3E3EA

Human thioredoxin double mutant c35s,c73r
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structure of human thioredoxin exhibits a large conformational change.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3e3eA00
2XHFA 4D73A 1XFLA 5ECMB 4IKHA 2IL3A 3KJYA 2XBQA 3TJJA 4IHUA 3DVWA 2R37A 3D5JA 4XRAA 4KAEA 4AJ7A 5G30A 3DKSA 4I97A 2KOKA 3BBYA 3ZZXA 1HNAA 1TI3A 2IN3A 4LA1A 2K6VA 4O5RA 3C1SA 4O92A 4TRXA 3V1WA 1SK0A 2YJHA 1V40A 3FZ4A 2WZ9A 4KUNA 3D6IA 1X5DA 1YF0A 2CZ2A 3L0HA 3VPTA 2EIOA 1X5EA 1WJKA 4ZILA 3Q74A 1ML6A 1ZGNA 4G2EA 4F0CA 5DAKB 1GSDA 5DCHA 4WEYA 2VUPA 2H30A 2MMZA 2VOCA 1THOA 2OE3A 3HHVA 3KTBA 3CXGA 2P0GA 3UMAA 1TK5B 1SKRB 5GSSA 2XPDA 3ZMLA 4PNGA 2RIIA 1M9BA 6GSYA 1JLVA 2HE3A 4HS1A 3WT1A 1ERWA 4L8EA 4IN0A 3DMLA 4IGJA 4QQ7A 2H75A 3L4NA 4Q5RA 3A2VA 5F05A 3PINA 4K1FA 2VCWA 1K0DA 2V6OA 1AXDA 1ZOFA 2H19A 2IMIA 2H1DA 1Z6NA 1EEJA 3F3RA 3Q19A 2LJAA 2DJ0A 3IV4A 1EEMA 4EE0A 4GWRA 5F8BA 2IWTA 3J7Yk 2H0IA 1A8LA 1F37A 3ERGA 1TKDB 3O6TA 2E0QA 3QAWA 2L5OA 1K0MA 4MJBA 2GTUA 4V1Ap 1V98A 3KM6A 2FA4A 4LL1B 2WFCA 5F07A 3WGEA 2CVDA 4MZWA 5DALB 3GSTA 3TJFA 1TRUA 1H4OA 3HKRA 4KDYA 11GSA 5GAND 1LJRA 1F6MC 2OE0A 2DBCA 1B9XC 1Z6MA 1R5AA 2R6KA 5ECHB 2FWGA 4NPBA 1TRWA 2O87A 3A2XA 4HEA2 1N8JA 2KP2A 1E6BA 2GQKA 3DGQA 3LFLA 3CSJA 3GX8A 4K7OA 4G10A 2YWIA 3UVHA 1AAZA 5FHIA 1SJ6A 4RQRA 4LLRA 4PUFC 5ECNB 2F3MA 1TRVA 3WD6A 2VCXA 2JACA 1TJDA 1HD2A 1TDIA 3ME8A 1J9BA 1GRXA 3N5OA 3EE2A 2HLSA 2H6XA 5EVOA 4HJMA 2DJKA 4IS0A 3P90A 4PQHA 1XWKA 5D93A 4GF0A 1EOGA 1QGVA 3GURA 2FUG2 1FB0A 4HI7A 1OVNA 2L6DA 5D9TA 5J9BA 3QOUA 3IBHA 2CVBA 5G2ZA 2IPAA 4MMMA 4F9ZA 4XS4B 4KNDA 4ZL8A 2C4JA 1THXA 4G9HA 2VCVA 4XS1A 4IBPA 5J3RA 2IMDA 4J57E 2JSYA 5ECQB 1V2AA 2PVQA 2WJUA 1DE1A 4MJCA 2VLTA 2DJ2A 4OD7A 4K0NA 2H6YA 5ID2B 3FW2A 4MA9A 4D73B 2HZFA 1H75A 3UJ1A 2FWFA 3EURA 3GL5A 5CRGA 4K9ZA 3VWVA 4TXOB 4X43A 3GKMA 3LSZA 5KN1A 3A2WA 4BWSA 1SKSB 4NWYA 4MH2A 4GQFA 1JZOA 3LXTA 4DSSB 4J56E 1SKWB 3MNGA 3L78A 1G0TA 3FEUA 3GSSA 4NV5A 4OO5A 3MDKA 3C71A 3KP8A 1URMA 2B3SA 1OC9B 2K8SA 3N9JA 1HNCA 4TVEA 3WGXA 2CQ9A 1K0CA 3TKSC 4ZB6A 1KBNA 3HY2A 1EV4A 4N0VA 4AJ8A 3HVSA 5DJMA 1B48A 3DXBA 1GH2A 1VRSD 1XW9A 1T1VA 1BQ7A 2VL2C 1EGRA 3QMXA 4NAXA 3F4TA 1XVQA 1M2AA 3KIJA 4AJ6A 2H76A 1GSSA 1QQ2A 4OWYA 6GSUA 1A0FA 4MPGA 2AB6A 4XRDA 2HZEB 4DEJA 1YQ1A 2NVLA 3QFBC 4J2FA 3FK8A 2B5YA 1U88A 2QKEA 5D9VA 5CYYA 3BOAA 4TN8A 2GSQA 2YCDA 3UBLA 1YZXA 3BJ5A 5GSTA 3G7IA 2B7JA 4KGIA 3BCIA 3RDWA 3E0UA 1VF2A 1R4WA 2H1AA 5HR3A 2OBIA 1GULA 4TR1A 1PKWA 1GWCA 3H1NA 3Q6OA 4ZXGA 5FWGA 1F3AA 4NHWA 2WGRA 5IMVA 2HRNA 3LJRA 1EOHA 2DLXA 3TRPA 5D96A 2F51A 1MDJA 4ML1A 1JHBA 2DIYA 3I69A 2TRCP 4Q5NA 5E4WA 5HR1A 2X64A 2X8HA 1GP1A 3GTUA 2KUCA 5DQSA 3KMNA 1QMVA 2GT6A 1O81A 2JZTA 2K18A 1USBA 2B1KA 2VAFA 1Q98A 3P7XA 2C3NA 4WF4A 2O85A 19GSA 8GSSA 2NBSA 1SK1A 5J41A 2AAWA 2FA8A 4H86A 2A4VA 1TRSA 3L9VA 5GZZB 2LKUA 3UL3A 4ZL7A 2E7PA 4WETA 2EIRA 1Z3EA 1IYHA 1XIYA 1JLWA 1FW1A 3TKSE 2GLRA 1AQXA 1Z7RA 2HXKA 2HSYA 3RPPA 4ULXA 3LYKA 3FZ5A 1AQWA 5JCUA 2L5LA 2OACA 4ISDA 3KH9A 4FYBA 5IMCA 3EMPA 2V32A 3VI7A 4O7HA 2HYXA 3HVXA 3CTFA 2JZSA 1PX6A 6GSXA 3C7MA 1DUGA 1S3CA 4TR4A 3GV1A 2O8VB 2VIMA 3F6FA 4TKYA 1PMTA 1A23A 1JFUA 1GL8A 2MYGA 5IMAA 2PERA 1YEPA 1A0RP 4MZBA 3LG6A 2LV3A 4F0BA 1GSEA 1XOAA 5B8BA 4POBA 3UIWA 1I5GA 3QDNA 4OFNA 4PQIA 3W8SA 4IVFA 5B6MA 2CVKA 3HZ8A 3FZ9A 3J7Yb 1DE2A 4WKWA 4JR4A 4EL1A 2DJ3A 2VLVA 4ECJA 3VURA 2GZPA 5CREA 4NXIA 2LJKA 3FR3A 2WCIA 4MK3A 2LNSA 2C0DA 4EF0A 4BWQA 3M3MA 3LGCA 4GRFA 1A8YA 4I6XA 14GSA 2ZNMA 3LWAA 1UC7A 3F63A 5B7CA 4EUYA 2IMKA 4JZQA 1TU7A 1SJZA 1PKZA 3FYGA 4I2UA 2OJLA 1F2EA 2G2QA 4NV2A 4X0XA 4I5QA 4JU5A 1PQNA 3ZFLA 3MWHA 2YJ7A 2H74A 5IIZA 2H72A 5DCGA 1ZYEA 2KHPA 1X5CA 4G19A 3G7JA 2P31A 4IQ1A 3QPMA 6GSVA 5A4UA 5IMZA 5INYA 2DMMA 2RUEA 2FGXA 4JBBA 2PMTA 4K6XA 2PU9C 4XS6A 1Y25A 3M1GA 2IJYA 4KX4A 2GZZA 4EC0A 5LNKe 1MD3A 2MZCA 1J08A 1RQMA 2VL3A 5IPGA 2V6KA 4L5OA 5KEJA 2LRCA 3HDCA 4HUAA 5AIXA 4XCSA 2GZYA 1NM3A 3ZL5A 1K0OA 3E9JB 1EGOA 3TCOA 2AYTA 3FHKA 1KEBA 2CT6A 1C72A 1M2BA 1VF1A 2E2GA 4KCEA 2CX4A 3DIEA 3WYWA 5IPHA 4WR5A 3FR9A 2VL2A 3KZQA 4I2TA 1K3OA 4JRRA 5AIVA 3EC3A 2JU5A 1FB6A 2F8AA 4RUVA 3ME7A 3EWLA 3EU4A 3D4MA 4LMWA 5AN1A 1BEDA 2LNTA 1QUWA 5CNWA 4AGSA 13GSA 4N0ZA 4RI7A 1YKCA 3GH9A 5KN0A 2LQOA 3NOFA 3IAS2 1PRXA 3CRUA 1BYEA 5B8AA 1N2AA 1YY7A 2GT5A 3IDVA 3WT2A 2QSIA 3LYPA 2FWHA 1NW2A 4K7NA 2A2RA 3IK9A 3DWVA 4DSQA 3UAPA 4MF6A 3HD5A 2GS3A 1ERTA 5ECOB 4POKA 3TOTA 10GSA 2LRTA 4IW9A 3IRAA 5G1LA 4MDCA 2GGTA 2IFQA 1TP9A 1MEKA 5AGYA 3F4SA 2QGVA 3BCKA 3HVVA 1O7UA 3TKPA 3ZTLA 5HFGA 2VCQA 3HJMA 3E3EA 3OR5A 1R5PA 1WRYA 4YH2A 1FHEA 2CZ3A 2MBSA 1M7TA 5DDLA 1SK2A 3TGZA 3H8QA 4BPYA 5IMDA 2I4AA 3TUEA 2RM6A 1FAAA 4MCUA 2YWNA 3GKKA 5DVBA 1BJXA 2FHEA 1VGLA 22GSA 3Q18A 2FCHA 5LCZA 2XBIA 1J0FA 1T00A 4Q5QA 4V1Ag 1Z7PA 2GQMA 2BJXA 2OE1A 1MD4A 1DSBA 2HRFA 5HR2A 2YV9A 4NMUA 3UBKA 2KP1A 4GQCA 5L71A 2O89A 3VK9A 3EU3A 2WS2A 1LU4A 4TW5A 1QXHA 4QL7A 3IPZA 4FYUA 3VWUA 3F3QA 3RBTA 1G7OA 4Q5FA 4LMVA 3VWXA 2IMEA 1GUKA 3FZAA 4IP6A 4YQVA 2C0FA 1KTEA 2P5QA 5EY6A 1SL0B 3D0ZA 1PSQA 2N5BA 4JR6A 4TR0A 5GAPD 3CSHA 5ECKB 4POMA 3M0FA 1A24A 4ID0A 3IHQA 3FR6A 2C3TA 2DSAA 2VCTA 3ED3A 1O8XA 1GSUA 4X1UA 1FOVA 1V57A 3H79A 5DAKA 3CBUA 1GTBA 1SU9A 1B4QA 18GSA 2HI7A 1EP8A 3IR4A 1XW6A 2C0EA 1UVZA 4HZ4A 1B8XA 4V2NA 5ECLB 4IQAA 4ZBAA 3RHBA 1AIUA 1TW9A 2F8FA 4YQMA 5DQYA 2NTOA 1ZYQB 2AUVA 1X0RA 2LEGA 3GL3A 4MPFA 2PUKC 4CDOA 3KMOA 1Z5YE 3ISOA 2YANA 2X8CA 4F03A 1XOBA 5HR0A 3ZITA 4KB3A 2B1LA 5ELAA 1T7PB 1GNWA 2DJ1A 3AY8A 2VM2A 2I9HA 3FRCA 3KD0A 3IXRA 1SYRA 2GSTA 2CV4A 2TIRA 3ERWA 2M80A 1OYJA 4HU7A 1XZOA 3CTGA 1GLPA 3DVXA 4DVCA 2I81A 4HU9A 4L5LA 4GLTA 2AV4A 1QK8A 4EO3A 2QC7A 3UEMA 4XTSA 5CO3A 1HNBA 2H1BA 2ON7A 1V9WA 2B5XA 1FG4A 4PURA 3VWWA 2ES7A 3KXOA 5DALA 2C0GA 2YPMA 4LL4B 5J4UA 1B9YC 2B7KA 4IJ3A 5F06A 2A2SA 3QAVA 2OKAA 5J5NA 3UVTA 1WMJA 1NSWA 1TTZA 2OBKA 3HJOA 1PA3A 1RW1A 2WDUA 3GMFA 2VM1A 2IFQB 2CX3A 3LXZA 2AJQB 4PX1A 2L4CA 4HOJA 2YZHA 3HYPA 1T8EB 5DBQA 3D21A 1GUHA 1AW9A 3SBCA 4MF7A 1XXUA 3I6AA 5FT3A 2R2JA 2VCZA 1A2MA 1RK4A 2H0GA 5ENUA 4Z7XA 3ZLPA 1G6WA 2AHEA 3F8UA 1VF3A 4KH7A 3RHCA 2PVOC 1R7HA 3F9UA 3IK7A 3ZIVA 1F9MA 4BL7A 4DSRA 5D8IA 4PUAA 3TRXA 3BD2A 4EKZA 3JCML 4PGTA 1E2YA 1SENA 4GSNA 3U6VA 3TKQA 3HJPA 3VI5A 4FIWA 1AC1A 1GSQA 17GSA 1Z9HA 3DYRA 2R3XA 1SJIA 5JWOB 2J9HA 4ECCA 1SYXA 4XHMA 5AISA 1SL2B 1WWJA 2B5EA 4EXJA 3APOA 1X9SB 2EC4A 4HQSA 3D22A 2F9SA 4CHSA 3TOUA 1XWCA 5ID2A 3RAZA 2CA8A 1G6YA 3F4RA 3GUSA 1GTUA 3S9FA 2HFDA 1OKDA 1IYIA 2N5FA 5CRHA 3H4KA 1Q4JA 2DMLA 1LBKA 5IO2A 2V2GA 4TXOA 5JWRB 3HCZA 4YAPA 1O6JA 4N11A 3GNJA 3VPQA 1M9AA 1U87A 4KE3A 1JZRA 1EP7A 1I9DA 3KGKA 3GHAA 3QFAC 1OE8A 2FWEA 4DSSA 1Y6EA 5CAXA 1YEXA 2MMOA 3I43A 1ZZYA 3D4TA 4PQ1A 5DJLA 1KNGA 2EIQA 4ECBA 2O7KA 2C80A 3IOSA 3UOMA 3TJKA 1AQVA 2B6MA 5B6NA 1OC9A 4ZB9A 3ZMKA 4KW6A 1O73A 3A3TA 2DJJA 3FY7A 3GFKA 5KN3A 2YNXA 4K0GA 3NIVA 1ZL9A 1EZKA 1WPIA 1PX7A 3TJGA 3F6DA 2H8LA 5IOXA 3GIXA 1MDIA 4OO4A 1OKTA 3TJBA 2YWOA 4TOPA 1MDKA 3ZVJA 4NHZA 1JZDA 3TKSA 4WBRD 2HZEA 2JL4A 2VL9A 5HFIA 5ELGA 3HXSA 1ERUA 1OC8A 3HZ4A 2LSTA 7GSSA 2BTOT 3PH9A 2LUSA 1O85A 2BMXA 3IC4A 3O3TA 1M99A 1GUMA 1YKAA 4KSOA 4ZL9A 1SL1B 3FKFA 4TR1B 2PBJA 5ABRA 2PN8A 3US3A 3APSA 3GYKA 2LJRA 4BVYA 3G7YA 3C8EA 4GTUA 2I1UA 2C8UA 1EWXA 5HFKA 4N30A 1S3DA 4ZBDA 2ZCTA 2LTKA 2HT9A 2H01A 1ABAA 2VD0A 1ILOA 1WP0A 1YJ6A 2JADA 1NHYA 1A2JA 2M72A 2X8GA 3GTUB 4GCIA 2LS5A 3A5WA 2YWMA 1XW5A 1JZWA 1XBSA 3F0IA 3APQA 5JCWA 3LQ7A 4WBJA 4BVXA 5COHA 1XWGA 3W6GA 3DRNA 3PR8A 3DEXA 4BA7A 1M2DA 4KSMA 2OADA 1OE7A 3W8JA 1K0AA 4KCAA 4MH3A 4ZB8A 3L9SA 4E8EA 5G31A 2TRXA 3QCPA 2H70A 3CYNA 5HQPA 4MABA 4P3YB 2K8VA 2YN1A 5CRDA 5G1KA 4OFTA 2MMNA 2IMFA 1PN9A 1ERVA 2H0HA 2GQLA 1HQOA 3CMIA 3KP9A 4KDUA 4JEDA 5D9WA 4POLA 3WGDA 3GKXA 20GSA 1T4ZA 2ZUPA 4KDXA 2H1GA 4IELA 2OA7A 5IOWA 2WB9A 3GA4A 2GSSA 1BX9A 4GXZA 4IP1A 1ST9A 1SD9A 2RLIA 4EDYA 5A5KA 2E2MA 4MJEA 1FVKA 1M0UA 1XWAA 3KEBA 1K0NA 2VD1A 5J9CA 2D2ZA 2X99A 2PPTA 3QR6A 2G0FA 3H93A 5C04A 4HJ2A 4QL9A 5H5SA 1XWBA 2LRNA 5EPFA 5KN2A 3GN3A 5A4VA 5CRWA 3GRXA 1TI1A 3ZYWA 4YQUA 1XVWA 1K3LA 4GSSA 4GSTA 2REMA 1GTIA 1CQHA 2YOIA 4TR3A 3VLNA 4CW9A 3IE3A 1BAYA 5IO0A 2I3YA 4WR4A 4EVMA 3I9V2 3LEFA 1FO5A 2VLUA 5D73A 2CAQA 1S3AA 3ZREA 1GNEA 1UA5A 1O8WA 3MSZA 1GSFA 2JZRA 1B4PA 2WULA 4ILFA 2V41A 3KH7A 1U6TA 1ACVA 1AUCA 5G5FA 4F82A 1ZCPA 2NPBA 3O76A 4ML6A 3TKRA 2H66A 2RM5A 4N10A 5ECSA 2YP6A 3CRTA 3NZNA 4F2IA 1TXXA 4MLYA 2WRTA 2H71A 3P2AA 1TK0B 4EDZA 3C73A 4V2MA 2FD3A 4TXVA 2CAIA 3GH6A 4AF2A 2L57A 2N5AA 2MBTA 4IJIA 2J23A 1GLQA 4FO5A 2RUFA 2V1MA 1R26A 3L9UA 3R2QA 2Z9SA 5G5EA 1K0BA 2GSRA 4FH8A 4WXTA 4WF5A 2LQQA 1NHOA 1T3BA 4RQXA 1X9WB 2DIZA 1YF1A 1T4YA 4ZIJA 3KCMA 4JE1A 3LORA 5H5RA 3M9JA 3HA9A 3QD9A 4E8HA 2GDRA 1TU8A 1EV9A 2NDOA 1A2LA 3U5RE 2GVPA 1XPVA 9GSSA 2R4VA 1PL2A 4KA0A 1FVJA 4L0UA 3PGTA 1DBYA 2L4QA 4YAVA 2H73A 4RI6A 3TRQA 1XCCA 4ACSA 5H5QA 1K3YA 3EINA 5JCGA 1QFNA 4OCFA 1V58A 3TB2A 1F3BA 4OFMA 4MJAA 3ZRDA 2C3QA 2P5RA 1W89A 1WE0A 1WOUA 1UN2A 3EYTA 3IAM2 12GSA 3M9KA 2ALBA 3GKNA 1YDKA 3QAGA 2C1YA 4K8MA 4PXOA 2XPEA 1BG5A 3TDGA 4MP4A 5ECIB 5IMFA 4MF5A 4HZ2A 2YZUA 5D9XA 5A4WA 2HNLA 1HYUA 2PGTA 4OCEA 4HDEA 1ON4A 2IIYA 3ZVJD 6GSSA 5F0GA 2XC2A 4ZBBA 2FY6A 1CQGA 1X9MB 2FNOA 3CSIA 2L6CA 5LD0A 2ON5A 3K8NA 1ZMAA 3EVIA 2VO4A 5C00A 3DD3A 5JWQB 4K7IA 4K2DA 5E59A 5ECRB 4OMVA 5CP1A 3VFIA 2PWJA 3MAKA 3P8WA 4MZCA 1U3IA 3M8NA 1VF4A 2YV7A 1MTCA 1U3AA 2DC5A 4ECIA 6GSWA 1W4VA 1G7EA 3UARA 6GSTA 1OC3A 2MMAA 5IM9A 4PNFA 16GSA 4HQZA 2FLSA 2M46A 4FYCA 4V2LA 2H6ZA 1PGTA 1OAZA 1GSYA 1TOFA 4I8BA 5EL8A 5ECPB 1SD8A 3ZIJA 2R5GA 3KTLA 2KLXA 3ERFA 4XS4A 3ZFBA 1PD21 2JSZA 4XIHA 3GX0A 3RPNA 3C1RA 4O32A 2L59A 1TK8B 3IA1A 2K9FA 3EMXA 1GTAA 1PL1A 1WIKA 2HSHA 3SWLA 4L0WA 3G9BA 5IQYA
chains in the Genus database with same CATH superfamily
2XHFA 4D73A 1XFLA 5ECMB 4IKHA 4O5UA 2IL3A 4EIQA 3KJYA 2XBQA 3TJJA 4IHUA 3DVWA 2R37A 3D5JA 4XRAA 4KAEA 4AJ7A 5G30A 3DKSA 4I97A 2KOKA 3BBYA 3ZZXA 1HNAA 1TI3A 2IN3A 4LA1A 2K6VA 4O5RA 1ZYPA 3C1SA 4O92A 4TRXA 3V1WA 1SK0A 2YJHA 1V40A 3FZ4A 2WZ9A 4KUNA 3D6IA 1X5DA 1YF0A 2CZ2A 3L0HA 3VPTA 2A2PA 2EIOA 1X5EA 1WJKA 4ZILA 3Q74A 1ML6A 4CY6A 1ZGNA 4G2EA 4F0CA 5DAKB 1GSDA 5DCHA 4WEYA 2VUPA 2H30A 2MMZA 2VOCA 1THOA 2OE3A 3HHVA 3KTBA 3CXGA 2P0GA 3UMAA 1TK5B 1SKRB 5GSSA 2XPDA 3ZMLA 4PNGA 3MYDA 2RIIA 1M9BA 6GSYA 1JLVA 2HE3A 4HS1A 3WT1A 1ERWA 4L8EA 4IN0A 3DMLA 4IGJA 4QQ7A 2H75A 3L4NA 4Q5RA 3A2VA 5F05A 3PINA 4K1FA 2VCWA 1K0DA 2V6OA 4MNNA 1AXDA 1ZOFA 2H19A 2IMIA 2H1DA 1Z6NA 1EEJA 3F3RA 3Q19A 4X4JA 2LJAA 2DJ0A 3IV4A 1EEMA 4EE0A 4GWRA 5F8BA 2IWTA 3J7Yk 2H0IA 1A8LA 1F37A 3ERGA 1TKDB 3O6TA 2E0QA 3QAWA 2L5OA 1K0MA 4MJBA 2GTUA 4V1Ap 1V98A 3KM6A 2FA4A 4LL1B 2WFCA 5F07A 3WGEA 2CVDA 4MZWA 5DALB 3GSTA 3TJFA 1TRUA 1H4OA 3HKRA 4KDYA 11GSA 5GAND 1LJRA 1F6MC 2OE0A 2DBCA 1B9XC 1Z6MA 1R5AA 2R6KA 5ECHB 2FWGA 4NPBA 3R3EA 1TRWA 2O87A 3A2XA 4HEA2 1N8JA 2KP2A 1E6BA 2GQKA 3DGQA 3LFLA 3CSJA 3GX8A 4K7OA 4G10A 2YWIA 3UVHA 1AAZA 5FHIA 1SJ6A 4RQRA 4LLRA 4PUFC 5ECNB 2F3MA 1TRVA 3WD6A 2VCXA 2JACA 1TJDA 1HD2A 1TDIA 3ME8A 1J9BA 1GRXA 3N5OA 3EE2A 2HLSA 2H6XA 5EVOA 4HJMA 2DJKA 4IS0A 4BL7B 3P90A 4PQHA 1XWKA 5D93A 4GF0A 1EOGA 1QGVA 3GURA 2FUG2 1FB0A 4HI7A 1OVNA 2L6DA 5D9TA 5J9BA 3QOUA 3IBHA 2CVBA 5G2ZA 2IPAA 4MMMA 4F9ZA 1S3RA 4XS4B 4KNDA 4ZL8A 2C4JA 1THXA 4G9HA 2VCVA 4XS1A 4IBPA 5J3RA 2IMDA 4J57E 2JSYA 5ECQB 1V2AA 2PVQA 2WJUA 1DE1A 4MJCA 2VLTA 2DJ2A 4OD7A 4K0NA 2H6YA 5ID2B 3FW2A 4MA9A 4D73B 2HZFA 1H75A 3UJ1A 4G0IA 2FWFA 3EURA 3GL5A 5CRGA 4K9ZA 3VWVA 4TXOB 4X43A 3GKMA 3LSZA 5KN1A 3A2WA 4BWSA 1SKSB 4NWYA 4MH2A 4GQFA 1JZOA 3LXTA 4DSSB 4J56E 1SKWB 3MNGA 3L78A 1G0TA 3FEUA 3GSSA 2QA2A 4NV5A 4OO5A 3MDKA 3C71A 3KP8A 1URMA 2B3SA 1OC9B 2K8SA 3N9JA 1HNCA 4TVEA 2A4HA 3WGXA 2CQ9A 1K0CA 3TKSC 4ZB6A 1KBNA 3HY2A 3IC8A 1EV4A 4N0VA 4AJ8A 3HVSA 5DJMA 1B48A 3DXBA 1GH2A 1VRSD 1XW9A 1T1VA 1BQ7A 2DKIA 2VL2C 1EGRA 3QMXA 4NAXA 3F4TA 1XVQA 3FMWA 1M2AA 3KIJA 4AJ6A 2H76A 1GSSA 1QQ2A 4OWYA 6GSUA 1A0FA 4MPGA 2AB6A 4XRDA 2HZEB 4DEJA 1YQ1A 2NVLA 3QFBC 4J2FA 3FK8A 4FQUA 2B5YA 5KOWA 1U88A 2QKEA 5D9VA 5CYYA 3BOAA 4TN8A 2GSQA 2YCDA 3UBLA 1YZXA 3BJ5A 5GSTA 3G7IA 2B7JA 4KGIA 3BCIA 3IHGA 3RDWA 3E0UA 1VF2A 1R4WA 2H1AA 5HR3A 2OBIA 1GULA 4TR1A 1PKWA 1GWCA 3H1NA 3Q6OA 4ZXGA 5FWGA 1F3AA 4NHWA 2WGRA 5IMVA 2HRNA 3LJRA 1EOHA 2DLXA 3TRPA 5D96A 2F51A 1MDJA 4ML1A 1JHBA 2DIYA 3I69A 2TRCP 4Q5NA 5E4WA 5HR1A 2X64A 2X8HA 1GP1A 3GTUA 2KUCA 5DQSA 4BVXB 3KMNA 1QMVA 2GT6A 1O81A 2JZTA 2K18A 1USBA 2B1KA 2VAFA 1Q98A 3P7XA 2C3NA 4WF4A 2O85A 19GSA 8GSSA 2NBSA 1SK1A 5J41A 2AAWA 2FA8A 4H86A 2A4VA 1TRSA 3L9VA 5GZZB 2LKUA 3UL3A 4ZL7A 2E7PA 4A5PA 4WETA 2EIRA 1Z3EA 1IYHA 1XIYA 1JLWA 1FW1A 3TKSE 2GLRA 1AQXA 1Z7RA 2HXKA 2HSYA 3RPPA 4ULXA 3LYKA 3FZ5A 1AQWA 5JCUA 2L5LA 2OACA 4ISDA 3KH9A 4FYBA 5IMCA 3EMPA 2V32A 3VI7A 4O7HA 2HYXA 3HVXA 3CTFA 2JZSA 1PX6A 2HRKA 6GSXA 3A5IA 3C7MA 1DUGA 1S3CA 4TR4A 3GV1A 2O8VB 4ICYA 2VIMA 3F6FA 4TKYA 1PMTA 1A23A 1JFUA 1GL8A 2MYGA 5IMAA 2PERA 1YEPA 1A0RP 4MZBA 4YKFA 3LG6A 2LV3A 4F0BA 1GSEA 1XOAA 5B8BA 4POBA 3UIWA 1I5GA 3QDNA 4HSCX 4OFNA 4PQIA 3W8SA 4IVFA 5B6MA 2CVKA 3HZ8A 3FZ9A 3J7Yb 1DE2A 4WKWA 4JR4A 4EL1A 2DJ3A 2VLVA 4ECJA 3VURA 2GZPA 5CREA 4NXIA 2LJKA 3FR3A 2WCIA 4MK3A 2LNSA 2C0DA 4EF0A 4BWQA 3M3MA 3LGCA 4GRFA 1A8YA 4I6XA 14GSA 2ZNMA 3LWAA 1UC7A 3F63A 5B7CA 4EUYA 2IMKA 4JZQA 1TU7A 1SJZA 1PKZA 3FYGA 4I2UA 2OJLA 1F2EA 2G2QA 4NV2A 4X0XA 4I5QA 4JU5A 1PQNA 3ZFLA 3MWHA 2YJ7A 2H74A 5IIZA 2H72A 5DCGA 1ZYEA 2KHPA 1X5CA 4G19A 3G7JA 2P31A 4IQ1A 5BMUA 3QPMA 6GSVA 5A4UA 5IMZA 5INYA 2DMMA 2RUEA 2FGXA 4JBBA 2PMTA 4K6XA 2PU9C 4XS6A 1Y25A 3M1GA 2IJYA 4KX4A 2GZZA 4EC0A 5LNKe 1MD3A 2MZCA 1J08A 1RQMA 2VL3A 5IPGA 2V6KA 4L5OA 5KEJA 2LRCA 3HDCA 4HUAA 5AIXA 4XCSA 2GZYA 1NM3A 3ZL5A 1K0OA 3E9JB 1EGOA 3TCOA 2AYTA 3FHKA 1KEBA 2CT6A 1C72A 1M2BA 1VF1A 2E2GA 4KCEA 2CX4A 3DIEA 3WYWA 5IPHA 4WR5A 3FR9A 2VL2A 3KZQA 4I2TA 1K3OA 4JRRA 5AIVA 3EC3A 2JU5A 1FB6A 2F8AA 4RUVA 3ME7A 3EWLA 3EU4A 3D4MA 4LMWA 5AN1A 1BEDA 2LNTA 1QUWA 5CNWA 4AGSA 13GSA 4N0ZA 4RI7A 1YKCA 3GH9A 5KN0A 2LQOA 3NOFA 3IAS2 1PRXA 3CRUA 1BYEA 5B8AA 1N2AA 1YY7A 2GT5A 3IDVA 3WT2A 2QSIA 3LYPA 2FWHA 1NW2A 4K7NA 4G0KA 2A2RA 3LW9A 3IK9A 3DWVA 4DSQA 5KOXA 3UAPA 4MF6A 3HD5A 2GS3A 1ERTA 5ECOB 4POKA 1FOHA 3TOTA 10GSA 2LRTA 4IW9A 3IRAA 5G1LA 4MDCA 2GGTA 3MIXA 2IFQA 4Z2UA 1TP9A 1MEKA 5AGYA 3F4SA 2QGVA 3BCKA 3HVVA 1O7UA 3TKPA 3ZTLA 5HFGA 2VCQA 3HJMA 4BIKA 3E3EA 3OR5A 1R5PA 1WRYA 4YH2A 1FHEA 2CZ3A 2MBSA 1M7TA 5DDLA 1SK2A 3TGZA 3H8QA 4BPYA 5IMDA 2I4AA 3TUEA 2RM6A 1FAAA 4MCUA 2YWNA 3GKKA 5DVBA 2QA1A 1BJXA 2FHEA 1VGLA 22GSA 4KF9A 3Q18A 2FCHA 5LCZA 2XBIA 1J0FA 1T00A 4Q5QA 4V1Ag 1Z7PA 2GQMA 2BJXA 4G0LA 2OE1A 1MD4A 1DSBA 2HRFA 5HR2A 2YV9A 4NMUA 3UBKA 1XG8A 2KP1A 4GQCA 5L71A 2O89A 3VK9A 3EU3A 2WS2A 1LU4A 4TW5A 1QXHA 4QL7A 3IPZA 4FYUA 3VWUA 3F3QA 3RBTA 1G7OA 4Q5FA 4LMVA 3VWXA 2IMEA 1GUKA 3FZAA 4IP6A 4YQVA 2C0FA 1KTEA 2P5QA 5EY6A 1SL0B 2X49A 1PSQA 3D0ZA 2N5BA 4JR6A 4TR0A 5GAPD 3CSHA 5ECKB 4POMA 3M0FA 1A24A 4ID0A 3IHQA 3FR6A 2C3TA 2DSAA 2VCTA 3ED3A 1O8XA 1GSUA 4X1UA 1FOVA 1V57A 4K5RA 3H79A 3HVNA 5DAKA 3CBUA 1GTBA 1SU9A 1B4QA 18GSA 2HI7A 1EP8A 3IR4A 1XW6A 2C0EA 1UVZA 4HZ4A 1B8XA 4V2NA 5ECLB 4IQAA 4ZBAA 3RHBA 1AIUA 1TW9A 2F8FA 4YQMA 5DQYA 2NTOA 1ZYQB 2AUVA 1X0RA 2LEGA 3GL3A 4MPFA 4EIPA 2PUKC 4CDOA 3KMOA 1Z5YE 3ISOA 2YANA 2X8CA 4F03A 1XOBA 5HR0A 3ZITA 4KB3A 2B1LA 5ELAA 1T7PB 1GNWA 2DJ1A 3AY8A 2VM2A 2I9HA 3FRCA 3KD0A 3IXRA 1SYRA 2GSTA 2CV4A 2TIRA 3ERWA 2M80A 1OYJA 4HU7A 1XZOA 3CTGA 2R0PA 1GLPA 3DVXA 2UZ8A 4DVCA 2I81A 4HU9A 4L5LA 4GLTA 2AV4A 1QK8A 4EO3A 2QC7A 3UEMA 4XTSA 5CO3A 1HNBA 2H1BA 2ON7A 1V9WA 2B5XA 1FG4A 4PURA 3VWWA 2ES7A 3KXOA 5DALA 4Z2TA 2C0GA 2YPMA 4LL4B 5J4UA 1B9YC 2B7KA 4IJ3A 5F06A 2A2SA 3QAVA 2OKAA 5J5NA 3UVTA 1WMJA 1NSWA 1TTZA 2OBKA 3HJOA 1PA3A 1RW1A 2WDUA 3GMFA 2VM1A 2IFQB 2CX3A 3LXZA 2AJQB 4PX1A 2L4CA 4HOJA 2YZHA 3HYPA 1T8EB 5DBQA 3D21A 1GUHA 1AW9A 3SBCA 4MF7A 1XXUA 3I6AA 5FT3A 2R2JA 2VCZA 1A2MA 1RK4A 2H0GA 5ENUA 4Z7XA 3ZLPA 1G6WA 2AHEA 3F8UA 1VF3A 4KH7A 3RHCA 2PVOC 1R7HA 3F9UA 3IK7A 3ZIVA 1F9MA 4BL7A 4DSRA 5D8IA 4PUAA 3TRXA 3BD2A 4EKZA 3JCML 4PGTA 1E2YA 1SENA 4GSNA 3U6VA 3TKQA 3HJPA 3VI5A 4FIWA 1AC1A 1GSQA 17GSA 1Z9HA 3DYRA 2R3XA 1SJIA 5JWOB 2J9HA 4ECCA 1SYXA 4XHMA 5AISA 1SL2B 1WWJA 2B5EA 4EXJA 3APOA 3EPTA 1X9SB 2EC4A 4HQSA 3D22A 2F9SA 4CHSA 3TOUA 1XWCA 5ID2A 3RAZA 2CA8A 1G6YA 3F4RA 3GUSA 1GTUA 3S9FA 2HFDA 1OKDA 1IYIA 2N5FA 5CRHA 3H4KA 1Q4JA 2DMLA 1LBKA 5IO2A 2V2GA 4TXOA 5JWRB 3HCZA 4YAPA 1O6JA 4N11A 3GNJA 5BRTA 3VPQA 1M9AA 1U87A 4KE3A 1JZRA 1EP7A 1I9DA 3KGKA 3GHAA 3QFAC 1OE8A 2FWEA 4DSSA 1Y6EA 5CAXA 1YEXA 2MMOA 3I43A 1ZZYA 3D4TA 4PQ1A 5DJLA 1KNGA 2EIQA 4ECBA 2O7KA 2C80A 3IOSA 3UOMA 3TJKA 1AQVA 2B6MA 5B6NA 1ZYNA 1OC9A 4ZB9A 3ZMKA 4KW6A 1O73A 3A3TA 2DJJA 3FY7A 3GFKA 5KN3A 2YNXA 4K0GA 3NIVA 1ZL9A 1EZKA 1WPIA 1PX7A 3TJGA 3F6DA 2H8LA 5IOXA 3GIXA 1MDIA 4OO4A 1OKTA 3TJBA 2YWOA 4TOPA 1MDKA 4K2XA 3ZVJA 2R0CA 4NHZA 1JZDA 3TKSA 4WBRD 2HZEA 2JL4A 2VL9A 5HFIA 5ELGA 3HXSA 1ERUA 4CY8A 1OC8A 3HZ4A 2LSTA 7GSSA 2BTOT 3PH9A 2LUSA 1O85A 4PTSA 2BMXA 3IC4A 3O3TA 1M99A 1GUMA 1YKAA 4KSOA 4ZL9A 1SL1B 3FKFA 4TR1B 2PBJA 5ABRA 2PN8A 3US3A 3APSA 3GYKA 2LJRA 4BVYA 3G7YA 3C8EA 4GTUA 2I1UA 2C8UA 1EWXA 5HFKA 4N30A 1S3DA 4ZBDA 2ZCTA 2LTKA 2HT9A 2H01A 1ABAA 2VD0A 1ILOA 1WP0A 1YJ6A 2JADA 1NHYA 1A2JA 1M3JA 2M72A 2X8GA 3GTUB 4GCIA 2LS5A 3A5WA 2YWMA 1XW5A 1JZWA 1XBSA 3F0IA 3APQA 5JCWA 3LQ7A 4WBJA 4BVXA 5COHA 1XWGA 3W6GA 3DRNA 3PR8A 3DEXA 4BA7A 1M2DA 4KSMA 2OADA 1OE7A 3W8JA 1K0AA 4KCAA 4MH3A 4ZB8A 3L9SA 4E8EA 5G31A 2TRXA 3QCPA 2H70A 3CYNA 5HQPA 4MABA 4P3YB 2K8VA 2YN1A 5CRDA 5G1KA 4OFTA 2MMNA 2IMFA 1PN9A 1ERVA 2H0HA 2GQLA 1HQOA 3CMIA 3KP9A 4Z2RA 4KDUA 4JEDA 5D9WA 4POLA 3WGDA 3GKXA 20GSA 1T4ZA 2ZUPA 4KDXA 2H1GA 4IELA 2OA7A 5IOWA 2WB9A 3GA4A 2GSSA 1BX9A 4GXZA 4IP1A 1ST9A 1SD9A 2RLIA 4EDYA 5A5KA 2E2MA 4MJEA 1FVKA 1M0UA 1XWAA 3KEBA 1K0NA 2VD1A 5J9CA 2D2ZA 2X99A 2PPTA 3QR6A 2G0FA 3H93A 5C04A 4HJ2A 3PPUA 4QL9A 5H5SA 1XWBA 2LRNA 4O5QA 5EPFA 3GN3A 5A4VA 5CRWA 4K5SA 5KN2A 3GRXA 1TI1A 3ZYWA 4YQUA 1XVWA 1K3LA 4GSSA 4GSTA 2REMA 1GTIA 1CQHA 2YOIA 4TR3A 3VLNA 4CW9A 3IE3A 1BAYA 5IO0A 2I3YA 4WR4A 4EVMA 3I9V2 3LEFA 1FO5A 2VLUA 5D73A 2CAQA 2DKHA 1S3AA 3ZREA 1GNEA 1UA5A 1O8WA 3MSZA 1GSFA 2HSMA 2JZRA 1B4PA 2WULA 4ILFA 2V41A 3KH7A 1U6TA 1ACVA 1AUCA 5G5FA 4F82A 1ZCPA 2NPBA 3O76A 4ML6A 3TKRA 2H66A 2RM5A 4N10A 5ECSA 2YP6A 3CRTA 3NZNA 4F2IA 1TXXA 4MLYA 2WRTA 2H71A 3P2AA 1TK0B 4EDZA 3C73A 4V2MA 2FD3A 4TXVA 2CAIA 3GH6A 4AF2A 2L57A 2X4AA 2N5AA 2MBTA 4IJIA 2J23A 1GLQA 4FO5A 2RUFA 2V1MA 1R26A 3L9UA 3R2QA 2Z9SA 5G5EA 1K0BA 2GSRA 4FH8A 4WXTA 1PN0A 4WF5A 2LQQA 1NHOA 1T3BA 3CQFA 4RQXA 1X9WB 2DIZA 1YF1A 1T4YA 4ZIJA 3KCMA 4JE1A 3LORA 5H5RA 3M9JA 3HA9A 3QD9A 4E8HA 2GDRA 1TU8A 1EV9A 2NDOA 1A2LA 3U5RE 2GVPA 1XPVA 2R0GA 9GSSA 2R4VA 1PL2A 4KA0A 1FVJA 4L0UA 4BVYB 3PGTA 1DBYA 2L4QA 4YAVA 2H73A 4RI6A 3TRQA 1XCCA 4ACSA 5H5QA 1K3YA 3EINA 5JCGA 1QFNA 4OCFA 1V58A 3TB2A 1F3BA 4OFMA 4MJAA 3ZRDA 2C3QA 2P5RA 1W89A 1WE0A 1WOUA 1UN2A 3EYTA 3IAM2 12GSA 3M9KA 2ALBA 2HRAA 3GKNA 1YDKA 3QAGA 2C1YA 4K8MA 4PXOA 2XPEA 1BG5A 3TDGA 4MP4A 5ECIB 5IMFA 4MF5A 4HZ2A 4USSA 2YZUA 5D9XA 5A4WA 2HNLA 1HYUA 2PGTA 4OCEA 4HDEA 1ON4A 1M3IA 2IIYA 3ZVJD 6GSSA 5F0GA 2XC2A 4ZBBA 2FY6A 1CQGA 1X9MB 2FNOA 3CSIA 2L6CA 5LD0A 2ON5A 3K8NA 1ZMAA 3EVIA 2VO4A 4YKGA 5C00A 3DD3A 5JWQB 4K7IA 4K2DA 5E59A 5ECRB 4OMVA 5CP1A 3VFIA 2PWJA 3MAKA 3P8WA 4MZCA 1U3IA 3M8NA 1VF4A 2YV7A 1MTCA 1U3AA 2DC5A 4ECIA 6GSWA 1PFOA 1W4VA 1G7EA 3UARA 6GSTA 1OC3A 2MMAA 5IM9A 4PNFA 16GSA 4HQZA 2FLSA 2M46A 4V2LA 4FYCA 2H6ZA 1PGTA 1OAZA 1GSYA 1TOFA 4I8BA 5EL8A 5ECPB 1SD8A 3ZIJA 2R5GA 3KTLA 2KLXA 3ERFA 4XS4A 3ZFBA 1PD21 2JSZA 4XIHA 3GX0A 3RPNA 3C1RA 4O32A 2L59A 1TK8B 3IA1A 2K9FA 3EMXA 1GTAA 1PL1A 1WIKA 2HSHA 3SWLA 4L0WA 3G9BA 5IQYA
chains in the Genus database with same CATH topology
2XHFA 4D73A 1XFLA 5ECMB 4IKHA 4O5UA 2IL3A 4EIQA 3KJYA 2XBQA 3TJJA 4IHUA 3DVWA 2R37A 3D5JA 4XRAA 4KAEA 4AJ7A 5G30A 3DKSA 4I97A 2KOKA 3BBYA 3ZZXA 1HNAA 1TI3A 2IN3A 4LA1A 2K6VA 4O5RA 1ZYPA 3C1SA 4O92A 4TRXA 3V1WA 1SK0A 2YJHA 1V40A 3FZ4A 2WZ9A 4KUNA 3D6IA 1X5DA 1YF0A 2CZ2A 3L0HA 3VPTA 2A2PA 2EIOA 1X5EA 1WJKA 4ZILA 3Q74A 1ML6A 4CY6A 1ZGNA 4G2EA 4F0CA 5DAKB 1GSDA 5DCHA 4WEYA 2VUPA 2H30A 2MMZA 2VOCA 1THOA 2OE3A 3HHVA 3KTBA 3CXGA 2P0GA 3UMAA 1TK5B 1SKRB 5GSSA 2XPDA 3ZMLA 4PNGA 3MYDA 2RIIA 1M9BA 6GSYA 1JLVA 2HE3A 4HS1A 3WT1A 1ERWA 4L8EA 4IN0A 3DMLA 4IGJA 4QQ7A 2H75A 3L4NA 4Q5RA 3A2VA 5F05A 3PINA 4K1FA 2VCWA 1K0DA 2V6OA 4MNNA 1AXDA 1ZOFA 2H19A 2IMIA 2H1DA 1Z6NA 1EEJA 3F3RA 3Q19A 4X4JA 2LJAA 2DJ0A 3IV4A 1EEMA 4EE0A 4GWRA 5F8BA 2IWTA 3J7Yk 2H0IA 1A8LA 1F37A 3ERGA 1TKDB 3O6TA 2E0QA 3QAWA 2L5OA 1K0MA 4MJBA 2GTUA 4V1Ap 1V98A 3KM6A 2FA4A 4LL1B 2WFCA 5F07A 3WGEA 2CVDA 4MZWA 5DALB 3GSTA 3TJFA 1TRUA 1H4OA 3HKRA 4KDYA 11GSA 5GAND 1LJRA 1F6MC 2OE0A 2DBCA 1B9XC 1Z6MA 1R5AA 2R6KA 5ECHB 2FWGA 4NPBA 3R3EA 1TRWA 2O87A 3A2XA 4HEA2 1N8JA 2KP2A 1E6BA 2GQKA 3DGQA 3LFLA 3CSJA 3GX8A 4K7OA 4G10A 2YWIA 3UVHA 1AAZA 5FHIA 1SJ6A 4RQRA 4LLRA 4PUFC 5ECNB 2F3MA 1TRVA 3WD6A 2VCXA 2JACA 1TJDA 1HD2A 1TDIA 3ME8A 1J9BA 1GRXA 3N5OA 3EE2A 2HLSA 2H6XA 5EVOA 4HJMA 2DJKA 4IS0A 4BL7B 3P90A 4PQHA 1XWKA 5D93A 4GF0A 1EOGA 1QGVA 3GURA 2FUG2 1FB0A 4HI7A 1OVNA 2L6DA 5D9TA 5J9BA 3QOUA 3IBHA 2CVBA 5G2ZA 2IPAA 4MMMA 4F9ZA 4XS4B 4KNDA 4ZL8A 2C4JA 1THXA 4G9HA 2VCVA 4XS1A 4IBPA 5J3RA 2IMDA 4J57E 2JSYA 5ECQB 1V2AA 2PVQA 2WJUA 1DE1A 4MJCA 2VLTA 2DJ2A 4OD7A 4K0NA 2H6YA 5ID2B 3FW2A 4MA9A 4D73B 2HZFA 1H75A 3UJ1A 4G0IA 2FWFA 3EURA 3GL5A 5CRGA 4K9ZA 3VWVA 4TXOB 4X43A 3GKMA 3LSZA 5KN1A 3A2WA 4BWSA 1SKSB 4NWYA 4MH2A 4GQFA 1JZOA 3LXTA 4DSSB 4J56E 1SKWB 3MNGA 3L78A 1G0TA 3FEUA 3GSSA 2QA2A 4NV5A 4OO5A 3MDKA 3C71A 3KP8A 1URMA 2B3SA 1OC9B 2K8SA 3N9JA 1HNCA 4TVEA 2A4HA 3WGXA 2CQ9A 1K0CA 3TKSC 4ZB6A 1KBNA 3HY2A 3IC8A 1EV4A 4N0VA 4AJ8A 3HVSA 5DJMA 1B48A 3DXBA 1GH2A 1VRSD 1XW9A 1T1VA 1BQ7A 2DKIA 2VL2C 1EGRA 3QMXA 4NAXA 3F4TA 1XVQA 3FMWA 1M2AA 3KIJA 4AJ6A 2H76A 1GSSA 1QQ2A 4OWYA 6GSUA 1A0FA 4MPGA 2AB6A 4XRDA 2HZEB 4DEJA 1YQ1A 2NVLA 3QFBC 4J2FA 3FK8A 4FQUA 2B5YA 5KOWA 1U88A 2QKEA 5D9VA 5CYYA 3BOAA 4TN8A 2GSQA 2YCDA 3UBLA 1YZXA 3BJ5A 5GSTA 3G7IA 2B7JA 4KGIA 3BCIA 3IHGA 3RDWA 3E0UA 1VF2A 1R4WA 2H1AA 5HR3A 2OBIA 1GULA 4TR1A 1PKWA 1GWCA 3H1NA 3Q6OA 4ZXGA 5FWGA 1F3AA 4NHWA 2WGRA 5IMVA 2HRNA 3LJRA 1EOHA 2DLXA 3TRPA 5D96A 2F51A 1MDJA 4ML1A 1JHBA 2DIYA 3I69A 2TRCP 4Q5NA 5E4WA 5HR1A 2X64A 2X8HA 1GP1A 3GTUA 2KUCA 5DQSA 4BVXB 3KMNA 1QMVA 2GT6A 1O81A 2JZTA 2K18A 1USBA 2B1KA 2VAFA 1Q98A 3P7XA 2C3NA 4WF4A 2O85A 19GSA 8GSSA 2NBSA 1SK1A 5J41A 2AAWA 2FA8A 4H86A 2A4VA 1TRSA 3L9VA 5GZZB 2LKUA 3UL3A 4ZL7A 2E7PA 4A5PA 4WETA 2EIRA 1Z3EA 1IYHA 1XIYA 1JLWA 1FW1A 3TKSE 2GLRA 1AQXA 1Z7RA 2HXKA 2HSYA 3RPPA 4ULXA 3LYKA 3FZ5A 1AQWA 5JCUA 2L5LA 2OACA 4ISDA 3KH9A 4FYBA 5IMCA 3EMPA 2V32A 3VI7A 4O7HA 2HYXA 3HVXA 3CTFA 2JZSA 1PX6A 2HRKA 6GSXA 3A5IA 3C7MA 1DUGA 1S3CA 4TR4A 3GV1A 2O8VB 4ICYA 2VIMA 3F6FA 4TKYA 1PMTA 1A23A 1JFUA 1GL8A 2MYGA 5IMAA 2PERA 1YEPA 1A0RP 4MZBA 4YKFA 3LG6A 2LV3A 4F0BA 1GSEA 1XOAA 5B8BA 4POBA 3UIWA 1I5GA 3QDNA 4OFNA 4PQIA 3W8SA 4IVFA 5B6MA 2CVKA 3HZ8A 3FZ9A 3J7Yb 1DE2A 4WKWA 4JR4A 4EL1A 2DJ3A 2VLVA 4ECJA 3VURA 2GZPA 5CREA 4NXIA 2LJKA 3FR3A 2WCIA 4MK3A 2LNSA 2C0DA 4EF0A 4BWQA 3M3MA 3LGCA 4GRFA 1A8YA 4I6XA 14GSA 2ZNMA 3LWAA 1UC7A 3F63A 5B7CA 4EUYA 2IMKA 4JZQA 1TU7A 1SJZA 1PKZA 3FYGA 4I2UA 2OJLA 1F2EA 2G2QA 4NV2A 4X0XA 4I5QA 4JU5A 1PQNA 3ZFLA 3MWHA 2YJ7A 2H74A 5IIZA 2H72A 5DCGA 1ZYEA 2KHPA 1X5CA 4G19A 3G7JA 2P31A 4IQ1A 5BMUA 3QPMA 6GSVA 5A4UA 5IMZA 5INYA 2DMMA 2RUEA 2FGXA 4JBBA 2PMTA 4K6XA 2PU9C 4XS6A 1Y25A 3M1GA 2IJYA 4KX4A 2GZZA 4EC0A 5LNKe 1MD3A 2MZCA 1J08A 1RQMA 2VL3A 5IPGA 2V6KA 4L5OA 5KEJA 2LRCA 3HDCA 4HUAA 5AIXA 4XCSA 2GZYA 1NM3A 3ZL5A 1K0OA 3E9JB 1EGOA 3TCOA 2AYTA 3FHKA 1KEBA 2CT6A 1C72A 1M2BA 1VF1A 2E2GA 4KCEA 2CX4A 3DIEA 3WYWA 5IPHA 4WR5A 3FR9A 2VL2A 3KZQA 4I2TA 1K3OA 4JRRA 5AIVA 3EC3A 2JU5A 1FB6A 2F8AA 4RUVA 3ME7A 3EWLA 3EU4A 3D4MA 4LMWA 5AN1A 1BEDA 2LNTA 1QUWA 5CNWA 4AGSA 13GSA 4N0ZA 4RI7A 1YKCA 3GH9A 5KN0A 2LQOA 3NOFA 3IAS2 1PRXA 3CRUA 1BYEA 5B8AA 1N2AA 1YY7A 2GT5A 3IDVA 3WT2A 2QSIA 3LYPA 2FWHA 1NW2A 4K7NA 4G0KA 2A2RA 3LW9A 3IK9A 3DWVA 4DSQA 5KOXA 3UAPA 4MF6A 3HD5A 2GS3A 1ERTA 5ECOB 4POKA 1FOHA 3TOTA 10GSA 2LRTA 4IW9A 3IRAA 5G1LA 4MDCA 2GGTA 3MIXA 2IFQA 4Z2UA 1TP9A 1MEKA 5AGYA 3F4SA 2QGVA 3BCKA 3HVVA 1O7UA 3TKPA 3ZTLA 5HFGA 2VCQA 3HJMA 3E3EA 3OR5A 1R5PA 1WRYA 4YH2A 1FHEA 2CZ3A 2MBSA 1M7TA 5DDLA 1SK2A 3TGZA 3H8QA 4BPYA 5IMDA 2I4AA 3TUEA 2RM6A 1FAAA 4MCUA 2YWNA 3GKKA 5DVBA 2QA1A 1BJXA 2FHEA 1VGLA 22GSA 4KF9A 3Q18A 2FCHA 5LCZA 2XBIA 1J0FA 1T00A 4Q5QA 4V1Ag 1Z7PA 2GQMA 2BJXA 4G0LA 2OE1A 1MD4A 1DSBA 2HRFA 5HR2A 2YV9A 4NMUA 3UBKA 2KP1A 4GQCA 5L71A 2O89A 3VK9A 3EU3A 2WS2A 1LU4A 4TW5A 1QXHA 4QL7A 3IPZA 4FYUA 3VWUA 3F3QA 3RBTA 1G7OA 4Q5FA 4LMVA 3VWXA 2IMEA 1GUKA 3FZAA 4IP6A 4YQVA 2C0FA 1KTEA 2P5QA 5EY6A 1SL0B 2X49A 1PSQA 3D0ZA 2N5BA 4JR6A 4TR0A 5GAPD 3CSHA 5ECKB 4POMA 3M0FA 1A24A 4ID0A 3IHQA 3FR6A 2C3TA 2DSAA 2VCTA 3ED3A 1O8XA 1GSUA 4X1UA 1FOVA 1V57A 4K5RA 3H79A 5DAKA 3CBUA 1GTBA 1SU9A 1B4QA 18GSA 2HI7A 1EP8A 3IR4A 1XW6A 2C0EA 1UVZA 4HZ4A 1B8XA 4V2NA 5ECLB 4IQAA 4ZBAA 3RHBA 1AIUA 1TW9A 2F8FA 4YQMA 5DQYA 2NTOA 1ZYQB 2AUVA 1X0RA 2LEGA 3GL3A 4MPFA 4EIPA 2PUKC 4CDOA 3KMOA 1Z5YE 3ISOA 2YANA 2X8CA 4F03A 1XOBA 5HR0A 3ZITA 4KB3A 2B1LA 5ELAA 1T7PB 1GNWA 2DJ1A 3AY8A 2VM2A 2I9HA 3FRCA 3KD0A 3IXRA 1SYRA 2GSTA 2CV4A 2TIRA 3ERWA 2M80A 1OYJA 4HU7A 1XZOA 3CTGA 2R0PA 1GLPA 3DVXA 2UZ8A 4DVCA 2I81A 4HU9A 4L5LA 4GLTA 2AV4A 1QK8A 4EO3A 2QC7A 3UEMA 4XTSA 5CO3A 1HNBA 2H1BA 2ON7A 1V9WA 2B5XA 1FG4A 4PURA 3VWWA 2ES7A 3KXOA 5DALA 4Z2TA 2C0GA 2YPMA 4LL4B 5J4UA 1B9YC 2B7KA 4IJ3A 5F06A 2A2SA 3QAVA 2OKAA 5J5NA 3UVTA 1WMJA 1NSWA 1TTZA 2OBKA 3HJOA 1PA3A 1RW1A 2WDUA 3GMFA 2VM1A 2IFQB 2CX3A 3LXZA 2AJQB 4PX1A 2L4CA 4HOJA 2YZHA 3HYPA 1T8EB 5DBQA 3D21A 1GUHA 1AW9A 3SBCA 4MF7A 1XXUA 3I6AA 5FT3A 2R2JA 2VCZA 1A2MA 1RK4A 2H0GA 5ENUA 4Z7XA 3ZLPA 1G6WA 2AHEA 3F8UA 1VF3A 4KH7A 3RHCA 2PVOC 1R7HA 3F9UA 3IK7A 3ZIVA 1F9MA 4BL7A 4DSRA 5D8IA 4PUAA 3TRXA 3BD2A 4EKZA 3JCML 4PGTA 1E2YA 1SENA 4GSNA 3U6VA 3TKQA 3HJPA 3VI5A 4FIWA 1AC1A 1GSQA 17GSA 1Z9HA 3DYRA 2R3XA 1SJIA 5JWOB 2J9HA 4ECCA 1SYXA 4XHMA 5AISA 1SL2B 1WWJA 2B5EA 4EXJA 3APOA 3EPTA 1X9SB 2EC4A 4HQSA 3D22A 2F9SA 4CHSA 3TOUA 1XWCA 5ID2A 3RAZA 2CA8A 1G6YA 3F4RA 3GUSA 1GTUA 3S9FA 2HFDA 1OKDA 1IYIA 2N5FA 5CRHA 3H4KA 1Q4JA 2DMLA 1LBKA 5IO2A 2V2GA 4TXOA 5JWRB 3HCZA 4YAPA 1O6JA 4N11A 3GNJA 5BRTA 3VPQA 1M9AA 1U87A 4KE3A 1JZRA 1EP7A 1I9DA 3KGKA 3GHAA 3QFAC 1OE8A 2FWEA 4DSSA 1Y6EA 5CAXA 1YEXA 2MMOA 3I43A 1ZZYA 3D4TA 4PQ1A 5DJLA 1KNGA 2EIQA 4ECBA 2O7KA 2C80A 3IOSA 3UOMA 3TJKA 1AQVA 2B6MA 5B6NA 1ZYNA 1OC9A 4ZB9A 3ZMKA 4KW6A 1O73A 3A3TA 2DJJA 3FY7A 3GFKA 5KN3A 2YNXA 4K0GA 3NIVA 1ZL9A 1EZKA 1WPIA 1PX7A 3TJGA 3F6DA 2H8LA 5IOXA 3GIXA 1MDIA 4OO4A 1OKTA 3TJBA 2YWOA 4TOPA 1MDKA 4K2XA 3ZVJA 2R0CA 4NHZA 1JZDA 3TKSA 4WBRD 2HZEA 2JL4A 2VL9A 5HFIA 5ELGA 3HXSA 1ERUA 4CY8A 1OC8A 3HZ4A 2LSTA 7GSSA 2BTOT 3PH9A 2LUSA 1O85A 4PTSA 2BMXA 3IC4A 3O3TA 1M99A 1GUMA 1YKAA 4KSOA 4ZL9A 1SL1B 3FKFA 4TR1B 2PBJA 5ABRA 2PN8A 3US3A 3APSA 3GYKA 2LJRA 4BVYA 3G7YA 3C8EA 4GTUA 2I1UA 2C8UA 1EWXA 5HFKA 4N30A 1S3DA 4ZBDA 2ZCTA 2LTKA 2HT9A 2H01A 1ABAA 2VD0A 1ILOA 1WP0A 1YJ6A 2JADA 1NHYA 1A2JA 2M72A 2X8GA 3GTUB 4GCIA 2LS5A 3A5WA 2YWMA 1XW5A 1JZWA 1XBSA 3F0IA 3APQA 5JCWA 3LQ7A 4WBJA 4BVXA 5COHA 1XWGA 3W6GA 3DRNA 3PR8A 3DEXA 4BA7A 1M2DA 4KSMA 2OADA 1OE7A 3W8JA 1K0AA 4KCAA 4MH3A 4ZB8A 3L9SA 4E8EA 5G31A 2TRXA 3QCPA 2H70A 3CYNA 5HQPA 4MABA 4P3YB 2K8VA 2YN1A 5CRDA 5G1KA 4OFTA 2MMNA 2IMFA 1PN9A 1ERVA 2H0HA 2GQLA 1HQOA 3CMIA 3KP9A 4Z2RA 4KDUA 4JEDA 5D9WA 4POLA 3WGDA 3GKXA 20GSA 1T4ZA 2ZUPA 4KDXA 2H1GA 4IELA 2OA7A 5IOWA 2WB9A 3GA4A 2GSSA 1BX9A 4GXZA 4IP1A 1ST9A 1SD9A 2RLIA 4EDYA 5A5KA 2E2MA 4MJEA 1FVKA 1M0UA 1XWAA 3KEBA 1K0NA 2VD1A 5J9CA 2D2ZA 2X99A 2PPTA 3QR6A 2G0FA 3H93A 5C04A 4HJ2A 3PPUA 4QL9A 5H5SA 1XWBA 2LRNA 4O5QA 5EPFA 3GN3A 5A4VA 5CRWA 4K5SA 5KN2A 3GRXA 1TI1A 3ZYWA 4YQUA 1XVWA 1K3LA 4GSSA 4GSTA 2REMA 1GTIA 1CQHA 2YOIA 4TR3A 3VLNA 4CW9A 3IE3A 1BAYA 5IO0A 2I3YA 4WR4A 4EVMA 3I9V2 3LEFA 1FO5A 2VLUA 5D73A 2CAQA 2DKHA 1S3AA 3ZREA 1GNEA 1UA5A 1O8WA 3MSZA 1GSFA 2HSMA 2JZRA 1B4PA 2WULA 4ILFA 2V41A 3KH7A 1U6TA 1ACVA 1AUCA 5G5FA 4F82A 1ZCPA 2NPBA 3O76A 4ML6A 3TKRA 2H66A 2RM5A 4N10A 5ECSA 2YP6A 3CRTA 3NZNA 4F2IA 1TXXA 4MLYA 2WRTA 2H71A 3P2AA 1TK0B 4EDZA 3C73A 4V2MA 2FD3A 4TXVA 2CAIA 3GH6A 4AF2A 2L57A 2X4AA 2N5AA 2MBTA 4IJIA 2J23A 1GLQA 4FO5A 2RUFA 2V1MA 1R26A 3L9UA 3R2QA 2Z9SA 5G5EA 1K0BA 2GSRA 4FH8A 4WXTA 1PN0A 4WF5A 2LQQA 1NHOA 1T3BA 4RQXA 1X9WB 2DIZA 1YF1A 1T4YA 4ZIJA 3KCMA 4JE1A 3LORA 5H5RA 3M9JA 3HA9A 3QD9A 4E8HA 2GDRA 1TU8A 1EV9A 2NDOA 1A2LA 3U5RE 2GVPA 1XPVA 2R0GA 9GSSA 2R4VA 1PL2A 4KA0A 1FVJA 4L0UA 4BVYB 3PGTA 1DBYA 2L4QA 4YAVA 2H73A 4RI6A 3TRQA 1XCCA 4ACSA 5H5QA 1K3YA 3EINA 5JCGA 1QFNA 4OCFA 1V58A 3TB2A 1F3BA 4OFMA 4MJAA 3ZRDA 2C3QA 2P5RA 1W89A 1WE0A 1WOUA 1UN2A 3EYTA 3IAM2 12GSA 3M9KA 2ALBA 2HRAA 3GKNA 1YDKA 3QAGA 2C1YA 4K8MA 4PXOA 2XPEA 1BG5A 3TDGA 4MP4A 5ECIB 5IMFA 4MF5A 4HZ2A 4USSA 2YZUA 5D9XA 5A4WA 2HNLA 1HYUA 2PGTA 4OCEA 4HDEA 1ON4A 2IIYA 3ZVJD 6GSSA 5F0GA 2XC2A 4ZBBA 2FY6A 1CQGA 1X9MB 2FNOA 3CSIA 2L6CA 5LD0A 2ON5A 3K8NA 1ZMAA 3EVIA 2VO4A 4YKGA 5C00A 3DD3A 5JWQB 4K7IA 4K2DA 5E59A 5ECRB 4OMVA 5CP1A 3VFIA 2PWJA 3MAKA 3P8WA 4MZCA 1U3IA 3M8NA 1VF4A 2YV7A 1MTCA 1U3AA 2DC5A 4ECIA 6GSWA 1W4VA 1G7EA 3UARA 6GSTA 1OC3A 2MMAA 5IM9A 4PNFA 16GSA 4HQZA 2FLSA 2M46A 4V2LA 4FYCA 2H6ZA 1PGTA 1OAZA 1GSYA 1TOFA 4I8BA 5EL8A 5ECPB 1SD8A 3ZIJA 2R5GA 3KTLA 2KLXA 3ERFA 4XS4A 3ZFBA 1PD21 2JSZA 4XIHA 3GX0A 3RPNA 3C1RA 4O32A 2L59A 1TK8B 3IA1A 2K9FA 3EMXA 1GTAA 1PL1A 1WIKA 2HSHA 3SWLA 4L0WA 3G9BA 5IQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHF A;  4D73 A;  1XFL A;  5ECM B;  4IKH A;  2IL3 A;  3KJY A;  2XBQ A;  3TJJ A;  4IHU A;  3DVW A;  2R37 A;  3D5J A;  4XRA A;  4KAE A;  4AJ7 A;  5G30 A;  3DKS A;  4I97 A;  2KOK A;  3BBY A;  3ZZX A;  1HNA A;  1TI3 A;  2IN3 A;  4LA1 A;  2K6V A;  4O5R A;  3C1S A;  4O92 A;  4TRX A;  3V1W A;  1SK0 A;  2YJH A;  1V40 A;  3FZ4 A;  2WZ9 A;  4KUN A;  3D6I A;  1X5D A;  1YF0 A;  2CZ2 A;  3L0H A;  3VPT A;  2EIO A;  1X5E A;  1WJK A;  4ZIL A;  3Q74 A;  1ML6 A;  1ZGN A;  4G2E A;  4F0C A;  5DAK B;  1GSD A;  5DCH A;  4WEY A;  2VUP A;  2H30 A;  2MMZ A;  2VOC A;  1THO A;  2OE3 A;  3HHV A;  3KTB A;  3CXG A;  2P0G A;  3UMA A;  1TK5 B;  1SKR B;  5GSS A;  2XPD A;  3ZML A;  4PNG A;  2RII A;  1M9B A;  6GSY A;  1JLV A;  2HE3 A;  4HS1 A;  3WT1 A;  1ERW A;  4L8E A;  4IN0 A;  3DML A;  4IGJ A;  4QQ7 A;  2H75 A;  3L4N A;  4Q5R A;  3A2V A;  5F05 A;  3PIN A;  4K1F A;  2VCW A;  1K0D A;  2V6O A;  1AXD A;  1ZOF A;  2H19 A;  2IMI A;  2H1D A;  1Z6N A;  1EEJ A;  3F3R A;  3Q19 A;  2LJA A;  2DJ0 A;  3IV4 A;  1EEM A;  4EE0 A;  4GWR A;  5F8B A;  2IWT A;  3J7Y k;  2H0I A;  1A8L A;  1F37 A;  3ERG A;  1TKD B;  3O6T A;  2E0Q A;  3QAW A;  2L5O A;  1K0M A;  4MJB A;  2GTU A;  4V1A p;  1V98 A;  3KM6 A;  2FA4 A;  4LL1 B;  2WFC A;  5F07 A;  3WGE A;  2CVD A;  4MZW A;  5DAL B;  3GST A;  3TJF A;  1TRU A;  1H4O A;  3HKR A;  4KDY A;  11GS A;  5GAN D;  1LJR A;  1F6M C;  2OE0 A;  2DBC A;  1B9X C;  1Z6M A;  1R5A A;  2R6K A;  5ECH B;  2FWG A;  4NPB A;  1TRW A;  2O87 A;  3A2X A;  4HEA 2;  1N8J A;  2KP2 A;  1E6B A;  2GQK A;  3DGQ A;  3LFL A;  3CSJ A;  3GX8 A;  4K7O A;  4G10 A;  2YWI A;  3UVH A;  1AAZ A;  5FHI A;  1SJ6 A;  4RQR A;  4LLR A;  4PUF C;  5ECN B;  2F3M A;  1TRV A;  3WD6 A;  2VCX A;  2JAC A;  1TJD A;  1HD2 A;  1TDI A;  3ME8 A;  1J9B A;  1GRX A;  3N5O A;  3EE2 A;  2HLS A;  2H6X A;  5EVO A;  4HJM A;  2DJK A;  4IS0 A;  3P90 A;  4PQH A;  1XWK A;  5D93 A;  4GF0 A;  1EOG A;  1QGV A;  3GUR A;  2FUG 2;  1FB0 A;  4HI7 A;  1OVN A;  2L6D A;  5D9T A;  5J9B A;  3QOU A;  3IBH A;  2CVB A;  5G2Z A;  2IPA A;  4MMM A;  4F9Z A;  4XS4 B;  4KND A;  4ZL8 A;  2C4J A;  1THX A;  4G9H A;  2VCV A;  4XS1 A;  4IBP A;  5J3R A;  2IMD A;  4J57 E;  2JSY A;  5ECQ B;  1V2A A;  2PVQ A;  2WJU A;  1DE1 A;  4MJC A;  2VLT A;  2DJ2 A;  4OD7 A;  4K0N A;  2H6Y A;  5ID2 B;  3FW2 A;  4MA9 A;  4D73 B;  2HZF A;  1H75 A;  3UJ1 A;  2FWF A;  3EUR A;  3GL5 A;  5CRG A;  4K9Z A;  3VWV A;  4TXO B;  4X43 A;  3GKM A;  3LSZ A;  5KN1 A;  3A2W A;  4BWS A;  1SKS B;  4NWY A;  4MH2 A;  4GQF A;  1JZO A;  3LXT A;  4DSS B;  4J56 E;  1SKW B;  3MNG A;  3L78 A;  1G0T A;  3FEU A;  3GSS A;  4NV5 A;  4OO5 A;  3MDK A;  3C71 A;  3KP8 A;  1URM A;  2B3S A;  1OC9 B;  2K8S A;  3N9J A;  1HNC A;  4TVE A;  3WGX A;  2CQ9 A;  1K0C A;  3TKS C;  4ZB6 A;  1KBN A;  3HY2 A;  1EV4 A;  4N0V A;  4AJ8 A;  3HVS A;  5DJM A;  1B48 A;  3DXB A;  1GH2 A;  1VRS D;  1XW9 A;  1T1V A;  1BQ7 A;  2VL2 C;  1EGR A;  3QMX A;  4NAX A;  3F4T A;  1XVQ A;  1M2A A;  3KIJ A;  4AJ6 A;  2H76 A;  1GSS A;  1QQ2 A;  4OWY A;  6GSU A;  1A0F A;  4MPG A;  2AB6 A;  4XRD A;  2HZE B;  4DEJ A;  1YQ1 A;  2NVL A;  3QFB C;  4J2F A;  3FK8 A;  2B5Y A;  1U88 A;  2QKE A;  5D9V A;  5CYY A;  3BOA A;  4TN8 A;  2GSQ A;  2YCD A;  3UBL A;  1YZX A;  3BJ5 A;  5GST A;  3G7I A;  2B7J A;  4KGI A;  3BCI A;  3RDW A;  3E0U A;  1VF2 A;  1R4W A;  2H1A A;  5HR3 A;  2OBI A;  1GUL A;  4TR1 A;  1PKW A;  1GWC A;  3H1N A;  3Q6O A;  4ZXG A;  5FWG A;  1F3A A;  4NHW A;  2WGR A;  5IMV A;  2HRN A;  3LJR A;  1EOH A;  2DLX A;  3TRP A;  5D96 A;  2F51 A;  1MDJ A;  4ML1 A;  1JHB A;  2DIY A;  3I69 A;  2TRC P;  4Q5N A;  5E4W A;  5HR1 A;  2X64 A;  2X8H A;  1GP1 A;  3GTU A;  2KUC A;  5DQS A;  3KMN A;  1QMV A;  2GT6 A;  1O81 A;  2JZT A;  2K18 A;  1USB A;  2B1K A;  2VAF A;  1Q98 A;  3P7X A;  2C3N A;  4WF4 A;  2O85 A;  19GS A;  8GSS A;  2NBS A;  1SK1 A;  5J41 A;  2AAW A;  2FA8 A;  4H86 A;  2A4V A;  1TRS A;  3L9V A;  5GZZ B;  2LKU A;  3UL3 A;  4ZL7 A;  2E7P A;  4WET A;  2EIR A;  1Z3E A;  1IYH A;  1XIY A;  1JLW A;  1FW1 A;  3TKS E;  2GLR A;  1AQX A;  1Z7R A;  2HXK A;  2HSY A;  3RPP A;  4ULX A;  3LYK A;  3FZ5 A;  1AQW A;  5JCU A;  2L5L A;  2OAC A;  4ISD A;  3KH9 A;  4FYB A;  5IMC A;  3EMP A;  2V32 A;  3VI7 A;  4O7H A;  2HYX A;  3HVX A;  3CTF A;  2JZS A;  1PX6 A;  6GSX A;  3C7M A;  1DUG A;  1S3C A;  4TR4 A;  3GV1 A;  2O8V B;  2VIM A;  3F6F A;  4TKY A;  1PMT A;  1A23 A;  1JFU A;  1GL8 A;  2MYG A;  5IMA A;  2PER A;  1YEP A;  1A0R P;  4MZB A;  3LG6 A;  2LV3 A;  4F0B A;  1GSE A;  1XOA A;  5B8B A;  4POB A;  3UIW A;  1I5G A;  3QDN A;  4OFN A;  4PQI A;  3W8S A;  4IVF A;  5B6M A;  2CVK A;  3HZ8 A;  3FZ9 A;  3J7Y b;  1DE2 A;  4WKW A;  4JR4 A;  4EL1 A;  2DJ3 A;  2VLV A;  4ECJ A;  3VUR A;  2GZP A;  5CRE A;  4NXI A;  2LJK A;  3FR3 A;  2WCI A;  4MK3 A;  2LNS A;  2C0D A;  4EF0 A;  4BWQ A;  3M3M A;  3LGC A;  4GRF A;  1A8Y A;  4I6X A;  14GS A;  2ZNM A;  3LWA A;  1UC7 A;  3F63 A;  5B7C A;  4EUY A;  2IMK A;  4JZQ A;  1TU7 A;  1SJZ A;  1PKZ A;  3FYG A;  4I2U A;  2OJL A;  1F2E A;  2G2Q A;  4NV2 A;  4X0X A;  4I5Q A;  4JU5 A;  1PQN A;  3ZFL A;  3MWH A;  2YJ7 A;  2H74 A;  5IIZ A;  2H72 A;  5DCG A;  1ZYE A;  2KHP A;  1X5C A;  4G19 A;  3G7J A;  2P31 A;  4IQ1 A;  3QPM A;  6GSV A;  5A4U A;  5IMZ A;  5INY A;  2DMM A;  2RUE A;  2FGX A;  4JBB A;  2PMT A;  4K6X A;  2PU9 C;  4XS6 A;  1Y25 A;  3M1G A;  2IJY A;  4KX4 A;  2GZZ A;  4EC0 A;  5LNK e;  1MD3 A;  2MZC A;  1J08 A;  1RQM A;  2VL3 A;  5IPG A;  2V6K A;  4L5O A;  5KEJ A;  2LRC A;  3HDC A;  4HUA A;  5AIX A;  4XCS A;  2GZY A;  1NM3 A;  3ZL5 A;  1K0O A;  3E9J B;  1EGO A;  3TCO A;  2AYT A;  3FHK A;  1KEB A;  2CT6 A;  1C72 A;  1M2B A;  1VF1 A;  2E2G A;  4KCE A;  2CX4 A;  3DIE A;  3WYW A;  5IPH A;  4WR5 A;  3FR9 A;  2VL2 A;  3KZQ A;  4I2T A;  1K3O A;  4JRR A;  5AIV A;  3EC3 A;  2JU5 A;  1FB6 A;  2F8A A;  4RUV A;  3ME7 A;  3EWL A;  3EU4 A;  3D4M A;  4LMW A;  5AN1 A;  1BED A;  2LNT A;  1QUW A;  5CNW A;  4AGS A;  13GS A;  4N0Z A;  4RI7 A;  1YKC A;  3GH9 A;  5KN0 A;  2LQO A;  3NOF A;  3IAS 2;  1PRX A;  3CRU A;  1BYE A;  5B8A A;  1N2A A;  1YY7 A;  2GT5 A;  3IDV A;  3WT2 A;  2QSI A;  3LYP A;  2FWH A;  1NW2 A;  4K7N A;  2A2R A;  3IK9 A;  3DWV A;  4DSQ A;  3UAP A;  4MF6 A;  3HD5 A;  2GS3 A;  1ERT A;  5ECO B;  4POK A;  3TOT A;  10GS A;  2LRT A;  4IW9 A;  3IRA A;  5G1L A;  4MDC A;  2GGT A;  2IFQ A;  1TP9 A;  1MEK A;  5AGY A;  3F4S A;  2QGV A;  3BCK A;  3HVV A;  1O7U A;  3TKP A;  3ZTL A;  5HFG A;  2VCQ A;  3HJM A;  3E3E A;  3OR5 A;  1R5P A;  1WRY A;  4YH2 A;  1FHE A;  2CZ3 A;  2MBS A;  1M7T A;  5DDL A;  1SK2 A;  3TGZ A;  3H8Q A;  4BPY A;  5IMD A;  2I4A A;  3TUE A;  2RM6 A;  1FAA A;  4MCU A;  2YWN A;  3GKK A;  5DVB A;  1BJX A;  2FHE A;  1VGL A;  22GS A;  3Q18 A;  2FCH A;  5LCZ A;  2XBI A;  1J0F A;  1T00 A;  4Q5Q A;  4V1A g;  1Z7P A;  2GQM A;  2BJX A;  2OE1 A;  1MD4 A;  1DSB A;  2HRF A;  5HR2 A;  2YV9 A;  4NMU A;  3UBK A;  2KP1 A;  4GQC A;  5L71 A;  2O89 A;  3VK9 A;  3EU3 A;  2WS2 A;  1LU4 A;  4TW5 A;  1QXH A;  4QL7 A;  3IPZ A;  4FYU A;  3VWU A;  3F3Q A;  3RBT A;  1G7O A;  4Q5F A;  4LMV A;  3VWX A;  2IME A;  1GUK A;  3FZA A;  4IP6 A;  4YQV A;  2C0F A;  1KTE A;  2P5Q A;  5EY6 A;  1SL0 B;  3D0Z A;  1PSQ A;  2N5B A;  4JR6 A;  4TR0 A;  5GAP D;  3CSH A;  5ECK B;  4POM A;  3M0F A;  1A24 A;  4ID0 A;  3IHQ A;  3FR6 A;  2C3T A;  2DSA A;  2VCT A;  3ED3 A;  1O8X A;  1GSU A;  4X1U A;  1FOV A;  1V57 A;  3H79 A;  5DAK A;  3CBU A;  1GTB A;  1SU9 A;  1B4Q A;  18GS A;  2HI7 A;  1EP8 A;  3IR4 A;  1XW6 A;  2C0E A;  1UVZ A;  4HZ4 A;  1B8X A;  4V2N A;  5ECL B;  4IQA A;  4ZBA A;  3RHB A;  1AIU A;  1TW9 A;  2F8F A;  4YQM A;  5DQY A;  2NTO A;  1ZYQ B;  2AUV A;  1X0R A;  2LEG A;  3GL3 A;  4MPF A;  2PUK C;  4CDO A;  3KMO A;  1Z5Y E;  3ISO A;  2YAN A;  2X8C A;  4F03 A;  1XOB A;  5HR0 A;  3ZIT A;  4KB3 A;  2B1L A;  5ELA A;  1T7P B;  1GNW A;  2DJ1 A;  3AY8 A;  2VM2 A;  2I9H A;  3FRC A;  3KD0 A;  3IXR A;  1SYR A;  2GST A;  2CV4 A;  2TIR A;  3ERW A;  2M80 A;  1OYJ A;  4HU7 A;  1XZO A;  3CTG A;  1GLP A;  3DVX A;  4DVC A;  2I81 A;  4HU9 A;  4L5L A;  4GLT A;  2AV4 A;  1QK8 A;  4EO3 A;  2QC7 A;  3UEM A;  4XTS A;  5CO3 A;  1HNB A;  2H1B A;  2ON7 A;  1V9W A;  2B5X A;  1FG4 A;  4PUR A;  3VWW A;  2ES7 A;  3KXO A;  5DAL A;  2C0G A;  2YPM A;  4LL4 B;  5J4U A;  1B9Y C;  2B7K A;  4IJ3 A;  5F06 A;  2A2S A;  3QAV A;  2OKA A;  5J5N A;  3UVT A;  1WMJ A;  1NSW A;  1TTZ A;  2OBK A;  3HJO A;  1PA3 A;  1RW1 A;  2WDU A;  3GMF A;  2VM1 A;  2IFQ B;  2CX3 A;  3LXZ A;  2AJQ B;  4PX1 A;  2L4C A;  4HOJ A;  2YZH A;  3HYP A;  1T8E B;  5DBQ A;  3D21 A;  1GUH A;  1AW9 A;  3SBC A;  4MF7 A;  1XXU A;  3I6A A;  5FT3 A;  2R2J A;  2VCZ A;  1A2M A;  1RK4 A;  2H0G A;  5ENU A;  4Z7X A;  3ZLP A;  1G6W A;  2AHE A;  3F8U A;  1VF3 A;  4KH7 A;  3RHC A;  2PVO C;  1R7H A;  3F9U A;  3IK7 A;  3ZIV A;  1F9M A;  4BL7 A;  4DSR A;  5D8I A;  4PUA A;  3TRX A;  3BD2 A;  4EKZ A;  3JCM L;  4PGT A;  1E2Y A;  1SEN A;  4GSN A;  3U6V A;  3TKQ A;  3HJP A;  3VI5 A;  4FIW A;  1AC1 A;  1GSQ A;  17GS A;  1Z9H A;  3DYR A;  2R3X A;  1SJI A;  5JWO B;  2J9H A;  4ECC A;  1SYX A;  4XHM A;  5AIS A;  1SL2 B;  1WWJ A;  2B5E A;  4EXJ A;  3APO A;  1X9S B;  2EC4 A;  4HQS A;  3D22 A;  2F9S A;  4CHS A;  3TOU A;  1XWC A;  5ID2 A;  3RAZ A;  2CA8 A;  1G6Y A;  3F4R A;  3GUS A;  1GTU A;  3S9F A;  2HFD A;  1OKD A;  1IYI A;  2N5F A;  5CRH A;  3H4K A;  1Q4J A;  2DML A;  1LBK A;  5IO2 A;  2V2G A;  4TXO A;  5JWR B;  3HCZ A;  4YAP A;  1O6J A;  4N11 A;  3GNJ A;  3VPQ A;  1M9A A;  1U87 A;  4KE3 A;  1JZR A;  1EP7 A;  1I9D A;  3KGK A;  3GHA A;  3QFA C;  1OE8 A;  2FWE A;  4DSS A;  1Y6E A;  5CAX A;  1YEX A;  2MMO A;  3I43 A;  1ZZY A;  3D4T A;  4PQ1 A;  5DJL A;  1KNG A;  2EIQ A;  4ECB A;  2O7K A;  2C80 A;  3IOS A;  3UOM A;  3TJK A;  1AQV A;  2B6M A;  5B6N A;  1OC9 A;  4ZB9 A;  3ZMK A;  4KW6 A;  1O73 A;  3A3T A;  2DJJ A;  3FY7 A;  3GFK A;  5KN3 A;  2YNX A;  4K0G A;  3NIV A;  1ZL9 A;  1EZK A;  1WPI A;  1PX7 A;  3TJG A;  3F6D A;  2H8L A;  5IOX A;  3GIX A;  1MDI A;  4OO4 A;  1OKT A;  3TJB A;  2YWO A;  4TOP A;  1MDK A;  3ZVJ A;  4NHZ A;  1JZD A;  3TKS A;  4WBR D;  2HZE A;  2JL4 A;  2VL9 A;  5HFI A;  5ELG A;  3HXS A;  1ERU A;  1OC8 A;  3HZ4 A;  2LST A;  7GSS A;  2BTO T;  3PH9 A;  2LUS A;  1O85 A;  2BMX A;  3IC4 A;  3O3T A;  1M99 A;  1GUM A;  1YKA A;  4KSO A;  4ZL9 A;  1SL1 B;  3FKF A;  4TR1 B;  2PBJ A;  5ABR A;  2PN8 A;  3US3 A;  3APS A;  3GYK A;  2LJR A;  4BVY A;  3G7Y A;  3C8E A;  4GTU A;  2I1U A;  2C8U A;  1EWX A;  5HFK A;  4N30 A;  1S3D A;  4ZBD A;  2ZCT A;  2LTK A;  2HT9 A;  2H01 A;  1ABA A;  2VD0 A;  1ILO A;  1WP0 A;  1YJ6 A;  2JAD A;  1NHY A;  1A2J A;  2M72 A;  2X8G A;  3GTU B;  4GCI A;  2LS5 A;  3A5W A;  2YWM A;  1XW5 A;  1JZW A;  1XBS A;  3F0I A;  3APQ A;  5JCW A;  3LQ7 A;  4WBJ A;  4BVX A;  5COH A;  1XWG A;  3W6G A;  3DRN A;  3PR8 A;  3DEX A;  4BA7 A;  1M2D A;  4KSM A;  2OAD A;  1OE7 A;  3W8J A;  1K0A A;  4KCA A;  4MH3 A;  4ZB8 A;  3L9S A;  4E8E A;  5G31 A;  2TRX A;  3QCP A;  2H70 A;  3CYN A;  5HQP A;  4MAB A;  4P3Y B;  2K8V A;  2YN1 A;  5CRD A;  5G1K A;  4OFT A;  2MMN A;  2IMF A;  1PN9 A;  1ERV A;  2H0H A;  2GQL A;  1HQO A;  3CMI A;  3KP9 A;  4KDU A;  4JED A;  5D9W A;  4POL A;  3WGD A;  3GKX A;  20GS A;  1T4Z A;  2ZUP A;  4KDX A;  2H1G A;  4IEL A;  2OA7 A;  5IOW A;  2WB9 A;  3GA4 A;  2GSS A;  1BX9 A;  4GXZ A;  4IP1 A;  1ST9 A;  1SD9 A;  2RLI A;  4EDY A;  5A5K A;  2E2M A;  4MJE A;  1FVK A;  1M0U A;  1XWA A;  3KEB A;  1K0N A;  2VD1 A;  5J9C A;  2D2Z A;  2X99 A;  2PPT A;  3QR6 A;  2G0F A;  3H93 A;  5C04 A;  4HJ2 A;  4QL9 A;  5H5S A;  1XWB A;  2LRN A;  5EPF A;  5KN2 A;  3GN3 A;  5A4V A;  5CRW A;  3GRX A;  1TI1 A;  3ZYW A;  4YQU A;  1XVW A;  1K3L A;  4GSS A;  4GST A;  2REM A;  1GTI A;  1CQH A;  2YOI A;  4TR3 A;  3VLN A;  4CW9 A;  3IE3 A;  1BAY A;  5IO0 A;  2I3Y A;  4WR4 A;  4EVM A;  3I9V 2;  3LEF A;  1FO5 A;  2VLU A;  5D73 A;  2CAQ A;  1S3A A;  3ZRE A;  1GNE A;  1UA5 A;  1O8W A;  3MSZ A;  1GSF A;  2JZR A;  1B4P A;  2WUL A;  4ILF A;  2V41 A;  3KH7 A;  1U6T A;  1ACV A;  1AUC A;  5G5F A;  4F82 A;  1ZCP A;  2NPB A;  3O76 A;  4ML6 A;  3TKR A;  2H66 A;  2RM5 A;  4N10 A;  5ECS A;  2YP6 A;  3CRT A;  3NZN A;  4F2I A;  1TXX A;  4MLY A;  2WRT A;  2H71 A;  3P2A A;  1TK0 B;  4EDZ A;  3C73 A;  4V2M A;  2FD3 A;  4TXV A;  2CAI A;  3GH6 A;  4AF2 A;  2L57 A;  2N5A A;  2MBT A;  4IJI A;  2J23 A;  1GLQ A;  4FO5 A;  2RUF A;  2V1M A;  1R26 A;  3L9U A;  3R2Q A;  2Z9S A;  5G5E A;  1K0B A;  2GSR A;  4FH8 A;  4WXT A;  4WF5 A;  2LQQ A;  1NHO A;  1T3B A;  4RQX A;  1X9W B;  2DIZ A;  1YF1 A;  1T4Y A;  4ZIJ A;  3KCM A;  4JE1 A;  3LOR A;  5H5R A;  3M9J A;  3HA9 A;  3QD9 A;  4E8H A;  2GDR A;  1TU8 A;  1EV9 A;  2NDO A;  1A2L A;  3U5R E;  2GVP A;  1XPV A;  9GSS A;  2R4V A;  1PL2 A;  4KA0 A;  1FVJ A;  4L0U A;  3PGT A;  1DBY A;  2L4Q A;  4YAV A;  2H73 A;  4RI6 A;  3TRQ A;  1XCC A;  4ACS A;  5H5Q A;  1K3Y A;  3EIN A;  5JCG A;  1QFN A;  4OCF A;  1V58 A;  3TB2 A;  1F3B A;  4OFM A;  4MJA A;  3ZRD A;  2C3Q A;  2P5R A;  1W89 A;  1WE0 A;  1WOU A;  1UN2 A;  3EYT A;  3IAM 2;  12GS A;  3M9K A;  2ALB A;  3GKN A;  1YDK A;  3QAG A;  2C1Y A;  4K8M A;  4PXO A;  2XPE A;  1BG5 A;  3TDG A;  4MP4 A;  5ECI B;  5IMF A;  4MF5 A;  4HZ2 A;  2YZU A;  5D9X A;  5A4W A;  2HNL A;  1HYU A;  2PGT A;  4OCE A;  4HDE A;  1ON4 A;  2IIY A;  3ZVJ D;  6GSS A;  5F0G A;  2XC2 A;  4ZBB A;  2FY6 A;  1CQG A;  1X9M B;  2FNO A;  3CSI A;  2L6C A;  5LD0 A;  2ON5 A;  3K8N A;  1ZMA A;  3EVI A;  2VO4 A;  5C00 A;  3DD3 A;  5JWQ B;  4K7I A;  4K2D A;  5E59 A;  5ECR B;  4OMV A;  5CP1 A;  3VFI A;  2PWJ A;  3MAK A;  3P8W A;  4MZC A;  1U3I A;  3M8N A;  1VF4 A;  2YV7 A;  1MTC A;  1U3A A;  2DC5 A;  4ECI A;  6GSW A;  1W4V A;  1G7E A;  3UAR A;  6GST A;  1OC3 A;  2MMA A;  5IM9 A;  4PNF A;  16GS A;  4HQZ A;  2FLS A;  2M46 A;  4FYC A;  4V2L A;  2H6Z A;  1PGT A;  1OAZ A;  1GSY A;  1TOF A;  4I8B A;  5EL8 A;  5ECP B;  1SD8 A;  3ZIJ A;  2R5G A;  3KTL A;  2KLX A;  3ERF A;  4XS4 A;  3ZFB A;  1PD2 1;  2JSZ A;  4XIH A;  3GX0 A;  3RPN A;  3C1R A;  4O32 A;  2L59 A;  1TK8 B;  3IA1 A;  2K9F A;  3EMX A;  1GTA A;  1PL1 A;  1WIK A;  2HSH A;  3SWL A;  4L0W A;  3G9B A;  5IQY A; 
#chains in the Genus database with same CATH topology
 2XHF A;  4D73 A;  1XFL A;  5ECM B;  4IKH A;  4O5U A;  2IL3 A;  4EIQ A;  3KJY A;  2XBQ A;  3TJJ A;  4IHU A;  3DVW A;  2R37 A;  3D5J A;  4XRA A;  4KAE A;  4AJ7 A;  5G30 A;  3DKS A;  4I97 A;  2KOK A;  3BBY A;  3ZZX A;  1HNA A;  1TI3 A;  2IN3 A;  4LA1 A;  2K6V A;  4O5R A;  1ZYP A;  3C1S A;  4O92 A;  4TRX A;  3V1W A;  1SK0 A;  2YJH A;  1V40 A;  3FZ4 A;  2WZ9 A;  4KUN A;  3D6I A;  1X5D A;  1YF0 A;  2CZ2 A;  3L0H A;  3VPT A;  2A2P A;  2EIO A;  1X5E A;  1WJK A;  4ZIL A;  3Q74 A;  1ML6 A;  4CY6 A;  1ZGN A;  4G2E A;  4F0C A;  5DAK B;  1GSD A;  5DCH A;  4WEY A;  2VUP A;  2H30 A;  2MMZ A;  2VOC A;  1THO A;  2OE3 A;  3HHV A;  3KTB A;  3CXG A;  2P0G A;  3UMA A;  1TK5 B;  1SKR B;  5GSS A;  2XPD A;  3ZML A;  4PNG A;  3MYD A;  2RII A;  1M9B A;  6GSY A;  1JLV A;  2HE3 A;  4HS1 A;  3WT1 A;  1ERW A;  4L8E A;  4IN0 A;  3DML A;  4IGJ A;  4QQ7 A;  2H75 A;  3L4N A;  4Q5R A;  3A2V A;  5F05 A;  3PIN A;  4K1F A;  2VCW A;  1K0D A;  2V6O A;  4MNN A;  1AXD A;  1ZOF A;  2H19 A;  2IMI A;  2H1D A;  1Z6N A;  1EEJ A;  3F3R A;  3Q19 A;  4X4J A;  2LJA A;  2DJ0 A;  3IV4 A;  1EEM A;  4EE0 A;  4GWR A;  5F8B A;  2IWT A;  3J7Y k;  2H0I A;  1A8L A;  1F37 A;  3ERG A;  1TKD B;  3O6T A;  2E0Q A;  3QAW A;  2L5O A;  1K0M A;  4MJB A;  2GTU A;  4V1A p;  1V98 A;  3KM6 A;  2FA4 A;  4LL1 B;  2WFC A;  5F07 A;  3WGE A;  2CVD A;  4MZW A;  5DAL B;  3GST A;  3TJF A;  1TRU A;  1H4O A;  3HKR A;  4KDY A;  11GS A;  5GAN D;  1LJR A;  1F6M C;  2OE0 A;  2DBC A;  1B9X C;  1Z6M A;  1R5A A;  2R6K A;  5ECH B;  2FWG A;  4NPB A;  3R3E A;  1TRW A;  2O87 A;  3A2X A;  4HEA 2;  1N8J A;  2KP2 A;  1E6B A;  2GQK A;  3DGQ A;  3LFL A;  3CSJ A;  3GX8 A;  4K7O A;  4G10 A;  2YWI A;  3UVH A;  1AAZ A;  5FHI A;  1SJ6 A;  4RQR A;  4LLR A;  4PUF C;  5ECN B;  2F3M A;  1TRV A;  3WD6 A;  2VCX A;  2JAC A;  1TJD A;  1HD2 A;  1TDI A;  3ME8 A;  1J9B A;  1GRX A;  3N5O A;  3EE2 A;  2HLS A;  2H6X A;  5EVO A;  4HJM A;  2DJK A;  4IS0 A;  4BL7 B;  3P90 A;  4PQH A;  1XWK A;  5D93 A;  4GF0 A;  1EOG A;  1QGV A;  3GUR A;  2FUG 2;  1FB0 A;  4HI7 A;  1OVN A;  2L6D A;  5D9T A;  5J9B A;  3QOU A;  3IBH A;  2CVB A;  5G2Z A;  2IPA A;  4MMM A;  4F9Z A;  1S3R A;  4XS4 B;  4KND A;  4ZL8 A;  2C4J A;  1THX A;  4G9H A;  2VCV A;  4XS1 A;  4IBP A;  5J3R A;  2IMD A;  4J57 E;  2JSY A;  5ECQ B;  1V2A A;  2PVQ A;  2WJU A;  1DE1 A;  4MJC A;  2VLT A;  2DJ2 A;  4OD7 A;  4K0N A;  2H6Y A;  5ID2 B;  3FW2 A;  4MA9 A;  4D73 B;  2HZF A;  1H75 A;  3UJ1 A;  4G0I A;  2FWF A;  3EUR A;  3GL5 A;  5CRG A;  4K9Z A;  3VWV A;  4TXO B;  4X43 A;  3GKM A;  3LSZ A;  5KN1 A;  3A2W A;  4BWS A;  1SKS B;  4NWY A;  4MH2 A;  4GQF A;  1JZO A;  3LXT A;  4DSS B;  4J56 E;  1SKW B;  3MNG A;  3L78 A;  1G0T A;  3FEU A;  3GSS A;  2QA2 A;  4NV5 A;  4OO5 A;  3MDK A;  3C71 A;  3KP8 A;  1URM A;  2B3S A;  1OC9 B;  2K8S A;  3N9J A;  1HNC A;  4TVE A;  2A4H A;  3WGX A;  2CQ9 A;  1K0C A;  3TKS C;  4ZB6 A;  1KBN A;  3HY2 A;  3IC8 A;  1EV4 A;  4N0V A;  4AJ8 A;  3HVS A;  5DJM A;  1B48 A;  3DXB A;  1GH2 A;  1VRS D;  1XW9 A;  1T1V A;  1BQ7 A;  2DKI A;  2VL2 C;  1EGR A;  3QMX A;  4NAX A;  3F4T A;  1XVQ A;  3FMW A;  1M2A A;  3KIJ A;  4AJ6 A;  2H76 A;  1GSS A;  1QQ2 A;  4OWY A;  6GSU A;  1A0F A;  4MPG A;  2AB6 A;  4XRD A;  2HZE B;  4DEJ A;  1YQ1 A;  2NVL A;  3QFB C;  4J2F A;  3FK8 A;  4FQU A;  2B5Y A;  5KOW A;  1U88 A;  2QKE A;  5D9V A;  5CYY A;  3BOA A;  4TN8 A;  2GSQ A;  2YCD A;  3UBL A;  1YZX A;  3BJ5 A;  5GST A;  3G7I A;  2B7J A;  4KGI A;  3BCI A;  3IHG A;  3RDW A;  3E0U A;  1VF2 A;  1R4W A;  2H1A A;  5HR3 A;  2OBI A;  1GUL A;  4TR1 A;  1PKW A;  1GWC A;  3H1N A;  3Q6O A;  4ZXG A;  5FWG A;  1F3A A;  4NHW A;  2WGR A;  5IMV A;  2HRN A;  3LJR A;  1EOH A;  2DLX A;  3TRP A;  5D96 A;  2F51 A;  1MDJ A;  4ML1 A;  1JHB A;  2DIY A;  3I69 A;  2TRC P;  4Q5N A;  5E4W A;  5HR1 A;  2X64 A;  2X8H A;  1GP1 A;  3GTU A;  2KUC A;  5DQS A;  4BVX B;  3KMN A;  1QMV A;  2GT6 A;  1O81 A;  2JZT A;  2K18 A;  1USB A;  2B1K A;  2VAF A;  1Q98 A;  3P7X A;  2C3N A;  4WF4 A;  2O85 A;  19GS A;  8GSS A;  2NBS A;  1SK1 A;  5J41 A;  2AAW A;  2FA8 A;  4H86 A;  2A4V A;  1TRS A;  3L9V A;  5GZZ B;  2LKU A;  3UL3 A;  4ZL7 A;  2E7P A;  4A5P A;  4WET A;  2EIR A;  1Z3E A;  1IYH A;  1XIY A;  1JLW A;  1FW1 A;  3TKS E;  2GLR A;  1AQX A;  1Z7R A;  2HXK A;  2HSY A;  3RPP A;  4ULX A;  3LYK A;  3FZ5 A;  1AQW A;  5JCU A;  2L5L A;  2OAC A;  4ISD A;  3KH9 A;  4FYB A;  5IMC A;  3EMP A;  2V32 A;  3VI7 A;  4O7H A;  2HYX A;  3HVX A;  3CTF A;  2JZS A;  1PX6 A;  2HRK A;  6GSX A;  3A5I A;  3C7M A;  1DUG A;  1S3C A;  4TR4 A;  3GV1 A;  2O8V B;  4ICY A;  2VIM A;  3F6F A;  4TKY A;  1PMT A;  1A23 A;  1JFU A;  1GL8 A;  2MYG A;  5IMA A;  2PER A;  1YEP A;  1A0R P;  4MZB A;  4YKF A;  3LG6 A;  2LV3 A;  4F0B A;  1GSE A;  1XOA A;  5B8B A;  4POB A;  3UIW A;  1I5G A;  3QDN A;  4HSC X;  4OFN A;  4PQI A;  3W8S A;  4IVF A;  5B6M A;  2CVK A;  3HZ8 A;  3FZ9 A;  3J7Y b;  1DE2 A;  4WKW A;  4JR4 A;  4EL1 A;  2DJ3 A;  2VLV A;  4ECJ A;  3VUR A;  2GZP A;  5CRE A;  4NXI A;  2LJK A;  3FR3 A;  2WCI A;  4MK3 A;  2LNS A;  2C0D A;  4EF0 A;  4BWQ A;  3M3M A;  3LGC A;  4GRF A;  1A8Y A;  4I6X A;  14GS A;  2ZNM A;  3LWA A;  1UC7 A;  3F63 A;  5B7C A;  4EUY A;  2IMK A;  4JZQ A;  1TU7 A;  1SJZ A;  1PKZ A;  3FYG A;  4I2U A;  2OJL A;  1F2E A;  2G2Q A;  4NV2 A;  4X0X A;  4I5Q A;  4JU5 A;  1PQN A;  3ZFL A;  3MWH A;  2YJ7 A;  2H74 A;  5IIZ A;  2H72 A;  5DCG A;  1ZYE A;  2KHP A;  1X5C A;  4G19 A;  3G7J A;  2P31 A;  4IQ1 A;  5BMU A;  3QPM A;  6GSV A;  5A4U A;  5IMZ A;  5INY A;  2DMM A;  2RUE A;  2FGX A;  4JBB A;  2PMT A;  4K6X A;  2PU9 C;  4XS6 A;  1Y25 A;  3M1G A;  2IJY A;  4KX4 A;  2GZZ A;  4EC0 A;  5LNK e;  1MD3 A;  2MZC A;  1J08 A;  1RQM A;  2VL3 A;  5IPG A;  2V6K A;  4L5O A;  5KEJ A;  2LRC A;  3HDC A;  4HUA A;  5AIX A;  4XCS A;  2GZY A;  1NM3 A;  3ZL5 A;  1K0O A;  3E9J B;  1EGO A;  3TCO A;  2AYT A;  3FHK A;  1KEB A;  2CT6 A;  1C72 A;  1M2B A;  1VF1 A;  2E2G A;  4KCE A;  2CX4 A;  3DIE A;  3WYW A;  5IPH A;  4WR5 A;  3FR9 A;  2VL2 A;  3KZQ A;  4I2T A;  1K3O A;  4JRR A;  5AIV A;  3EC3 A;  2JU5 A;  1FB6 A;  2F8A A;  4RUV A;  3ME7 A;  3EWL A;  3EU4 A;  3D4M A;  4LMW A;  5AN1 A;  1BED A;  2LNT A;  1QUW A;  5CNW A;  4AGS A;  13GS A;  4N0Z A;  4RI7 A;  1YKC A;  3GH9 A;  5KN0 A;  2LQO A;  3NOF A;  3IAS 2;  1PRX A;  3CRU A;  1BYE A;  5B8A A;  1N2A A;  1YY7 A;  2GT5 A;  3IDV A;  3WT2 A;  2QSI A;  3LYP A;  2FWH A;  1NW2 A;  4K7N A;  4G0K A;  2A2R A;  3LW9 A;  3IK9 A;  3DWV A;  4DSQ A;  5KOX A;  3UAP A;  4MF6 A;  3HD5 A;  2GS3 A;  1ERT A;  5ECO B;  4POK A;  1FOH A;  3TOT A;  10GS A;  2LRT A;  4IW9 A;  3IRA A;  5G1L A;  4MDC A;  2GGT A;  3MIX A;  2IFQ A;  4Z2U A;  1TP9 A;  1MEK A;  5AGY A;  3F4S A;  2QGV A;  3BCK A;  3HVV A;  1O7U A;  3TKP A;  3ZTL A;  5HFG A;  2VCQ A;  3HJM A;  4BIK A;  3E3E A;  3OR5 A;  1R5P A;  1WRY A;  4YH2 A;  1FHE A;  2CZ3 A;  2MBS A;  1M7T A;  5DDL A;  1SK2 A;  3TGZ A;  3H8Q A;  4BPY A;  5IMD A;  2I4A A;  3TUE A;  2RM6 A;  1FAA A;  4MCU A;  2YWN A;  3GKK A;  5DVB A;  2QA1 A;  1BJX A;  2FHE A;  1VGL A;  22GS A;  4KF9 A;  3Q18 A;  2FCH A;  5LCZ A;  2XBI A;  1J0F A;  1T00 A;  4Q5Q A;  4V1A g;  1Z7P A;  2GQM A;  2BJX A;  4G0L A;  2OE1 A;  1MD4 A;  1DSB A;  2HRF A;  5HR2 A;  2YV9 A;  4NMU A;  3UBK A;  1XG8 A;  2KP1 A;  4GQC A;  5L71 A;  2O89 A;  3VK9 A;  3EU3 A;  2WS2 A;  1LU4 A;  4TW5 A;  1QXH A;  4QL7 A;  3IPZ A;  4FYU A;  3VWU A;  3F3Q A;  3RBT A;  1G7O A;  4Q5F A;  4LMV A;  3VWX A;  2IME A;  1GUK A;  3FZA A;  4IP6 A;  4YQV A;  2C0F A;  1KTE A;  2P5Q A;  5EY6 A;  1SL0 B;  2X49 A;  1PSQ A;  3D0Z A;  2N5B A;  4JR6 A;  4TR0 A;  5GAP D;  3CSH A;  5ECK B;  4POM A;  3M0F A;  1A24 A;  4ID0 A;  3IHQ A;  3FR6 A;  2C3T A;  2DSA A;  2VCT A;  3ED3 A;  1O8X A;  1GSU A;  4X1U A;  1FOV A;  1V57 A;  4K5R A;  3H79 A;  3HVN A;  5DAK A;  3CBU A;  1GTB A;  1SU9 A;  1B4Q A;  18GS A;  2HI7 A;  1EP8 A;  3IR4 A;  1XW6 A;  2C0E A;  1UVZ A;  4HZ4 A;  1B8X A;  4V2N A;  5ECL B;  4IQA A;  4ZBA A;  3RHB A;  1AIU A;  1TW9 A;  2F8F A;  4YQM A;  5DQY A;  2NTO A;  1ZYQ B;  2AUV A;  1X0R A;  2LEG A;  3GL3 A;  4MPF A;  4EIP A;  2PUK C;  4CDO A;  3KMO A;  1Z5Y E;  3ISO A;  2YAN A;  2X8C A;  4F03 A;  1XOB A;  5HR0 A;  3ZIT A;  4KB3 A;  2B1L A;  5ELA A;  1T7P B;  1GNW A;  2DJ1 A;  3AY8 A;  2VM2 A;  2I9H A;  3FRC A;  3KD0 A;  3IXR A;  1SYR A;  2GST A;  2CV4 A;  2TIR A;  3ERW A;  2M80 A;  1OYJ A;  4HU7 A;  1XZO A;  3CTG A;  2R0P A;  1GLP A;  3DVX A;  2UZ8 A;  4DVC A;  2I81 A;  4HU9 A;  4L5L A;  4GLT A;  2AV4 A;  1QK8 A;  4EO3 A;  2QC7 A;  3UEM A;  4XTS A;  5CO3 A;  1HNB A;  2H1B A;  2ON7 A;  1V9W A;  2B5X A;  1FG4 A;  4PUR A;  3VWW A;  2ES7 A;  3KXO A;  5DAL A;  4Z2T A;  2C0G A;  2YPM A;  4LL4 B;  5J4U A;  1B9Y C;  2B7K A;  4IJ3 A;  5F06 A;  2A2S A;  3QAV A;  2OKA A;  5J5N A;  3UVT A;  1WMJ A;  1NSW A;  1TTZ A;  2OBK A;  3HJO A;  1PA3 A;  1RW1 A;  2WDU A;  3GMF A;  2VM1 A;  2IFQ B;  2CX3 A;  3LXZ A;  2AJQ B;  4PX1 A;  2L4C A;  4HOJ A;  2YZH A;  3HYP A;  1T8E B;  5DBQ A;  3D21 A;  1GUH A;  1AW9 A;  3SBC A;  4MF7 A;  1XXU A;  3I6A A;  5FT3 A;  2R2J A;  2VCZ A;  1A2M A;  1RK4 A;  2H0G A;  5ENU A;  4Z7X A;  3ZLP A;  1G6W A;  2AHE A;  3F8U A;  1VF3 A;  4KH7 A;  3RHC A;  2PVO C;  1R7H A;  3F9U A;  3IK7 A;  3ZIV A;  1F9M A;  4BL7 A;  4DSR A;  5D8I A;  4PUA A;  3TRX A;  3BD2 A;  4EKZ A;  3JCM L;  4PGT A;  1E2Y A;  1SEN A;  4GSN A;  3U6V A;  3TKQ A;  3HJP A;  3VI5 A;  4FIW A;  1AC1 A;  1GSQ A;  17GS A;  1Z9H A;  3DYR A;  2R3X A;  1SJI A;  5JWO B;  2J9H A;  4ECC A;  1SYX A;  4XHM A;  5AIS A;  1SL2 B;  1WWJ A;  2B5E A;  4EXJ A;  3APO A;  3EPT A;  1X9S B;  2EC4 A;  4HQS A;  3D22 A;  2F9S A;  4CHS A;  3TOU A;  1XWC A;  5ID2 A;  3RAZ A;  2CA8 A;  1G6Y A;  3F4R A;  3GUS A;  1GTU A;  3S9F A;  2HFD A;  1OKD A;  1IYI A;  2N5F A;  5CRH A;  3H4K A;  1Q4J A;  2DML A;  1LBK A;  5IO2 A;  2V2G A;  4TXO A;  5JWR B;  3HCZ A;  4YAP A;  1O6J A;  4N11 A;  3GNJ A;  5BRT A;  3VPQ A;  1M9A A;  1U87 A;  4KE3 A;  1JZR A;  1EP7 A;  1I9D A;  3KGK A;  3GHA A;  3QFA C;  1OE8 A;  2FWE A;  4DSS A;  1Y6E A;  5CAX A;  1YEX A;  2MMO A;  3I43 A;  1ZZY A;  3D4T A;  4PQ1 A;  5DJL A;  1KNG A;  2EIQ A;  4ECB A;  2O7K A;  2C80 A;  3IOS A;  3UOM A;  3TJK A;  1AQV A;  2B6M A;  5B6N A;  1ZYN A;  1OC9 A;  4ZB9 A;  3ZMK A;  4KW6 A;  1O73 A;  3A3T A;  2DJJ A;  3FY7 A;  3GFK A;  5KN3 A;  2YNX A;  4K0G A;  3NIV A;  1ZL9 A;  1EZK A;  1WPI A;  1PX7 A;  3TJG A;  3F6D A;  2H8L A;  5IOX A;  3GIX A;  1MDI A;  4OO4 A;  1OKT A;  3TJB A;  2YWO A;  4TOP A;  1MDK A;  4K2X A;  3ZVJ A;  2R0C A;  4NHZ A;  1JZD A;  3TKS A;  4WBR D;  2HZE A;  2JL4 A;  2VL9 A;  5HFI A;  5ELG A;  3HXS A;  1ERU A;  4CY8 A;  1OC8 A;  3HZ4 A;  2LST A;  7GSS A;  2BTO T;  3PH9 A;  2LUS A;  1O85 A;  4PTS A;  2BMX A;  3IC4 A;  3O3T A;  1M99 A;  1GUM A;  1YKA A;  4KSO A;  4ZL9 A;  1SL1 B;  3FKF A;  4TR1 B;  2PBJ A;  5ABR A;  2PN8 A;  3US3 A;  3APS A;  3GYK A;  2LJR A;  4BVY A;  3G7Y A;  3C8E A;  4GTU A;  2I1U A;  2C8U A;  1EWX A;  5HFK A;  4N30 A;  1S3D A;  4ZBD A;  2ZCT A;  2LTK A;  2HT9 A;  2H01 A;  1ABA A;  2VD0 A;  1ILO A;  1WP0 A;  1YJ6 A;  2JAD A;  1NHY A;  1A2J A;  1M3J A;  2M72 A;  2X8G A;  3GTU B;  4GCI A;  2LS5 A;  3A5W A;  2YWM A;  1XW5 A;  1JZW A;  1XBS A;  3F0I A;  3APQ A;  5JCW A;  3LQ7 A;  4WBJ A;  4BVX A;  5COH A;  1XWG A;  3W6G A;  3DRN A;  3PR8 A;  3DEX A;  4BA7 A;  1M2D A;  4KSM A;  2OAD A;  1OE7 A;  3W8J A;  1K0A A;  4KCA A;  4MH3 A;  4ZB8 A;  3L9S A;  4E8E A;  5G31 A;  2TRX A;  3QCP A;  2H70 A;  3CYN A;  5HQP A;  4MAB A;  4P3Y B;  2K8V A;  2YN1 A;  5CRD A;  5G1K A;  4OFT A;  2MMN A;  2IMF A;  1PN9 A;  1ERV A;  2H0H A;  2GQL A;  1HQO A;  3CMI A;  3KP9 A;  4Z2R A;  4KDU A;  4JED A;  5D9W A;  4POL A;  3WGD A;  3GKX A;  20GS A;  1T4Z A;  2ZUP A;  4KDX A;  2H1G A;  4IEL A;  2OA7 A;  5IOW A;  2WB9 A;  3GA4 A;  2GSS A;  1BX9 A;  4GXZ A;  4IP1 A;  1ST9 A;  1SD9 A;  2RLI A;  4EDY A;  5A5K A;  2E2M A;  4MJE A;  1FVK A;  1M0U A;  1XWA A;  3KEB A;  1K0N A;  2VD1 A;  5J9C A;  2D2Z A;  2X99 A;  2PPT A;  3QR6 A;  2G0F A;  3H93 A;  5C04 A;  4HJ2 A;  3PPU A;  4QL9 A;  5H5S A;  1XWB A;  2LRN A;  4O5Q A;  5EPF A;  3GN3 A;  5A4V A;  5CRW A;  4K5S A;  5KN2 A;  3GRX A;  1TI1 A;  3ZYW A;  4YQU A;  1XVW A;  1K3L A;  4GSS A;  4GST A;  2REM A;  1GTI A;  1CQH A;  2YOI A;  4TR3 A;  3VLN A;  4CW9 A;  3IE3 A;  1BAY A;  5IO0 A;  2I3Y A;  4WR4 A;  4EVM A;  3I9V 2;  3LEF A;  1FO5 A;  2VLU A;  5D73 A;  2CAQ A;  2DKH A;  1S3A A;  3ZRE A;  1GNE A;  1UA5 A;  1O8W A;  3MSZ A;  1GSF A;  2HSM A;  2JZR A;  1B4P A;  2WUL A;  4ILF A;  2V41 A;  3KH7 A;  1U6T A;  1ACV A;  1AUC A;  5G5F A;  4F82 A;  1ZCP A;  2NPB A;  3O76 A;  4ML6 A;  3TKR A;  2H66 A;  2RM5 A;  4N10 A;  5ECS A;  2YP6 A;  3CRT A;  3NZN A;  4F2I A;  1TXX A;  4MLY A;  2WRT A;  2H71 A;  3P2A A;  1TK0 B;  4EDZ A;  3C73 A;  4V2M A;  2FD3 A;  4TXV A;  2CAI A;  3GH6 A;  4AF2 A;  2L57 A;  2X4A A;  2N5A A;  2MBT A;  4IJI A;  2J23 A;  1GLQ A;  4FO5 A;  2RUF A;  2V1M A;  1R26 A;  3L9U A;  3R2Q A;  2Z9S A;  5G5E A;  1K0B A;  2GSR A;  4FH8 A;  4WXT A;  1PN0 A;  4WF5 A;  2LQQ A;  1NHO A;  1T3B A;  3CQF A;  4RQX A;  1X9W B;  2DIZ A;  1YF1 A;  1T4Y A;  4ZIJ A;  3KCM A;  4JE1 A;  3LOR A;  5H5R A;  3M9J A;  3HA9 A;  3QD9 A;  4E8H A;  2GDR A;  1TU8 A;  1EV9 A;  2NDO A;  1A2L A;  3U5R E;  2GVP A;  1XPV A;  2R0G A;  9GSS A;  2R4V A;  1PL2 A;  4KA0 A;  1FVJ A;  4L0U A;  4BVY B;  3PGT A;  1DBY A;  2L4Q A;  4YAV A;  2H73 A;  4RI6 A;  3TRQ A;  1XCC A;  4ACS A;  5H5Q A;  1K3Y A;  3EIN A;  5JCG A;  1QFN A;  4OCF A;  1V58 A;  3TB2 A;  1F3B A;  4OFM A;  4MJA A;  3ZRD A;  2C3Q A;  2P5R A;  1W89 A;  1WE0 A;  1WOU A;  1UN2 A;  3EYT A;  3IAM 2;  12GS A;  3M9K A;  2ALB A;  2HRA A;  3GKN A;  1YDK A;  3QAG A;  2C1Y A;  4K8M A;  4PXO A;  2XPE A;  1BG5 A;  3TDG A;  4MP4 A;  5ECI B;  5IMF A;  4MF5 A;  4HZ2 A;  4USS A;  2YZU A;  5D9X A;  5A4W A;  2HNL A;  1HYU A;  2PGT A;  4OCE A;  4HDE A;  1ON4 A;  1M3I A;  2IIY A;  3ZVJ D;  6GSS A;  5F0G A;  2XC2 A;  4ZBB A;  2FY6 A;  1CQG A;  1X9M B;  2FNO A;  3CSI A;  2L6C A;  5LD0 A;  2ON5 A;  3K8N A;  1ZMA A;  3EVI A;  2VO4 A;  4YKG A;  5C00 A;  3DD3 A;  5JWQ B;  4K7I A;  4K2D A;  5E59 A;  5ECR B;  4OMV A;  5CP1 A;  3VFI A;  2PWJ A;  3MAK A;  3P8W A;  4MZC A;  1U3I A;  3M8N A;  1VF4 A;  2YV7 A;  1MTC A;  1U3A A;  2DC5 A;  4ECI A;  6GSW A;  1PFO A;  1W4V A;  1G7E A;  3UAR A;  6GST A;  1OC3 A;  2MMA A;  5IM9 A;  4PNF A;  16GS A;  4HQZ A;  2FLS A;  2M46 A;  4V2L A;  4FYC A;  2H6Z A;  1PGT A;  1OAZ A;  1GSY A;  1TOF A;  4I8B A;  5EL8 A;  5ECP B;  1SD8 A;  3ZIJ A;  2R5G A;  3KTL A;  2KLX A;  3ERF A;  4XS4 A;  3ZFB A;  1PD2 1;  2JSZ A;  4XIH A;  3GX0 A;  3RPN A;  3C1R A;  4O32 A;  2L59 A;  1TK8 B;  3IA1 A;  2K9F A;  3EMX A;  1GTA A;  1PL1 A;  1WIK A;  2HSH A;  3SWL A;  4L0W A;  3G9B A;  5IQY A; 
#chains in the Genus database with same CATH homology
 2XHF A;  4D73 A;  1XFL A;  5ECM B;  4IKH A;  4O5U A;  2IL3 A;  4EIQ A;  3KJY A;  2XBQ A;  3TJJ A;  4IHU A;  3DVW A;  2R37 A;  3D5J A;  4XRA A;  4KAE A;  4AJ7 A;  5G30 A;  3DKS A;  4I97 A;  2KOK A;  3BBY A;  3ZZX A;  1HNA A;  1TI3 A;  2IN3 A;  4LA1 A;  2K6V A;  4O5R A;  1ZYP A;  3C1S A;  4O92 A;  4TRX A;  3V1W A;  1SK0 A;  2YJH A;  1V40 A;  3FZ4 A;  2WZ9 A;  4KUN A;  3D6I A;  1X5D A;  1YF0 A;  2CZ2 A;  3L0H A;  3VPT A;  2A2P A;  2EIO A;  1X5E A;  1WJK A;  4ZIL A;  3Q74 A;  1ML6 A;  4CY6 A;  1ZGN A;  4G2E A;  4F0C A;  5DAK B;  1GSD A;  5DCH A;  4WEY A;  2VUP A;  2H30 A;  2MMZ A;  2VOC A;  1THO A;  2OE3 A;  3HHV A;  3KTB A;  3CXG A;  2P0G A;  3UMA A;  1TK5 B;  1SKR B;  5GSS A;  2XPD A;  3ZML A;  4PNG A;  3MYD A;  2RII A;  1M9B A;  6GSY A;  1JLV A;  2HE3 A;  4HS1 A;  3WT1 A;  1ERW A;  4L8E A;  4IN0 A;  3DML A;  4IGJ A;  4QQ7 A;  2H75 A;  3L4N A;  4Q5R A;  3A2V A;  5F05 A;  3PIN A;  4K1F A;  2VCW A;  1K0D A;  2V6O A;  4MNN A;  1AXD A;  1ZOF A;  2H19 A;  2IMI A;  2H1D A;  1Z6N A;  1EEJ A;  3F3R A;  3Q19 A;  4X4J A;  2LJA A;  2DJ0 A;  3IV4 A;  1EEM A;  4EE0 A;  4GWR A;  5F8B A;  2IWT A;  3J7Y k;  2H0I A;  1A8L A;  1F37 A;  3ERG A;  1TKD B;  3O6T A;  2E0Q A;  3QAW A;  2L5O A;  1K0M A;  4MJB A;  2GTU A;  4V1A p;  1V98 A;  3KM6 A;  2FA4 A;  4LL1 B;  2WFC A;  5F07 A;  3WGE A;  2CVD A;  4MZW A;  5DAL B;  3GST A;  3TJF A;  1TRU A;  1H4O A;  3HKR A;  4KDY A;  11GS A;  5GAN D;  1LJR A;  1F6M C;  2OE0 A;  2DBC A;  1B9X C;  1Z6M A;  1R5A A;  2R6K A;  5ECH B;  2FWG A;  4NPB A;  3R3E A;  1TRW A;  2O87 A;  3A2X A;  4HEA 2;  1N8J A;  2KP2 A;  1E6B A;  2GQK A;  3DGQ A;  3LFL A;  3CSJ A;  3GX8 A;  4K7O A;  4G10 A;  2YWI A;  3UVH A;  1AAZ A;  5FHI A;  1SJ6 A;  4RQR A;  4LLR A;  4PUF C;  5ECN B;  2F3M A;  1TRV A;  3WD6 A;  2VCX A;  2JAC A;  1TJD A;  1HD2 A;  1TDI A;  3ME8 A;  1J9B A;  1GRX A;  3N5O A;  3EE2 A;  2HLS A;  2H6X A;  5EVO A;  4HJM A;  2DJK A;  4IS0 A;  4BL7 B;  3P90 A;  4PQH A;  1XWK A;  5D93 A;  4GF0 A;  1EOG A;  1QGV A;  3GUR A;  2FUG 2;  1FB0 A;  4HI7 A;  1OVN A;  2L6D A;  5D9T A;  5J9B A;  3QOU A;  3IBH A;  2CVB A;  5G2Z A;  2IPA A;  4MMM A;  4F9Z A;  4XS4 B;  4KND A;  4ZL8 A;  2C4J A;  1THX A;  4G9H A;  2VCV A;  4XS1 A;  4IBP A;  5J3R A;  2IMD A;  4J57 E;  2JSY A;  5ECQ B;  1V2A A;  2PVQ A;  2WJU A;  1DE1 A;  4MJC A;  2VLT A;  2DJ2 A;  4OD7 A;  4K0N A;  2H6Y A;  5ID2 B;  3FW2 A;  4MA9 A;  4D73 B;  2HZF A;  1H75 A;  3UJ1 A;  4G0I A;  2FWF A;  3EUR A;  3GL5 A;  5CRG A;  4K9Z A;  3VWV A;  4TXO B;  4X43 A;  3GKM A;  3LSZ A;  5KN1 A;  3A2W A;  4BWS A;  1SKS B;  4NWY A;  4MH2 A;  4GQF A;  1JZO A;  3LXT A;  4DSS B;  4J56 E;  1SKW B;  3MNG A;  3L78 A;  1G0T A;  3FEU A;  3GSS A;  2QA2 A;  4NV5 A;  4OO5 A;  3MDK A;  3C71 A;  3KP8 A;  1URM A;  2B3S A;  1OC9 B;  2K8S A;  3N9J A;  1HNC A;  4TVE A;  2A4H A;  3WGX A;  2CQ9 A;  1K0C A;  3TKS C;  4ZB6 A;  1KBN A;  3HY2 A;  3IC8 A;  1EV4 A;  4N0V A;  4AJ8 A;  3HVS A;  5DJM A;  1B48 A;  3DXB A;  1GH2 A;  1VRS D;  1XW9 A;  1T1V A;  1BQ7 A;  2DKI A;  2VL2 C;  1EGR A;  3QMX A;  4NAX A;  3F4T A;  1XVQ A;  3FMW A;  1M2A A;  3KIJ A;  4AJ6 A;  2H76 A;  1GSS A;  1QQ2 A;  4OWY A;  6GSU A;  1A0F A;  4MPG A;  2AB6 A;  4XRD A;  2HZE B;  4DEJ A;  1YQ1 A;  2NVL A;  3QFB C;  4J2F A;  3FK8 A;  4FQU A;  2B5Y A;  5KOW A;  1U88 A;  2QKE A;  5D9V A;  5CYY A;  3BOA A;  4TN8 A;  2GSQ A;  2YCD A;  3UBL A;  1YZX A;  3BJ5 A;  5GST A;  3G7I A;  2B7J A;  4KGI A;  3BCI A;  3IHG A;  3RDW A;  3E0U A;  1VF2 A;  1R4W A;  2H1A A;  5HR3 A;  2OBI A;  1GUL A;  4TR1 A;  1PKW A;  1GWC A;  3H1N A;  3Q6O A;  4ZXG A;  5FWG A;  1F3A A;  4NHW A;  2WGR A;  5IMV A;  2HRN A;  3LJR A;  1EOH A;  2DLX A;  3TRP A;  5D96 A;  2F51 A;  1MDJ A;  4ML1 A;  1JHB A;  2DIY A;  3I69 A;  2TRC P;  4Q5N A;  5E4W A;  5HR1 A;  2X64 A;  2X8H A;  1GP1 A;  3GTU A;  2KUC A;  5DQS A;  4BVX B;  3KMN A;  1QMV A;  2GT6 A;  1O81 A;  2JZT A;  2K18 A;  1USB A;  2B1K A;  2VAF A;  1Q98 A;  3P7X A;  2C3N A;  4WF4 A;  2O85 A;  19GS A;  8GSS A;  2NBS A;  1SK1 A;  5J41 A;  2AAW A;  2FA8 A;  4H86 A;  2A4V A;  1TRS A;  3L9V A;  5GZZ B;  2LKU A;  3UL3 A;  4ZL7 A;  2E7P A;  4A5P A;  4WET A;  2EIR A;  1Z3E A;  1IYH A;  1XIY A;  1JLW A;  1FW1 A;  3TKS E;  2GLR A;  1AQX A;  1Z7R A;  2HXK A;  2HSY A;  3RPP A;  4ULX A;  3LYK A;  3FZ5 A;  1AQW A;  5JCU A;  2L5L A;  2OAC A;  4ISD A;  3KH9 A;  4FYB A;  5IMC A;  3EMP A;  2V32 A;  3VI7 A;  4O7H A;  2HYX A;  3HVX A;  3CTF A;  2JZS A;  1PX6 A;  2HRK A;  6GSX A;  3A5I A;  3C7M A;  1DUG A;  1S3C A;  4TR4 A;  3GV1 A;  2O8V B;  4ICY A;  2VIM A;  3F6F A;  4TKY A;  1PMT A;  1A23 A;  1JFU A;  1GL8 A;  2MYG A;  5IMA A;  2PER A;  1YEP A;  1A0R P;  4MZB A;  4YKF A;  3LG6 A;  2LV3 A;  4F0B A;  1GSE A;  1XOA A;  5B8B A;  4POB A;  3UIW A;  1I5G A;  3QDN A;  4OFN A;  4PQI A;  3W8S A;  4IVF A;  5B6M A;  2CVK A;  3HZ8 A;  3FZ9 A;  3J7Y b;  1DE2 A;  4WKW A;  4JR4 A;  4EL1 A;  2DJ3 A;  2VLV A;  4ECJ A;  3VUR A;  2GZP A;  5CRE A;  4NXI A;  2LJK A;  3FR3 A;  2WCI A;  4MK3 A;  2LNS A;  2C0D A;  4EF0 A;  4BWQ A;  3M3M A;  3LGC A;  4GRF A;  1A8Y A;  4I6X A;  14GS A;  2ZNM A;  3LWA A;  1UC7 A;  3F63 A;  5B7C A;  4EUY A;  2IMK A;  4JZQ A;  1TU7 A;  1SJZ A;  1PKZ A;  3FYG A;  4I2U A;  2OJL A;  1F2E A;  2G2Q A;  4NV2 A;  4X0X A;  4I5Q A;  4JU5 A;  1PQN A;  3ZFL A;  3MWH A;  2YJ7 A;  2H74 A;  5IIZ A;  2H72 A;  5DCG A;  1ZYE A;  2KHP A;  1X5C A;  4G19 A;  3G7J A;  2P31 A;  4IQ1 A;  5BMU A;  3QPM A;  6GSV A;  5A4U A;  5IMZ A;  5INY A;  2DMM A;  2RUE A;  2FGX A;  4JBB A;  2PMT A;  4K6X A;  2PU9 C;  4XS6 A;  1Y25 A;  3M1G A;  2IJY A;  4KX4 A;  2GZZ A;  4EC0 A;  5LNK e;  1MD3 A;  2MZC A;  1J08 A;  1RQM A;  2VL3 A;  5IPG A;  2V6K A;  4L5O A;  5KEJ A;  2LRC A;  3HDC A;  4HUA A;  5AIX A;  4XCS A;  2GZY A;  1NM3 A;  3ZL5 A;  1K0O A;  3E9J B;  1EGO A;  3TCO A;  2AYT A;  3FHK A;  1KEB A;  2CT6 A;  1C72 A;  1M2B A;  1VF1 A;  2E2G A;  4KCE A;  2CX4 A;  3DIE A;  3WYW A;  5IPH A;  4WR5 A;  3FR9 A;  2VL2 A;  3KZQ A;  4I2T A;  1K3O A;  4JRR A;  5AIV A;  3EC3 A;  2JU5 A;  1FB6 A;  2F8A A;  4RUV A;  3ME7 A;  3EWL A;  3EU4 A;  3D4M A;  4LMW A;  5AN1 A;  1BED A;  2LNT A;  1QUW A;  5CNW A;  4AGS A;  13GS A;  4N0Z A;  4RI7 A;  1YKC A;  3GH9 A;  5KN0 A;  2LQO A;  3NOF A;  3IAS 2;  1PRX A;  3CRU A;  1BYE A;  5B8A A;  1N2A A;  1YY7 A;  2GT5 A;  3IDV A;  3WT2 A;  2QSI A;  3LYP A;  2FWH A;  1NW2 A;  4K7N A;  4G0K A;  2A2R A;  3LW9 A;  3IK9 A;  3DWV A;  4DSQ A;  5KOX A;  3UAP A;  4MF6 A;  3HD5 A;  2GS3 A;  1ERT A;  5ECO B;  4POK A;  1FOH A;  3TOT A;  10GS A;  2LRT A;  4IW9 A;  3IRA A;  5G1L A;  4MDC A;  2GGT A;  3MIX A;  2IFQ A;  4Z2U A;  1TP9 A;  1MEK A;  5AGY A;  3F4S A;  2QGV A;  3BCK A;  3HVV A;  1O7U A;  3TKP A;  3ZTL A;  5HFG A;  2VCQ A;  3HJM A;  3E3E A;  3OR5 A;  1R5P A;  1WRY A;  4YH2 A;  1FHE A;  2CZ3 A;  2MBS A;  1M7T A;  5DDL A;  1SK2 A;  3TGZ A;  3H8Q A;  4BPY A;  5IMD A;  2I4A A;  3TUE A;  2RM6 A;  1FAA A;  4MCU A;  2YWN A;  3GKK A;  5DVB A;  2QA1 A;  1BJX A;  2FHE A;  1VGL A;  22GS A;  4KF9 A;  3Q18 A;  2FCH A;  5LCZ A;  2XBI A;  1J0F A;  1T00 A;  4Q5Q A;  4V1A g;  1Z7P A;  2GQM A;  2BJX A;  4G0L A;  2OE1 A;  1MD4 A;  1DSB A;  2HRF A;  5HR2 A;  2YV9 A;  4NMU A;  3UBK A;  2KP1 A;  4GQC A;  5L71 A;  2O89 A;  3VK9 A;  3EU3 A;  2WS2 A;  1LU4 A;  4TW5 A;  1QXH A;  4QL7 A;  3IPZ A;  4FYU A;  3VWU A;  3F3Q A;  3RBT A;  1G7O A;  4Q5F A;  4LMV A;  3VWX A;  2IME A;  1GUK A;  3FZA A;  4IP6 A;  4YQV A;  2C0F A;  1KTE A;  2P5Q A;  5EY6 A;  1SL0 B;  2X49 A;  1PSQ A;  3D0Z A;  2N5B A;  4JR6 A;  4TR0 A;  5GAP D;  3CSH A;  5ECK B;  4POM A;  3M0F A;  1A24 A;  4ID0 A;  3IHQ A;  3FR6 A;  2C3T A;  2DSA A;  2VCT A;  3ED3 A;  1O8X A;  1GSU A;  4X1U A;  1FOV A;  1V57 A;  4K5R A;  3H79 A;  5DAK A;  3CBU A;  1GTB A;  1SU9 A;  1B4Q A;  18GS A;  2HI7 A;  1EP8 A;  3IR4 A;  1XW6 A;  2C0E A;  1UVZ A;  4HZ4 A;  1B8X A;  4V2N A;  5ECL B;  4IQA A;  4ZBA A;  3RHB A;  1AIU A;  1TW9 A;  2F8F A;  4YQM A;  5DQY A;  2NTO A;  1ZYQ B;  2AUV A;  1X0R A;  2LEG A;  3GL3 A;  4MPF A;  4EIP A;  2PUK C;  4CDO A;  3KMO A;  1Z5Y E;  3ISO A;  2YAN A;  2X8C A;  4F03 A;  1XOB A;  5HR0 A;  3ZIT A;  4KB3 A;  2B1L A;  5ELA A;  1T7P B;  1GNW A;  2DJ1 A;  3AY8 A;  2VM2 A;  2I9H A;  3FRC A;  3KD0 A;  3IXR A;  1SYR A;  2GST A;  2CV4 A;  2TIR A;  3ERW A;  2M80 A;  1OYJ A;  4HU7 A;  1XZO A;  3CTG A;  2R0P A;  1GLP A;  3DVX A;  2UZ8 A;  4DVC A;  2I81 A;  4HU9 A;  4L5L A;  4GLT A;  2AV4 A;  1QK8 A;  4EO3 A;  2QC7 A;  3UEM A;  4XTS A;  5CO3 A;  1HNB A;  2H1B A;  2ON7 A;  1V9W A;  2B5X A;  1FG4 A;  4PUR A;  3VWW A;  2ES7 A;  3KXO A;  5DAL A;  4Z2T A;  2C0G A;  2YPM A;  4LL4 B;  5J4U A;  1B9Y C;  2B7K A;  4IJ3 A;  5F06 A;  2A2S A;  3QAV A;  2OKA A;  5J5N A;  3UVT A;  1WMJ A;  1NSW A;  1TTZ A;  2OBK A;  3HJO A;  1PA3 A;  1RW1 A;  2WDU A;  3GMF A;  2VM1 A;  2IFQ B;  2CX3 A;  3LXZ A;  2AJQ B;  4PX1 A;  2L4C A;  4HOJ A;  2YZH A;  3HYP A;  1T8E B;  5DBQ A;  3D21 A;  1GUH A;  1AW9 A;  3SBC A;  4MF7 A;  1XXU A;  3I6A A;  5FT3 A;  2R2J A;  2VCZ A;  1A2M A;  1RK4 A;  2H0G A;  5ENU A;  4Z7X A;  3ZLP A;  1G6W A;  2AHE A;  3F8U A;  1VF3 A;  4KH7 A;  3RHC A;  2PVO C;  1R7H A;  3F9U A;  3IK7 A;  3ZIV A;  1F9M A;  4BL7 A;  4DSR A;  5D8I A;  4PUA A;  3TRX A;  3BD2 A;  4EKZ A;  3JCM L;  4PGT A;  1E2Y A;  1SEN A;  4GSN A;  3U6V A;  3TKQ A;  3HJP A;  3VI5 A;  4FIW A;  1AC1 A;  1GSQ A;  17GS A;  1Z9H A;  3DYR A;  2R3X A;  1SJI A;  5JWO B;  2J9H A;  4ECC A;  1SYX A;  4XHM A;  5AIS A;  1SL2 B;  1WWJ A;  2B5E A;  4EXJ A;  3APO A;  3EPT A;  1X9S B;  2EC4 A;  4HQS A;  3D22 A;  2F9S A;  4CHS A;  3TOU A;  1XWC A;  5ID2 A;  3RAZ A;  2CA8 A;  1G6Y A;  3F4R A;  3GUS A;  1GTU A;  3S9F A;  2HFD A;  1OKD A;  1IYI A;  2N5F A;  5CRH A;  3H4K A;  1Q4J A;  2DML A;  1LBK A;  5IO2 A;  2V2G A;  4TXO A;  5JWR B;  3HCZ A;  4YAP A;  1O6J A;  4N11 A;  3GNJ A;  5BRT A;  3VPQ A;  1M9A A;  1U87 A;  4KE3 A;  1JZR A;  1EP7 A;  1I9D A;  3KGK A;  3GHA A;  3QFA C;  1OE8 A;  2FWE A;  4DSS A;  1Y6E A;  5CAX A;  1YEX A;  2MMO A;  3I43 A;  1ZZY A;  3D4T A;  4PQ1 A;  5DJL A;  1KNG A;  2EIQ A;  4ECB A;  2O7K A;  2C80 A;  3IOS A;  3UOM A;  3TJK A;  1AQV A;  2B6M A;  5B6N A;  1ZYN A;  1OC9 A;  4ZB9 A;  3ZMK A;  4KW6 A;  1O73 A;  3A3T A;  2DJJ A;  3FY7 A;  3GFK A;  5KN3 A;  2YNX A;  4K0G A;  3NIV A;  1ZL9 A;  1EZK A;  1WPI A;  1PX7 A;  3TJG A;  3F6D A;  2H8L A;  5IOX A;  3GIX A;  1MDI A;  4OO4 A;  1OKT A;  3TJB A;  2YWO A;  4TOP A;  1MDK A;  4K2X A;  3ZVJ A;  2R0C A;  4NHZ A;  1JZD A;  3TKS A;  4WBR D;  2HZE A;  2JL4 A;  2VL9 A;  5HFI A;  5ELG A;  3HXS A;  1ERU A;  4CY8 A;  1OC8 A;  3HZ4 A;  2LST A;  7GSS A;  2BTO T;  3PH9 A;  2LUS A;  1O85 A;  4PTS A;  2BMX A;  3IC4 A;  3O3T A;  1M99 A;  1GUM A;  1YKA A;  4KSO A;  4ZL9 A;  1SL1 B;  3FKF A;  4TR1 B;  2PBJ A;  5ABR A;  2PN8 A;  3US3 A;  3APS A;  3GYK A;  2LJR A;  4BVY A;  3G7Y A;  3C8E A;  4GTU A;  2I1U A;  2C8U A;  1EWX A;  5HFK A;  4N30 A;  1S3D A;  4ZBD A;  2ZCT A;  2LTK A;  2HT9 A;  2H01 A;  1ABA A;  2VD0 A;  1ILO A;  1WP0 A;  1YJ6 A;  2JAD A;  1NHY A;  1A2J A;  2M72 A;  2X8G A;  3GTU B;  4GCI A;  2LS5 A;  3A5W A;  2YWM A;  1XW5 A;  1JZW A;  1XBS A;  3F0I A;  3APQ A;  5JCW A;  3LQ7 A;  4WBJ A;  4BVX A;  5COH A;  1XWG A;  3W6G A;  3DRN A;  3PR8 A;  3DEX A;  4BA7 A;  1M2D A;  4KSM A;  2OAD A;  1OE7 A;  3W8J A;  1K0A A;  4KCA A;  4MH3 A;  4ZB8 A;  3L9S A;  4E8E A;  5G31 A;  2TRX A;  3QCP A;  2H70 A;  3CYN A;  5HQP A;  4MAB A;  4P3Y B;  2K8V A;  2YN1 A;  5CRD A;  5G1K A;  4OFT A;  2MMN A;  2IMF A;  1PN9 A;  1ERV A;  2H0H A;  2GQL A;  1HQO A;  3CMI A;  3KP9 A;  4Z2R A;  4KDU A;  4JED A;  5D9W A;  4POL A;  3WGD A;  3GKX A;  20GS A;  1T4Z A;  2ZUP A;  4KDX A;  2H1G A;  4IEL A;  2OA7 A;  5IOW A;  2WB9 A;  3GA4 A;  2GSS A;  1BX9 A;  4GXZ A;  4IP1 A;  1ST9 A;  1SD9 A;  2RLI A;  4EDY A;  5A5K A;  2E2M A;  4MJE A;  1FVK A;  1M0U A;  1XWA A;  3KEB A;  1K0N A;  2VD1 A;  5J9C A;  2D2Z A;  2X99 A;  2PPT A;  3QR6 A;  2G0F A;  3H93 A;  5C04 A;  4HJ2 A;  3PPU A;  4QL9 A;  5H5S A;  1XWB A;  2LRN A;  4O5Q A;  5EPF A;  3GN3 A;  5A4V A;  5CRW A;  4K5S A;  5KN2 A;  3GRX A;  1TI1 A;  3ZYW A;  4YQU A;  1XVW A;  1K3L A;  4GSS A;  4GST A;  2REM A;  1GTI A;  1CQH A;  2YOI A;  4TR3 A;  3VLN A;  4CW9 A;  3IE3 A;  1BAY A;  5IO0 A;  2I3Y A;  4WR4 A;  4EVM A;  3I9V 2;  3LEF A;  1FO5 A;  2VLU A;  5D73 A;  2CAQ A;  2DKH A;  1S3A A;  3ZRE A;  1GNE A;  1UA5 A;  1O8W A;  3MSZ A;  1GSF A;  2HSM A;  2JZR A;  1B4P A;  2WUL A;  4ILF A;  2V41 A;  3KH7 A;  1U6T A;  1ACV A;  1AUC A;  5G5F A;  4F82 A;  1ZCP A;  2NPB A;  3O76 A;  4ML6 A;  3TKR A;  2H66 A;  2RM5 A;  4N10 A;  5ECS A;  2YP6 A;  3CRT A;  3NZN A;  4F2I A;  1TXX A;  4MLY A;  2WRT A;  2H71 A;  3P2A A;  1TK0 B;  4EDZ A;  3C73 A;  4V2M A;  2FD3 A;  4TXV A;  2CAI A;  3GH6 A;  4AF2 A;  2L57 A;  2X4A A;  2N5A A;  2MBT A;  4IJI A;  2J23 A;  1GLQ A;  4FO5 A;  2RUF A;  2V1M A;  1R26 A;  3L9U A;  3R2Q A;  2Z9S A;  5G5E A;  1K0B A;  2GSR A;  4FH8 A;  4WXT A;  1PN0 A;  4WF5 A;  2LQQ A;  1NHO A;  1T3B A;  4RQX A;  1X9W B;  2DIZ A;  1YF1 A;  1T4Y A;  4ZIJ A;  3KCM A;  4JE1 A;  3LOR A;  5H5R A;  3M9J A;  3HA9 A;  3QD9 A;  4E8H A;  2GDR A;  1TU8 A;  1EV9 A;  2NDO A;  1A2L A;  3U5R E;  2GVP A;  1XPV A;  2R0G A;  9GSS A;  2R4V A;  1PL2 A;  4KA0 A;  1FVJ A;  4L0U A;  4BVY B;  3PGT A;  1DBY A;  2L4Q A;  4YAV A;  2H73 A;  4RI6 A;  3TRQ A;  1XCC A;  4ACS A;  5H5Q A;  1K3Y A;  3EIN A;  5JCG A;  1QFN A;  4OCF A;  1V58 A;  3TB2 A;  1F3B A;  4OFM A;  4MJA A;  3ZRD A;  2C3Q A;  2P5R A;  1W89 A;  1WE0 A;  1WOU A;  1UN2 A;  3EYT A;  3IAM 2;  12GS A;  3M9K A;  2ALB A;  2HRA A;  3GKN A;  1YDK A;  3QAG A;  2C1Y A;  4K8M A;  4PXO A;  2XPE A;  1BG5 A;  3TDG A;  4MP4 A;  5ECI B;  5IMF A;  4MF5 A;  4HZ2 A;  4USS A;  2YZU A;  5D9X A;  5A4W A;  2HNL A;  1HYU A;  2PGT A;  4OCE A;  4HDE A;  1ON4 A;  2IIY A;  3ZVJ D;  6GSS A;  5F0G A;  2XC2 A;  4ZBB A;  2FY6 A;  1CQG A;  1X9M B;  2FNO A;  3CSI A;  2L6C A;  5LD0 A;  2ON5 A;  3K8N A;  1ZMA A;  3EVI A;  2VO4 A;  4YKG A;  5C00 A;  3DD3 A;  5JWQ B;  4K7I A;  4K2D A;  5E59 A;  5ECR B;  4OMV A;  5CP1 A;  3VFI A;  2PWJ A;  3MAK A;  3P8W A;  4MZC A;  1U3I A;  3M8N A;  1VF4 A;  2YV7 A;  1MTC A;  1U3A A;  2DC5 A;  4ECI A;  6GSW A;  1W4V A;  1G7E A;  3UAR A;  6GST A;  1OC3 A;  2MMA A;  5IM9 A;  4PNF A;  16GS A;  4HQZ A;  2FLS A;  2M46 A;  4V2L A;  4FYC A;  2H6Z A;  1PGT A;  1OAZ A;  1GSY A;  1TOF A;  4I8B A;  5EL8 A;  5ECP B;  1SD8 A;  3ZIJ A;  2R5G A;  3KTL A;  2KLX A;  3ERF A;  4XS4 A;  3ZFB A;  1PD2 1;  2JSZ A;  4XIH A;  3GX0 A;  3RPN A;  3C1R A;  4O32 A;  2L59 A;  1TK8 B;  3IA1 A;  2K9F A;  3EMX A;  1GTA A;  1PL1 A;  1WIK A;  2HSH A;  3SWL A;  4L0W A;  3G9B A;  5IQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...