOA 4HCBA 2VC8A 1SG5A 3VS4A 1MV3A 1OEBA 1WGSA 3CXCP 2C0OA 2EYWA 2LRQA 4JRKA 1TTHB 5GMKh 2CKKA 2XMFA 1X43A 2PVOB 1IGUA 4EMHA 2E1HA 1H92A 3CCLT 4RTUA 2OTLA 4M77G 4KGXB 2BIVA 4DA4A 3E2UA 2LQKA 2A28A 4C5HA 4EMKA 4EPCA 1OQKA 2YUNA 2DL7A 2FZGB 4YTLA 1QVFP 2DRMA 2MAMA 4OMMA 4HCZA 4F7UA 1Y71A 1FMWA 2BZXA 1M90R 4A4EA 2V8JA 4LDUA 4RKUE 5KYYA 2JTFA 4JS4A 4BI3A 4IUPA 2Y4YA 1EX4A 2E41A 2DIQA 4QQGA 2JNGA 1K4US 5LJ5e 1BI0A 4QW2A 5FWCA 1HD3A 2L3PA 2W0ZA 3CPWP 2EW3A 4R0KA 1YHQQ 4B9XA 3P8HA 1VQNQ 4EDUA 3FLGA 3M53A 4ANJA 2X35A 3FJ5A 2L3SA 1I5LA 1K0XA 3H8ZA 1RAIB 4O5VA 1KFZA 1B07A 2JZ2A 2FYKA 4RTZA 2SRCA 2JS0A 5GMKi 1I0CA 4NL2A 4GY5A 1GCPA 3MO8A 2IG0A 4KGZB 3A8MB 2CZ6B 2VKNA 1UGVA 3OYGA 2X9HA 3M4YA 3CC2Q 4M7AB 2GGRA 1W2BP 2RHIA 3NTHA 5GAN8 1GFCA 3M5AA 4OB3B 4ZGEB 1MMAA 2FRWA 3EGXB 3REAB 1U1TA 1RAAB 2ROLA 4HVWA 2LT4A 2QA4A 4PJJA 3E9GA 4HKEA 4M7DE 1YJNA 2EYQA 2I2LA 4L59A 2M9UA 3JAME 4NOYA 3FEOA 4BY6B 3CCJQ 2GFUA 5GAN7 1ZX6A 1KQSP 3E1SA 2YRVA 2XG8D 1WHLA 2RH2A 3SFMA 5D6XA 1X2KA 2EJFA 1EZZB 1UB4A 2CSQA 3OMGA 2DL5A 4KGVB 2Z0WA 1W70A 5KYXA 4N0AC 4QKUA 1UGPB 2DPPB 3G71T 1Y07A 3M4GA 3O5ZA 3CC4T 4C0ZA 2M51A 3OS5A 1Y7XA 3EFOB 1PCXA 3BY7A 2AKKA 2CP6A 4AFQC 3CCUA 3WVDB 3HRSA 3UATA 4GBQA 2EQIA 1YCSB 2QEXA 1ZA2B 2YLCA 1X27A 2OTLQ 2KY9A 4M7DG 3I55T 3E19A 1ZBXA 3PTAA 1BI2A 4A4FA 3CCRT 4Y91A 2LMJA 5KE3A 4FW2A 4M7AF 2D1XA 3A8OB 5GMKe 1WNLA 2KROA 3QIIA 2JTMA 2KNBB 1PM3A 4PJOE 2CH4A 2DFUA 2GQVA 2K4YA 3T9NA 1VQKT 1QVPA 1V1CA 4XTZA 1M90C 4AFSC 1Q81C 5L23A 3VS7A 4FYVB 5KYUB 3M58A 3HP9A 5IXBA 1G8XA 3MEUA 3GIBA 2O9SA 1SSHA 2M16A 3X24B 1TUDA 3V7SA 1OULA 2JMAA 3HFNA 1D0YA 3M0RA 4OMFB 4E7ZA 5HK0A 3BDLA 2EPDA 2RI3A 4JZ3A 2PUOB 4E47A 1RAHB 2DTHA 2DBMA 4N4GA 1KD1R 2PZ1A 1K73C 1UG1A 5GJVB 4B6MA 3QZ5B 3JCMc 4C0DC 4M7AE 2J6OA 2RJDA 4XTUA 2DTOA 1W6XA 5FU6B 4ZNXA 4BUGA 1OV3A 1YHQT 1MNDA 1TUGB 2A08A 1VIFA 1JXMA 1WJQA 2L0AA 1TUCA 2K2MA 2MIOA 2QA4Q 4CRIA 5GANh 1PD0A 2K5FA 1YJNQ 4RUGA 1JJ2S 1QP3A 1KIKA 1K9MC 1Z9ZA 2DLPA 2F5TX 3MEVA 1VQPA 4BDZA 1NJIR 1TG0A 4Q5WA 1IHVA 1GBQA 5FROA 2QGGA 1Y96A 4Z8AA 5I21A 2KK4A 3META 3CXCS 1RL2A 1D0ZA 4C92E 4M75E 1VQ9Q 1FWZA 2XDPA 4HVVA 4IUVA 1X2QA 4B9WA 2PNIA 3RMQA 1UGRB 5KYNA 3MEWA 2K3XA 3KBGA 4IUQA 1VQ8A 2ESWA 4A4GA 2HQXA 2JS2A 2E6NA 2E64A 5D7UA 2HL3A 2XI9A 1B3QA 2FHDA 3PVLA 3CCUQ 3JB9F 4BB7A 1Q95G 3OS2A 4BE1A 1YJWQ 1GRIA 1QVFS 2RM4A 3AHUA 2YUPA 5C6SA 2QEXQ 2L89A 1QVGS 2M1HA 1ABOA 4QVDA 2FVUA 5GAN4 5AT1B 4E7IA 1JEGA 1BCOA 3JB9I 2KT8A 3VS2A 1WHGA 1BBZA 3GF5A 4QT7A 2DL4A 1AHJB 4KH0B 4RG2A 1Q7YU 3RUXA 3AT1B 4RMOA
chains in the Genus database with same CATH topology
2E3IA 2E4HA 1LPLA 1WHHA 1WHMA 2QK0A 2Z0WA 2CP0A 2COWA 3TQ7P 2MPXC 2HKNA 2CP7A 2HKQB 2M02A 3E2UA 2E3HA 3RDVA 1IXDA 1WHKA 2HL5C 2HQHA 1WHGA 2COYA 2HL3A 1TOVA 1WHJA 1WHLA 2COZA 2CP2A 4B6MA 2CP3A 1TXQA 2CP5A 2CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3I A;  2E4H A;  1LPL A;  1WHH A;  1WHM A;  2QK0 A;  2Z0W A;  2CP0 A;  2COW A;  3TQ7 P;  2MPX C;  2HKN A;  2CP7 A;  2HKQ B;  2M02 A;  3E2U A;  2E3H A;  3RDV A;  1IXD A;  1WHK A;  2HL5 C;  2HQH A;  1WHG A;  2COY A;  2HL3 A;  1TOV A;  1WHJ A;  1WHL A;  2COZ A;  2CP2 A;  4B6M A;  2CP3 A;  1TXQ A;  2CP5 A;  2CP6 A; 
#chains in the Genus database with same CATH topology
 2KQW A;  4M78 C;  3EFS A;  3GP8 A;  1D0X A;  2QQR A;  1WHM A;  3HRU A;  2RNA A;  1EFN A;  2D9T A;  1N9R A;  2X4J A;  1VQM A;  2QGF B;  3JCM V;  5M9O A;  4OF1 A;  4C92 G;  2CYZ B;  3CXC A;  1FX7 A;  4M78 G;  4M77 B;  3EG2 A;  1VQL Q;  2RQV A;  2RA2 A;  2LX9 A;  3A98 A;  1MGQ A;  1Y0M A;  2O9V A;  2O4X A;  1FMV A;  2FPF A;  4UC4 A;  1B34 A;  1WIE A;  5GAO q;  1C0M A;  1N9S A;  2QDY B;  4P5N A;  2XIC A;  2GF7 A;  3NHN A;  3EGX A;  3OYB A;  1CKA A;  3X28 B;  4FYY B;  4C8Q D;  3A5Z B;  1QVF A;  3OMC A;  1YWO A;  3CCQ Q;  4JJB A;  3QZ9 B;  1W1F A;  5CAI A;  1KC8 U;  3JB9 D;  2RHZ A;  3G4S A;  4ELZ C;  1QKW A;  2NWM A;  2OTJ A;  2X51 A;  4FU6 A;  2RHX A;  3LLR A;  2M0O A;  2KBT A;  2GNC A;  4J6Y A;  1UTI A;  3OYA A;  1YJ9 A;  2LNV A;  3LGF A;  3C12 A;  1VQ4 T;  2CP3 A;  1TXQ A;  3CCV T;  1KQS S;  5FRN A;  1G5V A;  1ZSZ B;  2P0K A;  2DTI A;  2RJE A;  3NTI A;  2CRE A;  1F1B B;  1MHN A;  2FPD A;  2QK0 A;  1D1B A;  4DQ2 A;  3OYJ A;  4XK8 E;  3H6Z A;  1VQP Q;  4J9G A;  1YIT A;  2YSQ A;  4C8Q C;  3EGD B;  2PUK B;  1U5S A;  2WSC E;  4M77 F;  1UJ0 A;  4LUD A;  5GAN e;  1RI9 A;  4DEX A;  2LQ8 A;  1QKX A;  4OGE A;  1GCQ C;  3V8L A;  5IHI A;  1LPL A;  4O6J A;  1MMD A;  4ESR A;  4FL6 A;  2KEA A;  3TSZ A;  1NEB A;  3CCS Q;  1W2B A;  1UUE A;  2EVR A;  2DXU A;  3DB3 A;  4J7I A;  1BKB A;  1VQ8 Q;  5HKC A;  5GAO m;  4ME7 A;  5GAO p;  2K3B A;  3FIF A;  3SHW A;  2QA4 T;  3CCM Q;  4F7U E;  4CC4 B;  1S72 Q;  5D6W A;  1TU0 B;  3S6W A;  1Q82 C;  2GTJ A;  3I56 Q;  1FMK A;  2RI2 A;  3MP1 A;  5KYU A;  1JXO A;  1KQS A;  1B7T A;  1X01 A;  2EJG A;  1O9S A;  4JRP A;  2HBW A;  2GTO A;  2W10 A;  3EG0 A;  3L2Q A;  1WJR A;  2HDA A;  2DRK A;  2YXY A;  3M56 A;  2Y90 A;  1YI2 Q;  1ZUK A;  3N5B B;  5KCO A;  2CP5 A;  1PRL C;  1N8R C;  2DXC A;  3REB B;  1VQ9 T;  4KUD K;  4C8Q A;  1BU1 A;  3M54 A;  3ZFJ A;  2H3E B;  4XTW A;  2RN8 A;  5J26 A;  1VQ5 A;  4CC3 A;  1G3W A;  5I11 A;  2DNU A;  1GCQ A;  3QUI A;  4M7D B;  2HL5 C;  2DXB A;  2QQS A;  1WHJ A;  2VGM A;  4JJD A;  3OYL A;  1YJW T;  1X6G A;  4R55 A;  1JJ2 P;  2DJQ A;  2BZ8 A;  4RCC A;  3VUB A;  1UDL A;  4A53 A;  4F7U G;  4CC7 A;  1M1K U;  4LDW A;  3SEM A;  3KXT A;  2WSE E;  8ATC B;  2GBQ A;  2J6F A;  1PC0 A;  1NYG A;  2H3J A;  3OYE A;  4HT8 A;  2OAU A;  2BKD N;  2COY A;  2WSF E;  4LXC A;  2CDT A;  4BE2 A;  5FW9 A;  2VUB A;  4IUR A;  1M8V A;  3GBQ A;  4BE0 A;  3OW2 S;  3G7Z A;  2XID A;  5J3B A;  2A3L A;  2J06 A;  3NPF A;  1NYF A;  3ULR B;  2CS7 A;  1AWO A;  1VQ7 A;  2FRY A;  2OTJ Q;  2DIG A;  2VV5 A;  1LNX A;  5HY6 A;  2DEQ A;  2NUP B;  2D0N A;  4BI4 A;  3G6E A;  1UE9 A;  2KE9 A;  1VQL T;  3GNF B;  5IXF A;  3S3M A;  3DLM A;  2L8D A;  5FU7 B;  4E7J A;  4HCK A;  1K8A C;  4OMN A;  3H0H A;  2HSP A;  2CSI A;  1QVG P;  4XTY A;  1YBY A;  5GAN 3;  2KGT A;  2MYS A;  2K5L A;  5CIU A;  1CSK A;  1Q81 R;  3OYN A;  1YIJ A;  5CKF A;  4DBQ A;  4KH1 B;  1KQ1 A;  3RKY A;  4PJO B;  4JUV A;  3CCQ T;  3CMA Q;  2JUF A;  4A4K A;  1BK2 A;  3CC7 A;  3X25 B;  3H0I A;  5LJ3 d;  4M7D F;  4F17 A;  4DOV A;  1ACM B;  2SEM A;  4RTV A;  1I5O B;  1SEM A;  2XHC A;  2ZAE A;  5A0L A;  1WLP B;  1WYX A;  2KAF A;  4ZTF A;  2KDS A;  3OYK A;  3LWH A;  1XQH A;  1BCM A;  2XU8 A;  4JRQ A;  3UDC A;  3UA7 A;  2DJZ A;  3KFV A;  2EYY A;  4EIK A;  5GAM g;  3CME A;  1K73 R;  2DL3 A;  3OS1 A;  3QPH A;  1TS9 A;  2LDM A;  4Y92 A;  3O8V A;  3M0S A;  2RK2 A;  1VQP T;  3RES A;  4C5G A;  4E7H A;  2HD0 A;  4OP0 A;  3L2U A;  1E6G A;  2RQW A;  5CR2 A;  3EH2 A;  2CZ0 B;  4RG8 A;  2QTX A;  4FM4 B;  5A0G A;  3CCS T;  4LN2 A;  3RIR A;  2QYZ A;  4M4Z A;  3P8D A;  3DLL A;  3C4S A;  1K9M R;  2HEQ A;  3H0F A;  3JRZ A;  1UGS B;  5CQX A;  1VQ5 Q;  2RQT A;  1A0N B;  1XNI A;  2CUD A;  3L2R A;  3CCM T;  3FJP A;  3CCE T;  4PNO A;  4PJO F;  1S72 T;  1XOV A;  3OYH A;  3HSB A;  4J7F A;  5DY9 A;  1NLP C;  3I56 T;  2RO0 A;  2QXF A;  2KR3 A;  3E9F A;  2E3I A;  3QG1 A;  3OB9 A;  1PG5 B;  4E7K A;  3CD6 Q;  3EH1 A;  1AVZ C;  2ED1 A;  1WHH A;  1SKU B;  4PK4 A;  2FO0 A;  3UT1 A;  3ASK A;  4AG1 C;  5KE2 A;  1YI2 T;  4JS5 A;  3JCM d;  4C92 B;  4M75 B;  2BZY A;  4JJC A;  2CZ7 B;  1K76 A;  1NPR A;  5KCH A;  5GAM d;  2DVE A;  2F5K A;  5I22 A;  3C95 A;  3V7C A;  1G3T A;  2EQU A;  3M0T A;  3H9N A;  2VXF A;  3R6O A;  4C5I A;  4J9H A;  1VQ7 Q;  1M1G A;  1OU8 A;  4D6W A;  1I1J A;  3NMZ C;  2MI6 A;  4MML A;  2HKQ B;  2M02 A;  2QQB A;  2G6F X;  2ABL A;  3RDV A;  1IXD A;  4JLI A;  3ZL7 C;  5DLO A;  3FRN A;  2IIM A;  1QCN A;  2K7A A;  3EFR A;  3PFS A;  1UFF A;  2R5A A;  3RR6 A;  5IHN A;  3OY9 A;  3VS3 A;  2KSS A;  4AFZ C;  3MCA B;  3SDZ A;  3BW1 A;  1W4S A;  2ZPE B;  2ZCF B;  2ECZ A;  1H3Z A;  1JU5 C;  2OI3 A;  5ECA A;  2RQR A;  2NLU A;  2LP5 A;  4AT1 B;  4MZM A;  4XU0 A;  4PFZ A;  3UF4 A;  1T3S A;  4F14 A;  2ZGW A;  1M3B A;  3QXE B;  1SHG A;  3MPU B;  2OAW A;  3CQT A;  1UHC A;  4BI8 B;  2JM8 A;  1AT1 B;  4FT4 A;  2KRS A;  2VWF A;  8AT1 B;  1WJS A;  2FG0 A;  2O2O A;  1QQJ A;  3EG9 B;  4DEY A;  2RB6 A;  3JCM b;  1JQQ A;  2QQA A;  3CCL A;  4NS5 A;  1I4K 1;  1VQO A;  4C92 F;  4M75 F;  4DBF A;  2F2V A;  2ENM A;  5CKD A;  4M78 F;  2E12 A;  1TWB A;  2X4Y A;  1M8M A;  4RTX A;  1AZG B;  4ATO A;  4PFO A;  4LD6 A;  3OYF A;  3QJY A;  3CMA T;  1WXB A;  3BE3 A;  2DAQ A;  2CGH A;  3OW2 P;  2VGN A;  4M7A D;  2KYM A;  1VQN T;  3PE0 A;  1V76 A;  4OMQ A;  1WZO A;  2D8J A;  2E5K A;  3A1P A;  1R0C B;  3SWN B;  1GBR A;  1R8O B;  4OMO A;  3VS6 A;  4XU1 A;  4LDY A;  4WTO B;  2RK1 A;  2P4T A;  2K9G A;  2K2V A;  2V8K A;  4IKF A;  2LCL A;  2PTK A;  2LX7 A;  2E10 A;  1OPL A;  2RPN A;  4D8K A;  1OX9 A;  3RER A;  2XKO C;  2L3R A;  3EHQ A;  4LUE A;  1XJW B;  4OML A;  3RMS A;  2QDL A;  3CC2 T;  2MPX C;  4M78 E;  3VS1 A;  1K0S A;  2DER A;  2NUZ A;  2R58 A;  4MMK A;  1ZLM A;  2BUD A;  2DL8 A;  1AWX A;  4M7A C;  1R0B G;  2QAS A;  4II1 A;  1P92 A;  4FCY A;  4FW1 A;  5KYW B;  1Q82 R;  4EMK B;  1WXT A;  3LX7 A;  1VQ5 T;  4PJO A;  1R77 A;  2H8H A;  3PVQ A;  2XDD A;  3CCJ T;  2CP0 A;  2HZY A;  5IAY A;  4E6R A;  4F7U B;  1IRX A;  2IPO B;  5CO7 A;  4E2F B;  4BY6 C;  5GAM j;  2KYB A;  5LJ3 f;  2BTT A;  1I8F A;  1OU9 A;  1JJ2 A;  6AT1 B;  1N8R R;  3CD6 T;  3J7A F;  3VYH B;  2RJF A;  1ZUY A;  9ATC B;  2EGA A;  4D8D A;  5IHK A;  2HQE A;  4LE9 A;  2XDB A;  2PQW A;  2YUO A;  4R56 A;  1HSQ A;  4OB1 B;  5HK3 A;  1T0J A;  1HYO A;  4PFP A;  3V8J A;  3VRY A;  1NG2 A;  1D3B B;  1WFW A;  3MP8 A;  3HHT B;  5HCK A;  3G71 A;  1UHF A;  2DD4 A;  4AMC A;  3CC4 A;  2V1Q A;  2EYZ A;  5LJ5 d;  3EHR A;  1BIB A;  5GAN 6;  2V8I A;  4M7A A;  2OTL T;  4MZP A;  4KBM B;  4NL3 A;  2XK0 A;  4L5G A;  5LL6 S;  3CCL Q;  2HMA A;  1OPK A;  1Q7Y C;  3JB9 J;  3I55 A;  1QW1 A;  1VQO Q;  1HK9 A;  3CCR A;  2RQU A;  1QVG A;  1YCY A;  2HAX A;  2RD1 A;  1E6H A;  4QVC A;  4KUL A;  3P8B B;  3HKS A;  1QWF A;  3M9Q A;  2NYS A;  3BFM A;  1NLO C;  3EG1 A;  1VQK A;  2D0Q B;  2KVQ G;  1ZUU A;  4F7U F;  1IB8 A;  1M5Q 1;  2LT1 A;  2GFA A;  2KRM A;  2MF2 A;  3NTK A;  1VQ6 A;  1NJI U;  3S3N A;  1K8A R;  2ZPH B;  3MEA A;  1AD5 A;  3JCM P;  2EGC A;  2A36 A;  2JJ9 A;  1MMN A;  4M75 A;  3PNW C;  2CH4 W;  2EAY A;  3EGU A;  3JCM f;  3QYH B;  2DMO A;  5GAN 5;  5KYX B;  3EFO A;  2ZPG B;  2E3H A;  5GAM f;  3QO3 A;  2LQN A;  4XAX B;  1KC8 C;  2AT1 B;  1BI3 A;  2DE0 X;  4F16 A;  4C8Q G;  1U06 A;  1I07 A;  3KUF A;  4PJN A;  3OYD A;  1NM7 A;  1OOT A;  3M55 A;  1FYN A;  1EIF A;  4X9D A;  5FU6 C;  3JB9 G;  2CT4 A;  1RAG B;  5GMK l;  1KJW A;  5C0M A;  2BE7 D;  2JVV A;  1Q86 U;  2AZV A;  1YHQ A;  1YJN T;  3HFO A;  2AK5 A;  2DXT A;  5GAO r;  1AEY A;  2AHJ B;  5EC7 A;  4TVR A;  2IVW A;  2K6D A;  4ZN3 A;  2JTE A;  4Z89 A;  3RBB B;  1YN8 A;  2Y4X A;  1HXD A;  1JB0 E;  4HA8 A;  3PIO A;  5IH2 A;  3QKJ A;  3M0U A;  1M4Z A;  3QDF A;  1H8K A;  1X6B A;  5GAN 2;  1M27 C;  2DBK A;  3TEE A;  1AOJ A;  2D8H A;  3L2Z A;  1VQM Q;  2X4W A;  1PSF A;  1MMG A;  1PHT A;  2ZPF B;  4Z88 A;  3OYY A;  3CBO A;  2JMC A;  5LJ3 g;  1M1F A;  4WCI A;  3JSC A;  3CCU T;  3DB4 A;  3IQL A;  2DIL A;  4M77 D;  2QEX T;  1K1Z A;  1N6A A;  3Q1J A;  1TH7 A;  3HRT A;  3UPU A;  1UGQ B;  2LCC A;  1NPP A;  3OA6 A;  2J6K A;  1T3L A;  1SRL A;  1RAC B;  4J9D A;  2LCS A;  1AWJ A;  1RAF B;  1LCK A;  3CCR Q;  3SWN A;  2EJ9 A;  1RAE B;  2FPE A;  2E5Q A;  5CCA A;  5I2M A;  1QLY A;  2LJ3 A;  1RAD B;  4PKC C;  1N5Z A;  1VQK Q;  3G4S Q;  1ZBJ A;  2RHU A;  1NBE B;  2F2W A;  2YLB A;  4AFU C;  1LVK A;  1C6V X;  1UEB A;  2VYT A;  2PVD B;  3PMT A;  1VQ6 Q;  1YJ9 Q;  4M77 C;  4OB2 B;  1E7O A;  4J9E A;  1M1K C;  2EIF A;  3PMI A;  1Y96 B;  5DM7 R;  2K3Y A;  2P4R A;  3PGG A;  3H41 A;  4LD9 K;  3M57 A;  3PT9 A;  2B86 A;  1VQO T;  3LYI A;  1M2V B;  1YIT Q;  1G3Y A;  4EMG A;  5KYW A;  4ZN1 A;  2EBP A;  1MNE A;  3L2V A;  2HNI A;  4F04 B;  5A0D A;  4X1V A;  4KRT A;  4C0D B;  4GLK A;  3CBP A;  2AIR B;  2DO3 A;  1H64 1;  5CQY A;  1WPY A;  1M3A A;  3FB9 A;  1VYU A;  1KSW A;  1KHI A;  4XU3 A;  3OYC A;  3JCM g;  3OW2 A;  4HT9 A;  2QQ9 A;  2DZ9 A;  1WDX A;  2HQH A;  1SHF A;  4PJM A;  2RJC A;  3MHX A;  1PRM C;  3D7S B;  1VQ4 A;  3CCV A;  1ZSZ C;  3VKI A;  4FT2 A;  2ROT A;  4FYX B;  4DBH A;  5GAO n;  2EGE A;  2JW4 A;  2EWN A;  3EAE A;  1D3B A;  2OJ2 A;  4M77 A;  1JO8 A;  3QYG B;  1VYT A;  2EKO A;  2ZPI B;  3VYG A;  1ZHI A;  1WQ7 A;  2O01 E;  5FRM A;  3VJP A;  3URG A;  4DOW A;  2VAS A;  3WVE B;  2KRN A;  5IN1 A;  5LJ5 f;  3THK A;  4N4H A;  1YWP A;  3JCM J;  1XTD A;  2O4X B;  1VQ8 T;  2K79 A;  5LJ3 h;  3ZBD A;  4OB0 B;  1B34 B;  5CK9 A;  3OYI A;  4X34 A;  1LJO A;  2DKG A;  4FSS A;  1K9A A;  5CKB A;  3ZEH A;  2JT4 A;  2YUQ A;  2P0P A;  2RMO A;  1I81 A;  4ORZ A;  3JB9 H;  4M7D D;  1WXU A;  1RUW A;  3V8K A;  3SD4 A;  5GMK j;  5GMK m;  2DZC A;  1G3S A;  3GPL A;  2R5M A;  4OVA A;  4BD3 A;  2YRD A;  3J81 E;  3S3O A;  5GAN g;  3JCM X;  2XD0 A;  2O88 A;  2A0F B;  4Z02 A;  2WAC A;  2HSE B;  1ZSZ A;  3ER0 A;  4FIB A;  4J6W A;  2F2X A;  3CBM A;  1U3O A;  1ZA1 B;  4M78 B;  1VOM A;  2DK3 A;  2D6F A;  2AZS A;  4IIM A;  1VQM T;  1H3H A;  1VQ9 A;  3L2W A;  1SSF A;  3FDR A;  4RTT A;  3EGD A;  3NGP A;  2YT6 A;  2A7Y A;  1M90 U;  1C1A A;  3G6E Q;  1ARK A;  1Q81 U;  3RNJ A;  4XTV A;  2DD5 A;  3I5S A;  2L5Q A;  3CPF A;  2FZK B;  1OYX A;  4M7D C;  1Y57 A;  4DBR A;  4JZ4 A;  4A63 B;  1KHC A;  4KUI A;  4JRI A;  4JJN K;  4L6V 5;  5FLX E;  1YJW A;  1BYM A;  4J9B A;  1Z9Q A;  2NUT B;  3TQ7 P;  1YIJ Q;  4AG2 C;  5J39 A;  1S1N A;  3HPW A;  3LH0 A;  4MZT A;  3CC7 Q;  1TOV A;  4PJO D;  1VYV A;  1YFN A;  2RF0 A;  1K73 U;  3G4S T;  5AYF A;  1FXX A;  2F1L A;  2LQW A;  2OTJ T;  3JCM h;  1HJD A;  1JRI A;  3QDR B;  5GAM h;  5GAN d;  1VQ6 T;  2EQM A;  1Q7Y R;  1YJ9 T;  2CUB A;  5LJ3 j;  1WHK A;  1QMC A;  3CME Q;  4N0A A;  1CKB A;  1VQL A;  2COZ A;  1VIE A;  1ZQ1 A;  3QJ6 A;  3QHS A;  4CC2 A;  4QQD A;  2K5I A;  3QBY A;  1VQ4 Q;  5FU7 C;  3CCV Q;  2HBP A;  1YIT T;  2C0I A;  4M7D A;  4C8Q B;  1MUZ A;  1PKS A;  1UEC A;  1K9M U;  2MWO A;  4PJO C;  3MKD A;  2ZPB B;  3CCQ A;  1NEG A;  2RI5 A;  4JDS A;  2YHT A;  3V7R A;  4RCB A;  4RTW A;  4HCC A;  2DET A;  2ZZD A;  5GAO l;  2E4H A;  3INZ A;  1U1S A;  2ATC B;  4XU2 A;  4PJO G;  2COW A;  1PKT A;  5DLQ E;  3JV3 A;  3GLX A;  2P0Q A;  2JN0 A;  2FB7 A;  1OX8 A;  2FEI A;  1IO6 A;  2DYI A;  4PLI A;  4HVU A;  2O31 A;  4Y28 E;  1KC8 R;  3CEY A;  3I35 A;  2ED0 A;  1PWT A;  3MP6 A;  1SRM A;  4IUU A;  5LJ5 g;  4LNP A;  4JPB W;  3RKX A;  2NUP A;  2JOY A;  3HL8 A;  1U8R A;  3LGL A;  3OBY A;  5LJ3 e;  1OI1 A;  4ZGJ B;  2EQK A;  2HKN A;  3M0P A;  5CKH A;  5D6Y A;  2K57 A;  1D09 B;  4HXJ A;  3RKW A;  3NFC A;  4J8O A;  4V2S A;  1X75 C;  4J6X A;  2LZ6 B;  4C92 D;  4M75 D;  4E7L A;  4MDW A;  3OSS C;  1AWW A;  2QAZ A;  3UWN A;  2MWP A;  2GCX A;  3MJX A;  4M78 D;  1M2V A;  3SB2 A;  3CCS A;  3I5R A;  3VRZ A;  4M7A G;  4XTX A;  3X26 B;  4C8Q F;  2MOX A;  2KXC A;  5KYY B;  1M3C A;  3CCM A;  2CP2 A;  3CCE A;  2V1R A;  1S72 A;  3QWY A;  2RHY A;  2VB6 A;  4XQ3 A;  3I56 A;  1RLP C;  4J5Y A;  5EG2 A;  4QQ6 A;  4K11 A;  2OX7 A;  2EQJ A;  1TSF A;  1QCF A;  2CP7 A;  2CZ1 B;  3TVT A;  2C0T A;  4JLG A;  4PJL A;  1Q86 R;  2LNH B;  1M2O A;  3LH5 A;  4IIO A;  4N4I A;  1PNJ A;  2X3W D;  3M59 A;  2QG9 B;  1YI2 A;  1X6O A;  4C92 C;  2MMP A;  1PSE A;  4M75 C;  1PD1 A;  5A2Q E;  1WA7 A;  1DJ7 B;  3J80 E;  1KD1 U;  3QWX X;  1KG1 A;  2E6Z A;  1ZSG A;  3CPW S;  1VQ7 T;  2DF6 A;  4RTY A;  1WQW A;  1BB9 A;  2VVK A;  1WX6 A;  1X69 A;  4QVZ A;  3G6E T;  1D1C A;  2HCK A;  4M75 G;  1WI7 A;  3U23 A;  2X4X A;  1ABQ A;  4OMP A;  1SPK A;  1JBM A;  2DX1 A;  1M9S A;  2A37 A;  2G3R A;  2PU9 B;  3TU4 K;  2DM1 A;  4C8Q E;  3JCM Q;  3DKM A;  4C0G A;  2DVJ A;  4A54 A;  2C06 A;  3JCM e;  1YIJ T;  1RLQ C;  2LJ1 A;  1J3T A;  5GAN j;  1GFD A;  3LWI A;  3BDU A;  2EFI A;  5GAM e;  3X20 B;  1OZ2 A;  2LC4 A;  1T0H A;  3CC7 T;  1IRE B;  2JXB A;  3GOX A;  4J9C A;  5L8R E;  3VU3 C;  2FZC B;  3HTR A;  1KD1 C;  1UJY A;  3OBW A;  4PLL A;  1W2B S;  3VS5 A;  2MCN A;  1M1K R;  4ELY C;  3OSV A;  2B8A A;  1VA7 A;  1BIA A;  2EYX A;  4VUB A;  3L42 A;  3TSW A;  4GLM A;  4C0F A;  3C0C A;  4C92 A;  5CVI A;  1RI0 A;  3I9Q A;  2F69 A;  4M78 A;  3CME T;  2I0N A;  2J05 A;  3A8L B;  3CPW A;  3OS0 A;  2KXD A;  5LJ5 h;  1YP5 A;  5FWB A;  4LDX A;  1NZ9 A;  4FYW B;  4BDY A;  2J7I A;  1QCO A;  4KT0 E;  1N27 A;  1AZE A;  3M0Q A;  1LOJ A;  2E70 A;  1GL5 A;  2P84 A;  1QWE A;  2QI2 A;  2DYB A;  3F70 A;  1Q82 U;  4J9F A;  2CT3 A;  4A4H A;  3CMA A;  1NJI C;  2KI7 A;  3OQ5 A;  1IZ6 A;  3G1J A;  2YDL A;  4J9I A;  4WF2 A;  3FC3 A;  2VXE A;  3A8G B;  3WXM B;  2NUT A;  3VS0 A;  4X9C A;  1SF9 A;  1VQN A;  1N8R U;  2FL7 A;  3OYM A;  3JCM W;  4CI0 C;  2KMT A;  2X3X D;  2KT1 A;  2L3Q A;  3SWN C;  5KH6 A;  4FSX A;  1GXI E;  1M30 A;  3R6N A;  1IHW A;  2JM9 A;  4ZTJ A;  2DA9 A;  4E7S A;  3CCE Q;  1BI1 A;  2PVG B;  4IUT A;  2EKH A;  7AT1 B;  1KK7 A;  5IT9 E;  2GQI A;  3EG9 A;  1VUB A;  3PIP A;  3GNG A;  5GAN f;  4MDX A;  4PL6 A;  1KQ2 A;  2E65 A;  4LDV A;  2YRC A;  3CC2 A;  1QP2 A;  1D1A A;  1Q86 C;  1OZ3 A;  4C5E A;  3L1A A;  3G71 Q;  2V26 A;  2QTV A;  3CC4 Q;  1IGQ A;  1V29 B;  2MK5 A;  2M0Y A;  2R57 A;  2YWW A;  3ME9 A;  5CKE A;  5I2S A;  4EMK C;  4M77 E;  2LVM A;  3VV0 A;  4BAC A;  3C94 A;  1G2B A;  1MV0 B;  3TCJ A;  3CCJ A;  2DEU A;  2L2P A;  4ZGD B;  3A8H B;  3UA6 A;  1RAB B;  3I55 Q;  3LW5 E;  3QSU A;  1G83 A;  2LJ0 A;  3VUZ A;  4OGC A;  5LJ5 j;  1YNZ A;  1O75 A;  1NE8 A;  3CD6 A;  2BE9 B;  3TRE A;  3EG3 A;  1K8A U;  5GJW B;  2AKL A;  4J83 A;  2LTO A;  4HCB A;  2VC8 A;  1SG5 A;  3VS4 A;  1MV3 A;  1OEB A;  1WGS A;  3CXC P;  2C0O A;  2EYW A;  2LRQ A;  4JRK A;  1TTH B;  5GMK h;  2CKK A;  2XMF A;  1X43 A;  2PVO B;  1IGU A;  4EMH A;  2E1H A;  1H92 A;  3CCL T;  4RTU A;  2OTL A;  4M77 G;  4KGX B;  2BIV A;  4DA4 A;  3E2U A;  2LQK A;  2A28 A;  4C5H A;  4EMK A;  4EPC A;  1OQK A;  2YUN A;  2DL7 A;  2FZG B;  4YTL A;  1QVF P;  2DRM A;  2MAM A;  4OMM A;  4HCZ A;  4F7U A;  1Y71 A;  1FMW A;  2BZX A;  1M90 R;  4A4E A;  2V8J A;  4LDU A;  4RKU E;  5KYY A;  2JTF A;  4JS4 A;  4BI3 A;  4IUP A;  2Y4Y A;  1EX4 A;  2E41 A;  2DIQ A;  4QQG A;  2JNG A;  1K4U S;  5LJ5 e;  1BI0 A;  4QW2 A;  5FWC A;  1HD3 A;  2L3P A;  2W0Z A;  3CPW P;  2EW3 A;  4R0K A;  1YHQ Q;  4B9X A;  3P8H A;  1VQN Q;  4EDU A;  3FLG A;  3M53 A;  4ANJ A;  2X35 A;  3FJ5 A;  2L3S A;  1I5L A;  1K0X A;  3H8Z A;  1RAI B;  4O5V A;  1KFZ A;  1B07 A;  2JZ2 A;  2FYK A;  4RTZ A;  2SRC A;  2JS0 A;  5GMK i;  1I0C A;  4NL2 A;  4GY5 A;  1GCP A;  3MO8 A;  2IG0 A;  4KGZ B;  3A8M B;  2CZ6 B;  2VKN A;  1UGV A;  3OYG A;  2X9H A;  3M4Y A;  3CC2 Q;  4M7A B;  2GGR A;  1W2B P;  2RHI A;  3NTH A;  5GAN 8;  1GFC A;  3M5A A;  4OB3 B;  4ZGE B;  1MMA A;  2FRW A;  3EGX B;  3REA B;  1U1T A;  1RAA B;  2ROL A;  4HVW A;  2LT4 A;  2QA4 A;  4PJJ A;  3E9G A;  4HKE A;  4M7D E;  1YJN A;  2EYQ A;  2I2L A;  4L59 A;  2M9U A;  3JAM E;  4NOY A;  3FEO A;  4BY6 B;  3CCJ Q;  2GFU A;  5GAN 7;  1ZX6 A;  1KQS P;  3E1S A;  2YRV A;  2XG8 D;  1WHL A;  2RH2 A;  3SFM A;  5D6X A;  1X2K A;  2EJF A;  1EZZ B;  1UB4 A;  2CSQ A;  3OMG A;  2DL5 A;  4KGV B;  2Z0W A;  1W70 A;  5KYX A;  4N0A C;  4QKU A;  1UGP B;  2DPP B;  3G71 T;  1Y07 A;  3M4G A;  3O5Z A;  3CC4 T;  4C0Z A;  2M51 A;  3OS5 A;  1Y7X A;  3EFO B;  1PCX A;  3BY7 A;  2AKK A;  2CP6 A;  4AFQ C;  3CCU A;  3WVD B;  3HRS A;  3UAT A;  4GBQ A;  2EQI A;  1YCS B;  2QEX A;  1ZA2 B;  2YLC A;  1X27 A;  2OTL Q;  2KY9 A;  4M7D G;  3I55 T;  3E19 A;  1ZBX A;  3PTA A;  1BI2 A;  4A4F A;  3CCR T;  4Y91 A;  2LMJ A;  5KE3 A;  4FW2 A;  4M7A F;  2D1X A;  3A8O B;  5GMK e;  1WNL A;  2KRO A;  3QII A;  2JTM A;  2KNB B;  1PM3 A;  4PJO E;  2CH4 A;  2DFU A;  2GQV A;  2K4Y A;  3T9N A;  1VQK T;  1QVP A;  1V1C A;  4XTZ A;  1M90 C;  4AFS C;  1Q81 C;  5L23 A;  3VS7 A;  4FYV B;  5KYU B;  3M58 A;  3HP9 A;  5IXB A;  1G8X A;  3MEU A;  3GIB A;  2O9S A;  1SSH A;  2M16 A;  3X24 B;  1TUD A;  3V7S A;  1OUL A;  2JMA A;  3HFN A;  1D0Y A;  3M0R A;  4OMF B;  4E7Z A;  5HK0 A;  3BDL A;  2EPD A;  2RI3 A;  4JZ3 A;  2PUO B;  4E47 A;  1RAH B;  2DTH A;  2DBM A;  4N4G A;  1KD1 R;  2PZ1 A;  1K73 C;  1UG1 A;  5GJV B;  4B6M A;  3QZ5 B;  3JCM c;  4C0D C;  4M7A E;  2J6O A;  2RJD A;  4XTU A;  2DTO A;  1W6X A;  5FU6 B;  4ZNX A;  4BUG A;  1OV3 A;  1YHQ T;  1MND A;  1TUG B;  2A08 A;  1VIF A;  1JXM A;  1WJQ A;  2L0A A;  1TUC A;  2K2M A;  2MIO A;  2QA4 Q;  4CRI A;  5GAN h;  1PD0 A;  2K5F A;  1YJN Q;  4RUG A;  1JJ2 S;  1QP3 A;  1KIK A;  1K9M C;  1Z9Z A;  2DLP A;  2F5T X;  3MEV A;  1VQP A;  4BDZ A;  1NJI R;  1TG0 A;  4Q5W A;  1IHV A;  1GBQ A;  5FRO A;  2QGG A;  1Y96 A;  4Z8A A;  5I21 A;  2KK4 A;  3MET A;  3CXC S;  1RL2 A;  1D0Z A;  4C92 E;  4M75 E;  1VQ9 Q;  1FWZ A;  2XDP A;  4HVV A;  4IUV A;  1X2Q A;  4B9W A;  2PNI A;  3RMQ A;  1UGR B;  5KYN A;  3MEW A;  2K3X A;  3KBG A;  4IUQ A;  1VQ8 A;  2ESW A;  4A4G A;  2HQX A;  2JS2 A;  2E6N A;  2E64 A;  5D7U A;  2HL3 A;  2XI9 A;  1B3Q A;  2FHD A;  3PVL A;  3CCU Q;  3JB9 F;  4BB7 A;  1Q95 G;  3OS2 A;  4BE1 A;  1YJW Q;  1GRI A;  1QVF S;  2RM4 A;  3AHU A;  2YUP A;  5C6S A;  2QEX Q;  2L89 A;  1QVG S;  2M1H A;  1ABO A;  4QVD A;  2FVU A;  5GAN 4;  5AT1 B;  4E7I A;  1JEG A;  1BCO A;  3JB9 I;  2KT8 A;  3VS2 A;  1WHG A;  1BBZ A;  3GF5 A;  4QT7 A;  2DL4 A;  1AHJ B;  4KH0 B;  4RG2 A;  1Q7Y U;  3RUX A;  3AT1 B;  4RMO A; 
#chains in the Genus database with same CATH homology
 2E3I A;  2E4H A;  1LPL A;  1WHH A;  1WHM A;  2QK0 A;  2Z0W A;  2CP0 A;  2COW A;  3TQ7 P;  2MPX C;  2HKN A;  2CP7 A;  2HKQ B;  2M02 A;  3E2U A;  2E3H A;  3RDV A;  1IXD A;  1WHK A;  2HL5 C;  2HQH A;  1WHG A;  2COY A;  2HL3 A;  1TOV A;  1WHJ A;  1WHL A;  2COZ A;  2CP2 A;  4B6M A;  2CP3 A;  1TXQ A;  2CP5 A;  2CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...