3E2YA

Crystal structure of mouse kynurenine aminotransferase iii in complex with glutamine
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
410
structure length
410
Chain Sequence
b'NAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine-oxoglutarate transaminase 3
publication title Correction for Han et al., "Biochemical and Structural Properties of Mouse Kynurenine Aminotransferase III".
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase, lyase
total genus 138
structure length 410
sequence length 410
chains with identical sequence B
ec nomenclature ec 2.6.1.63: Kynurenine--glyoxylate transaminase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3e2yA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3e2yA01
3FD0A 2E7IA 1Z3ZA 2VGWA 2ZSMA 1BT4A 1ASEA 3G7QA 3NUIA 4GE7A 4M2JA 3MKJA 1CZEA 1PG8A 3NNKA 4EFFA 3FKDA 3R9AA 2OGEA 1Z7DA 2AY8A 3MADA 2X5FA 3JU7A 3MC6C 1RVUA 2QB2A 3CAIA 3NUBA 1X0MA 1W7LA 4F5LA 2Z61A 3GZDC 3II0A 1JF9A 1EJIA 1JG8A 2OGAA 1IX6A 3QPGA 1CQ8A 2VMWA 2BYJA 4IY7A 4MQPA 4EB7A 2W7FA 3FDBA 3WKSA 3FFRA 4RLGA 4WYGA 3HQTA 1S07A 2GMUA 2Z67A 2R5CB 2ZY5A 4XAUA 3PGYA 1GC2A 2PB0A 4UHNA 2CY8A 5I92A 1BJOB 1IBJA 4IXOA 1M32A 2D5YA 2QMAA 4WBTA 4AZKA 1G4VA 4R5ZA 1QISA 3IF2A 2AY3A 3ZRPA 2GB3A 2YKVA 3JWBA 2VIBA 1LW4A 1ASAA 2X5DA 4PVFA 4W5KA 2VI9A 4AZJA 1OHVA 2HOZA 4Y0HA 2BWOA 1OXPA 3BN1A 4GRXA 3QM2A 3BCAA 1ASLA 3AEOA 1AJSB 1CS1A 1AHFA 1KL1A 2FNUA 4Q6RA 2D61A 3AEMC 3P1TA 3L44A 2YHKA 1YAAA 3FZ6A 4QGRA 4F5IA 2VGVA 3PA9A 2X8UA 3HVYA 3ASAA 5BJ3A 3FVSA 5BJ4A 3ACZA 3KGWA 2VMRA 5EIGA 4CXQA 1IAXA 1BQDA 1MAQA 3H7FA 4JEYA 4KXKA 1LK9A 3VK3A 5G0AA 1M7YA 1M0PA 1VP4A 4ZDPA 1ORDA 1AHEA 3FSLA 1OHYA 3DZZA 4XK1A 2W7JA 3H14A 3DYDA 1B5PA 1X28A 1M0OA 1ECXA 2CB1A 2BWPA 4OCAA 5DJ9A 3VAXA 3VK2A 4A0FA 2HOYA 4OT8A 1O62A 3LVMA 1ARSA 2YKXA 3FTBA 3QGUA 4NOGA 3UAKA 4RKCA 1GC0A 1AAWA 5G4JA 2AY9A 1ZODA 2HP1A 3DXVA 3LVKA 5D95A 5E4ZA 3RI6A 4U1TA 2V0YA 2YCTA 4GDYA 1TATA 4F5FA 5DB5A 3IHJA 2DOUA 4E1OA 3E77A 1ASMA 1ASDA 1YIYA 2VMVA 2Z9WA 2YOBA 3HDOA 3K7YA 4XJLA 3F0HA 3I5TA 4TN4A 1GCKA 1LKCA 2AY7A 2VMPA 4JE5D 4OBVA 4RJ0A 5HXXA 3A8UX 2VMUA 4XQ2A 1BJOA 4A0HA 3GR9A 1YJYA 2VMOA 4WYDA 4ITGA 4P3MA 1WYVA 4ADDA 2EH6A 2OKKA 2W7HA 2FQ6A 2W7EA 3M5UA 1DJ9A 1M4NA 5M49A 3TCMA 5FT8A 4ADEA 1C7GA 1KKJA 4IXZA 1CQ6A 2YCPA 1ARGA 4PIWA 2X3LA 3VOMA 2BI2A 4PFFA 3AOVA 2JGTA 3EZSA 1LC8A 1XEYA 3N5MA 4WYFA 3A9XA 1T3IA 4A0RA 1AJSA 4JF0A 3JWAA 2E54A 2NMPA 1IX7A 5F9SA 4BA5A 2V1PA 5M4BA 2HORA 3AEJC 3OP7A 1OATA 4Q76A 1D7UA 2AY6A 4MKKA 3DRDA 1GC4A 1S09A 2EO5A 2VGTA 3NDNA 3AV7A 1M0QA 2C44A 4MQQA 3ELPA 4XJMA 1M6SA 4CBSA 9AATA 1V2EA 2HOXA 5DJ1A 4N0WA 3GZCA 2AEVA 4LNJA 5EAVA 2ZC0A 2VMNA 1PFFA 5LH9A 3NX3A 5C6UA 4MKJA 1TOIA 4K2BA 1MGVA 4J8LA 4DGTA 4EU1A 1TASA 4GE4A 2C0RA 3WCOA 4AH3A 3GSBA 2EZ2A 2JJGA 5EQCA 2QA3A 3UE8A 3DC1A 1AJRA 3NRAA 2VYCA 4E3QA 5M46A 2EGYA 4JEZA 4GE9A 2ZUKA 3PDXA 5DX5A 3VP6A 3W1JA 1ELUA 1D7VA 1SZSA 3TFUA 4ZM4A 3W1HA 2VMQA 1YOOA 4R5FA 3PPLA 4RM1A 4K2MA 5E3KA 4RJYA 3B1CA 4WLHA 1ZOBA 3PD6B 1O61A 4IYOB 1GEYA 1BJ4A 4ZM3A 1WYVB 1V72A 2E7JA 1ARHA 5J8QA 5K8BA 3GBXA 1GDEA 1SZUA 4M2MA 3MBBA 2YKYA 2O1BA 1W23A 1WYTA 3AENA 3KKIA 1DGDA 1W7MA 4Q75A 2D64A 1DJUA 2VGUA 3GZDA 2AEUA 1GEWA 2W7GA 1XI9A 2ZSLA 1S08A 1IJIA 4RITA 1M0NA 1TPLA 3FZ7A 2C7TA 3LY1A 3A9ZA 4LW4A 3QHXA 2VGSA 2WK7A 4R2NA 4A00A 3E9KA 4MY5A 5EUNA 3HMUA 4ISYA 1WKGA 2Z9XA 3ELEA 1FC4A 3KE3A 1QJ3A 1KMKA 1BW0A 1AKAA 1SVVA 4UOYA 4ATPA 3BCBA 4IXSA 1B5OA 1UU1A 1YJZA 4OC9A 3B1EA 3COGA 2VMSA 4KYOA 3VK4A 4W1WA 1I43A 1KKPA 3BWNA 2ZY3A 1YJSA 2W8VA 1WSTA 1TOGA 3GWPA 2CH2A 5FT5A 2XBNA 4IX8A 5E5IA 2EPJA 2W7IA 3JW9A 3PJ0A 3WGBA 4FL0A 4A6UA 4JF1A 2FYFA 2VIAA 4WXBA 2BI9A 2CH1A 2VMTA 4MQRA 3LVLB 4Y0IA 1DFOA 2W7KA 3HT4A 3CQ4A 2CANA 2CJHA 2R5EA 4F5KA 2AY4A 3EI9A 1IX8A 2D66A 1MAPA 4E77A 3TQXA 1IAYA 7AATA 1AMRA 4WYCA 1B4XA 1X2AA 2ZP7A 3EI5A 1OHWA 2Z9UA 4PFNA 2PB2A 5G2QA 4ADCA 2BI1A 3PD6A 3LG0A 4IYOA 2AY5A 3B1DA 3E2ZB 1AY4A 4JEXA 2BWNA 2D65A 3G8MA 4XEWA 3LV2A 4ZASA 4W1XA 2Z1YA 2CINA 1WYTB 2W8JA 1B9HA 1CJ0A 3AENB 5HHYA 3E2FA 2OATA 4HF8A 2AATA 4TMRA 3T32A 1AMAA 4LNMA 3A9YA 4AOAA 1CL1A 2CSTA 4ZAHA 1AAMA 3FFHA 1G7WA 2BI3A 5HDMA 1C7OA 1IUGA 2FM1A 2XH1A 5FT4A 2VMZA 5D5SA 2W7MA 1JS6A 4P7YA 2HUIA 1C9CA 2JJEA 2ZYJA 4ATQA 3B46A 4A72A 3WY7A 1H0CA 4WLJA 2R0TA 4TV7A 2HP2A 2YKUA 4GEBA 3FDDA 1C4KA 3NYTA 5FT6A 3BS8A 1ELQA 4WXFA 2BIAA 3JTXA 3RUYA 3ZZKA 2GMSA 1AICA 1G4XA 3PDBB 1AHGA 3QI6A 4A6RA 1C0NA 2O7CA 2FN6A 1W3UA 2W8TA 2GSAA 3GJUA 2QB3A 3TATA 1YIZA 2G6WA 3MAFB 3ZZJA 5EUEA 4U2HA 3BV0A 5AX8A 4DBCA 4MGRA 3PAAA 3RCHB 3EUCA 3ECDA 1FG3A 3ZRQA 1D7SA 1ARTA 4UHOA 3NYSA 1TOEA 1GEXA 1CQ7A 4B9BA 4WB0B 2CJDA 1H1CA 4WYAA 4WP0A 3HLMA 3JZLA 1ASFA 3PIUA 1E5EA 2Z9VA 1B9IA 1ZC9A 3AOWA 3P6KA 3EI8A 3HBXA 3G0TA 2AY2A 3DODA 3L8AA 2CTZA 2JJHA 4W91A 3EIAA 3AEPA 1ARIA 1DGEA 3FVUA 4UQVA 4IW7A 4Y0DA 4JEWA 3LWSA 3RQ1A 4ZSYA 3WKRA 1AKBA 1V2FA 4LNLA 1SPAA 1BQAA 2YRIA 1SF2A 1G7XA 1AHXA 2C81A 2CFBA 3TFTA 1GD9A 1AMSA 2W7LA 4RKDA 1SZKA 1TOJA 3FQ8A 2EZ1A 5TF5A 1BKGA 1N31A 1U08A 3ZRRA 3LVJA 5JAYA 3WCNA 3F9TA 1MDXA 5IWQA 4W8IA 4OYTA 4Q31A 3E2ZA 3RBFA 1ASGA 1LS3A 3A2BA 2ZY4A 3MC6A 1ASNA 2JG2A 4W1VA 1UKJA 1MDOA 3DXWA 5EAAA 4CVQA 2Z1ZA 2VI8A 1WYUB 1Y4IA 2D63A 4CBRA 3QN6A 5EFSA 3BB8A 1D2FA 1O69A 3DU4A 3ISLA 4K2IA 3EI7A 1DJEA 5M4DA 3D6KA 3Q8NA 1FG7A 3WGCA 4F5JA 1QZ9A 4ZWMA 2BI5A 3WX9A 2YRRA 1EQBA 1VJOA 3F6TA 4ADBA 1OXOA 1P3WA 4O6ZA 2JJFA 4B98A 3E2YA 1AY8A 4MSOA 3R4TA 2ZJGA 3WLXA 1I48A 2F8JA 4M2KA 1AIBA 3BWNC 1JS3A 4AO4A 2D7YA 2QBTA 2VLFA 1LC5A 1S0AA 2ORDA 1CL2A 3PDBA 4E3RA 1RV4A 2DKBA 3ASBA 1MDZA 2BKWA 3MAFA 2O0RA 1PMMA 4FFCA 1QITA 2Q7WA 1I29A 3RCHA 4ZDOA 2AY1A 3CBFA 4BHDA 1I41A 1LC7A 2OKJA 4WB0A 1RVYA 2TPLA 4R8DA 2E7UA 2BIEA 4EMYA 1EG5A 3NU7A 3OKSA 3N75A 4F5HA 3AEMA 3FRKA 1QGNA 4JE5A 2DGLA 3MEBA 3NTJA 2HUUA 1KMJA 2VLHA 3QBOA 4A0GA 4WXGA 4OMAA 2BIGA 2DGMA 1S06A 3EIBA 3FQAA 5F8VA 3AATA 3W1IA 4UHMA 4L0OA 2WK8A 3ATHA 3BCXA 1D7RA 1X29A 1AHYA 1TOKA 2DGKA 1RV3A 2VGZA 1CZCA 1QIRA 2W8WA 4RIZA 2DKJA 1MLYA 4H51A 2W7DA 1QJ5A 4BA4A 2FNIA 2D7ZA 1WKHA 2HUFA 2JISA 3CQ5A 4LW2A 4F5GA 3KGXA 1BS0A 4F5MA 3GETA 1KL2A 3CQ6A 4OTLA 4EB5A 2VMXA 1AKCA 2DR1A 3MAUA 3HL2A 4ITXA 3FZ8A 3BWOA 1WYUA 1E5FA 3E6GA 3FQ7A 4GSAA 3RBLA 2BYLA 1UU0A 2OQXA 5EUDA 5G4IA 5LHAA 1DTYA 8AATA 4J5UA 2R5CA 3N0LA 1PMOA 2Z20A 4WD2A 1J04A 1AY5A 2HZPA 4F4EA 2PO3A 3FCRA 3NYUA 4BMKA 1V2DA 2VMYA 4HVKA 2W8UA 3WZFA 1TARA 3NU8A 4I8AA 4DQ6A 4CXRA 1W7NA 3DR7A 5G2PA 1C7NA 2BHXA 3B8XA 3DR4A 4ZDLA 4KAMA 2QLRA 1BJNA 3EZ1A 1YNUA 3K40A 4OBUA 3I16A 4BQ0A 1SFFA 3I4JA 2RFVA 1IVRA 3K28A 3UWCA 1MLZA 1N8PA 1ASCA 1VEFA 2GQNA 2WKAA 3EI6A 1DKAA 1GBNA 3USFA 1N2TA 1UU2A 4WYEA 4A6TA 4XJOA 4AO9A 2YCNA 4ZWVA 2R2NA 3AELA 1AX4A 1BJWA 1GC3A 4LC3A 4RAEA 1AMQA 5EIGB 4JEVA 4ZSWA 1ASBA 1B8GA 2ZY2A 2WK9A 4XJPA 1LW5A 1O4SA 1J32A 3AEJA 3BC8A 5G09A 4ZLVA 4N0BA 2CJGA 1AIAA 3FVXA
chains in the Genus database with same CATH superfamily
3FD0A 2E7IA 1Z3ZA 2VGWA 2ZSMA 1BT4A 1ASEA 3G7QA 3NUIA 4GE7A 4M2JA 3MKJA 1CZEA 1PG8A 3NNKA 4EFFA 3FKDA 3R9AA 2OGEA 1Z7DA 2AY8A 3MADA 2X5FA 3JU7A 3MC6C 1RVUA 2QB2A 3CAIA 3NUBA 1X0MA 1W7LA 4F5LA 2Z61A 3GZDC 3II0A 1JF9A 1EJIA 1JG8A 2OGAA 1IX6A 3QPGA 1CQ8A 2VMWA 2BYJA 4IY7A 4MQPA 4EB7A 2W7FA 3FDBA 3WKSA 3FFRA 1KAFA 4RLGA 4WYGA 3HQTA 1S07A 2GMUA 2Z67A 2R5CB 2ZY5A 4XAUA 3PGYA 1GC2A 2PB0A 4UHNA 2CY8A 5I92A 1BJOB 1IBJA 4IXOA 1M32A 2D5YA 2QMAA 4WBTA 4AZKA 1G4VA 4R5ZA 1QISA 3IF2A 2AY3A 3ZRPA 2GB3A 2YKVA 3JWBA 2VIBA 1LW4A 1ASAA 2X5DA 4PVFA 4W5KA 2VI9A 4AZJA 1OHVA 2HOZA 4Y0HA 2EYQA 2BWOA 1OXPA 3BN1A 4GRXA 3QM2A 3BCAA 1ASLA 3AEOA 1AJSB 1CS1A 1AHFA 1KL1A 2FNUA 4Q6RA 2D61A 3AEMC 3P1TA 3N4SA 3L44A 2YHKA 1YAAA 3FZ6A 4QGRA 4F5IA 2VGVA 3PA9A 2X8UA 3HVYA 3ASAA 5BJ3A 3FVSA 5BJ4A 3ACZA 3KGWA 2VMRA 5EIGA 4CXQA 1IAXA 1BQDA 1MAQA 3H7FA 4JEYA 4KXKA 1LK9A 3VK3A 5G0AA 1M7YA 1M0PA 1VP4A 4ZDPA 1ORDA 1AHEA 3FSLA 1OHYA 3DZZA 4XK1A 2W7JA 3H14A 3DYDA 1B5PA 1X28A 1M0OA 1ECXA 2CB1A 2BWPA 4OCAA 5DJ9A 3VAXA 3VK2A 4A0FA 2HOYA 4OT8A 1O62A 3LVMA 1ARSA 2YKXA 3FTBA 3QGUA 4NOGA 3UAKA 4RKCA 1GC0A 1AAWA 5G4JA 2AY9A 1ZODA 2HP1A 3DXVA 3LVKA 5D95A 5E4ZA 3RI6A 4U1TA 2V0YA 2YCTA 4GDYA 1TATA 4F5FA 5DB5A 3IHJA 2DOUA 4E1OA 3E77A 1ASMA 1ASDA 1YIYA 2VMVA 2Z9WA 2YOBA 3HDOA 3K7YA 4XJLA 3F0HA 3I5TA 4TN4A 1GCKA 1LKCA 2AY7A 2VMPA 4JE5D 4OBVA 4RJ0A 5HXXA 3A8UX 2VMUA 4XQ2A 1BJOA 4A0HA 3GR9A 1YJYA 2VMOA 4WYDA 4ITGA 4P3MA 1WYVA 4ADDA 2EH6A 2OKKA 2W7HA 2FQ6A 2W7EA 3M5UA 1DJ9A 1M4NA 5M49A 3TCMA 5FT8A 4ADEA 1C7GA 1KKJA 4IXZA 1CQ6A 2YCPA 1ARGA 4PIWA 2X3LA 3VOMA 2BI2A 4PFFA 3AOVA 2JGTA 3EZSA 1LC8A 1XEYA 3N5MA 4WYFA 3A9XA 1T3IA 4A0RA 1AJSA 4JF0A 3JWAA 2E54A 2NMPA 1IX7A 5F9SA 4BA5A 2V1PA 5M4BA 2HORA 3AEJC 3OP7A 1OATA 4Q76A 1D7UA 2AY6A 4MKKA 3DRDA 1GC4A 1S09A 2EO5A 2VGTA 3NDNA 3AV7A 1M0QA 2C44A 4MQQA 3ELPA 4XJMA 1M6SA 4CBSA 9AATA 1V2EA 2HOXA 5DJ1A 4N0WA 3GZCA 2AEVA 4LNJA 5EAVA 2ZC0A 2VMNA 3N4RA 1PFFA 5LH9A 3NX3A 5C6UA 4MKJA 1TOIA 4K2BA 1MGVA 4J8LA 4DGTA 4EU1A 1TASA 4GE4A 2C0RA 3WCOA 4AH3A 3GSBA 2EZ2A 2JJGA 5EQCA 2QA3A 3UE8A 3DC1A 1AJRA 3NRAA 2VYCA 4E3QA 5M46A 2EGYA 4JEZA 4GE9A 2ZUKA 3PDXA 5DX5A 3VP6A 3W1JA 2G7JA 1ELUA 1D7VA 1SZSA 3TFUA 4ZM4A 3W1HA 2VMQA 1YOOA 4R5FA 3PPLA 4RM1A 4K2MA 5E3KA 4RJYA 3B1CA 4WLHA 1ZOBA 3PD6B 1O61A 4IYOB 1GEYA 1BJ4A 4ZM3A 1WYVB 1V72A 2E7JA 1ARHA 5J8QA 5K8BA 3GBXA 1GDEA 1SZUA 4M2MA 3MBBA 2YKYA 2O1BA 1W23A 1WYTA 3AENA 3KKIA 1DGDA 1W7MA 4Q75A 2D64A 1DJUA 2VGUA 3GZDA 2AEUA 1GEWA 2W7GA 1XI9A 2ZSLA 1S08A 1IJIA 4RITA 1M0NA 1TPLA 3FZ7A 2C7TA 3LY1A 3A9ZA 4LW4A 3QHXA 2VGSA 2WK7A 4R2NA 4A00A 3E9KA 4MY5A 5EUNA 3HMUA 4ISYA 1WKGA 2Z9XA 3ELEA 1FC4A 3KE3A 1QJ3A 1KMKA 1BW0A 1AKAA 1SVVA 4UOYA 4ATPA 3BCBA 4IXSA 1B5OA 1UU1A 1YJZA 4OC9A 3B1EA 3COGA 2VMSA 4KYOA 3VK4A 4W1WA 1I43A 1KKPA 3BWNA 2ZY3A 1YJSA 2W8VA 1WSTA 1TOGA 3GWPA 2CH2A 5FT5A 2XBNA 4IX8A 5E5IA 2EPJA 2W7IA 3JW9A 3PJ0A 3WGBA 4FL0A 4A6UA 4JF1A 2FYFA 2VIAA 4WXBA 2BI9A 2FKIA 2CH1A 2VMTA 4MQRA 3LVLB 4Y0IA 1DFOA 2W7KA 3HT4A 3CQ4A 2CANA 2CJHA 2R5EA 4F5KA 2AY4A 3EI9A 1IX8A 2D66A 1MAPA 4E77A 3TQXA 1IAYA 7AATA 1AMRA 4WYCA 1B4XA 1X2AA 2ZP7A 3EI5A 1OHWA 2Z9UA 4PFNA 2PB2A 5G2QA 4ADCA 2BI1A 3PD6A 3LG0A 4IYOA 2AY5A 3B1DA 3E2ZB 1AY4A 4JEXA 5KTBA 2BWNA 2D65A 3G8MA 4XEWA 3LV2A 4ZASA 4W1XA 2Z1YA 2CINA 1WYTB 2W8JA 1B9HA 1CJ0A 3AENB 5HHYA 3E2FA 2OATA 4HF8A 2AATA 4TMRA 3T32A 1AMAA 4LNMA 3A9YA 4AOAA 1CL1A 2CSTA 4ZAHA 1AAMA 3FFHA 1G7WA 2BI3A 5HDMA 1C7OA 1IUGA 2FM1A 2XH1A 5FT4A 2VMZA 5D5SA 2W7MA 1JS6A 4P7YA 2HUIA 1C9CA 2JJEA 2ZYJA 4ATQA 3B46A 4A72A 3WY7A 1H0CA 4WLJA 2R0TA 4TV7A 2HP2A 2YKUA 4GEBA 3FDDA 1C4KA 3NYTA 5FT6A 2WB6A 2QSRA 3BS8A 3N4XA 1ELQA 4WXFA 2BIAA 3JTXA 3RUYA 3ZZKA 2GMSA 1AICA 1G4XA 3PDBB 1AHGA 3QI6A 4A6RA 1C0NA 2O7CA 2FN6A 1W3UA 2W8TA 2GSAA 3GJUA 2QB3A 3TATA 1YIZA 2G6WA 3MAFB 3ZZJA 5EUEA 4U2HA 2A1VA 3BV0A 5AX8A 4DBCA 4MGRA 3PAAA 3RCHB 3EUCA 3ECDA 1FG3A 3ZRQA 1D7SA 1ARTA 4UHOA 3NYSA 1TOEA 1GEXA 1CQ7A 4B9BA 4WB0B 2CJDA 1H1CA 4WYAA 4WP0A 3HLMA 3JZLA 1ASFA 3PIUA 1E5EA 2Z9VA 1B9IA 1ZC9A 3AOWA 3P6KA 3EI8A 3HBXA 3G0TA 2AY2A 3DODA 3L8AA 2CTZA 2JJHA 4W91A 3EIAA 3AEPA 1ARIA 1DGEA 3FVUA 4UQVA 4IW7A 4Y0DA 3H9XA 4JEWA 3LWSA 3RQ1A 4ZSYA 3WKRA 1AKBA 1V2FA 4LNLA 1SPAA 1BQAA 2YRIA 1SF2A 1G7XA 1AHXA 2C81A 2CFBA 3TFTA 1GD9A 1AMSA 2W7LA 4RKDA 1SZKA 1TOJA 3FQ8A 2EZ1A 5TF5A 1BKGA 1N31A 1U08A 3ZRRA 3LVJA 5JAYA 3WCNA 3F9TA 1MDXA 5IWQA 4W8IA 4OYTA 4Q31A 3E2ZA 3RBFA 1ASGA 1LS3A 3A2BA 2ZY4A 3MC6A 1ASNA 2JG2A 4W1VA 1UKJA 1MDOA 2KFPA 3DXWA 5EAAA 4CVQA 2Z1ZA 2VI8A 1WYUB 1Y4IA 2D63A 4CBRA 3QN6A 5EFSA 3BB8A 1D2FA 1O69A 3DU4A 3ISLA 4K2IA 3EI7A 1DJEA 5M4DA 3D6KA 3Q8NA 1FG7A 3WGCA 4F5JA 1QZ9A 4ZWMA 2BI5A 3WX9A 2YRRA 1EQBA 1VJOA 3F6TA 4ADBA 1OXOA 1P3WA 4O6ZA 2JJFA 4B98A 3E2YA 1AY8A 4MSOA 3R4TA 2ZJGA 3WLXA 1I48A 2F8JA 4M2KA 1AIBA 3BWNC 1JS3A 4AO4A 2D7YA 2QBTA 2VLFA 1LC5A 1S0AA 2ORDA 1CL2A 3PDBA 4E3RA 4K05A 1RV4A 2DKBA 3ASBA 1MDZA 2BKWA 3MAFA 2O0RA 1PMMA 4FFCA 1QITA 2Q7WA 1I29A 3RCHA 4ZDOA 2AY1A 3CBFA 4BHDA 1I41A 1LC7A 2OKJA 4WB0A 1RVYA 2TPLA 4R8DA 2E7UA 2BIEA 4EMYA 1EG5A 3NU7A 3OKSA 3N75A 4F5HA 3AEMA 3FRKA 1QGNA 4JE5A 2DGLA 3MEBA 3NTJA 2HUUA 1KMJA 2VLHA 3QBOA 4A0GA 4WXGA 4OMAA 2BIGA 2DGMA 1S06A 3EIBA 3FQAA 5F8VA 3AATA 3W1IA 4UHMA 4L0OA 2WK8A 3ATHA 3BCXA 1D7RA 1X29A 1AHYA 1TOKA 2DGKA 1RV3A 2VGZA 1CZCA 1QIRA 2W8WA 4RIZA 2DKJA 1MLYA 4H51A 2W7DA 1QJ5A 4BA4A 2FNIA 2D7ZA 1WKHA 2HUFA 2JISA 3CQ5A 4LW2A 4F5GA 3KGXA 1BS0A 4F5MA 3GETA 1KL2A 3CQ6A 4OTLA 4EB5A 2VMXA 1AKCA 2DR1A 3MAUA 3HL2A 4ITXA 3FZ8A 3BWOA 1WYUA 1E5FA 3E6GA 3FQ7A 4GSAA 3RBLA 2BYLA 1UU0A 2OQXA 5EUDA 5G4IA 5LHAA 1DTYA 8AATA 4J5UA 2R5CA 3N0LA 1PMOA 2Z20A 4WD2A 1J04A 1AY5A 2HZPA 4F4EA 2PO3A 3FCRA 3NYUA 4BMKA 1V2DA 2VMYA 4HVKA 2W8UA 3WZFA 1TARA 3NU8A 4I8AA 4DQ6A 4CXRA 1W7NA 3DR7A 5G2PA 1C7NA 2BHXA 3B8XA 3DR4A 4ZDLA 4KAMA 2QLRA 1BJNA 3EZ1A 1YNUA 3K40A 4OBUA 3I16A 4BQ0A 1SFFA 3I4JA 3N7NA 2RFVA 1IVRA 3K28A 3UWCA 1MLZA 1N8PA 1ASCA 1VEFA 2GQNA 2WKAA 3EI6A 1DKAA 1GBNA 3USFA 1N2TA 1UU2A 4WYEA 4A6TA 4XJOA 4AO9A 2YCNA 4ZWVA 2R2NA 3AELA 1AX4A 1BJWA 1GC3A 4LC3A 4RAEA 1AMQA 5EIGB 4JEVA 4ZSWA 1ASBA 1B8GA 2ZY2A 2WK9A 4XJPA 1LW5A 1O4SA 1J32A 3AEJA 3BC8A 5G09A 4ZLVA 4H63Q 4N0BA 2CJGA 1AIAA 3FVXA
chains in the Genus database with same CATH topology
3FD0A 2E7IA 1Z3ZA 2VGWA 2ZSMA 1BT4A 1ASEA 3G7QA 3NUIA 4GE7A 4M2JA 3MKJA 1CZEA 1PG8A 3NNKA 4EFFA 3FKDA 3R9AA 2OGEA 1Z7DA 2AY8A 3MADA 2X5FA 3JU7A 3MC6C 1RVUA 2QB2A 3CAIA 3NUBA 1X0MA 1W7LA 4F5LA 2Z61A 3GZDC 3II0A 1JF9A 1EJIA 1JG8A 2OGAA 1IX6A 3QPGA 1CQ8A 2VMWA 2BYJA 4IY7A 4MQPA 4EB7A 2W7FA 3FDBA 3WKSA 3FFRA 4RLGA 4WYGA 3HQTA 1S07A 2GMUA 2Z67A 2R5CB 2ZY5A 4XAUA 3PGYA 1GC2A 2PB0A 4UHNA 2CY8A 5I92A 1BJOB 1IBJA 4IXOA 1M32A 2D5YA 2QMAA 4WBTA 4AZKA 1G4VA 4R5ZA 1QISA 3IF2A 2AY3A 3ZRPA 2GB3A 2YKVA 3JWBA 2VIBA 1LW4A 1ASAA 2X5DA 4PVFA 4W5KA 2VI9A 4AZJA 1OHVA 2HOZA 4Y0HA 2EYQA 2BWOA 1OXPA 3BN1A 4GRXA 3QM2A 3BCAA 1ASLA 3AEOA 1AJSB 1CS1A 1AHFA 1KL1A 2FNUA 4Q6RA 2D61A 3AEMC 3P1TA 3N4SA 3L44A 2YHKA 1YAAA 3FZ6A 4QGRA 4F5IA 2VGVA 3PA9A 2X8UA 3HVYA 3ASAA 5BJ3A 3FVSA 5BJ4A 3ACZA 3KGWA 2VMRA 5EIGA 4CXQA 1IAXA 1BQDA 1MAQA 3H7FA 4JEYA 4KXKA 1LK9A 3VK3A 5G0AA 1M7YA 1M0PA 1VP4A 4ZDPA 1ORDA 1AHEA 3FSLA 1OHYA 3DZZA 4XK1A 2W7JA 3H14A 3DYDA 1B5PA 1X28A 1M0OA 1ECXA 2CB1A 2BWPA 4OCAA 5DJ9A 3VAXA 3VK2A 4A0FA 2HOYA 4OT8A 1O62A 3LVMA 1ARSA 2YKXA 3FTBA 3QGUA 4NOGA 3UAKA 4RKCA 1GC0A 1AAWA 5G4JA 2AY9A 1ZODA 2HP1A 3DXVA 3LVKA 5D95A 5E4ZA 3RI6A 4U1TA 2V0YA 2YCTA 4GDYA 1TATA 4F5FA 5DB5A 3IHJA 2DOUA 4E1OA 3E77A 1ASMA 1ASDA 1YIYA 2VMVA 2Z9WA 2YOBA 3HDOA 3K7YA 4XJLA 3F0HA 3I5TA 4TN4A 1GCKA 1LKCA 2AY7A 2VMPA 4JE5D 4OBVA 4RJ0A 5HXXA 3A8UX 2VMUA 4XQ2A 1BJOA 4A0HA 3GR9A 1YJYA 2VMOA 4WYDA 4ITGA 4P3MA 1WYVA 4ADDA 2EH6A 2OKKA 2W7HA 2FQ6A 2W7EA 3M5UA 1DJ9A 1M4NA 5M49A 3TCMA 5FT8A 4ADEA 1C7GA 1KKJA 4IXZA 1CQ6A 2YCPA 1ARGA 4PIWA 2X3LA 3VOMA 2BI2A 4PFFA 3AOVA 2JGTA 3EZSA 1LC8A 1XEYA 3N5MA 4WYFA 3A9XA 1T3IA 4A0RA 1AJSA 4JF0A 3JWAA 2E54A 2NMPA 1IX7A 5F9SA 4BA5A 2V1PA 5M4BA 2HORA 3AEJC 3OP7A 1OATA 4Q76A 1D7UA 2AY6A 4MKKA 3DRDA 1GC4A 1S09A 2EO5A 2VGTA 3NDNA 3AV7A 1M0QA 2C44A 4MQQA 3ELPA 4XJMA 1M6SA 4CBSA 9AATA 1V2EA 2HOXA 5DJ1A 4N0WA 3GZCA 2AEVA 4LNJA 5EAVA 2ZC0A 2VMNA 3N4RA 1PFFA 5LH9A 3NX3A 5C6UA 4MKJA 1TOIA 4K2BA 1MGVA 4J8LA 4DGTA 4EU1A 1TASA 4GE4A 2C0RA 3WCOA 4AH3A 3GSBA 2EZ2A 2JJGA 5EQCA 2QA3A 3UE8A 3DC1A 1AJRA 3NRAA 2VYCA 4E3QA 5M46A 2EGYA 4JEZA 4GE9A 2ZUKA 3PDXA 5DX5A 3VP6A 3W1JA 2G7JA 1ELUA 1D7VA 1SZSA 3TFUA 4ZM4A 3W1HA 2VMQA 1YOOA 4R5FA 3PPLA 4RM1A 4K2MA 5E3KA 4RJYA 3B1CA 4WLHA 1ZOBA 3PD6B 1O61A 4IYOB 1GEYA 1BJ4A 4ZM3A 1WYVB 1V72A 2E7JA 1ARHA 5J8QA 5K8BA 3GBXA 1GDEA 1SZUA 4M2MA 3MBBA 2YKYA 2O1BA 1W23A 1WYTA 3AENA 3KKIA 1DGDA 1W7MA 4Q75A 2D64A 1DJUA 2VGUA 3GZDA 2AEUA 1GEWA 2W7GA 1XI9A 2ZSLA 1S08A 1IJIA 4RITA 1M0NA 1TPLA 3FZ7A 2C7TA 3LY1A 3A9ZA 4LW4A 3QHXA 2VGSA 2WK7A 4R2NA 4A00A 3E9KA 4MY5A 5EUNA 3HMUA 4ISYA 1WKGA 2Z9XA 3ELEA 1FC4A 3KE3A 1QJ3A 1KMKA 1BW0A 1AKAA 1SVVA 4UOYA 4ATPA 3BCBA 4IXSA 1B5OA 1UU1A 1YJZA 4OC9A 3B1EA 3COGA 2VMSA 4KYOA 3VK4A 4W1WA 1I43A 1KKPA 3BWNA 2ZY3A 1YJSA 2W8VA 1WSTA 1TOGA 3GWPA 2CH2A 5FT5A 2XBNA 4IX8A 5E5IA 2EPJA 2W7IA 3JW9A 3PJ0A 3WGBA 4FL0A 4A6UA 4JF1A 2FYFA 2VIAA 4WXBA 2BI9A 2FKIA 2CH1A 2VMTA 4MQRA 3LVLB 4Y0IA 1DFOA 2W7KA 3HT4A 3CQ4A 2CANA 2CJHA 2R5EA 4F5KA 2AY4A 3EI9A 1IX8A 2D66A 1MAPA 4E77A 3TQXA 1IAYA 7AATA 1AMRA 4WYCA 1B4XA 1X2AA 2ZP7A 3EI5A 1OHWA 2Z9UA 4PFNA 2PB2A 5G2QA 4ADCA 2BI1A 3PD6A 3LG0A 4IYOA 2AY5A 3B1DA 3E2ZB 1AY4A 4JEXA 5KTBA 2BWNA 2D65A 3G8MA 4XEWA 3LV2A 4ZASA 4W1XA 2Z1YA 2CINA 1WYTB 2W8JA 1B9HA 1CJ0A 3AENB 5HHYA 3E2FA 2OATA 4HF8A 2AATA 4TMRA 3T32A 1AMAA 4LNMA 3A9YA 4AOAA 1CL1A 2CSTA 4ZAHA 1AAMA 3FFHA 1G7WA 2BI3A 5HDMA 1C7OA 1IUGA 2FM1A 2XH1A 5FT4A 2VMZA 5D5SA 2W7MA 1JS6A 4P7YA 2HUIA 1C9CA 2JJEA 2ZYJA 4ATQA 3B46A 4A72A 3WY7A 1H0CA 4WLJA 2R0TA 4TV7A 2HP2A 2YKUA 4GEBA 3FDDA 1C4KA 3NYTA 5FT6A 2WB6A 2QSRA 3BS8A 3N4XA 1ELQA 4WXFA 2BIAA 3JTXA 3RUYA 3ZZKA 2GMSA 1AICA 1G4XA 3PDBB 1AHGA 3QI6A 4A6RA 1C0NA 2O7CA 2FN6A 1W3UA 2W8TA 2GSAA 3GJUA 2QB3A 3TATA 1YIZA 2G6WA 3MAFB 3ZZJA 5EUEA 4U2HA 2A1VA 3BV0A 5AX8A 4DBCA 4MGRA 3PAAA 3RCHB 3EUCA 3ECDA 1FG3A 3ZRQA 1D7SA 1ARTA 4UHOA 3NYSA 1TOEA 1GEXA 1CQ7A 4B9BA 4WB0B 2CJDA 1H1CA 4WYAA 4WP0A 3HLMA 3JZLA 1ASFA 3PIUA 1E5EA 2Z9VA 1B9IA 1ZC9A 3AOWA 3P6KA 3EI8A 3HBXA 3G0TA 2AY2A 3DODA 3L8AA 2CTZA 2JJHA 4W91A 3EIAA 3AEPA 1ARIA 1DGEA 3FVUA 4UQVA 4IW7A 4Y0DA 3H9XA 4JEWA 3LWSA 3RQ1A 4ZSYA 3WKRA 1AKBA 1V2FA 4LNLA 1SPAA 1BQAA 2YRIA 1SF2A 1G7XA 1AHXA 2C81A 2CFBA 3TFTA 1GD9A 1AMSA 2W7LA 4RKDA 1SZKA 1TOJA 3FQ8A 2EZ1A 5TF5A 1BKGA 1N31A 1U08A 3ZRRA 3LVJA 5JAYA 3WCNA 3F9TA 1MDXA 5IWQA 4W8IA 4OYTA 4Q31A 3E2ZA 3RBFA 1ASGA 1LS3A 3A2BA 2ZY4A 3MC6A 1ASNA 2JG2A 4W1VA 1UKJA 1MDOA 2KFPA 3DXWA 5EAAA 4CVQA 2Z1ZA 2VI8A 1WYUB 1Y4IA 2D63A 4CBRA 3QN6A 5EFSA 3BB8A 1D2FA 1O69A 3DU4A 3ISLA 4K2IA 3EI7A 1DJEA 5M4DA 3D6KA 3Q8NA 1FG7A 3WGCA 4F5JA 1QZ9A 4ZWMA 2BI5A 3WX9A 2YRRA 1EQBA 1VJOA 3F6TA 4ADBA 1OXOA 1P3WA 4O6ZA 2JJFA 4B98A 3E2YA 1AY8A 4MSOA 3R4TA 2ZJGA 3WLXA 1I48A 2F8JA 4M2KA 1AIBA 3BWNC 1JS3A 4AO4A 2D7YA 2QBTA 2VLFA 1LC5A 1S0AA 2ORDA 1CL2A 3PDBA 4E3RA 4K05A 1RV4A 2DKBA 3ASBA 1MDZA 2BKWA 3MAFA 2O0RA 1PMMA 4FFCA 1QITA 2Q7WA 1I29A 3RCHA 4ZDOA 2AY1A 3CBFA 4BHDA 1I41A 1LC7A 2OKJA 4WB0A 1RVYA 2TPLA 4R8DA 2E7UA 2BIEA 4EMYA 1EG5A 3NU7A 3OKSA 3N75A 4F5HA 3AEMA 3FRKA 1QGNA 4JE5A 2DGLA 3MEBA 3NTJA 2HUUA 1KMJA 2VLHA 3QBOA 4A0GA 4WXGA 4OMAA 2BIGA 2DGMA 1S06A 3EIBA 3FQAA 5F8VA 3AATA 3W1IA 4UHMA 4L0OA 2WK8A 3ATHA 3BCXA 1D7RA 1X29A 1AHYA 1TOKA 2DGKA 1RV3A 2VGZA 1CZCA 1QIRA 2W8WA 4RIZA 2DKJA 1MLYA 4H51A 2W7DA 1QJ5A 4BA4A 2FNIA 2D7ZA 1WKHA 2HUFA 2JISA 3CQ5A 4LW2A 4F5GA 3KGXA 1BS0A 4F5MA 3GETA 1KL2A 3CQ6A 4OTLA 4EB5A 2VMXA 1AKCA 2DR1A 3MAUA 3HL2A 4ITXA 3FZ8A 3BWOA 1WYUA 1E5FA 3E6GA 3FQ7A 4GSAA 3RBLA 2BYLA 1UU0A 2OQXA 5EUDA 5G4IA 5LHAA 1DTYA 8AATA 4J5UA 2R5CA 3N0LA 1PMOA 2Z20A 4WD2A 1J04A 1AY5A 2HZPA 4F4EA 2PO3A 3FCRA 3NYUA 4BMKA 1V2DA 2VMYA 4HVKA 2W8UA 3WZFA 1TARA 3NU8A 4I8AA 4DQ6A 4CXRA 1W7NA 3DR7A 5G2PA 1C7NA 2BHXA 3B8XA 3DR4A 4ZDLA 4KAMA 2QLRA 1BJNA 3EZ1A 1YNUA 3K40A 4OBUA 3I16A 4BQ0A 1SFFA 3I4JA 3N7NA 2RFVA 1IVRA 3K28A 3UWCA 1MLZA 1N8PA 1ASCA 1VEFA 2GQNA 2WKAA 3EI6A 1DKAA 1GBNA 3USFA 1N2TA 1UU2A 4WYEA 4A6TA 4XJOA 4AO9A 2YCNA 4ZWVA 2R2NA 3AELA 1AX4A 1BJWA 1GC3A 4LC3A 4RAEA 1AMQA 5EIGB 4JEVA 4ZSWA 1ASBA 1B8GA 2ZY2A 2WK9A 4XJPA 1LW5A 1O4SA 1J32A 3AEJA 3BC8A 5G09A 4ZLVA 4H63Q 4N0BA 2CJGA 1AIAA 3FVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD0 A;  2E7I A;  1Z3Z A;  2VGW A;  2ZSM A;  1BT4 A;  1ASE A;  3G7Q A;  3NUI A;  4GE7 A;  4M2J A;  3MKJ A;  1CZE A;  1PG8 A;  3NNK A;  4EFF A;  3FKD A;  3R9A A;  2OGE A;  1Z7D A;  2AY8 A;  3MAD A;  2X5F A;  3JU7 A;  3MC6 C;  1RVU A;  2QB2 A;  3CAI A;  3NUB A;  1X0M A;  1W7L A;  4F5L A;  2Z61 A;  3GZD C;  3II0 A;  1JF9 A;  1EJI A;  1JG8 A;  2OGA A;  1IX6 A;  3QPG A;  1CQ8 A;  2VMW A;  2BYJ A;  4IY7 A;  4MQP A;  4EB7 A;  2W7F A;  3FDB A;  3WKS A;  3FFR A;  4RLG A;  4WYG A;  3HQT A;  1S07 A;  2GMU A;  2Z67 A;  2R5C B;  2ZY5 A;  4XAU A;  3PGY A;  1GC2 A;  2PB0 A;  4UHN A;  2CY8 A;  5I92 A;  1BJO B;  1IBJ A;  4IXO A;  1M32 A;  2D5Y A;  2QMA A;  4WBT A;  4AZK A;  1G4V A;  4R5Z A;  1QIS A;  3IF2 A;  2AY3 A;  3ZRP A;  2GB3 A;  2YKV A;  3JWB A;  2VIB A;  1LW4 A;  1ASA A;  2X5D A;  4PVF A;  4W5K A;  2VI9 A;  4AZJ A;  1OHV A;  2HOZ A;  4Y0H A;  2BWO A;  1OXP A;  3BN1 A;  4GRX A;  3QM2 A;  3BCA A;  1ASL A;  3AEO A;  1AJS B;  1CS1 A;  1AHF A;  1KL1 A;  2FNU A;  4Q6R A;  2D61 A;  3AEM C;  3P1T A;  3L44 A;  2YHK A;  1YAA A;  3FZ6 A;  4QGR A;  4F5I A;  2VGV A;  3PA9 A;  2X8U A;  3HVY A;  3ASA A;  5BJ3 A;  3FVS A;  5BJ4 A;  3ACZ A;  3KGW A;  2VMR A;  5EIG A;  4CXQ A;  1IAX A;  1BQD A;  1MAQ A;  3H7F A;  4JEY A;  4KXK A;  1LK9 A;  3VK3 A;  5G0A A;  1M7Y A;  1M0P A;  1VP4 A;  4ZDP A;  1ORD A;  1AHE A;  3FSL A;  1OHY A;  3DZZ A;  4XK1 A;  2W7J A;  3H14 A;  3DYD A;  1B5P A;  1X28 A;  1M0O A;  1ECX A;  2CB1 A;  2BWP A;  4OCA A;  5DJ9 A;  3VAX A;  3VK2 A;  4A0F A;  2HOY A;  4OT8 A;  1O62 A;  3LVM A;  1ARS A;  2YKX A;  3FTB A;  3QGU A;  4NOG A;  3UAK A;  4RKC A;  1GC0 A;  1AAW A;  5G4J A;  2AY9 A;  1ZOD A;  2HP1 A;  3DXV A;  3LVK A;  5D95 A;  5E4Z A;  3RI6 A;  4U1T A;  2V0Y A;  2YCT A;  4GDY A;  1TAT A;  4F5F A;  5DB5 A;  3IHJ A;  2DOU A;  4E1O A;  3E77 A;  1ASM A;  1ASD A;  1YIY A;  2VMV A;  2Z9W A;  2YOB A;  3HDO A;  3K7Y A;  4XJL A;  3F0H A;  3I5T A;  4TN4 A;  1GCK A;  1LKC A;  2AY7 A;  2VMP A;  4JE5 D;  4OBV A;  4RJ0 A;  5HXX A;  3A8U X;  2VMU A;  4XQ2 A;  1BJO A;  4A0H A;  3GR9 A;  1YJY A;  2VMO A;  4WYD A;  4ITG A;  4P3M A;  1WYV A;  4ADD A;  2EH6 A;  2OKK A;  2W7H A;  2FQ6 A;  2W7E A;  3M5U A;  1DJ9 A;  1M4N A;  5M49 A;  3TCM A;  5FT8 A;  4ADE A;  1C7G A;  1KKJ A;  4IXZ A;  1CQ6 A;  2YCP A;  1ARG A;  4PIW A;  2X3L A;  3VOM A;  2BI2 A;  4PFF A;  3AOV A;  2JGT A;  3EZS A;  1LC8 A;  1XEY A;  3N5M A;  4WYF A;  3A9X A;  1T3I A;  4A0R A;  1AJS A;  4JF0 A;  3JWA A;  2E54 A;  2NMP A;  1IX7 A;  5F9S A;  4BA5 A;  2V1P A;  5M4B A;  2HOR A;  3AEJ C;  3OP7 A;  1OAT A;  4Q76 A;  1D7U A;  2AY6 A;  4MKK A;  3DRD A;  1GC4 A;  1S09 A;  2EO5 A;  2VGT A;  3NDN A;  3AV7 A;  1M0Q A;  2C44 A;  4MQQ A;  3ELP A;  4XJM A;  1M6S A;  4CBS A;  9AAT A;  1V2E A;  2HOX A;  5DJ1 A;  4N0W A;  3GZC A;  2AEV A;  4LNJ A;  5EAV A;  2ZC0 A;  2VMN A;  1PFF A;  5LH9 A;  3NX3 A;  5C6U A;  4MKJ A;  1TOI A;  4K2B A;  1MGV A;  4J8L A;  4DGT A;  4EU1 A;  1TAS A;  4GE4 A;  2C0R A;  3WCO A;  4AH3 A;  3GSB A;  2EZ2 A;  2JJG A;  5EQC A;  2QA3 A;  3UE8 A;  3DC1 A;  1AJR A;  3NRA A;  2VYC A;  4E3Q A;  5M46 A;  2EGY A;  4JEZ A;  4GE9 A;  2ZUK A;  3PDX A;  5DX5 A;  3VP6 A;  3W1J A;  1ELU A;  1D7V A;  1SZS A;  3TFU A;  4ZM4 A;  3W1H A;  2VMQ A;  1YOO A;  4R5F A;  3PPL A;  4RM1 A;  4K2M A;  5E3K A;  4RJY A;  3B1C A;  4WLH A;  1ZOB A;  3PD6 B;  1O61 A;  4IYO B;  1GEY A;  1BJ4 A;  4ZM3 A;  1WYV B;  1V72 A;  2E7J A;  1ARH A;  5J8Q A;  5K8B A;  3GBX A;  1GDE A;  1SZU A;  4M2M A;  3MBB A;  2YKY A;  2O1B A;  1W23 A;  1WYT A;  3AEN A;  3KKI A;  1DGD A;  1W7M A;  4Q75 A;  2D64 A;  1DJU A;  2VGU A;  3GZD A;  2AEU A;  1GEW A;  2W7G A;  1XI9 A;  2ZSL A;  1S08 A;  1IJI A;  4RIT A;  1M0N A;  1TPL A;  3FZ7 A;  2C7T A;  3LY1 A;  3A9Z A;  4LW4 A;  3QHX A;  2VGS A;  2WK7 A;  4R2N A;  4A00 A;  3E9K A;  4MY5 A;  5EUN A;  3HMU A;  4ISY A;  1WKG A;  2Z9X A;  3ELE A;  1FC4 A;  3KE3 A;  1QJ3 A;  1KMK A;  1BW0 A;  1AKA A;  1SVV A;  4UOY A;  4ATP A;  3BCB A;  4IXS A;  1B5O A;  1UU1 A;  1YJZ A;  4OC9 A;  3B1E A;  3COG A;  2VMS A;  4KYO A;  3VK4 A;  4W1W A;  1I43 A;  1KKP A;  3BWN A;  2ZY3 A;  1YJS A;  2W8V A;  1WST A;  1TOG A;  3GWP A;  2CH2 A;  5FT5 A;  2XBN A;  4IX8 A;  5E5I A;  2EPJ A;  2W7I A;  3JW9 A;  3PJ0 A;  3WGB A;  4FL0 A;  4A6U A;  4JF1 A;  2FYF A;  2VIA A;  4WXB A;  2BI9 A;  2CH1 A;  2VMT A;  4MQR A;  3LVL B;  4Y0I A;  1DFO A;  2W7K A;  3HT4 A;  3CQ4 A;  2CAN A;  2CJH A;  2R5E A;  4F5K A;  2AY4 A;  3EI9 A;  1IX8 A;  2D66 A;  1MAP A;  4E77 A;  3TQX A;  1IAY A;  7AAT A;  1AMR A;  4WYC A;  1B4X A;  1X2A A;  2ZP7 A;  3EI5 A;  1OHW A;  2Z9U A;  4PFN A;  2PB2 A;  5G2Q A;  4ADC A;  2BI1 A;  3PD6 A;  3LG0 A;  4IYO A;  2AY5 A;  3B1D A;  3E2Z B;  1AY4 A;  4JEX A;  2BWN A;  2D65 A;  3G8M A;  4XEW A;  3LV2 A;  4ZAS A;  4W1X A;  2Z1Y A;  2CIN A;  1WYT B;  2W8J A;  1B9H A;  1CJ0 A;  3AEN B;  5HHY A;  3E2F A;  2OAT A;  4HF8 A;  2AAT A;  4TMR A;  3T32 A;  1AMA A;  4LNM A;  3A9Y A;  4AOA A;  1CL1 A;  2CST A;  4ZAH A;  1AAM A;  3FFH A;  1G7W A;  2BI3 A;  5HDM A;  1C7O A;  1IUG A;  2FM1 A;  2XH1 A;  5FT4 A;  2VMZ A;  5D5S A;  2W7M A;  1JS6 A;  4P7Y A;  2HUI A;  1C9C A;  2JJE A;  2ZYJ A;  4ATQ A;  3B46 A;  4A72 A;  3WY7 A;  1H0C A;  4WLJ A;  2R0T A;  4TV7 A;  2HP2 A;  2YKU A;  4GEB A;  3FDD A;  1C4K A;  3NYT A;  5FT6 A;  3BS8 A;  1ELQ A;  4WXF A;  2BIA A;  3JTX A;  3RUY A;  3ZZK A;  2GMS A;  1AIC A;  1G4X A;  3PDB B;  1AHG A;  3QI6 A;  4A6R A;  1C0N A;  2O7C A;  2FN6 A;  1W3U A;  2W8T A;  2GSA A;  3GJU A;  2QB3 A;  3TAT A;  1YIZ A;  2G6W A;  3MAF B;  3ZZJ A;  5EUE A;  4U2H A;  3BV0 A;  5AX8 A;  4DBC A;  4MGR A;  3PAA A;  3RCH B;  3EUC A;  3ECD A;  1FG3 A;  3ZRQ A;  1D7S A;  1ART A;  4UHO A;  3NYS A;  1TOE A;  1GEX A;  1CQ7 A;  4B9B A;  4WB0 B;  2CJD A;  1H1C A;  4WYA A;  4WP0 A;  3HLM A;  3JZL A;  1ASF A;  3PIU A;  1E5E A;  2Z9V A;  1B9I A;  1ZC9 A;  3AOW A;  3P6K A;  3EI8 A;  3HBX A;  3G0T A;  2AY2 A;  3DOD A;  3L8A A;  2CTZ A;  2JJH A;  4W91 A;  3EIA A;  3AEP A;  1ARI A;  1DGE A;  3FVU A;  4UQV A;  4IW7 A;  4Y0D A;  4JEW A;  3LWS A;  3RQ1 A;  4ZSY A;  3WKR A;  1AKB A;  1V2F A;  4LNL A;  1SPA A;  1BQA A;  2YRI A;  1SF2 A;  1G7X A;  1AHX A;  2C81 A;  2CFB A;  3TFT A;  1GD9 A;  1AMS A;  2W7L A;  4RKD A;  1SZK A;  1TOJ A;  3FQ8 A;  2EZ1 A;  5TF5 A;  1BKG A;  1N31 A;  1U08 A;  3ZRR A;  3LVJ A;  5JAY A;  3WCN A;  3F9T A;  1MDX A;  5IWQ A;  4W8I A;  4OYT A;  4Q31 A;  3E2Z A;  3RBF A;  1ASG A;  1LS3 A;  3A2B A;  2ZY4 A;  3MC6 A;  1ASN A;  2JG2 A;  4W1V A;  1UKJ A;  1MDO A;  3DXW A;  5EAA A;  4CVQ A;  2Z1Z A;  2VI8 A;  1WYU B;  1Y4I A;  2D63 A;  4CBR A;  3QN6 A;  5EFS A;  3BB8 A;  1D2F A;  1O69 A;  3DU4 A;  3ISL A;  4K2I A;  3EI7 A;  1DJE A;  5M4D A;  3D6K A;  3Q8N A;  1FG7 A;  3WGC A;  4F5J A;  1QZ9 A;  4ZWM A;  2BI5 A;  3WX9 A;  2YRR A;  1EQB A;  1VJO A;  3F6T A;  4ADB A;  1OXO A;  1P3W A;  4O6Z A;  2JJF A;  4B98 A;  3E2Y A;  1AY8 A;  4MSO A;  3R4T A;  2ZJG A;  3WLX A;  1I48 A;  2F8J A;  4M2K A;  1AIB A;  3BWN C;  1JS3 A;  4AO4 A;  2D7Y A;  2QBT A;  2VLF A;  1LC5 A;  1S0A A;  2ORD A;  1CL2 A;  3PDB A;  4E3R A;  1RV4 A;  2DKB A;  3ASB A;  1MDZ A;  2BKW A;  3MAF A;  2O0R A;  1PMM A;  4FFC A;  1QIT A;  2Q7W A;  1I29 A;  3RCH A;  4ZDO A;  2AY1 A;  3CBF A;  4BHD A;  1I41 A;  1LC7 A;  2OKJ A;  4WB0 A;  1RVY A;  2TPL A;  4R8D A;  2E7U A;  2BIE A;  4EMY A;  1EG5 A;  3NU7 A;  3OKS A;  3N75 A;  4F5H A;  3AEM A;  3FRK A;  1QGN A;  4JE5 A;  2DGL A;  3MEB A;  3NTJ A;  2HUU A;  1KMJ A;  2VLH A;  3QBO A;  4A0G A;  4WXG A;  4OMA A;  2BIG A;  2DGM A;  1S06 A;  3EIB A;  3FQA A;  5F8V A;  3AAT A;  3W1I A;  4UHM A;  4L0O A;  2WK8 A;  3ATH A;  3BCX A;  1D7R A;  1X29 A;  1AHY A;  1TOK A;  2DGK A;  1RV3 A;  2VGZ A;  1CZC A;  1QIR A;  2W8W A;  4RIZ A;  2DKJ A;  1MLY A;  4H51 A;  2W7D A;  1QJ5 A;  4BA4 A;  2FNI A;  2D7Z A;  1WKH A;  2HUF A;  2JIS A;  3CQ5 A;  4LW2 A;  4F5G A;  3KGX A;  1BS0 A;  4F5M A;  3GET A;  1KL2 A;  3CQ6 A;  4OTL A;  4EB5 A;  2VMX A;  1AKC A;  2DR1 A;  3MAU A;  3HL2 A;  4ITX A;  3FZ8 A;  3BWO A;  1WYU A;  1E5F A;  3E6G A;  3FQ7 A;  4GSA A;  3RBL A;  2BYL A;  1UU0 A;  2OQX A;  5EUD A;  5G4I A;  5LHA A;  1DTY A;  8AAT A;  4J5U A;  2R5C A;  3N0L A;  1PMO A;  2Z20 A;  4WD2 A;  1J04 A;  1AY5 A;  2HZP A;  4F4E A;  2PO3 A;  3FCR A;  3NYU A;  4BMK A;  1V2D A;  2VMY A;  4HVK A;  2W8U A;  3WZF A;  1TAR A;  3NU8 A;  4I8A A;  4DQ6 A;  4CXR A;  1W7N A;  3DR7 A;  5G2P A;  1C7N A;  2BHX A;  3B8X A;  3DR4 A;  4ZDL A;  4KAM A;  2QLR A;  1BJN A;  3EZ1 A;  1YNU A;  3K40 A;  4OBU A;  3I16 A;  4BQ0 A;  1SFF A;  3I4J A;  2RFV A;  1IVR A;  3K28 A;  3UWC A;  1MLZ A;  1N8P A;  1ASC A;  1VEF A;  2GQN A;  2WKA A;  3EI6 A;  1DKA A;  1GBN A;  3USF A;  1N2T A;  1UU2 A;  4WYE A;  4A6T A;  4XJO A;  4AO9 A;  2YCN A;  4ZWV A;  2R2N A;  3AEL A;  1AX4 A;  1BJW A;  1GC3 A;  4LC3 A;  4RAE A;  1AMQ A;  5EIG B;  4JEV A;  4ZSW A;  1ASB A;  1B8G A;  2ZY2 A;  2WK9 A;  4XJP A;  1LW5 A;  1O4S A;  1J32 A;  3AEJ A;  3BC8 A;  5G09 A;  4ZLV A;  4N0B A;  2CJG A;  1AIA A;  3FVX A; 
#chains in the Genus database with same CATH topology
 3FD0 A;  2E7I A;  1Z3Z A;  2VGW A;  2ZSM A;  1BT4 A;  1ASE A;  3G7Q A;  3NUI A;  4GE7 A;  4M2J A;  3MKJ A;  1CZE A;  1PG8 A;  3NNK A;  4EFF A;  3FKD A;  3R9A A;  2OGE A;  1Z7D A;  2AY8 A;  3MAD A;  2X5F A;  3JU7 A;  3MC6 C;  1RVU A;  2QB2 A;  3CAI A;  3NUB A;  1X0M A;  1W7L A;  4F5L A;  2Z61 A;  3GZD C;  3II0 A;  1JF9 A;  1EJI A;  1JG8 A;  2OGA A;  1IX6 A;  3QPG A;  1CQ8 A;  2VMW A;  2BYJ A;  4IY7 A;  4MQP A;  4EB7 A;  2W7F A;  3FDB A;  3WKS A;  3FFR A;  1KAF A;  4RLG A;  4WYG A;  3HQT A;  1S07 A;  2GMU A;  2Z67 A;  2R5C B;  2ZY5 A;  4XAU A;  3PGY A;  1GC2 A;  2PB0 A;  4UHN A;  2CY8 A;  5I92 A;  1BJO B;  1IBJ A;  4IXO A;  1M32 A;  2D5Y A;  2QMA A;  4WBT A;  4AZK A;  1G4V A;  4R5Z A;  1QIS A;  3IF2 A;  2AY3 A;  3ZRP A;  2GB3 A;  2YKV A;  3JWB A;  2VIB A;  1LW4 A;  1ASA A;  2X5D A;  4PVF A;  4W5K A;  2VI9 A;  4AZJ A;  1OHV A;  2HOZ A;  4Y0H A;  2EYQ A;  2BWO A;  1OXP A;  3BN1 A;  4GRX A;  3QM2 A;  3BCA A;  1ASL A;  3AEO A;  1AJS B;  1CS1 A;  1AHF A;  1KL1 A;  2FNU A;  4Q6R A;  2D61 A;  3AEM C;  3P1T A;  3N4S A;  3L44 A;  2YHK A;  1YAA A;  3FZ6 A;  4QGR A;  4F5I A;  2VGV A;  3PA9 A;  2X8U A;  3HVY A;  3ASA A;  5BJ3 A;  3FVS A;  5BJ4 A;  3ACZ A;  3KGW A;  2VMR A;  5EIG A;  4CXQ A;  1IAX A;  1BQD A;  1MAQ A;  3H7F A;  4JEY A;  4KXK A;  1LK9 A;  3VK3 A;  5G0A A;  1M7Y A;  1M0P A;  1VP4 A;  4ZDP A;  1ORD A;  1AHE A;  3FSL A;  1OHY A;  3DZZ A;  4XK1 A;  2W7J A;  3H14 A;  3DYD A;  1B5P A;  1X28 A;  1M0O A;  1ECX A;  2CB1 A;  2BWP A;  4OCA A;  5DJ9 A;  3VAX A;  3VK2 A;  4A0F A;  2HOY A;  4OT8 A;  1O62 A;  3LVM A;  1ARS A;  2YKX A;  3FTB A;  3QGU A;  4NOG A;  3UAK A;  4RKC A;  1GC0 A;  1AAW A;  5G4J A;  2AY9 A;  1ZOD A;  2HP1 A;  3DXV A;  3LVK A;  5D95 A;  5E4Z A;  3RI6 A;  4U1T A;  2V0Y A;  2YCT A;  4GDY A;  1TAT A;  4F5F A;  5DB5 A;  3IHJ A;  2DOU A;  4E1O A;  3E77 A;  1ASM A;  1ASD A;  1YIY A;  2VMV A;  2Z9W A;  2YOB A;  3HDO A;  3K7Y A;  4XJL A;  3F0H A;  3I5T A;  4TN4 A;  1GCK A;  1LKC A;  2AY7 A;  2VMP A;  4JE5 D;  4OBV A;  4RJ0 A;  5HXX A;  3A8U X;  2VMU A;  4XQ2 A;  1BJO A;  4A0H A;  3GR9 A;  1YJY A;  2VMO A;  4WYD A;  4ITG A;  4P3M A;  1WYV A;  4ADD A;  2EH6 A;  2OKK A;  2W7H A;  2FQ6 A;  2W7E A;  3M5U A;  1DJ9 A;  1M4N A;  5M49 A;  3TCM A;  5FT8 A;  4ADE A;  1C7G A;  1KKJ A;  4IXZ A;  1CQ6 A;  2YCP A;  1ARG A;  4PIW A;  2X3L A;  3VOM A;  2BI2 A;  4PFF A;  3AOV A;  2JGT A;  3EZS A;  1LC8 A;  1XEY A;  3N5M A;  4WYF A;  3A9X A;  1T3I A;  4A0R A;  1AJS A;  4JF0 A;  3JWA A;  2E54 A;  2NMP A;  1IX7 A;  5F9S A;  4BA5 A;  2V1P A;  5M4B A;  2HOR A;  3AEJ C;  3OP7 A;  1OAT A;  4Q76 A;  1D7U A;  2AY6 A;  4MKK A;  3DRD A;  1GC4 A;  1S09 A;  2EO5 A;  2VGT A;  3NDN A;  3AV7 A;  1M0Q A;  2C44 A;  4MQQ A;  3ELP A;  4XJM A;  1M6S A;  4CBS A;  9AAT A;  1V2E A;  2HOX A;  5DJ1 A;  4N0W A;  3GZC A;  2AEV A;  4LNJ A;  5EAV A;  2ZC0 A;  2VMN A;  3N4R A;  1PFF A;  5LH9 A;  3NX3 A;  5C6U A;  4MKJ A;  1TOI A;  4K2B A;  1MGV A;  4J8L A;  4DGT A;  4EU1 A;  1TAS A;  4GE4 A;  2C0R A;  3WCO A;  4AH3 A;  3GSB A;  2EZ2 A;  2JJG A;  5EQC A;  2QA3 A;  3UE8 A;  3DC1 A;  1AJR A;  3NRA A;  2VYC A;  4E3Q A;  5M46 A;  2EGY A;  4JEZ A;  4GE9 A;  2ZUK A;  3PDX A;  5DX5 A;  3VP6 A;  3W1J A;  2G7J A;  1ELU A;  1D7V A;  1SZS A;  3TFU A;  4ZM4 A;  3W1H A;  2VMQ A;  1YOO A;  4R5F A;  3PPL A;  4RM1 A;  4K2M A;  5E3K A;  4RJY A;  3B1C A;  4WLH A;  1ZOB A;  3PD6 B;  1O61 A;  4IYO B;  1GEY A;  1BJ4 A;  4ZM3 A;  1WYV B;  1V72 A;  2E7J A;  1ARH A;  5J8Q A;  5K8B A;  3GBX A;  1GDE A;  1SZU A;  4M2M A;  3MBB A;  2YKY A;  2O1B A;  1W23 A;  1WYT A;  3AEN A;  3KKI A;  1DGD A;  1W7M A;  4Q75 A;  2D64 A;  1DJU A;  2VGU A;  3GZD A;  2AEU A;  1GEW A;  2W7G A;  1XI9 A;  2ZSL A;  1S08 A;  1IJI A;  4RIT A;  1M0N A;  1TPL A;  3FZ7 A;  2C7T A;  3LY1 A;  3A9Z A;  4LW4 A;  3QHX A;  2VGS A;  2WK7 A;  4R2N A;  4A00 A;  3E9K A;  4MY5 A;  5EUN A;  3HMU A;  4ISY A;  1WKG A;  2Z9X A;  3ELE A;  1FC4 A;  3KE3 A;  1QJ3 A;  1KMK A;  1BW0 A;  1AKA A;  1SVV A;  4UOY A;  4ATP A;  3BCB A;  4IXS A;  1B5O A;  1UU1 A;  1YJZ A;  4OC9 A;  3B1E A;  3COG A;  2VMS A;  4KYO A;  3VK4 A;  4W1W A;  1I43 A;  1KKP A;  3BWN A;  2ZY3 A;  1YJS A;  2W8V A;  1WST A;  1TOG A;  3GWP A;  2CH2 A;  5FT5 A;  2XBN A;  4IX8 A;  5E5I A;  2EPJ A;  2W7I A;  3JW9 A;  3PJ0 A;  3WGB A;  4FL0 A;  4A6U A;  4JF1 A;  2FYF A;  2VIA A;  4WXB A;  2BI9 A;  2FKI A;  2CH1 A;  2VMT A;  4MQR A;  3LVL B;  4Y0I A;  1DFO A;  2W7K A;  3HT4 A;  3CQ4 A;  2CAN A;  2CJH A;  2R5E A;  4F5K A;  2AY4 A;  3EI9 A;  1IX8 A;  2D66 A;  1MAP A;  4E77 A;  3TQX A;  1IAY A;  7AAT A;  1AMR A;  4WYC A;  1B4X A;  1X2A A;  2ZP7 A;  3EI5 A;  1OHW A;  2Z9U A;  4PFN A;  2PB2 A;  5G2Q A;  4ADC A;  2BI1 A;  3PD6 A;  3LG0 A;  4IYO A;  2AY5 A;  3B1D A;  3E2Z B;  1AY4 A;  4JEX A;  5KTB A;  2BWN A;  2D65 A;  3G8M A;  4XEW A;  3LV2 A;  4ZAS A;  4W1X A;  2Z1Y A;  2CIN A;  1WYT B;  2W8J A;  1B9H A;  1CJ0 A;  3AEN B;  5HHY A;  3E2F A;  2OAT A;  4HF8 A;  2AAT A;  4TMR A;  3T32 A;  1AMA A;  4LNM A;  3A9Y A;  4AOA A;  1CL1 A;  2CST A;  4ZAH A;  1AAM A;  3FFH A;  1G7W A;  2BI3 A;  5HDM A;  1C7O A;  1IUG A;  2FM1 A;  2XH1 A;  5FT4 A;  2VMZ A;  5D5S A;  2W7M A;  1JS6 A;  4P7Y A;  2HUI A;  1C9C A;  2JJE A;  2ZYJ A;  4ATQ A;  3B46 A;  4A72 A;  3WY7 A;  1H0C A;  4WLJ A;  2R0T A;  4TV7 A;  2HP2 A;  2YKU A;  4GEB A;  3FDD A;  1C4K A;  3NYT A;  5FT6 A;  2WB6 A;  2QSR A;  3BS8 A;  3N4X A;  1ELQ A;  4WXF A;  2BIA A;  3JTX A;  3RUY A;  3ZZK A;  2GMS A;  1AIC A;  1G4X A;  3PDB B;  1AHG A;  3QI6 A;  4A6R A;  1C0N A;  2O7C A;  2FN6 A;  1W3U A;  2W8T A;  2GSA A;  3GJU A;  2QB3 A;  3TAT A;  1YIZ A;  2G6W A;  3MAF B;  3ZZJ A;  5EUE A;  4U2H A;  2A1V A;  3BV0 A;  5AX8 A;  4DBC A;  4MGR A;  3PAA A;  3RCH B;  3EUC A;  3ECD A;  1FG3 A;  3ZRQ A;  1D7S A;  1ART A;  4UHO A;  3NYS A;  1TOE A;  1GEX A;  1CQ7 A;  4B9B A;  4WB0 B;  2CJD A;  1H1C A;  4WYA A;  4WP0 A;  3HLM A;  3JZL A;  1ASF A;  3PIU A;  1E5E A;  2Z9V A;  1B9I A;  1ZC9 A;  3AOW A;  3P6K A;  3EI8 A;  3HBX A;  3G0T A;  2AY2 A;  3DOD A;  3L8A A;  2CTZ A;  2JJH A;  4W91 A;  3EIA A;  3AEP A;  1ARI A;  1DGE A;  3FVU A;  4UQV A;  4IW7 A;  4Y0D A;  3H9X A;  4JEW A;  3LWS A;  3RQ1 A;  4ZSY A;  3WKR A;  1AKB A;  1V2F A;  4LNL A;  1SPA A;  1BQA A;  2YRI A;  1SF2 A;  1G7X A;  1AHX A;  2C81 A;  2CFB A;  3TFT A;  1GD9 A;  1AMS A;  2W7L A;  4RKD A;  1SZK A;  1TOJ A;  3FQ8 A;  2EZ1 A;  5TF5 A;  1BKG A;  1N31 A;  1U08 A;  3ZRR A;  3LVJ A;  5JAY A;  3WCN A;  3F9T A;  1MDX A;  5IWQ A;  4W8I A;  4OYT A;  4Q31 A;  3E2Z A;  3RBF A;  1ASG A;  1LS3 A;  3A2B A;  2ZY4 A;  3MC6 A;  1ASN A;  2JG2 A;  4W1V A;  1UKJ A;  1MDO A;  2KFP A;  3DXW A;  5EAA A;  4CVQ A;  2Z1Z A;  2VI8 A;  1WYU B;  1Y4I A;  2D63 A;  4CBR A;  3QN6 A;  5EFS A;  3BB8 A;  1D2F A;  1O69 A;  3DU4 A;  3ISL A;  4K2I A;  3EI7 A;  1DJE A;  5M4D A;  3D6K A;  3Q8N A;  1FG7 A;  3WGC A;  4F5J A;  1QZ9 A;  4ZWM A;  2BI5 A;  3WX9 A;  2YRR A;  1EQB A;  1VJO A;  3F6T A;  4ADB A;  1OXO A;  1P3W A;  4O6Z A;  2JJF A;  4B98 A;  3E2Y A;  1AY8 A;  4MSO A;  3R4T A;  2ZJG A;  3WLX A;  1I48 A;  2F8J A;  4M2K A;  1AIB A;  3BWN C;  1JS3 A;  4AO4 A;  2D7Y A;  2QBT A;  2VLF A;  1LC5 A;  1S0A A;  2ORD A;  1CL2 A;  3PDB A;  4E3R A;  4K05 A;  1RV4 A;  2DKB A;  3ASB A;  1MDZ A;  2BKW A;  3MAF A;  2O0R A;  1PMM A;  4FFC A;  1QIT A;  2Q7W A;  1I29 A;  3RCH A;  4ZDO A;  2AY1 A;  3CBF A;  4BHD A;  1I41 A;  1LC7 A;  2OKJ A;  4WB0 A;  1RVY A;  2TPL A;  4R8D A;  2E7U A;  2BIE A;  4EMY A;  1EG5 A;  3NU7 A;  3OKS A;  3N75 A;  4F5H A;  3AEM A;  3FRK A;  1QGN A;  4JE5 A;  2DGL A;  3MEB A;  3NTJ A;  2HUU A;  1KMJ A;  2VLH A;  3QBO A;  4A0G A;  4WXG A;  4OMA A;  2BIG A;  2DGM A;  1S06 A;  3EIB A;  3FQA A;  5F8V A;  3AAT A;  3W1I A;  4UHM A;  4L0O A;  2WK8 A;  3ATH A;  3BCX A;  1D7R A;  1X29 A;  1AHY A;  1TOK A;  2DGK A;  1RV3 A;  2VGZ A;  1CZC A;  1QIR A;  2W8W A;  4RIZ A;  2DKJ A;  1MLY A;  4H51 A;  2W7D A;  1QJ5 A;  4BA4 A;  2FNI A;  2D7Z A;  1WKH A;  2HUF A;  2JIS A;  3CQ5 A;  4LW2 A;  4F5G A;  3KGX A;  1BS0 A;  4F5M A;  3GET A;  1KL2 A;  3CQ6 A;  4OTL A;  4EB5 A;  2VMX A;  1AKC A;  2DR1 A;  3MAU A;  3HL2 A;  4ITX A;  3FZ8 A;  3BWO A;  1WYU A;  1E5F A;  3E6G A;  3FQ7 A;  4GSA A;  3RBL A;  2BYL A;  1UU0 A;  2OQX A;  5EUD A;  5G4I A;  5LHA A;  1DTY A;  8AAT A;  4J5U A;  2R5C A;  3N0L A;  1PMO A;  2Z20 A;  4WD2 A;  1J04 A;  1AY5 A;  2HZP A;  4F4E A;  2PO3 A;  3FCR A;  3NYU A;  4BMK A;  1V2D A;  2VMY A;  4HVK A;  2W8U A;  3WZF A;  1TAR A;  3NU8 A;  4I8A A;  4DQ6 A;  4CXR A;  1W7N A;  3DR7 A;  5G2P A;  1C7N A;  2BHX A;  3B8X A;  3DR4 A;  4ZDL A;  4KAM A;  2QLR A;  1BJN A;  3EZ1 A;  1YNU A;  3K40 A;  4OBU A;  3I16 A;  4BQ0 A;  1SFF A;  3I4J A;  3N7N A;  2RFV A;  1IVR A;  3K28 A;  3UWC A;  1MLZ A;  1N8P A;  1ASC A;  1VEF A;  2GQN A;  2WKA A;  3EI6 A;  1DKA A;  1GBN A;  3USF A;  1N2T A;  1UU2 A;  4WYE A;  4A6T A;  4XJO A;  4AO9 A;  2YCN A;  4ZWV A;  2R2N A;  3AEL A;  1AX4 A;  1BJW A;  1GC3 A;  4LC3 A;  4RAE A;  1AMQ A;  5EIG B;  4JEV A;  4ZSW A;  1ASB A;  1B8G A;  2ZY2 A;  2WK9 A;  4XJP A;  1LW5 A;  1O4S A;  1J32 A;  3AEJ A;  3BC8 A;  5G09 A;  4ZLV A;  4H63 Q;  4N0B A;  2CJG A;  1AIA A;  3FVX A; 
#chains in the Genus database with same CATH homology
 3FD0 A;  2E7I A;  1Z3Z A;  2VGW A;  2ZSM A;  1BT4 A;  1ASE A;  3G7Q A;  3NUI A;  4GE7 A;  4M2J A;  3MKJ A;  1CZE A;  1PG8 A;  3NNK A;  4EFF A;  3FKD A;  3R9A A;  2OGE A;  1Z7D A;  2AY8 A;  3MAD A;  2X5F A;  3JU7 A;  3MC6 C;  1RVU A;  2QB2 A;  3CAI A;  3NUB A;  1X0M A;  1W7L A;  4F5L A;  2Z61 A;  3GZD C;  3II0 A;  1JF9 A;  1EJI A;  1JG8 A;  2OGA A;  1IX6 A;  3QPG A;  1CQ8 A;  2VMW A;  2BYJ A;  4IY7 A;  4MQP A;  4EB7 A;  2W7F A;  3FDB A;  3WKS A;  3FFR A;  4RLG A;  4WYG A;  3HQT A;  1S07 A;  2GMU A;  2Z67 A;  2R5C B;  2ZY5 A;  4XAU A;  3PGY A;  1GC2 A;  2PB0 A;  4UHN A;  2CY8 A;  5I92 A;  1BJO B;  1IBJ A;  4IXO A;  1M32 A;  2D5Y A;  2QMA A;  4WBT A;  4AZK A;  1G4V A;  4R5Z A;  1QIS A;  3IF2 A;  2AY3 A;  3ZRP A;  2GB3 A;  2YKV A;  3JWB A;  2VIB A;  1LW4 A;  1ASA A;  2X5D A;  4PVF A;  4W5K A;  2VI9 A;  4AZJ A;  1OHV A;  2HOZ A;  4Y0H A;  2EYQ A;  2BWO A;  1OXP A;  3BN1 A;  4GRX A;  3QM2 A;  3BCA A;  1ASL A;  3AEO A;  1AJS B;  1CS1 A;  1AHF A;  1KL1 A;  2FNU A;  4Q6R A;  2D61 A;  3AEM C;  3P1T A;  3N4S A;  3L44 A;  2YHK A;  1YAA A;  3FZ6 A;  4QGR A;  4F5I A;  2VGV A;  3PA9 A;  2X8U A;  3HVY A;  3ASA A;  5BJ3 A;  3FVS A;  5BJ4 A;  3ACZ A;  3KGW A;  2VMR A;  5EIG A;  4CXQ A;  1IAX A;  1BQD A;  1MAQ A;  3H7F A;  4JEY A;  4KXK A;  1LK9 A;  3VK3 A;  5G0A A;  1M7Y A;  1M0P A;  1VP4 A;  4ZDP A;  1ORD A;  1AHE A;  3FSL A;  1OHY A;  3DZZ A;  4XK1 A;  2W7J A;  3H14 A;  3DYD A;  1B5P A;  1X28 A;  1M0O A;  1ECX A;  2CB1 A;  2BWP A;  4OCA A;  5DJ9 A;  3VAX A;  3VK2 A;  4A0F A;  2HOY A;  4OT8 A;  1O62 A;  3LVM A;  1ARS A;  2YKX A;  3FTB A;  3QGU A;  4NOG A;  3UAK A;  4RKC A;  1GC0 A;  1AAW A;  5G4J A;  2AY9 A;  1ZOD A;  2HP1 A;  3DXV A;  3LVK A;  5D95 A;  5E4Z A;  3RI6 A;  4U1T A;  2V0Y A;  2YCT A;  4GDY A;  1TAT A;  4F5F A;  5DB5 A;  3IHJ A;  2DOU A;  4E1O A;  3E77 A;  1ASM A;  1ASD A;  1YIY A;  2VMV A;  2Z9W A;  2YOB A;  3HDO A;  3K7Y A;  4XJL A;  3F0H A;  3I5T A;  4TN4 A;  1GCK A;  1LKC A;  2AY7 A;  2VMP A;  4JE5 D;  4OBV A;  4RJ0 A;  5HXX A;  3A8U X;  2VMU A;  4XQ2 A;  1BJO A;  4A0H A;  3GR9 A;  1YJY A;  2VMO A;  4WYD A;  4ITG A;  4P3M A;  1WYV A;  4ADD A;  2EH6 A;  2OKK A;  2W7H A;  2FQ6 A;  2W7E A;  3M5U A;  1DJ9 A;  1M4N A;  5M49 A;  3TCM A;  5FT8 A;  4ADE A;  1C7G A;  1KKJ A;  4IXZ A;  1CQ6 A;  2YCP A;  1ARG A;  4PIW A;  2X3L A;  3VOM A;  2BI2 A;  4PFF A;  3AOV A;  2JGT A;  3EZS A;  1LC8 A;  1XEY A;  3N5M A;  4WYF A;  3A9X A;  1T3I A;  4A0R A;  1AJS A;  4JF0 A;  3JWA A;  2E54 A;  2NMP A;  1IX7 A;  5F9S A;  4BA5 A;  2V1P A;  5M4B A;  2HOR A;  3AEJ C;  3OP7 A;  1OAT A;  4Q76 A;  1D7U A;  2AY6 A;  4MKK A;  3DRD A;  1GC4 A;  1S09 A;  2EO5 A;  2VGT A;  3NDN A;  3AV7 A;  1M0Q A;  2C44 A;  4MQQ A;  3ELP A;  4XJM A;  1M6S A;  4CBS A;  9AAT A;  1V2E A;  2HOX A;  5DJ1 A;  4N0W A;  3GZC A;  2AEV A;  4LNJ A;  5EAV A;  2ZC0 A;  2VMN A;  3N4R A;  1PFF A;  5LH9 A;  3NX3 A;  5C6U A;  4MKJ A;  1TOI A;  4K2B A;  1MGV A;  4J8L A;  4DGT A;  4EU1 A;  1TAS A;  4GE4 A;  2C0R A;  3WCO A;  4AH3 A;  3GSB A;  2EZ2 A;  2JJG A;  5EQC A;  2QA3 A;  3UE8 A;  3DC1 A;  1AJR A;  3NRA A;  2VYC A;  4E3Q A;  5M46 A;  2EGY A;  4JEZ A;  4GE9 A;  2ZUK A;  3PDX A;  5DX5 A;  3VP6 A;  3W1J A;  2G7J A;  1ELU A;  1D7V A;  1SZS A;  3TFU A;  4ZM4 A;  3W1H A;  2VMQ A;  1YOO A;  4R5F A;  3PPL A;  4RM1 A;  4K2M A;  5E3K A;  4RJY A;  3B1C A;  4WLH A;  1ZOB A;  3PD6 B;  1O61 A;  4IYO B;  1GEY A;  1BJ4 A;  4ZM3 A;  1WYV B;  1V72 A;  2E7J A;  1ARH A;  5J8Q A;  5K8B A;  3GBX A;  1GDE A;  1SZU A;  4M2M A;  3MBB A;  2YKY A;  2O1B A;  1W23 A;  1WYT A;  3AEN A;  3KKI A;  1DGD A;  1W7M A;  4Q75 A;  2D64 A;  1DJU A;  2VGU A;  3GZD A;  2AEU A;  1GEW A;  2W7G A;  1XI9 A;  2ZSL A;  1S08 A;  1IJI A;  4RIT A;  1M0N A;  1TPL A;  3FZ7 A;  2C7T A;  3LY1 A;  3A9Z A;  4LW4 A;  3QHX A;  2VGS A;  2WK7 A;  4R2N A;  4A00 A;  3E9K A;  4MY5 A;  5EUN A;  3HMU A;  4ISY A;  1WKG A;  2Z9X A;  3ELE A;  1FC4 A;  3KE3 A;  1QJ3 A;  1KMK A;  1BW0 A;  1AKA A;  1SVV A;  4UOY A;  4ATP A;  3BCB A;  4IXS A;  1B5O A;  1UU1 A;  1YJZ A;  4OC9 A;  3B1E A;  3COG A;  2VMS A;  4KYO A;  3VK4 A;  4W1W A;  1I43 A;  1KKP A;  3BWN A;  2ZY3 A;  1YJS A;  2W8V A;  1WST A;  1TOG A;  3GWP A;  2CH2 A;  5FT5 A;  2XBN A;  4IX8 A;  5E5I A;  2EPJ A;  2W7I A;  3JW9 A;  3PJ0 A;  3WGB A;  4FL0 A;  4A6U A;  4JF1 A;  2FYF A;  2VIA A;  4WXB A;  2BI9 A;  2FKI A;  2CH1 A;  2VMT A;  4MQR A;  3LVL B;  4Y0I A;  1DFO A;  2W7K A;  3HT4 A;  3CQ4 A;  2CAN A;  2CJH A;  2R5E A;  4F5K A;  2AY4 A;  3EI9 A;  1IX8 A;  2D66 A;  1MAP A;  4E77 A;  3TQX A;  1IAY A;  7AAT A;  1AMR A;  4WYC A;  1B4X A;  1X2A A;  2ZP7 A;  3EI5 A;  1OHW A;  2Z9U A;  4PFN A;  2PB2 A;  5G2Q A;  4ADC A;  2BI1 A;  3PD6 A;  3LG0 A;  4IYO A;  2AY5 A;  3B1D A;  3E2Z B;  1AY4 A;  4JEX A;  5KTB A;  2BWN A;  2D65 A;  3G8M A;  4XEW A;  3LV2 A;  4ZAS A;  4W1X A;  2Z1Y A;  2CIN A;  1WYT B;  2W8J A;  1B9H A;  1CJ0 A;  3AEN B;  5HHY A;  3E2F A;  2OAT A;  4HF8 A;  2AAT A;  4TMR A;  3T32 A;  1AMA A;  4LNM A;  3A9Y A;  4AOA A;  1CL1 A;  2CST A;  4ZAH A;  1AAM A;  3FFH A;  1G7W A;  2BI3 A;  5HDM A;  1C7O A;  1IUG A;  2FM1 A;  2XH1 A;  5FT4 A;  2VMZ A;  5D5S A;  2W7M A;  1JS6 A;  4P7Y A;  2HUI A;  1C9C A;  2JJE A;  2ZYJ A;  4ATQ A;  3B46 A;  4A72 A;  3WY7 A;  1H0C A;  4WLJ A;  2R0T A;  4TV7 A;  2HP2 A;  2YKU A;  4GEB A;  3FDD A;  1C4K A;  3NYT A;  5FT6 A;  2WB6 A;  2QSR A;  3BS8 A;  3N4X A;  1ELQ A;  4WXF A;  2BIA A;  3JTX A;  3RUY A;  3ZZK A;  2GMS A;  1AIC A;  1G4X A;  3PDB B;  1AHG A;  3QI6 A;  4A6R A;  1C0N A;  2O7C A;  2FN6 A;  1W3U A;  2W8T A;  2GSA A;  3GJU A;  2QB3 A;  3TAT A;  1YIZ A;  2G6W A;  3MAF B;  3ZZJ A;  5EUE A;  4U2H A;  2A1V A;  3BV0 A;  5AX8 A;  4DBC A;  4MGR A;  3PAA A;  3RCH B;  3EUC A;  3ECD A;  1FG3 A;  3ZRQ A;  1D7S A;  1ART A;  4UHO A;  3NYS A;  1TOE A;  1GEX A;  1CQ7 A;  4B9B A;  4WB0 B;  2CJD A;  1H1C A;  4WYA A;  4WP0 A;  3HLM A;  3JZL A;  1ASF A;  3PIU A;  1E5E A;  2Z9V A;  1B9I A;  1ZC9 A;  3AOW A;  3P6K A;  3EI8 A;  3HBX A;  3G0T A;  2AY2 A;  3DOD A;  3L8A A;  2CTZ A;  2JJH A;  4W91 A;  3EIA A;  3AEP A;  1ARI A;  1DGE A;  3FVU A;  4UQV A;  4IW7 A;  4Y0D A;  3H9X A;  4JEW A;  3LWS A;  3RQ1 A;  4ZSY A;  3WKR A;  1AKB A;  1V2F A;  4LNL A;  1SPA A;  1BQA A;  2YRI A;  1SF2 A;  1G7X A;  1AHX A;  2C81 A;  2CFB A;  3TFT A;  1GD9 A;  1AMS A;  2W7L A;  4RKD A;  1SZK A;  1TOJ A;  3FQ8 A;  2EZ1 A;  5TF5 A;  1BKG A;  1N31 A;  1U08 A;  3ZRR A;  3LVJ A;  5JAY A;  3WCN A;  3F9T A;  1MDX A;  5IWQ A;  4W8I A;  4OYT A;  4Q31 A;  3E2Z A;  3RBF A;  1ASG A;  1LS3 A;  3A2B A;  2ZY4 A;  3MC6 A;  1ASN A;  2JG2 A;  4W1V A;  1UKJ A;  1MDO A;  2KFP A;  3DXW A;  5EAA A;  4CVQ A;  2Z1Z A;  2VI8 A;  1WYU B;  1Y4I A;  2D63 A;  4CBR A;  3QN6 A;  5EFS A;  3BB8 A;  1D2F A;  1O69 A;  3DU4 A;  3ISL A;  4K2I A;  3EI7 A;  1DJE A;  5M4D A;  3D6K A;  3Q8N A;  1FG7 A;  3WGC A;  4F5J A;  1QZ9 A;  4ZWM A;  2BI5 A;  3WX9 A;  2YRR A;  1EQB A;  1VJO A;  3F6T A;  4ADB A;  1OXO A;  1P3W A;  4O6Z A;  2JJF A;  4B98 A;  3E2Y A;  1AY8 A;  4MSO A;  3R4T A;  2ZJG A;  3WLX A;  1I48 A;  2F8J A;  4M2K A;  1AIB A;  3BWN C;  1JS3 A;  4AO4 A;  2D7Y A;  2QBT A;  2VLF A;  1LC5 A;  1S0A A;  2ORD A;  1CL2 A;  3PDB A;  4E3R A;  4K05 A;  1RV4 A;  2DKB A;  3ASB A;  1MDZ A;  2BKW A;  3MAF A;  2O0R A;  1PMM A;  4FFC A;  1QIT A;  2Q7W A;  1I29 A;  3RCH A;  4ZDO A;  2AY1 A;  3CBF A;  4BHD A;  1I41 A;  1LC7 A;  2OKJ A;  4WB0 A;  1RVY A;  2TPL A;  4R8D A;  2E7U A;  2BIE A;  4EMY A;  1EG5 A;  3NU7 A;  3OKS A;  3N75 A;  4F5H A;  3AEM A;  3FRK A;  1QGN A;  4JE5 A;  2DGL A;  3MEB A;  3NTJ A;  2HUU A;  1KMJ A;  2VLH A;  3QBO A;  4A0G A;  4WXG A;  4OMA A;  2BIG A;  2DGM A;  1S06 A;  3EIB A;  3FQA A;  5F8V A;  3AAT A;  3W1I A;  4UHM A;  4L0O A;  2WK8 A;  3ATH A;  3BCX A;  1D7R A;  1X29 A;  1AHY A;  1TOK A;  2DGK A;  1RV3 A;  2VGZ A;  1CZC A;  1QIR A;  2W8W A;  4RIZ A;  2DKJ A;  1MLY A;  4H51 A;  2W7D A;  1QJ5 A;  4BA4 A;  2FNI A;  2D7Z A;  1WKH A;  2HUF A;  2JIS A;  3CQ5 A;  4LW2 A;  4F5G A;  3KGX A;  1BS0 A;  4F5M A;  3GET A;  1KL2 A;  3CQ6 A;  4OTL A;  4EB5 A;  2VMX A;  1AKC A;  2DR1 A;  3MAU A;  3HL2 A;  4ITX A;  3FZ8 A;  3BWO A;  1WYU A;  1E5F A;  3E6G A;  3FQ7 A;  4GSA A;  3RBL A;  2BYL A;  1UU0 A;  2OQX A;  5EUD A;  5G4I A;  5LHA A;  1DTY A;  8AAT A;  4J5U A;  2R5C A;  3N0L A;  1PMO A;  2Z20 A;  4WD2 A;  1J04 A;  1AY5 A;  2HZP A;  4F4E A;  2PO3 A;  3FCR A;  3NYU A;  4BMK A;  1V2D A;  2VMY A;  4HVK A;  2W8U A;  3WZF A;  1TAR A;  3NU8 A;  4I8A A;  4DQ6 A;  4CXR A;  1W7N A;  3DR7 A;  5G2P A;  1C7N A;  2BHX A;  3B8X A;  3DR4 A;  4ZDL A;  4KAM A;  2QLR A;  1BJN A;  3EZ1 A;  1YNU A;  3K40 A;  4OBU A;  3I16 A;  4BQ0 A;  1SFF A;  3I4J A;  3N7N A;  2RFV A;  1IVR A;  3K28 A;  3UWC A;  1MLZ A;  1N8P A;  1ASC A;  1VEF A;  2GQN A;  2WKA A;  3EI6 A;  1DKA A;  1GBN A;  3USF A;  1N2T A;  1UU2 A;  4WYE A;  4A6T A;  4XJO A;  4AO9 A;  2YCN A;  4ZWV A;  2R2N A;  3AEL A;  1AX4 A;  1BJW A;  1GC3 A;  4LC3 A;  4RAE A;  1AMQ A;  5EIG B;  4JEV A;  4ZSW A;  1ASB A;  1B8G A;  2ZY2 A;  2WK9 A;  4XJP A;  1LW5 A;  1O4S A;  1J32 A;  3AEJ A;  3BC8 A;  5G09 A;  4ZLV A;  4H63 Q;  4N0B A;  2CJG A;  1AIA A;  3FVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...