3E2UA

Crystal structure of the zink-knuckle 2 domain of human clip-170 in complex with cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationship of CAP-Gly domains
pubmed doi rcsb
molecule keywords Dynactin subunit 1
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 3e2uA00
2CP2A 2COWA 2CP3A 2E3IA 3E2UA 1TOVA 2COZA 2MPXC 2HKNA 2E3HA 2QK0A 3TQ7P 2HKQB 2HL5C 2COYA 4B6MA 2HQHA 1WHGA 1IXDA 2HL3A 1WHMA 1WHLA 2E4HA 1WHJA 2CP0A 1LPLA 2CP7A 3RDVA 1WHHA 2Z0WA 2CP5A 2CP6A 2M02A 1WHKA 1TXQA
chains in the Genus database with same CATH superfamily
4OMNA 2C0TA 5LJ5d 2BE7D 3EGDB 4IURA 1ZUYA 2JZ2A 2RMOA 1ZUUA 5GAOn 3VS4A 4J9EA 1YI2A 2FG0A 3CCMQ 1N9SA 1VQ9A 5FW9A 2H3EB 4RKUE 1KIKA 2L5QA 1TWBA 2F2XA 1MGQA 4FCYA 1VQ8Q 3V8LA 4LUEA 2HKNA 1ABQA 4EMGA 2XHCA 2AKLA 2K57A 4M78E 3M57A 2FRWA 2JOYA 2DA9A 4R56A 4JS5A 1PNJA 1YP5A 5FU7B 2MIOA 1RLPC 4J9IA 2DL7A 3CCUT 5GAN5 2JNGA 2E41A 1AVZC 2A0FB 1LJOA 3M55A 3OY9A 3E9GA 4KT0E 2QYZA 4M7DD 1B34A 5GAN7 2M51A 3CCRQ 1M3BA 4ORZA 2X3WD 2X3XD 1DJ7B 1NPPA 4A53A 1KD1C 3JSCA 5IHKA 2GFAA 4N4IA 4CI0C 3CCQA 2LDMA 4EMKB 3JCMQ 2M0YA 3KFVA 4BD3A 3MKDA 3JB9G 3E2UA 2F5TX 4FYVB 1OOTA 3NTIA 2K2MA 1MV3A 2A28A 3G4SA 4M77E 3G6ET 1FMVA 1N8RU 1UUEA 2M9UA 2NLUA 4NS5A 3I55T 3ZBDA 1IZ6A 4C0DB 4OMLA 1PRMC 1YITQ 2X4WA 1UGQB 2DBMA 5LJ3g 4E7LA 3TEEA 2DO3A 1Z9QA 1NM7A 2KROA 4HCCA 2FL7A 3C94A 2YUQA 2V8KA 3LYIA 2OJ2A 4XU1A 2OTJT 5KYWA 2PVGB 5LJ5g 2NYSA 3QSUA 2FPDA 1OYXA 4C8QE 4QW2A 1WYXA 3PE0A 4FW1A 4LD9K 1WIEA 2DVJA 2L0AA 3M5AA 4M7DC 2K9GA 2P0PA 4WF2A 1S72T 4FT4A 2R5AA 4MZPA 1YI2Q 1N8RR 3META 4LD6A 2HQEA 1VQ9Q 1RI9A 1SHFA 1ARKA 1M3CA 3OMGA 5GANf 2W10A 1O9SA 1YHQT 2ZPEB 1O75A 1YIJA 1RAHB 4Y91A 3I5RA 2RH2A 3CCSQ 2DRKA 4LDYA 5GAMd 5KYWB 1U3OA 1Y0MA 3VU3C 4BY6C 3JCMf 5I22A 2HCKA 4TVRA 5IXBA 2CDTA 2RHUA 3OB9A 2EJFA 2FEIA 2YDLA 1X27A 1WXUA 1GBRA 4MDXA 1OX9A 2GCXA 5A0DA 1WHKA 2O4XA 2QA4T 1EZZB 1QMCA 1X6OA 2YRDA 3CBMA 5I21A 3URGA 3RESA 2MI6A 4M78G 3NTHA 3CCVT 4L5GA 5D6WA 2KE9A 5CQYA 2EKHA 3F70A 2KDSA 3CCQQ 3CC7T 1I4K1 4F7UA 3BE3A 3VS3A 4ZN1A 2QQBA 2ECZA 2XDBA 1H3HA 1BBZA 1M9SA 3G4SQ 1K1ZA 1WJQA 2DILA 2HBPA 2DL3A 2JJ9A 4BE1A 1FX7A 3VS0A 3M58A 4FYWB 5GAOm 1UTIA 1PRLC 2HEQA 4F17A 1XJWB 2I0NA 2O4XB 3EHQA 3BDLA 2DEUA 5GMKe 1PD1A 4XTWA 4FYXB 5HK3A 3V8KA 3AHUA 5GAN2 1BK2A 4M77G 1GBQA 4HT9A 4F7UB 2HQXA 2HQHA 2X51A 5J26A 2HNIA 5CIUA 1N5ZA 1MMGA 3RERA 2DL4A 2K3YA 1NJIC 2K5FA 4X9CA 2L2PA 4BB7A 3G6EA 2QEXA 1EX4A 1BCMA 3PTAA 2PNIA 3I55A 4OMMA 1AEYA 2E5KA 2DAQA 2DYBA 3H0IA 1CSKA 3NMZC 4YTLA 4JZ3A 5GAMg 3JRZA 4XTZA 2EGCA 1YIJQ 3X26B 1ZHIA 2LT1A 1K8AU 2QDLA 4C8QG 3ULRB 1Y07A 1JXMA 1WQ7A 3A8OB 4R55A 2OTJA 5AYFA 1JJ2P 3CCET 1AWJA 1VQLT 1JEGA 3S3OA 2ZCFB 5GAN8 1QCFA 2CZ6B 5J3BA 4JJDA 1PCXA 1GCQC 1E7OA 1WHGA 4M75C 4M7DA 1S72A 1SSHA 1JBMA 1VIFA 2JUFA 2PVOB 3REAB 2O2OA 2M1HA 3L2UA 4OB0B 4OB2B 4ANJA 1YHQA 2A08A 1Y71A 3EGUA 4RTUA 2YLBA 3OYDA 4X34A 3X24B 1K8AR 5GANd 2K4YA 4QVCA 1WHMA 5FROA 1HJDA 2MOXA 4NL2A 2XIDA 2VGMA 3QG1A 2EQJA 4ME7A 1MNDA 1UJ0A 2M02A 1QQJA 2ZPGB 2QK0A 4XK8E 1K73U 2PZ1A 1OU9A 1V76A 3H9NA 2VXFA 1IO6A 4HCZA 4M7DB 3M0TA 4M75F 1T0JA 2ED0A 3REBB 1N27A 2RQWA 1X75C 2QA4A 1NYFA 3RMSA 3EG3A 4PFOA 3R6OA 3A8MB 4KBMB 4RTTA 4GY5A 1I81A 3GP8A 1RI0A 3A8GB 2CP2A 2A3LA 3LH0A 6AT1B 1FYNA 1Q7YR 3CC7A 4PJOE 3TQ7P 3M0RA 2KR3A 2DMOA 5IHNA 2COYA 4AG2C 3NPFA 2PVDB 2RJDA 2QEXQ 2DL5A 4D8KA 2YRCA 3I55Q 2KI7A 4XTUA 2QGGA 5L23A 1YJWA 2EPDA 4ZTJA 2COZA 1JU5C 2HZYA 4PNOA 4DEYA 3JAME 2E65A 5GAOr 1HYOA 4IIOA 4JLIA 1TUGB 3EHRA 3CPWP 4EMHA 1MNEA 1UDLA 2OTJQ 1A0NB 4EMKC 2EQMA 2JT4A 1KC8U 1PM3A 2EQKA 2JXBA 4C92D 3JCMW 1IGUA 3S6WA 1OQKA 1OEBA 3QYHB 2DX1A 4QQGA 5IH2A 5KCHA 1S72Q 4A4GA 2XI9A 1M5Q1 3P8BB 2MYSA 1YBYA 1D09B 2LRQA 2A7YA 2EJGA 3QJ6A 1JB0E 3UATA 4DA4A 2E70A 4O5VA 5KH6A 1KQ1A 4IIMA 1WA7A 1H92A 2RK1A 2J6FA 4RCBA 2X4JA 2F2VA 1W2BP 2RHZA 3RMQA 3KXTA 3NHNA 1BKBA 1I8FA 4CC4B 1RAIB 1X2KA 3CCEA 1OPLA 1KC8R 1VQLA 2EBPA 2Y4YA 3X25B 3DB3A 3JV3A 3V7CA 4C0ZA 1SRMA 1G3YA 1GCQA 3BDUA 3E19A 2DYIA 4X9DA 3A1PA 2QA4Q 1N8RC 1KHIA 4FM4B 1QVPA 3DB4A 2CZ1B 4C92C 2E12A 2WACA 5AT1B 1VQ5T 4M4ZA 2PU9B 3L1AA 1PD0A 2CH4A 1YNZA 1VYUA 1M1KR 2MWOA 2F2WA 1Q86U 3CPWS 1NLOC 2KY9A 2OX7A 4JRPA 2FPEA 4HXJA 1WPYA 3EFOA 1QVGP 2VC8A 1WNLA 2NUTB 2LQKA 3QXEB 1XNIA 2XMFA 4OF1A 4PJOD 1YJWQ 1G8XA 1PSFA 2HAXA 1JXOA 4LUDA 1VQ7Q 1JJ2A 1TG0A 2CP3A 1UJYA 1ABOA 3ZL7C 1Q82U 2O01E 1W2BS 2EQIA 5FWCA 4E7SA 4A4FA 2EIFA 3THKA 4F14A 1JO8A 4EDUA 4XQ3A 3LWHA 3CCLT 5GMKj 1TXQA 3WVDB 1W4SA 4FU6A 3JCMJ 3CMET 3E1SA 4F7UG 2YUPA 4DBRA 4IUVA 2KVQG 2LX9A 1I1JA 2FZCB 3HRTA 4F16A 4J9GA 4A54A 4KUIA 2CUDA 3QUIA 4FYYB 2IG0A 4E2FB 2NWMA 3SFMA 2DXUA 1RAFB 3PIOA 3ZEHA 1R77A 4J9BA 1VA7A 3FJ5A 1JQQA 1ZQ1A 3CCEQ 1Q82R 5GANh 4EMKA 1YJNT 1VQLQ 2X35A 4JRQA 3DLMA 1I5LA 2L8DA 4C5HA 1QVGS 4VUBA 2FPFA 2K5IA 3EG0A 3FDRA 2G6FX 3JCMh 5CCAA 3M56A 2QQRA 3QYGB 3TVTA 4AFQC 2XDPA 2E3HA 3QHSA 4XTVA 3JB9D 2NUZA 1TSFA 2RA2A 2CSQA 2W0ZA 3CD6T 4F7UF 3A8LB 3IQLA 2J6KA 1VQ6T 1HK9A 1RL2A 2ENMA 1PWTA 2G3RA 2RK2A 3MP6A 2OI3A 2QQSA 3VS2A 1KSWA 1D0ZA 2MWPA 3CPWA 4CC3A 3OYHA 4KGZB 5GMKm 2LZ6B 1PKTA 5CQXA 2CP5A 3EG9A 2R58A 4K11A 2JN0A 3KBGA 2DPPB 1TOVA 4C92A 1VQ5A 2KBTA 2PQWA 5IHIA 4M75E 2RHYA 4J9DA 2HMAA 1IXDA 1K8AC 2HSEB 1ZSZB 2DBKA 3CC2A 2CZ0B 1VUBA 3ME9A 3VS5A 1SG5A 3C95A 2EW3A 2OTLT 1LNXA 3ZFJA 4M7AD 2SEMA 4BDYA 4N4HA 3I9QA 1W2BA 3C0CA 5D6XA 2ZGWA 2EYWA 3QO3A 4JZ4A 1RACB 3GOXA 4DOWA 1VQNT 4BUGA 1PSEA 3EG9B 1D0XA 1ZA2B 3T9NA 4C92B 2DE0X 2E6ZA 2CP6A 1BYMA 4OMQA 4IUTA 2YT6A 3RKWA 1OULA 2ROLA 4WCIA 3G71T 2JW4A 1YFNA 2EGEA 1R0BG 4J9HA 3CCLA 2DXBA 3R6NA 4AT1B 3SWNA 2JM9A 3HPWA 4A4EA 1QCNA 2JS2A 5CKBA 2YRVA 4HT8A 4M7DF 3VKIA 1VQKT 4M78D 1K73C 1Q81R 2M16A 2ZPHB 2DZCA 5DY9A 4A4KA 2PTKA 2VGNA 4E7IA 1SEMA 1QVGA 2LQNA 3P8HA 1K0XA 3OS0A 3NTKA 2AIRB 4M7AC 2KAFA 2L89A 1U1SA 3MEWA 4J9CA 1I0CA 1NE8A 1VQOT 3GIBA 5CK9A 2ZAEA 3X28B 2R57A 1N9RA 1QLYA 2RJCA 3JCMb 2RQVA 3SWNB 4J6WA 2RHXA 3CCUA 1M8MA 3PT9A 1ZUKA 3FRNA 3QJYA 3HTRA 5GAOl 3OYKA 4FIBA 1U5SA 1S1NA 1OX8A 3D7SB 3TU4K 3S3NA 2DZ9A 4M77D 1VQ5Q 2DNUA 1WDXA 1W1FA 2DL8A 2IPOB 1QP3A 4C5EA 5I2SA 3CPFA 1UGRB 3QWXX 2RI3A 2XU8A 5LL6S 5LJ3h 1CKBA 1M2VB 4MZMA 3CD6A 3CC2Q 4BI8B 4B9XA 4J6YA 2CYZB 3UWNA 1KC8C 1GFDA 1VQ6A 1OZ3A 4OGCA 2RD1A 4P5NA 1VQMT 5LJ5h 3I35A 1X01A 4C8QD 4HVVA 1OU8A 5KCOA 2E64A 4A4HA 3OSSC 4M75G 4AFZC 2D6FA 3KUFA 1QW1A 2V1QA 1W6XA 1E6GA 1ACMB 1RABB 1B7TA 2BE9B 5FU6C 3MPUB 3WVEB 2AT1B 2V8IA 1UEBA 1RLQC 4LDVA 3Q1JA 1RAAB 1AWOA 3CCLQ 1K76A 1YJ9T 3U23A 4ELYC 4M77C 1T3LA 2OTLA 2J6OA 1QCOA 2MMPA 3HL8A 3QDRB 5GAN3 3CC4T 5GAN6 3N5BB 1K0SA 3OYAA 1ZX6A 1VQNA 5GJWB 3RNJA 1KQ2A 4MMLA 4HCKA 2IIMA 3CEYA 4KGVB 1U06A 4C5IA 1N6AA 4B6MA 1WGSA 1Q7YU 4KH0B 2KT1A 2BZYA 4NL3A 2RNAA 1VQPT 1IB8A 1Q86C 3G71A 3WXMB 4RUGA 3HP9A 3RR6A 3UDCA 5LJ3j 4L59A 4OMPA 5I11A 2OAUA 2DLPA 4OB3B 4EPCA 1NYGA 3CCUQ 2C06A 3SEMA 5J39A 2DJQA 2WSCE 1F1BB 5KYNA 2MAMA 1VQKA 4BI3A 2EFIA 3PVQA 1IHVA 1OPKA 3M54A 4LDUA 5LJ5j 2DRMA 4RTYA 5CO7A 3OYFA 2YSQA 4Y92A 4C0GA 1HSQA 3O8VA 4RMOA 1GXIE 4JJCA 2QTVA 5CKHA 3CCVA 4M7AA 3CD6Q 4ZN3A 4J83A 1Q82C 1BI3A 4JS4A 1VQOA 1PKSA 1VQ6Q 3LX7A 1E6HA 1SRLA 1UFFA 3JCMe 5HY6A 3G6EQ 1AOJA 3MO8A 1M3AA 3HFOA 3RIRA 4F7UE 9ATCB 1BIAA 2XICA 1QP2A 1HD3A 2LNVA 1LVKA 2D0NA 3RBBB 4AFSC 2JVVA 1D1CA 1I07A 2CH4W 4J7FA 2ROTA 3HRSA 3UPUA 5GAMh 5CVIA 2EYYA 4M7AB 5FRNA 1OZ2A 4NOYA 2ED1A 2V8JA 4HVUA 4M78A 1K9MU 5FWBA 3FIFA 4HVWA 2RO0A 1K9AA 2OTLQ 1M2OA 1VQMA 1D1AA 3CCST 1YWPA 2Y90A 4D6WA 2EYZA 2FRYA 4BE2A 4LXCA 1TTHB 4XU3A 1VQNQ 1FWZA 4JDSA 3UA7A 4RG8A 1U8RA 1YHQQ 1FMWA 1WX6A 2RM4A 2EKOA 2KXDA 1M1KU 4JRIA 2DJZA 2IVWA 2P4RA 2JTEA 7AT1B 1RUWA 1UHCA 1ZSZC 3CXCP 4ZGDB 2V26A 3GLXA 4PLLA 2HD0A 3G71Q 1H641 2FZGB 2EJ9A 4M78B 2VASA 2ABLA 2FO0A 1M90U 2NUTA 1WZOA 3OA6A 1YJ9A 1K9MR 1UE9A 3SD4A 2CKKA 3MEVA 4OMFB 4M77A 2P0KA 2M0OA 2VKNA 5I2MA 5KE3A 1R0CB 2BTTA 2DEQA 1VQKQ 2JS0A 4PJNA 3CC4A 2K2VA 2DKGA 2WSFE 1W70A 3OS1A 4JPBW 4GLMA 2Z0WA 1G2BA 2QASA 3L2VA 4M7DE 3CCVQ 2RI5A 2GQVA 5FU6B 1GFCA 1TUCA 2I2LA 3QPHA 2GFUA 3CC7Q 2K3BA 2XK0A 1VQOQ 2AZVA 4BI4A 1VQPA 4C8QA 3SHWA 2F69A 3JB9H 2CT4A 4Z8AA 8ATCB 1YCYA 1NZ9A 4J5YA 5GAMj 3L2QA 1M90R 2CZ7B 3OBWA 4ZGJB 4M77B 1NLPC 1C1AA 4PL6A 3TREA 4XAXB 2J06A 2EGAA 2DTIA 1SPKA 3OYNA 2YHTA 1B07A 1G3TA 1AZEA 5ECAA 4C92F 5CKFA 2RJFA 2DTOA 1IHWA 2K6DA 1Q95G 2RHIA 4BDZA 3CXCS 4Z88A 4CC2A 1BI1A 2K7AA 3V7RA 4E7HA 2DVEA 4DBFA 2LT4A 1TUDA 4FSXA 4ATOA 4C8QB 5GAOq 2JTMA 3SWNC 4JUVA 4LDXA 1JRIA 2AZSA 2P0QA 2EVRA 1FMKA 4CC7A 1VQMQ 1OI1A 4PLIA 3GNGA 3P8DA 3FLGA 4J9FA 3E9FA 4KRTA 4OGEA 1XOVA 3BY7A 4PFZA 1WJRA 2ESWA 2Y4XA 2D8JA 3RDVA 4DOVA 3FB9A 4XU0A 4IUQA 3MHXA 1KG1A 5DM7R 1SKUB 5LJ3e 3S3MA 1Y57A 1KJWA 1VYTA 2MCNA 2LJ1A 2RQRA 1G5VA 3SB2A 2QDYB 4PJOC 2K5LA 1M1FA 3BFMA 2HKQB 2DK3A 3TSWA 1M8VA 5LJ5e 5GMKi 1YJ9Q 3VRZA 2RPNA 1M27C 1D3BA 1ZBJA 2LQ8A 3BW1A 1WJSA 2DTHA 3I5SA 2RF0A 2QQAA 2YUOA 4PJLA 3CCSA 3GNFB 1I5OB 3HRUA 3CC4Q 4PKCC 3PNWC 5IAYA 2VXEA 1D0YA 1QVFP 2EQUA 1T0HA 2VUBA 4N0AC 3J80E 5EG2A 4ESRA 5A2QE 2FVUA 1K4US 3EFSA 1MUZA 4QT7A 2E10A 4DEXA 2KK4A 2E5QA 2DFUA 1ZSZA 1EIFA 2QGFB 3I56T 1X2QA 4RTWA 2RQUA 1VQPQ 1NPRA 2QI2A 4GBQA 3OW2P 4PJOF 4XU2A 3MCAB 3QZ9B 3OSVA 5HKCA 1D3BB 3EAEA 3TCJA 1QWEA 2GGRA 1WHLA 2FB7A 2GTOA 5GMKl 3MP8A 1ZBXA 4M7DG 1H8KA 2X4XA 2QEXT 3OYGA 3NFCA 5KYYA 2BIVA 3FEOA 2CUBA 1J3TA 2WSEE 4RG2A 3EH2A 2KEAA 2KRSA 3A98A 2EWNA 2AKKA 1Y7XA 4PJJA 4RTXA 5HCKA 2BKDN 5GANj 2GBQA 1B34B 3L2WA 3EG1A 2K3XA 2LC4A 1Q81U 3M53A 1Z9ZA 3OYYA 3UF4A 4E7ZA 2KYMA 2BZ8A 2ZPIB 3CXCA 2DETA 2FZKB 3CCJT 3OYBA 1V1CA 1QVFS 3M0UA 2CP7A 4ZGEB 2CREA 2LP5A 3L2RA 2E1HA 4J8OA 1RADB 2C0OA 5FLXE 1KQSP 2L3PA 1C0MA 5KYYB 5M9OA 1IGQA 4R0KA 2H3JA 2D0QB 1Y96A 4GLKA 1BCOA 2KRNA 1Q7YC 3QWYA 3OW2S 4M7AG 2JM8A 3OYLA 2DIQA 3MEAA 4KH1B 2YLCA 4X1VA 3CMEA 1NEGA 1X43A 1LPLA 1KHCA 2L3RA 3PIPA 1TH7A 3HHTB 2F1LA 2VWFA 3JB9F 3QBYA 1BIBA 1WXTA 2LMJA 2YWWA 2LCSA 3RKYA 2KXCA 2E6NA 3LLRA 4V2SA 3M4YA 5C0MA 2DERA 3CMAT 3VJPA 1GRIA 4Z02A 5GAMe 1EFNA 5EC7A 8AT1B 5IXFA 1KK7A 1FXXA 2J7IA 4Y28E 1M2VA 2D8HA 4LDWA 2VVKA 3UA6A 4RCCA 1YJNA 5L8RE 2BZXA 4PJOA 1G83A 4XTXA 1Y96B 1G3SA 3J81E 4AMCA 3M4GA 3QDFA 3J7AF 3QZ5B 3VRYA 3DLLA 3CQTA 3VYHB 2EAYA 2YUNA 1OV3A 1RAGB 4OVAA 3RKXA 3LWIA 4O6JA 1H3ZA 1WQWA 4N0AA 2MPXC 3CBPA 2O9VA 5HK0A 5KYUA 2X4YA 4M7AF 1KQSS 1YJWT 1V29B 3I56A 2RN8A 3H0FA 4M78C 3INZA 1C6VX 1PHTA 1VQ7T 2O9SA 1VQ4T 2KRMA 4PJOB 3V8JA 1KD1U 2LX7A 5DLQE 4BACA 1UB4A 4M75D 1M30A 1MMNA 2RB6A 4Q5WA 2B8AA 2KSSA 4HA8A 1K9MC 5IT9E 2E3IA 2CT3A 2LCCA 2QTXA 1ZSGA 1VOMA 4UC4A 5A0LA 2DM1A 4IUUA 2P4TA 2HBWA 3M0QA 4E7KA 4LN2A 2RQTA 3JB9I 4Z89A 1UGSB 2PUKB 2E4HA 2VYTA 2QG9B 3EH1A 2K79A 4KUDK 2GQIA 5KYUB 3GBQA 1UGVA 2H8HA 1WI7A 5CKDA 1M1KC 3C4SA 3JCMP 2HSPA 1QKWA 4LE9A 1P92A 4J6XA 4ZTFA 3CCMT 3OQ5A 4E6RA 4M78F 1TS9A 1QVFA 4C92E 3L42A 2ZPFB 2D1XA 4PFPA 3OYIA 2HL5C 3CMEQ 5A0GA 2O88A 2HL3A 5KYXA 1KD1R 1VQ8T 5GAOp 5DLOA 1YWOA 4DBQA 4JRKA 4LNPA 4OB1B 1M90C 2EYXA 3JCMc 4MDWA 2ZPBB 2SRCA 3CCJA 2VV5A 2VB6A 1XQHA 2DXCA 4PK4A 3OW2A 3PGGA 3LGLA 4QVZA 4OP0A 3M59A 3JCMV 1U1TA 4KULA 3G1JA 1T3SA 1BI2A 4FSSA 3MP1A 1YJNQ 4C8QC 3H6ZA 3QKJA 2DIGA 3TSZA 1AHJB 3MJXA 3H0HA 3CCRT 3CBOA 4M77F 5KYXB 2LCLA 1NG2A 4QQDA 1D1BA 3LGFA 3ER0A 1ZLMA 1XTDA 2ZZDA 3M9QA 3JB9J 4WTOB 3VV0A 2CSIA 1VIEA 1X69A 4RTVA 3A5ZB 4QKUA 2FYKA 3CMAA 2D9TA 2X9HA 2DD5A 2O31A 5GANe 2P84A 3FJPA 2COWA 2LQWA 4JJBA 3JCMd 2ATCB 4N4GA 3OMCA 2QXFA 4C5GA 3I56Q 2NUPA 3QIIA 3PMIA 1YITT 4L6V5 2LJ0A 4C8QF 5LJ3f 4FW2A 2L3SA 4KGXB 2CP0A 4J7IA 1R8OB 1KFZA 3EFRA 2QAZA 3X20B 2XG8D 2CGHA 5C6SA 1X6BA 2LNHB 5LJ5f 1KQSA 4HKEA 2KNBB 1GCPA 1SF9A 4ELZC 1JJ2S 4JJNK 3OBYA 3GPLA 3RUXA 1LCKA 4BY6B 3VUZA 5GAN4 3LW5E 5FU7C 4E47A 2KT8A 3AT1B 3OYEA 3EGXA 4EIKA 1M4ZA 1AD5A 1HXDA 1PC0A 1K73R 1YI2T 5CAIA 5GJVB 1VQ9T 2NUPB 2QQ9A 3VS7A 1MHNA 1VQ7A 1VQ4A 1WXBA 3VYGA 3OYMA 3ASKA 5FRMA 2FHDA 3OYJA 3PVLA 4DQ2A 3OS5A 3FC3A 3DKMA 4MMKA 3PMTA 2MF2A 4CRIA 1G3WA 1WHHA 2GTJA 1NJIU 3CCJQ 2XD0A 2AHJB 4PJMA 2XDDA 2EYQA 3HFNA 1AZGB 4JLGA 3UT1A 1BU1A 3PFSA 1UHFA 1IRXA 1BI0A 2B86A 1VYVA 5D7UA 1X6GA 4C0DC 3VS1A 3EGXB 3JCMX 2F5KA 3LH5A 4F04B 4AFUC 4C92G 3NGPA 1GL5A 1UG1A 5IN1A 3CCMA 2CS7A 2A36A 3EG2A 5GANg 2DD4A 2V1RA 1AWWA 1QWFA 1YCSB 3M0SA 4A63B 1ZA1B 4FT2A 1AWXA 5CR2A 1NEBA 1CKAA 1VQ8A 5GMKh 3HKSA 2KQWA 1IREB 2JMCA 4OMOA 4C0FA 3CCQT 1NBEB 5D6YA 3C12A 3VS6A 3JCMg 2OAWA 2HDAA 4XTYA 1NJIR 4QVDA 4E7JA 3CMAQ 1UGPB 3G4ST 1SSFA 1YN8A 2GNCA 3MEUA 5KE2A 1PG5B 2KYBA 4BE0A 4M75A 4IKFA 4FL6A 2JTFA 1WLPB 1MMDA 4AG1C 1MV0B 2MK5A 2J05A 1SHGA 3V7SA 1AT1B 4B9WA 2KGTA 2A37A 3H41A 3H8ZA 3VUBA 3CCRA 4D8DA 1B3QA 2RI2A 3GF5A 2C0IA 1LOJA 1WFWA 1MMAA 3CC2T 1Q81C 2R5MA 4ZNXA 2PUOB 4RTZA 4HCBA 1M1GA 3EGDA 2DF6A 3L2ZA 2YXYA 3G7ZA 3OYCA 1WHJA 2DXTA 4M75B 2LJ3A 4IUPA 2L3QA 1YITA 2LVMA 3HSBA 3SDZA 5GAMf 3OS2A 1VQ4Q 2KMTA 3M0PA 4MZTA 1UECA 1YIJT 4II1A 2AK5A 3O5ZA 2LTOA 3A8HB 4QQ6A 4PJOG 2XKOC 1QKXA 5LJ3d 4M7AE 4DBHA 1Q86R 1RAEB 1TU0B 5CKEA 1BB9A 2RJEA 2GF7A 3EFOB 2JMAA 2BUDA
chains in the Genus database with same CATH topology
2CP2A 2COWA 2CP3A 2E3IA 3E2UA 1TOVA 2COZA 2MPXC 2HKNA 2E3HA 2QK0A 3TQ7P 2HKQB 2HL5C 2COYA 4B6MA 2HQHA 1WHGA 1IXDA 2HL3A 1WHMA 1WHLA 2E4HA 1WHJA 2CP0A 1LPLA 2CP7A 3RDVA 1WHHA 2Z0WA 2CP5A 2CP6A 2M02A 1WHKA 1TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP2 A;  2COW A;  2CP3 A;  2E3I A;  3E2U A;  1TOV A;  2COZ A;  2MPX C;  2HKN A;  2E3H A;  2QK0 A;  3TQ7 P;  2HKQ B;  2HL5 C;  2COY A;  4B6M A;  2HQH A;  1WHG A;  1IXD A;  2HL3 A;  1WHM A;  1WHL A;  2E4H A;  1WHJ A;  2CP0 A;  1LPL A;  2CP7 A;  3RDV A;  1WHH A;  2Z0W A;  2CP5 A;  2CP6 A;  2M02 A;  1WHK A;  1TXQ A; 
#chains in the Genus database with same CATH topology
 4OMN A;  2C0T A;  5LJ5 d;  2BE7 D;  3EGD B;  4IUR A;  1ZUY A;  2JZ2 A;  2RMO A;  1ZUU A;  5GAO n;  3VS4 A;  4J9E A;  1YI2 A;  2FG0 A;  3CCM Q;  1N9S A;  1VQ9 A;  5FW9 A;  2H3E B;  4RKU E;  1KIK A;  2L5Q A;  1TWB A;  2F2X A;  1MGQ A;  4FCY A;  1VQ8 Q;  3V8L A;  4LUE A;  2HKN A;  1ABQ A;  4EMG A;  2XHC A;  2AKL A;  2K57 A;  4M78 E;  3M57 A;  2FRW A;  2JOY A;  2DA9 A;  4R56 A;  4JS5 A;  1PNJ A;  1YP5 A;  5FU7 B;  2MIO A;  1RLP C;  4J9I A;  2DL7 A;  3CCU T;  5GAN 5;  2JNG A;  2E41 A;  1AVZ C;  2A0F B;  1LJO A;  3M55 A;  3OY9 A;  3E9G A;  4KT0 E;  2QYZ A;  4M7D D;  1B34 A;  5GAN 7;  2M51 A;  3CCR Q;  1M3B A;  4ORZ A;  2X3W D;  2X3X D;  1DJ7 B;  1NPP A;  4A53 A;  1KD1 C;  3JSC A;  5IHK A;  2GFA A;  4N4I A;  4CI0 C;  3CCQ A;  2LDM A;  4EMK B;  3JCM Q;  2M0Y A;  3KFV A;  4BD3 A;  3MKD A;  3JB9 G;  3E2U A;  2F5T X;  4FYV B;  1OOT A;  3NTI A;  2K2M A;  1MV3 A;  2A28 A;  3G4S A;  4M77 E;  3G6E T;  1FMV A;  1N8R U;  1UUE A;  2M9U A;  2NLU A;  4NS5 A;  3I55 T;  3ZBD A;  1IZ6 A;  4C0D B;  4OML A;  1PRM C;  1YIT Q;  2X4W A;  1UGQ B;  2DBM A;  5LJ3 g;  4E7L A;  3TEE A;  2DO3 A;  1Z9Q A;  1NM7 A;  2KRO A;  4HCC A;  2FL7 A;  3C94 A;  2YUQ A;  2V8K A;  3LYI A;  2OJ2 A;  4XU1 A;  2OTJ T;  5KYW A;  2PVG B;  5LJ5 g;  2NYS A;  3QSU A;  2FPD A;  1OYX A;  4C8Q E;  4QW2 A;  1WYX A;  3PE0 A;  4FW1 A;  4LD9 K;  1WIE A;  2DVJ A;  2L0A A;  3M5A A;  4M7D C;  2K9G A;  2P0P A;  4WF2 A;  1S72 T;  4FT4 A;  2R5A A;  4MZP A;  1YI2 Q;  1N8R R;  3MET A;  4LD6 A;  2HQE A;  1VQ9 Q;  1RI9 A;  1SHF A;  1ARK A;  1M3C A;  3OMG A;  5GAN f;  2W10 A;  1O9S A;  1YHQ T;  2ZPE B;  1O75 A;  1YIJ A;  1RAH B;  4Y91 A;  3I5R A;  2RH2 A;  3CCS Q;  2DRK A;  4LDY A;  5GAM d;  5KYW B;  1U3O A;  1Y0M A;  3VU3 C;  4BY6 C;  3JCM f;  5I22 A;  2HCK A;  4TVR A;  5IXB A;  2CDT A;  2RHU A;  3OB9 A;  2EJF A;  2FEI A;  2YDL A;  1X27 A;  1WXU A;  1GBR A;  4MDX A;  1OX9 A;  2GCX A;  5A0D A;  1WHK A;  2O4X A;  2QA4 T;  1EZZ B;  1QMC A;  1X6O A;  2YRD A;  3CBM A;  5I21 A;  3URG A;  3RES A;  2MI6 A;  4M78 G;  3NTH A;  3CCV T;  4L5G A;  5D6W A;  2KE9 A;  5CQY A;  2EKH A;  3F70 A;  2KDS A;  3CCQ Q;  3CC7 T;  1I4K 1;  4F7U A;  3BE3 A;  3VS3 A;  4ZN1 A;  2QQB A;  2ECZ A;  2XDB A;  1H3H A;  1BBZ A;  1M9S A;  3G4S Q;  1K1Z A;  1WJQ A;  2DIL A;  2HBP A;  2DL3 A;  2JJ9 A;  4BE1 A;  1FX7 A;  3VS0 A;  3M58 A;  4FYW B;  5GAO m;  1UTI A;  1PRL C;  2HEQ A;  4F17 A;  1XJW B;  2I0N A;  2O4X B;  3EHQ A;  3BDL A;  2DEU A;  5GMK e;  1PD1 A;  4XTW A;  4FYX B;  5HK3 A;  3V8K A;  3AHU A;  5GAN 2;  1BK2 A;  4M77 G;  1GBQ A;  4HT9 A;  4F7U B;  2HQX A;  2HQH A;  2X51 A;  5J26 A;  2HNI A;  5CIU A;  1N5Z A;  1MMG A;  3RER A;  2DL4 A;  2K3Y A;  1NJI C;  2K5F A;  4X9C A;  2L2P A;  4BB7 A;  3G6E A;  2QEX A;  1EX4 A;  1BCM A;  3PTA A;  2PNI A;  3I55 A;  4OMM A;  1AEY A;  2E5K A;  2DAQ A;  2DYB A;  3H0I A;  1CSK A;  3NMZ C;  4YTL A;  4JZ3 A;  5GAM g;  3JRZ A;  4XTZ A;  2EGC A;  1YIJ Q;  3X26 B;  1ZHI A;  2LT1 A;  1K8A U;  2QDL A;  4C8Q G;  3ULR B;  1Y07 A;  1JXM A;  1WQ7 A;  3A8O B;  4R55 A;  2OTJ A;  5AYF A;  1JJ2 P;  3CCE T;  1AWJ A;  1VQL T;  1JEG A;  3S3O A;  2ZCF B;  5GAN 8;  1QCF A;  2CZ6 B;  5J3B A;  4JJD A;  1PCX A;  1GCQ C;  1E7O A;  1WHG A;  4M75 C;  4M7D A;  1S72 A;  1SSH A;  1JBM A;  1VIF A;  2JUF A;  2PVO B;  3REA B;  2O2O A;  2M1H A;  3L2U A;  4OB0 B;  4OB2 B;  4ANJ A;  1YHQ A;  2A08 A;  1Y71 A;  3EGU A;  4RTU A;  2YLB A;  3OYD A;  4X34 A;  3X24 B;  1K8A R;  5GAN d;  2K4Y A;  4QVC A;  1WHM A;  5FRO A;  1HJD A;  2MOX A;  4NL2 A;  2XID A;  2VGM A;  3QG1 A;  2EQJ A;  4ME7 A;  1MND A;  1UJ0 A;  2M02 A;  1QQJ A;  2ZPG B;  2QK0 A;  4XK8 E;  1K73 U;  2PZ1 A;  1OU9 A;  1V76 A;  3H9N A;  2VXF A;  1IO6 A;  4HCZ A;  4M7D B;  3M0T A;  4M75 F;  1T0J A;  2ED0 A;  3REB B;  1N27 A;  2RQW A;  1X75 C;  2QA4 A;  1NYF A;  3RMS A;  3EG3 A;  4PFO A;  3R6O A;  3A8M B;  4KBM B;  4RTT A;  4GY5 A;  1I81 A;  3GP8 A;  1RI0 A;  3A8G B;  2CP2 A;  2A3L A;  3LH0 A;  6AT1 B;  1FYN A;  1Q7Y R;  3CC7 A;  4PJO E;  3TQ7 P;  3M0R A;  2KR3 A;  2DMO A;  5IHN A;  2COY A;  4AG2 C;  3NPF A;  2PVD B;  2RJD A;  2QEX Q;  2DL5 A;  4D8K A;  2YRC A;  3I55 Q;  2KI7 A;  4XTU A;  2QGG A;  5L23 A;  1YJW A;  2EPD A;  4ZTJ A;  2COZ A;  1JU5 C;  2HZY A;  4PNO A;  4DEY A;  3JAM E;  2E65 A;  5GAO r;  1HYO A;  4IIO A;  4JLI A;  1TUG B;  3EHR A;  3CPW P;  4EMH A;  1MNE A;  1UDL A;  2OTJ Q;  1A0N B;  4EMK C;  2EQM A;  2JT4 A;  1KC8 U;  1PM3 A;  2EQK A;  2JXB A;  4C92 D;  3JCM W;  1IGU A;  3S6W A;  1OQK A;  1OEB A;  3QYH B;  2DX1 A;  4QQG A;  5IH2 A;  5KCH A;  1S72 Q;  4A4G A;  2XI9 A;  1M5Q 1;  3P8B B;  2MYS A;  1YBY A;  1D09 B;  2LRQ A;  2A7Y A;  2EJG A;  3QJ6 A;  1JB0 E;  3UAT A;  4DA4 A;  2E70 A;  4O5V A;  5KH6 A;  1KQ1 A;  4IIM A;  1WA7 A;  1H92 A;  2RK1 A;  2J6F A;  4RCB A;  2X4J A;  2F2V A;  1W2B P;  2RHZ A;  3RMQ A;  3KXT A;  3NHN A;  1BKB A;  1I8F A;  4CC4 B;  1RAI B;  1X2K A;  3CCE A;  1OPL A;  1KC8 R;  1VQL A;  2EBP A;  2Y4Y A;  3X25 B;  3DB3 A;  3JV3 A;  3V7C A;  4C0Z A;  1SRM A;  1G3Y A;  1GCQ A;  3BDU A;  3E19 A;  2DYI A;  4X9D A;  3A1P A;  2QA4 Q;  1N8R C;  1KHI A;  4FM4 B;  1QVP A;  3DB4 A;  2CZ1 B;  4C92 C;  2E12 A;  2WAC A;  5AT1 B;  1VQ5 T;  4M4Z A;  2PU9 B;  3L1A A;  1PD0 A;  2CH4 A;  1YNZ A;  1VYU A;  1M1K R;  2MWO A;  2F2W A;  1Q86 U;  3CPW S;  1NLO C;  2KY9 A;  2OX7 A;  4JRP A;  2FPE A;  4HXJ A;  1WPY A;  3EFO A;  1QVG P;  2VC8 A;  1WNL A;  2NUT B;  2LQK A;  3QXE B;  1XNI A;  2XMF A;  4OF1 A;  4PJO D;  1YJW Q;  1G8X A;  1PSF A;  2HAX A;  1JXO A;  4LUD A;  1VQ7 Q;  1JJ2 A;  1TG0 A;  2CP3 A;  1UJY A;  1ABO A;  3ZL7 C;  1Q82 U;  2O01 E;  1W2B S;  2EQI A;  5FWC A;  4E7S A;  4A4F A;  2EIF A;  3THK A;  4F14 A;  1JO8 A;  4EDU A;  4XQ3 A;  3LWH A;  3CCL T;  5GMK j;  1TXQ A;  3WVD B;  1W4S A;  4FU6 A;  3JCM J;  3CME T;  3E1S A;  4F7U G;  2YUP A;  4DBR A;  4IUV A;  2KVQ G;  2LX9 A;  1I1J A;  2FZC B;  3HRT A;  4F16 A;  4J9G A;  4A54 A;  4KUI A;  2CUD A;  3QUI A;  4FYY B;  2IG0 A;  4E2F B;  2NWM A;  3SFM A;  2DXU A;  1RAF B;  3PIO A;  3ZEH A;  1R77 A;  4J9B A;  1VA7 A;  3FJ5 A;  1JQQ A;  1ZQ1 A;  3CCE Q;  1Q82 R;  5GAN h;  4EMK A;  1YJN T;  1VQL Q;  2X35 A;  4JRQ A;  3DLM A;  1I5L A;  2L8D A;  4C5H A;  1QVG S;  4VUB A;  2FPF A;  2K5I A;  3EG0 A;  3FDR A;  2G6F X;  3JCM h;  5CCA A;  3M56 A;  2QQR A;  3QYG B;  3TVT A;  4AFQ C;  2XDP A;  2E3H A;  3QHS A;  4XTV A;  3JB9 D;  2NUZ A;  1TSF A;  2RA2 A;  2CSQ A;  2W0Z A;  3CD6 T;  4F7U F;  3A8L B;  3IQL A;  2J6K A;  1VQ6 T;  1HK9 A;  1RL2 A;  2ENM A;  1PWT A;  2G3R A;  2RK2 A;  3MP6 A;  2OI3 A;  2QQS A;  3VS2 A;  1KSW A;  1D0Z A;  2MWP A;  3CPW A;  4CC3 A;  3OYH A;  4KGZ B;  5GMK m;  2LZ6 B;  1PKT A;  5CQX A;  2CP5 A;  3EG9 A;  2R58 A;  4K11 A;  2JN0 A;  3KBG A;  2DPP B;  1TOV A;  4C92 A;  1VQ5 A;  2KBT A;  2PQW A;  5IHI A;  4M75 E;  2RHY A;  4J9D A;  2HMA A;  1IXD A;  1K8A C;  2HSE B;  1ZSZ B;  2DBK A;  3CC2 A;  2CZ0 B;  1VUB A;  3ME9 A;  3VS5 A;  1SG5 A;  3C95 A;  2EW3 A;  2OTL T;  1LNX A;  3ZFJ A;  4M7A D;  2SEM A;  4BDY A;  4N4H A;  3I9Q A;  1W2B A;  3C0C A;  5D6X A;  2ZGW A;  2EYW A;  3QO3 A;  4JZ4 A;  1RAC B;  3GOX A;  4DOW A;  1VQN T;  4BUG A;  1PSE A;  3EG9 B;  1D0X A;  1ZA2 B;  3T9N A;  4C92 B;  2DE0 X;  2E6Z A;  2CP6 A;  1BYM A;  4OMQ A;  4IUT A;  2YT6 A;  3RKW A;  1OUL A;  2ROL A;  4WCI A;  3G71 T;  2JW4 A;  1YFN A;  2EGE A;  1R0B G;  4J9H A;  3CCL A;  2DXB A;  3R6N A;  4AT1 B;  3SWN A;  2JM9 A;  3HPW A;  4A4E A;  1QCN A;  2JS2 A;  5CKB A;  2YRV A;  4HT8 A;  4M7D F;  3VKI A;  1VQK T;  4M78 D;  1K73 C;  1Q81 R;  2M16 A;  2ZPH B;  2DZC A;  5DY9 A;  4A4K A;  2PTK A;  2VGN A;  4E7I A;  1SEM A;  1QVG A;  2LQN A;  3P8H A;  1K0X A;  3OS0 A;  3NTK A;  2AIR B;  4M7A C;  2KAF A;  2L89 A;  1U1S A;  3MEW A;  4J9C A;  1I0C A;  1NE8 A;  1VQO T;  3GIB A;  5CK9 A;  2ZAE A;  3X28 B;  2R57 A;  1N9R A;  1QLY A;  2RJC A;  3JCM b;  2RQV A;  3SWN B;  4J6W A;  2RHX A;  3CCU A;  1M8M A;  3PT9 A;  1ZUK A;  3FRN A;  3QJY A;  3HTR A;  5GAO l;  3OYK A;  4FIB A;  1U5S A;  1S1N A;  1OX8 A;  3D7S B;  3TU4 K;  3S3N A;  2DZ9 A;  4M77 D;  1VQ5 Q;  2DNU A;  1WDX A;  1W1F A;  2DL8 A;  2IPO B;  1QP3 A;  4C5E A;  5I2S A;  3CPF A;  1UGR B;  3QWX X;  2RI3 A;  2XU8 A;  5LL6 S;  5LJ3 h;  1CKB A;  1M2V B;  4MZM A;  3CD6 A;  3CC2 Q;  4BI8 B;  4B9X A;  4J6Y A;  2CYZ B;  3UWN A;  1KC8 C;  1GFD A;  1VQ6 A;  1OZ3 A;  4OGC A;  2RD1 A;  4P5N A;  1VQM T;  5LJ5 h;  3I35 A;  1X01 A;  4C8Q D;  4HVV A;  1OU8 A;  5KCO A;  2E64 A;  4A4H A;  3OSS C;  4M75 G;  4AFZ C;  2D6F A;  3KUF A;  1QW1 A;  2V1Q A;  1W6X A;  1E6G A;  1ACM B;  1RAB B;  1B7T A;  2BE9 B;  5FU6 C;  3MPU B;  3WVE B;  2AT1 B;  2V8I A;  1UEB A;  1RLQ C;  4LDV A;  3Q1J A;  1RAA B;  1AWO A;  3CCL Q;  1K76 A;  1YJ9 T;  3U23 A;  4ELY C;  4M77 C;  1T3L A;  2OTL A;  2J6O A;  1QCO A;  2MMP A;  3HL8 A;  3QDR B;  5GAN 3;  3CC4 T;  5GAN 6;  3N5B B;  1K0S A;  3OYA A;  1ZX6 A;  1VQN A;  5GJW B;  3RNJ A;  1KQ2 A;  4MML A;  4HCK A;  2IIM A;  3CEY A;  4KGV B;  1U06 A;  4C5I A;  1N6A A;  4B6M A;  1WGS A;  1Q7Y U;  4KH0 B;  2KT1 A;  2BZY A;  4NL3 A;  2RNA A;  1VQP T;  1IB8 A;  1Q86 C;  3G71 A;  3WXM B;  4RUG A;  3HP9 A;  3RR6 A;  3UDC A;  5LJ3 j;  4L59 A;  4OMP A;  5I11 A;  2OAU A;  2DLP A;  4OB3 B;  4EPC A;  1NYG A;  3CCU Q;  2C06 A;  3SEM A;  5J39 A;  2DJQ A;  2WSC E;  1F1B B;  5KYN A;  2MAM A;  1VQK A;  4BI3 A;  2EFI A;  3PVQ A;  1IHV A;  1OPK A;  3M54 A;  4LDU A;  5LJ5 j;  2DRM A;  4RTY A;  5CO7 A;  3OYF A;  2YSQ A;  4Y92 A;  4C0G A;  1HSQ A;  3O8V A;  4RMO A;  1GXI E;  4JJC A;  2QTV A;  5CKH A;  3CCV A;  4M7A A;  3CD6 Q;  4ZN3 A;  4J83 A;  1Q82 C;  1BI3 A;  4JS4 A;  1VQO A;  1PKS A;  1VQ6 Q;  3LX7 A;  1E6H A;  1SRL A;  1UFF A;  3JCM e;  5HY6 A;  3G6E Q;  1AOJ A;  3MO8 A;  1M3A A;  3HFO A;  3RIR A;  4F7U E;  9ATC B;  1BIA A;  2XIC A;  1QP2 A;  1HD3 A;  2LNV A;  1LVK A;  2D0N A;  3RBB B;  4AFS C;  2JVV A;  1D1C A;  1I07 A;  2CH4 W;  4J7F A;  2ROT A;  3HRS A;  3UPU A;  5GAM h;  5CVI A;  2EYY A;  4M7A B;  5FRN A;  1OZ2 A;  4NOY A;  2ED1 A;  2V8J A;  4HVU A;  4M78 A;  1K9M U;  5FWB A;  3FIF A;  4HVW A;  2RO0 A;  1K9A A;  2OTL Q;  1M2O A;  1VQM A;  1D1A A;  3CCS T;  1YWP A;  2Y90 A;  4D6W A;  2EYZ A;  2FRY A;  4BE2 A;  4LXC A;  1TTH B;  4XU3 A;  1VQN Q;  1FWZ A;  4JDS A;  3UA7 A;  4RG8 A;  1U8R A;  1YHQ Q;  1FMW A;  1WX6 A;  2RM4 A;  2EKO A;  2KXD A;  1M1K U;  4JRI A;  2DJZ A;  2IVW A;  2P4R A;  2JTE A;  7AT1 B;  1RUW A;  1UHC A;  1ZSZ C;  3CXC P;  4ZGD B;  2V26 A;  3GLX A;  4PLL A;  2HD0 A;  3G71 Q;  1H64 1;  2FZG B;  2EJ9 A;  4M78 B;  2VAS A;  2ABL A;  2FO0 A;  1M90 U;  2NUT A;  1WZO A;  3OA6 A;  1YJ9 A;  1K9M R;  1UE9 A;  3SD4 A;  2CKK A;  3MEV A;  4OMF B;  4M77 A;  2P0K A;  2M0O A;  2VKN A;  5I2M A;  5KE3 A;  1R0C B;  2BTT A;  2DEQ A;  1VQK Q;  2JS0 A;  4PJN A;  3CC4 A;  2K2V A;  2DKG A;  2WSF E;  1W70 A;  3OS1 A;  4JPB W;  4GLM A;  2Z0W A;  1G2B A;  2QAS A;  3L2V A;  4M7D E;  3CCV Q;  2RI5 A;  2GQV A;  5FU6 B;  1GFC A;  1TUC A;  2I2L A;  3QPH A;  2GFU A;  3CC7 Q;  2K3B A;  2XK0 A;  1VQO Q;  2AZV A;  4BI4 A;  1VQP A;  4C8Q A;  3SHW A;  2F69 A;  3JB9 H;  2CT4 A;  4Z8A A;  8ATC B;  1YCY A;  1NZ9 A;  4J5Y A;  5GAM j;  3L2Q A;  1M90 R;  2CZ7 B;  3OBW A;  4ZGJ B;  4M77 B;  1NLP C;  1C1A A;  4PL6 A;  3TRE A;  4XAX B;  2J06 A;  2EGA A;  2DTI A;  1SPK A;  3OYN A;  2YHT A;  1B07 A;  1G3T A;  1AZE A;  5ECA A;  4C92 F;  5CKF A;  2RJF A;  2DTO A;  1IHW A;  2K6D A;  1Q95 G;  2RHI A;  4BDZ A;  3CXC S;  4Z88 A;  4CC2 A;  1BI1 A;  2K7A A;  3V7R A;  4E7H A;  2DVE A;  4DBF A;  2LT4 A;  1TUD A;  4FSX A;  4ATO A;  4C8Q B;  5GAO q;  2JTM A;  3SWN C;  4JUV A;  4LDX A;  1JRI A;  2AZS A;  2P0Q A;  2EVR A;  1FMK A;  4CC7 A;  1VQM Q;  1OI1 A;  4PLI A;  3GNG A;  3P8D A;  3FLG A;  4J9F A;  3E9F A;  4KRT A;  4OGE A;  1XOV A;  3BY7 A;  4PFZ A;  1WJR A;  2ESW A;  2Y4X A;  2D8J A;  3RDV A;  4DOV A;  3FB9 A;  4XU0 A;  4IUQ A;  3MHX A;  1KG1 A;  5DM7 R;  1SKU B;  5LJ3 e;  3S3M A;  1Y57 A;  1KJW A;  1VYT A;  2MCN A;  2LJ1 A;  2RQR A;  1G5V A;  3SB2 A;  2QDY B;  4PJO C;  2K5L A;  1M1F A;  3BFM A;  2HKQ B;  2DK3 A;  3TSW A;  1M8V A;  5LJ5 e;  5GMK i;  1YJ9 Q;  3VRZ A;  2RPN A;  1M27 C;  1D3B A;  1ZBJ A;  2LQ8 A;  3BW1 A;  1WJS A;  2DTH A;  3I5S A;  2RF0 A;  2QQA A;  2YUO A;  4PJL A;  3CCS A;  3GNF B;  1I5O B;  3HRU A;  3CC4 Q;  4PKC C;  3PNW C;  5IAY A;  2VXE A;  1D0Y A;  1QVF P;  2EQU A;  1T0H A;  2VUB A;  4N0A C;  3J80 E;  5EG2 A;  4ESR A;  5A2Q E;  2FVU A;  1K4U S;  3EFS A;  1MUZ A;  4QT7 A;  2E10 A;  4DEX A;  2KK4 A;  2E5Q A;  2DFU A;  1ZSZ A;  1EIF A;  2QGF B;  3I56 T;  1X2Q A;  4RTW A;  2RQU A;  1VQP Q;  1NPR A;  2QI2 A;  4GBQ A;  3OW2 P;  4PJO F;  4XU2 A;  3MCA B;  3QZ9 B;  3OSV A;  5HKC A;  1D3B B;  3EAE A;  3TCJ A;  1QWE A;  2GGR A;  1WHL A;  2FB7 A;  2GTO A;  5GMK l;  3MP8 A;  1ZBX A;  4M7D G;  1H8K A;  2X4X A;  2QEX T;  3OYG A;  3NFC A;  5KYY A;  2BIV A;  3FEO A;  2CUB A;  1J3T A;  2WSE E;  4RG2 A;  3EH2 A;  2KEA A;  2KRS A;  3A98 A;  2EWN A;  2AKK A;  1Y7X A;  4PJJ A;  4RTX A;  5HCK A;  2BKD N;  5GAN j;  2GBQ A;  1B34 B;  3L2W A;  3EG1 A;  2K3X A;  2LC4 A;  1Q81 U;  3M53 A;  1Z9Z A;  3OYY A;  3UF4 A;  4E7Z A;  2KYM A;  2BZ8 A;  2ZPI B;  3CXC A;  2DET A;  2FZK B;  3CCJ T;  3OYB A;  1V1C A;  1QVF S;  3M0U A;  2CP7 A;  4ZGE B;  2CRE A;  2LP5 A;  3L2R A;  2E1H A;  4J8O A;  1RAD B;  2C0O A;  5FLX E;  1KQS P;  2L3P A;  1C0M A;  5KYY B;  5M9O A;  1IGQ A;  4R0K A;  2H3J A;  2D0Q B;  1Y96 A;  4GLK A;  1BCO A;  2KRN A;  1Q7Y C;  3QWY A;  3OW2 S;  4M7A G;  2JM8 A;  3OYL A;  2DIQ A;  3MEA A;  4KH1 B;  2YLC A;  4X1V A;  3CME A;  1NEG A;  1X43 A;  1LPL A;  1KHC A;  2L3R A;  3PIP A;  1TH7 A;  3HHT B;  2F1L A;  2VWF A;  3JB9 F;  3QBY A;  1BIB A;  1WXT A;  2LMJ A;  2YWW A;  2LCS A;  3RKY A;  2KXC A;  2E6N A;  3LLR A;  4V2S A;  3M4Y A;  5C0M A;  2DER A;  3CMA T;  3VJP A;  1GRI A;  4Z02 A;  5GAM e;  1EFN A;  5EC7 A;  8AT1 B;  5IXF A;  1KK7 A;  1FXX A;  2J7I A;  4Y28 E;  1M2V A;  2D8H A;  4LDW A;  2VVK A;  3UA6 A;  4RCC A;  1YJN A;  5L8R E;  2BZX A;  4PJO A;  1G83 A;  4XTX A;  1Y96 B;  1G3S A;  3J81 E;  4AMC A;  3M4G A;  3QDF A;  3J7A F;  3QZ5 B;  3VRY A;  3DLL A;  3CQT A;  3VYH B;  2EAY A;  2YUN A;  1OV3 A;  1RAG B;  4OVA A;  3RKX A;  3LWI A;  4O6J A;  1H3Z A;  1WQW A;  4N0A A;  2MPX C;  3CBP A;  2O9V A;  5HK0 A;  5KYU A;  2X4Y A;  4M7A F;  1KQS S;  1YJW T;  1V29 B;  3I56 A;  2RN8 A;  3H0F A;  4M78 C;  3INZ A;  1C6V X;  1PHT A;  1VQ7 T;  2O9S A;  1VQ4 T;  2KRM A;  4PJO B;  3V8J A;  1KD1 U;  2LX7 A;  5DLQ E;  4BAC A;  1UB4 A;  4M75 D;  1M30 A;  1MMN A;  2RB6 A;  4Q5W A;  2B8A A;  2KSS A;  4HA8 A;  1K9M C;  5IT9 E;  2E3I A;  2CT3 A;  2LCC A;  2QTX A;  1ZSG A;  1VOM A;  4UC4 A;  5A0L A;  2DM1 A;  4IUU A;  2P4T A;  2HBW A;  3M0Q A;  4E7K A;  4LN2 A;  2RQT A;  3JB9 I;  4Z89 A;  1UGS B;  2PUK B;  2E4H A;  2VYT A;  2QG9 B;  3EH1 A;  2K79 A;  4KUD K;  2GQI A;  5KYU B;  3GBQ A;  1UGV A;  2H8H A;  1WI7 A;  5CKD A;  1M1K C;  3C4S A;  3JCM P;  2HSP A;  1QKW A;  4LE9 A;  1P92 A;  4J6X A;  4ZTF A;  3CCM T;  3OQ5 A;  4E6R A;  4M78 F;  1TS9 A;  1QVF A;  4C92 E;  3L42 A;  2ZPF B;  2D1X A;  4PFP A;  3OYI A;  2HL5 C;  3CME Q;  5A0G A;  2O88 A;  2HL3 A;  5KYX A;  1KD1 R;  1VQ8 T;  5GAO p;  5DLO A;  1YWO A;  4DBQ A;  4JRK A;  4LNP A;  4OB1 B;  1M90 C;  2EYX A;  3JCM c;  4MDW A;  2ZPB B;  2SRC A;  3CCJ A;  2VV5 A;  2VB6 A;  1XQH A;  2DXC A;  4PK4 A;  3OW2 A;  3PGG A;  3LGL A;  4QVZ A;  4OP0 A;  3M59 A;  3JCM V;  1U1T A;  4KUL A;  3G1J A;  1T3S A;  1BI2 A;  4FSS A;  3MP1 A;  1YJN Q;  4C8Q C;  3H6Z A;  3QKJ A;  2DIG A;  3TSZ A;  1AHJ B;  3MJX A;  3H0H A;  3CCR T;  3CBO A;  4M77 F;  5KYX B;  2LCL A;  1NG2 A;  4QQD A;  1D1B A;  3LGF A;  3ER0 A;  1ZLM A;  1XTD A;  2ZZD A;  3M9Q A;  3JB9 J;  4WTO B;  3VV0 A;  2CSI A;  1VIE A;  1X69 A;  4RTV A;  3A5Z B;  4QKU A;  2FYK A;  3CMA A;  2D9T A;  2X9H A;  2DD5 A;  2O31 A;  5GAN e;  2P84 A;  3FJP A;  2COW A;  2LQW A;  4JJB A;  3JCM d;  2ATC B;  4N4G A;  3OMC A;  2QXF A;  4C5G A;  3I56 Q;  2NUP A;  3QII A;  3PMI A;  1YIT T;  4L6V 5;  2LJ0 A;  4C8Q F;  5LJ3 f;  4FW2 A;  2L3S A;  4KGX B;  2CP0 A;  4J7I A;  1R8O B;  1KFZ A;  3EFR A;  2QAZ A;  3X20 B;  2XG8 D;  2CGH A;  5C6S A;  1X6B A;  2LNH B;  5LJ5 f;  1KQS A;  4HKE A;  2KNB B;  1GCP A;  1SF9 A;  4ELZ C;  1JJ2 S;  4JJN K;  3OBY A;  3GPL A;  3RUX A;  1LCK A;  4BY6 B;  3VUZ A;  5GAN 4;  3LW5 E;  5FU7 C;  4E47 A;  2KT8 A;  3AT1 B;  3OYE A;  3EGX A;  4EIK A;  1M4Z A;  1AD5 A;  1HXD A;  1PC0 A;  1K73 R;  1YI2 T;  5CAI A;  5GJV B;  1VQ9 T;  2NUP B;  2QQ9 A;  3VS7 A;  1MHN A;  1VQ7 A;  1VQ4 A;  1WXB A;  3VYG A;  3OYM A;  3ASK A;  5FRM A;  2FHD A;  3OYJ A;  3PVL A;  4DQ2 A;  3OS5 A;  3FC3 A;  3DKM A;  4MMK A;  3PMT A;  2MF2 A;  4CRI A;  1G3W A;  1WHH A;  2GTJ A;  1NJI U;  3CCJ Q;  2XD0 A;  2AHJ B;  4PJM A;  2XDD A;  2EYQ A;  3HFN A;  1AZG B;  4JLG A;  3UT1 A;  1BU1 A;  3PFS A;  1UHF A;  1IRX A;  1BI0 A;  2B86 A;  1VYV A;  5D7U A;  1X6G A;  4C0D C;  3VS1 A;  3EGX B;  3JCM X;  2F5K A;  3LH5 A;  4F04 B;  4AFU C;  4C92 G;  3NGP A;  1GL5 A;  1UG1 A;  5IN1 A;  3CCM A;  2CS7 A;  2A36 A;  3EG2 A;  5GAN g;  2DD4 A;  2V1R A;  1AWW A;  1QWF A;  1YCS B;  3M0S A;  4A63 B;  1ZA1 B;  4FT2 A;  1AWX A;  5CR2 A;  1NEB A;  1CKA A;  1VQ8 A;  5GMK h;  3HKS A;  2KQW A;  1IRE B;  2JMC A;  4OMO A;  4C0F A;  3CCQ T;  1NBE B;  5D6Y A;  3C12 A;  3VS6 A;  3JCM g;  2OAW A;  2HDA A;  4XTY A;  1NJI R;  4QVD A;  4E7J A;  3CMA Q;  1UGP B;  3G4S T;  1SSF A;  1YN8 A;  2GNC A;  3MEU A;  5KE2 A;  1PG5 B;  2KYB A;  4BE0 A;  4M75 A;  4IKF A;  4FL6 A;  2JTF A;  1WLP B;  1MMD A;  4AG1 C;  1MV0 B;  2MK5 A;  2J05 A;  1SHG A;  3V7S A;  1AT1 B;  4B9W A;  2KGT A;  2A37 A;  3H41 A;  3H8Z A;  3VUB A;  3CCR A;  4D8D A;  1B3Q A;  2RI2 A;  3GF5 A;  2C0I A;  1LOJ A;  1WFW A;  1MMA A;  3CC2 T;  1Q81 C;  2R5M A;  4ZNX A;  2PUO B;  4RTZ A;  4HCB A;  1M1G A;  3EGD A;  2DF6 A;  3L2Z A;  2YXY A;  3G7Z A;  3OYC A;  1WHJ A;  2DXT A;  4M75 B;  2LJ3 A;  4IUP A;  2L3Q A;  1YIT A;  2LVM A;  3HSB A;  3SDZ A;  5GAM f;  3OS2 A;  1VQ4 Q;  2KMT A;  3M0P A;  4MZT A;  1UEC A;  1YIJ T;  4II1 A;  2AK5 A;  3O5Z A;  2LTO A;  3A8H B;  4QQ6 A;  4PJO G;  2XKO C;  1QKX A;  5LJ3 d;  4M7A E;  4DBH A;  1Q86 R;  1RAE B;  1TU0 B;  5CKE A;  1BB9 A;  2RJE A;  2GF7 A;  3EFO B;  2JMA A;  2BUD A; 
#chains in the Genus database with same CATH homology
 2CP2 A;  2COW A;  2CP3 A;  2E3I A;  3E2U A;  1TOV A;  2COZ A;  2MPX C;  2HKN A;  2E3H A;  2QK0 A;  3TQ7 P;  2HKQ B;  2HL5 C;  2COY A;  4B6M A;  2HQH A;  1WHG A;  1IXD A;  2HL3 A;  1WHM A;  1WHL A;  2E4H A;  1WHJ A;  2CP0 A;  1LPL A;  2CP7 A;  3RDV A;  1WHH A;  2Z0W A;  2CP5 A;  2CP6 A;  2M02 A;  1WHK A;  1TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...