3E3TA

Structure of porcine pancreatic elastase with the magic triangle i3c
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A magic triangle for experimental phasing of macromolecules
pubmed doi rcsb
molecule keywords Elastase-1
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA01
2AH4X 4HI3A 1G3DA 1KXAA 1G3BA 2BD3A 3SU1A 3IG6B 1QCPA 4ZROA 4MPUA 2PWXA 5C1XA 3RXUA 1AFEH 1J16A 2SNVA 4K5ZA 1P2QA 3ZZ4A 5HXFA 2G5VA 3E0PB 1DXPA 3NPSA 3BIVH 4Y76A 4WXVA 2KAIA 1P2JA 1GHAF 1T4VH 3RXLA 1SLVB 1TX6A 1P09A 4GAWA 3QWCH 5ESBA 3A81A 5C5OA 5A09A 2K1QA 2Z9JA 4ZHLU 1SBWA 1FUJA 5E8EH 1UTQA 3HKIB 4AFZA 2SGDE 1Z1IA 1TRMA 3BTME 7GCHF 2FOCA 4I33A 2BY6X 1CBWB 4O3UA 1Q2WA 3SU3A 4AB9A 1O38A 1SPJA 3LGVA 4NG9H 1RTFB 2GCTC 3QTVH 3U8RH 1MBMA 3MO3A 1FY5A 2ZDMA 1Y3XA 5JBTA 1E0FD 3V0XA 4ZKRU 3DFLA 3MH7A 1TMBH 1SR5C 4AN7A 2J9NA 4FUDA 3SV8A 4UONA 2Z3EA 3H7TA 1Z8JB 3SGBE 2O8UA 4BAMB 1A0HB 2D8WA 1F7ZA 5DPAA 1GVKB 1P0SH 1AKSB 1TPPA 2STAE 1SGIB 3K6YA 1MUEB 4TWYA 2OC0A 3T29A 3A7XA 1D3TB 1FY1A 1HAVA 1XUIA 2JH0D 1CGIE 3DT0H 4I32A 3UTUH 4Y11E 1QNJA 1O37A 2VWLA 3LGWA 1A0LA 1H9IE 3TH3H 2W7UA 4Y8XA 1O3BA 1HFDA 2J34A 3W94A 1CT2E 2ZFRH 2OQ5A 5SGAE 2H9HA 1EPTA 4IC5A 3TGIE 2ESTE 3TJVA 2P16A 1Y5UT 1A0JA 1LHFH 1WUNH 2VIQA 3HK6B 2ALPA 2FWWA 1QJ7B 3TJOA 1UO6A 2GZ8A 2PKSB 4B2BA 1IAUA 1TQ7B 3CS7A 4WJG2 1NT1A 1O2JA 1GI4A 2BD8A 3URCA 5C20A 5A0CA 2OBQA 1H8DH 2FO9A 3MFJA 3GDSA 4X2XA 3RXQA 1O35A 1O30A 4UFDH 1C5TA 1AY6H 1F0UA 5FPSA 1GHAG 1QHRB 1BBRE 1D4PB 2GMTC 3FVFB 3SNAA 1C2FA 1QIXB 2NU3E 1LVOA 1EP5A 4WH6A 4Y7BA 1HJ9A 1ZTJA 1TPOA 1O2SA 1ZYOA 7GCHG 1TPSA 3GYLB 4WF8A 1OKXA 2PHBA 1QR3E 1L2EA 2A45B 4ABFA 1XUGA 4YZUA 5EW1H 4NZLA 1W7XH 2BVRH 1PJPA 3OX7U 2OC8A 2P8OB 1IQEA 2THFB 1DLEA 8LPRA 2JKHA 2OUAA 1ANDA 2ZP0H 2OINA 2OBOA 1BUIA 2ZTZA 3W95A 4CRDA 2J38A 4WY3A 3BTEE 1GJBB 1MD7A 4H6SB 5FCRA 1X7AC 3Q3KA 2XBVA 3TK5A 4FXGH 2PKAA 1MQ6A 4ABHA 1YLCA 3TITA 3V12A 1UVTH 1YPHE 2BOHB 1C5SA 1TA2A 2TIOA 1SQTA 3LU9B 4YT6H 1K2I1 6GCHF 1QBOA 5JYIA 5F8XA 1QBVH 1GG6B 3GISB 2CXVA 1DITH 1P2MA 1C5OH 4RSPA 2VIOA 1EAUA 1T32A 4X6OA 2OP9A 4A6LA 3HKJB 1XXDA 4AX9H 1XKBC 1P2KA 3RMMH 3SUFA 1TRYA 1K21H 5JPMH 3V7TA 2AGGX 3S7HB 1UTKA 2PTCE 3KHVA 3SV2H 3SW2B 4HZHA 1ESTA 2ZU3A 2GCHF 1BTWA 2W5EA 1FQ3A 3PLPA 4JZFH 3BTQE 1N8OC 2PSXA 1TOCB 2Y80A 8ESTE 4J2YB 1G37A 1GI0A 2FOGA 1GJ5H 1WYKA 2BXTH 4DG4A 1FJSA 3SHAH 3UPEA 1C5ZB 4BAKB 5IDKA 1O5CB 2VB0A 1J17T 3N7OA 4JYVH 4X0WU 1O3OA 3A7VA 1BMMH 3MI4A 1P9UA 1PPEE 4U2WA 4B73A 1OWJA 1SOTA 4X2VA 2WPIS 1OXGA 3RXMA 3TH2H 1DX5M 1A3EH 4FU9A 4AFUA 1ORFA 2PLXA 1BOQA 4TPYA 1TGTA 1TFXA 1MD8A 1HAGE 1TQ0B 1W0YH 5JBBS 2OTVA 3KGPA 2BQ7B 4MQAA 1ARBA 5FPYA 1HLTH 2HVXA 4INKA 1ANBA 2B8OH 3LGTA 2BX4A 3A89A 1S82A 3AW1A 3BN9A 3SBKA 1ESBA 1UJ1A 3SUGA 1DWBH 1O2MA 2GX4A 4I7YH 1MTSA 2CHAC 5DKMA 3TNSA 2RDLA 1O2ZA 1GBDA 2GZ7A 4BAQB 4AZ2B 1OWHA 3GY3A 1BZXE 4YOJA 1KDQB 3OSYA 2TGTA 1ZPCA 2ZA5A 1E37B 4X2YA 1C5UA 1K1PA 5FPTA 3OU0A 3E6PH 2H5DA 4WMDA 2QA9E 1O2VA 1ZHMA 4NA8A 4FUCA 2CV3A 3ATWA 1KIGH 2ZKSA 3BTDE 5EXNA 1S0RA 2B5TB 6GCHG 3U1JB 4ZUHA 4K3JA 1MKWH 1AKSA 5LPEA 1LKBA 4CR9A 1FY8E 2VGCB 2R2WU 2QN5T 2A5IA 4O3TA 2D2DA 3KN2A 4JK6A 1DOJA 1NZQH 1O2QA 3MOCA 1HDTH 3SI4H 4J1YA 1TX7A 2ZHDA 4FVBA 4X2WA 2A4GA 2P59A 1O2YA 2ZQ1A 3PROA 3ZVAA 3SU0A 3TIUA 1G30B 2B0FA 2ZGXH 1AVXA 1VJAU 2GCHG 4K1SA 1DY9A 3MU8A 3SJ8A 1HB0B 4WXIA 3ATLA 5E2OA 2PSYA 1QRXA 1PQ8A 3UUZA 4E7NA 2ASUB 1ELAA 3NUMA 2CN0H 2BLOA 2GT8A 1N1LA 2HLCA 1GI7B 2GV6A 1O3PB 4BAHB 1P04A 3ZZ6A 1TX8A 1CA0C 3WY8A 3SN8A 4CHAB 1FMGA 1KYNA 1Z8IB 2ZPQA 2OC1A 4Q7ZA 1UK4A 1DUAA 5A0AE 5FXLA 2ZEBA 2PGQB 1AU8A 1J14A 4XSKU 1LO6A 1P05A 3SJ9A 1C1VH 4D8NA 2AGIX 2EI6A 1NN6A 3LH3A 4WWYA 1W14U 3VGCC 2HNTC 1HAYB 2UWOA 3UREA 1SVPA 1O5EH 1D6WA 2UUFB 1VCQA 1MTWA 5AHGH 2YNAA 4KELA 4ZXYH 1IQFA 4E7RG 1FY4A 2FESH 3ATKA 2Z7FE 4IBLH 3LH1A 3RC5A 3S9BA 4O9VA 2F9UA 2C8ZB 1BITA 1GCDA 1MH0A 1Z6JH 2B7DH 3KCGH 1L1NA 5DP4A 4UEHH 3ZV9A 3F9FA 4DIIH 3S7KB 1TWXB 4NIXA 5LGOA 3P17H 3F68H 5DO4H 4OGXA 4XBBA 1IHTH 4I31A 3BTKE 5TJXA 2AMPA 4ABGA 2A7JA 2PW8H 4ZKNU 1S0QA 2XC0A 3T62A 3UY9A 1KSNA 1TNGA 3AVZA 3SJIA 1ZSLA 3P95A 3FZDA 1ZTKA 1GBJA 3QO6A 1YYY1 2AFQB 2O8TA 1O3JA 1RTLA 2ZDVH 1XUKA 1WQVH 1LHGH 2XBXA 4CR5A 3MNBA 1SGPE 1PFXC 2SFAA 2ZFTA 2QAAA 2A4OA 2YNBA 5T6GA 2G81E 1TONA 4NA7A 2AEIH 1OP0A 1XMNB 6CHAC 1ELFA 4ZKSU 3PYHA 1HAIH 1GGDC 1SGFA 4GVUA 4KTCA 3L33A 1TMTH 5AF9H 1ZMNA 3SNDA 1C2EA 1EX3A 1RGQA 4D76A 2AIPA 4JZDH 5FX6A 3ZVBA 1WSSH 4ZMAH 3LIWA 3LT3A 2ZZUH 1VCPA 1VR1H 5CHAC 1V2WT 1GCTB 1FPHH 3ZZ8A 3MYWA 3S9AA 1ACBE 2ZDLA 1L4ZA 2XXLA 3RXAA 1QURH 1MTNB 2FOEA 4FUGA 4MVNA 3A88A 2A1DB 1NFWA 1CT4E 1UVUH 1TNKA 1C4Y2 2QGRA 3P8NA 1EKBB 1C1WH 2TBSA 3HK3B 1C2MA 4X1RU 5FBIA 3Q00A 3BF6H 2FEQH 4AFSA 4MNVA 2ZFSA 3BEFB 1J15A 1AB9B 1EOLA 1PQ7A 1HYLA 1AD8H 2R3UA 4DT7B 1UCYH 3VXFH 3ATMA 3PO1C 1O5GH 2A4RA 1GMDF 4Y71A 3MHWU 1GJ9B 4BTIB 1TNJA 3P8GA 4DIHH 4TPIZ 1DWDH 1KDQA 2Q6FA 2P95A 1TE0A 5E2PA 3K65B 1AZZA 4K8BA 3RXOA 5E0JA 3T26A 1GI8B 1ZSJA 1GHXH 2BMGB 1AFQB 1GI1A 2A0QB 3EA9A 2P3UB 5GJ4B 1AWHB 1GI2A 2C8WB 2VWOA 2XWBI 1A7SA 5FBEA 1KY9A 1XUJA 1EAIA 1Y3YA 1V2VT 3L6PA 5EU8A 2UWPA 1O5BB 1NRQH 3RU4T 1ZRBA 4JK5A 2VWNA 5C2ZA 1DS2E 1N6XA 5E0GA 1OYQA 1ARCA 4VGCB 2ODQA 4K8YA 4IW4E 1EOJA 3ZVGA 1NY22 1RIWB 1SLWB 1HXFH 2WYGA 3ZZ5A 1HAPH 1C5QA 4B76A 3ELAH 3RM2H 1MU6B 1LHEH 1BMAA 3ITIA 3UR6A 2O9QA 4Z0KA 1YPHC 2A2QH 3SQEE 1O36A 3F9GA 2XNIA 1GI3A 2HNTE 4X1QU 1L4DA 5JB9S 2R3YA 1W7GH 1VZQH 1YKTA 3Q3XA 1AMHA 1P8VC 3A7YA 3A8BA 4YLQH 4A7IB 3UQVA 1BJUA 2Y5GA 4ISIH 1THSH 2BZAA 2Z3DA 3RC4A 1UK2A 2AIQA 1JMOH 4AYYB 1ETSH 1AUJA 2CGAA 1GI6A 1UTLM 2FS8A 4CH2B 1TLDA 3UR9A 2HOBA 1GHWH 3BG4C 2R9PA 2FI4E 3RXFA 4HFPB 1C1PA 4D7GA 2BDBA 4JCNA 4K2YA 4X8TH 1UTPA 2JETC 3C27B 3M7TA 4MNWA 2Q1JA 1NFUA 1FIWA 2FXRA 1ZHPA 3KF2A 3U8OH 1NC6A 1GMDG 3OTJE 3ZVCA 3U1IB 1Z8GA 1P2NA 4Q80A 5EQSA 1C1OA 2ZQ2A 5ABWA 4X1SU 4UFGH 1UTNA 2PTNA 3MWIU 3UWIA 1U6QA 1VGCB 5DP3A 3SI3H 1K28D 3PM3A 5L2ZH 4DJZB 2VU8E 3QGJA 4NIVA 4X6PA 1QFKH 1A2CH 5EQQA 1O2HA 3GY7A 3P8FA 2BDHA 5G4BA 3MNSA 3SU6A 2FPZA 1GMCF 3FANA 2C8YB 2BVSH 4B2CA 2G55A 2UUKB 1AHTH 2JH5D 3MH6A 1G9IE 4UFEH 1C1RA 1S85A 5FAHA 1KXFA 1THRH 2ILNA 1JRTA 6LPRA 2ZHEH 1HCGA 1TGSZ 3PMAB 4X8VH 1SFIA 2BYAX 2BTCE 1A46H 1SL3A 4B71A 1V2OT 4DURA 1PYTC 3UNQA 3EE0B 3K2UA 4CBOA 2BVXH 2GZ9A 1K1OA 1DSTA 1QB1A 3H7OA 1K1MA 3LGYA 4Q7YA 1S5SA 5GPIB 3EYDA 2ODPA 1TBZH 2UWLA 1OYTH 1BQYA 1UVSH 1O5AB 2QIQA 1MTUA 2ANKH 1PQ5A 3ATIA 2VH0A 4GCHF 2FTLE 3S69A 2OD3B 1CHOF 1RS0A 4XDEA 3ZVEA 1OWDA 2XC4A 2ZGJA 3A84A 1OPHB 1HGTH 1F0SA 3GCHB 1LPZB 1EPTC 4A1VA 4NCYA 3SJOA 1YPKH 4OS4A 4O03A 1OOKB 7KMEH 3GY6A 5JBAS 1F0RA 1BRAA 1TBRH 2BD7A 4OS1A 4MDSA 1SGFG 3U8TH 2BZ6H 2BDCA 4YLUA 1OX1A 3MH4A 1LMWB 3BTGE 3GDUA 3LONA 1O3IA 3ZZCA 3GY2A 1SGNE 1UVPA 1ZR0A 1QB9A 3TU7H 3QX5H 3PLBA 4MNYA 3EA7A 2P93A 1GI9B 3LOXA 4KGAA 3KNXA 1W13U 8KME2 2ZCLP 1O3EA 2H9TH 1O3DA 2Y6TA 1GWAA 3KIDU 3JZ2B 5L30H 1G2LA 2FODA 4RKJB 1E38B 3ZYEA 1DY8A 1XX9A 3F9HA 2PUXB 2BY7X 1FAKH 3LPRA 2DE8A 3MU4A 4BTTB 2FTMA 1GMCG 2O8LA 1L1GA 1TGCA 4M7GA 3RM0H 4GSOA 1S6HA 3F9EA 1NS3A 1SGTA 2HRVA 2CMYA 5GDSH 1AE5A 3SORA 2W26A 3IITA 3OY6U 1H9HE 1TYNA 1C1TA 2DUCA 1T8OA 2ZPSA 4H42U 4Y7AA 2VIDA 3T2NA 1HJAC 4R8TB 2ZI2H 1O33A 5EPNA 4GUXA 2VWMA 4LOYH 2M5TA 4UFFH 3STIA 5CMXH 4AG1A 1ANEA 4OGYA 3TPIZ 1P10A 2VIVA 2FYQA 5EW2H 2NWNA 3K9XB 2STBE 6ESTA 1BBRH 3IWMA 4Y8ZA 9LPRA 2A5AA 1HPGA 4UE7H 3SOSA 3LGUA 1V2ST 4K69A 1WOFA 1W0ZU 2W3IA 1Q3XA 1YPEH 4HTCH 3GCOA 4GCHG 1YC0A 2FLBH 4KTUA 3RMLH 1ZJKA 1GJ7B 1CHOG 5F8ZA 3QN7A 1EB1H 1NU7B 1TB6H 5A2MH 4GHQA 2FI3E 4Y0ZE 1E34B 2F83A 1FDPA 2XRCA 1V2PT 3A8AA 1FZZA 2FOHA 1JIMA 2A32A 4D9RA 9ESTA 1GJ4H 3PTBA 4ISHH 3VB7A 3NZIA 4I8JA 2FOBA 1V6DA 1J9CH 1QGFA 4OS5A 4CRFA 1DFPA 1K1IA 1F5LA 1O5FH 1UTJA 1TAWA 1CO7E 3A8CA 5DP9A 1O3AA 1Z8RA 5EODA 3SV6A 1MAXA 1G36A 1GL1A 3D49H 4JZEH 2Q6DA 1ZRKA 5HM2A 1FONA 1SOZA 4NIYA 1C5WB 3AAUA 2G4TA 2A7HA 1AE8H 3I77A 1QL7A 2HPPH 1CU1A 1MKXH 1K1JA 1HV7A 3BTTE 1T8LA 4AFQA 3M7QA 5C5NA 2VVCA 2WV5A 4YESB 3MO6A 2OC7A 5C3NA 5GXPA 3B23B 1VJ9U 1P3EA 1O3LA 5DP6A 1CBWC 3RXJA 4TY6A 1GBBA 1T31A 3VPKA 4FUFA 5I46H 4MNXA 2IJOB 1C9TA 1F5RA 3R0FA 4IMZA 1EJMA 1O32A 3SV9A 1VITH 1CSOE 1EZUC 3R3GB 1EJAA 1XVMA 1SQAA 3SU5A 4BANB 1IOEA 1EZQA 1AZ8A 4X1NU 1O0DH 5F6MA 5DP8A 3DHKH 4AB8A 1F5KU 5HM9A 2EA3A 3Q3YA 2OCVB 1NESE 2ALVA 2OQUA 2TGAA 3DFJA 2GGVB 2EI7A 2ZF0H 2ZWLH 3EGKH 1O2WA 1FY3A 1GPZA 2WYJA 3RC6A 1ZMLA 1ELDE 1QJ6B 1S81A 4JZ1A 4D7FA 4DW2U 1SGEE 5BRRE 1A5HA 3MH5A 3ENSB 3SU4A 3ZVFA 2Z3CA 1ETTH 1P03A 3LGIA 3A85A 3KL6A 5AVDA 5GCHF 2XWAA 1ETRH 4I8HA 2UUJB 2VJ1A 3S0NA 3LJOA 3E8LA 4KP0A 1F92A 2ULLA 1GHVH 2BLQA 3QZRA 1LKAA 2ZFQH 1BMNH 2FOFA 1ELEE 1W8BH 1GBHA 2PKSC 3LC5A 4JYUH 2G5NA 2WPMS 1QTFA 1SLXB 1T8NA 1HIAB 1D3DB 1PPBH 5T6FA 1XM1A 2H2ZA 3BTWE 1XUHA 1QA7A 2J92A 2FOAA 2NU2E 1SHYA 1S83A 3QTOH 3M5LA 1AVWA 4OS6A 3GY4A 5J4QA 4AGJA 4U01A 4NSYA 3E1XB 3NXPA 1NFYA 2A4QA 2WUCA 3HPTB 4FUHA 2V6NA 4GHTA 1H1BA 2A2XH 4BXWA 2R2MB 2ZECA 1SFQB 2GKVE 3A86A 4LK4A 1GJ6A 2HPQH 1D9IA 2CF9H 2WPJS 3CENA 2GCTB 3KQBA 1YCPH 1TBQH 1LVMA 3M5MA 1TNLA 1AIXH 4NWKA 1FLEE 3T25A 2FOMB 1TNIA 5HYOA 3CP7A 2P8OC 2VIWA 3LDXH 1C5VA 1D3QB 3BG8A 2C3SA 1CHGA 1SHHB 2VVVA 4ESTE 2WPKS 1IHSH 1WBGB 3Q76A 4FUBA 5DJ7A 4Y8YA 2PR3A 4FUEA 3FP8E 3SNBA 4NFFA 3V3MA 1MZAA 1B0FA 2Z94A 1GDNA 1QA0A 2F9PA 3ZVDA 2SGEE 2C90B 2PUQH 2DE9A 3RMOH 2QXGA 3GCTF 3UOUA 3QGNB 2AERH 2C8XB 1GG6C 2XCNA 2VH6A 1P06A 3E16B 3RLWH 2FS9A 1ZOMA 1FN8A 2ZGHA 3DA9B 4MTBA 5GCHG 1NM6A 1K1LA 2W7SA 4FVDA 1OWKA 3D65E 1UVOA 5A8ZA 1ZHRA 3LC3A 1C2KA 1NROH 1AO5A 1LQEA 1PPCE 2CJIA 2ZU4A 5BPEA 1XUFA 1C5RA 1O31A 2ZGCA 1TPAE 2RA0A 1MKWK 1FPCH 2H9EH 3BTHE 2FX4A 3AASA 2AYWA 2GMTB 1BRCE 1FAXA 2FLRH 1ZTLA 1QQ4A 1YPLH 2VNTA 3BEUA 5C1YA 3TH4H 4ABBA 2J94A 3GCNA 4FU8A 2TPIZ 4XFQA 3TLOA 2Z9GA 1PPGE 3MTYA 1YPMH 1T7CA 1RXPA 2XBWA 4XBCA 2VINA 5K0HA 1GBEA 3QK1A 1FI8A 4Y79A 3TK9A 4ZHMU 1IQGA 4TYDA 4AORA 2UUYA 3GYMA 3RXIA 2WPLS 1Y3VA 3UIRA 2SGFE 1GJAB 4KTSA 1KTSB 3Q77A 5FHTA 1C9PA 3I29A 3M7UA 5ETXA 1C5XB 1S6FA 1W3CA 2BDIA 2GV7A 3QUMP 2ZGBH 3VFEA 1OWEA 4BXSA 5JBCS 1Z6EA 3A8DA 4CRCA 5AFZH 1ZMJA 2ZU5A 1V2RT 2GTBA 1EUFA 2ZTXA 4X8SH 4X8UH 1SGDE 3UWJH 3TGJE 1EAWA 2F9NA 2R0LA 1NU9A 1KXCA 5ESTE 1ABJH 3F6UH 1Z7KA 2BLWA 5JB8S 3TNTA 3GCTG 1ZZZA 1SSXA 5C1UA 2Z9KA 1NFXA 2VGCC 3PTNA 3QDZB 2VVUA 1INCA 4BTUB 4OS7A 1C1NA 2BY8X 2ZHFH 2HWLB 1G3EA 3SU2A 3URDA 3B8JA 1O2RA 3A87A 1A1RA 1N8OB 3DUXH 1PPHE 1FV9A 1Y5BT 1O2TA 2J4IA 1W12U 1SC8U 2Y5HA 4DVAU 2ZHWH 2BB4A 1GJCB 4IC6A 3RXKA 1RD3B 1Y3UA 1DICA 1YPJH 2BX3A 2AMQA 1DVAH 2GVFA 4ABIA 1AVGH 4CRAA 2F9VA 1GVLA 1FIZA 3OYPA 3I78A 3SV7A 1HIAA 4GLYA 2A7CA 1BT7A 4IS5A 4CHAC 1TABE 1IQNA 1O2UA 4DY7B 4MG3A 3FZZA 1O2KA 3ZZBA 3TVJB 5FX5A 1AI8H 3U9AH 1C5NH 1PPZA 2SGPE 2XC5A 3F1SB 2ZDNA 3M3TA 2F91A 3QZQA 1UHBB 1XKAC 1P01A 2D1JA 3M5OA 2Y7XA 3M61U 3ODDA 1DLKB 1TGBA 1YF4A 3ESTA 2CHAB 4SGAE 2BM2A 5EGMA 3S9CA 4LXBH 2EEKA 4WMEA 1K1NA 1DSUA 2QCYA 1DE7H 2QXHA 2Q6GA 4NGAH 5JDUB 4YTAA 3NK8A 1O2XA 3RMNH 1S84A 1TIOA 1EXFA 3P8OA 1BA8B 4GPGA 2D26C 2BXUH 1LCYA 2LPRA 2ZO3H 1JOUB 1ZJDA 1TA6A 1BRUP 3BSQA 1A5IA 2FZZA 4U32A 1CVWH 1O3GA 1QY6A 3RXRA 3RXGA 1BTZA 4H6TA 1QRZA 4Y10E 5PTPA 1BTPA 3SGQE 4B75A 1PYTD 3D23A 1GBTA 4QT8C 3PMJA 1QJ1B 4MPWA 3M3VA 5AFYH 4BNRA 1UCYK 3PMBB 4A92A 1C1UH 2ANMH 3ZZ3A 2V3HH 3U69H 3MNXA 1NO9H 1P11E 3EQ0H 3FFGA 3E91A 1Y5AT 5CE1A 1F2SE 1KXBA 2Z6BD 1NTPA 1FN6A 5EXLA 4WH8A 1MTVA 2IN2A 2BY5X 1O3CA 2CF8H 3A7ZA 2ZHQH 2FMJA 3PMHB 3ZZDA 1EAXA 1CA0B 1GDUA 3SUDA 2OXSA 4A5TS 3BTFE 1LPKB 4Y0YE 2BQWB 3RU4E 3RXCA 3VB6A 2JH6D 4CH8B 1RTKA 3EA8A 3EDXB 3GOVB 1HAOH 1QL8A 2LNCA 1O2LA 1G3CA 1OWIA 1O2NA 4X1PU 1NRNH 1GCTC 4FUIA 1O3NA 1BHXB 4A1TA 2FYRA 4CRBA 2H6MA 4B74A 3RLYH 2ZCKP 1O2IA 3GY5A 2V0BA 3VGCB 1ZPZA 1MTNC 3P92A 3U98H 2AMDA 3OY5U 4CREA 1ZSKA 3KEEA 1GBIA 1BTYA 4YOIA 4ABJA 3FAOA 2QY0B 2ZU1A 2J95A 1THPB 1C2JA 3SNEA 5DGJA 2TGDA 2G51A 3M37A 3RXTA 4THNH 4ZHAA 4NFEA 1GI5A 1T4UH 2O8WA 3RXHA 2GT7A 3STJA 3SGAE 1AB9C 1O39A 2FP7B 1H9LB 1XVOA 2XYAA 3QLPH 1LVYA 5E0HA 1SGRE 2PV9B 1C5LH 2GDDA 1LHCH 3A82A 1V3XA 1V2UT 1DXWA 1H8IH 3SO3A 2R0KA 4Z6AH 1EATA 3A80A 5J4SA 3EAJA 1WAYB 1E35B 3T5FH 2A5KA 2FI5E 1VITF 1HUTH 1N6YA 3UOPA 4K1TA 3VEQB 1SGYE 1IQIA 1AFQC 3RXDA 1VCWA 2C4FH 3PWCA 4Q7XA 1P57B 1CGHA 1O2GH 4PROA 4B2AA 1UMAH 1EJNA 1A5GH 4HGCA 1O3KA 1JXPA 4K1EA 2P3TB 3DD2H 6CHAB 1KTTB 4I8GA 1JRSA 1C2HA 1GGDB 3RXEA 1HAXB 2H5CA 1JBUH 3AW0A 5EPYA 1FNIA 1T8MA 1IQLA 1TNHA 4K60A 4INHA 3T28A 4MLFB 4VGCC 5HMAA 4BAOB 3SJKA 3M36A 1RIWC 2QXIA 4DGJA 1FXYA 1L1JA 5CHAB 3FP7E 4ISOA 1GJDB 1OP2A 1ANCA 1GBMA 2ZCHP 1O34A 1MCTA 4NA9H 2ODYB 2BD2A 2QC2A 1YCPM 1CQQA 1TRNA 2XTTB 1EP6A 1EZXC 3B9FH 5A8XA 4ASHA 4ZH8A 5TCAA 1QQUA 1TALA 3RXBA 3AAVA 1YGCH 5A0BA 4FU7A 2C93B 2SNWA 1ID5H 2AGEX 3L3TA 3JZ1B 2HGTH 2ZDKA 3PLKA 1SGCA 3RP2A 1NPMA 2WPHS 5LH8A 4YO9A 2SGQE 3TK6A 1YBWA 1UHBA 3A7WA 2OLGA 5L6NH 2P94A 1BRBE 1GBLA 5EOKA 4F4OC 3PO1B 2Y7ZA 1O3FA 2BDAA 5LPFA 5EXMA 3BIUH 4B1TA 1HAZB 1PPFE 1ELCA 3ODFA 7ESTE 2EI8A 4X6NA 3VB5A 2BDYA 5DP5A 4RN6A 5DG6A 3GICB 3O8CA 4JMYA 3H5CB 1GMHF 2Y5FA 3LJJA 3RXVA 3UNRA 2YOLA 4AOQA 1BTXA 1CE5A 1DT2A 1VGCC 2BHGA 1W10U 1VITG 1Z71A 1WQSA 3NKKA 3SNCA 5T6DA 5EQRA 5GWZA 1GVZA 1DDJA 1L0ZA 2GD4B 1PQAA 1HRTH 2ZDAH 7LPRA 1BIOA 4R0IA 5L2YH 3ZZ7A 1AN1E 1MZDA 1P3CA 3MNCA 4U30A 4ZKOU 1O3HA 2EC9H 3SHCH 1DANH 4LZ1H 3LKWA 1TMUH 1XXFA 1P02A 1SG8B 5B6OA 3MMGA 4ABDA 1GHYH 1YP9A 1ELTA 1Z1JA 4ISLA 2B9LA 2G8TA 5C67A 4XE4A 5F03A 1ELVA 2PGBB 4Y6DA 1ELGA 3GDVA 2Z9LA 2H1UA 2BY9X 2ZPRA 1EQ9A 3C1KA 3GY8A 2F9BH 3PB1E 1HAHH 4AGKA 2BD5A 2GDEH 1BB0B 2HALA 3BG4B 4SGBE 1LVBA 4WMFA 3O8RA 1YLDA 5F8TA 1QL9A 1C2GA 2ZNKH 1KXDA 4IMQA 1V2KT 1NRSH 5IYTA 4XBDA 1C2DA 1C2IA 2JETB 3V13A 1OSSA 1AQ7A 3GCHC 1DWEH 3O8BA 4A1XA 1WTHD 1OP8A 1C2LA 1ZGIA 2F9OA 1P12E 5A8YA 3FP6E 1BBRK 1LPGB 1MU8B 4ZXXH 1MCVA 2FM2A 1O3MA 2IPHA 1Y3WA 1D6RA 2Z9IA 3BV9B 1JWTA 1C4V2 1E36B 4ZAEA 2KAIB 2RA3A 2WUBA 1AGJA 4DCDA 8GCHF 1G2MA 2G00A 1ZLRA 1C4U2 2ZIQH 4ISNA 1GMHG 1LDTT 1O2OA 4NZQA 2QF3A 2QYIA 1WV7H 5FCKA 1CGJE 4F49A 1B7XB 1ZGVA 4TWWA 1RRKA 1YM0A 1ABIH 1KLIH 1BTUA 1EZSC 3TJNA 1TGNA 3VB4A 3HATH 1AUTC 1GJ8B 3A7TA 1V2LT 4UDWH 1DM4B 1LHDH 1QBNA 2TGPZ 3K6ZA 4NSVA 1NRRH 1KLTA 1EB2A 2G4UA 1IQMA 1HBTH 1MAYA 2Y82A 3E0NB 1HJ8A 3TGKE 1Y8TA 1M9UA 1MMJN 2ZFPH 2FIRH 2RG3A 1UCYE 1BCUH 4E05H 3ZZAA 1HNEE 3ZV8A 2FX6A 2V35A 1ELBA 1K22H 3PV4A 4O97A 1EASA 4RKOB 3SZNA 2ZTYA 1BDAA 1V2QT 1MKXK 4NWLA 2Y81A 4ABAA 4NIWA 1C5MD 3UFAA 1A61H 1WCZA 3MU5A 1HAVB 4AG2A 1KLJH 3D62A 1GBCA 2BOKA 1B0EA 2TRMA 1GHBF 2BD4A 1TOMH 2BQ6B 2VIPA 2XCFA 1ESAA 3E90B 4CRGA 2NU0E 1EPTB 3MU1A 1LTOA 5H4IB 1YPGH 1BTHH 5K7RA 1RFNA 1NRPH 1DPOA 3MU0A 1C1QA 1UK3A 1P2IA 4MPVA 3T27A 1H4WA 1SMFE 2I6SA 1GBAA 2P3FH 4YT7H 1J8AA 3UNSA 3RU4D 2ZU2A 1SB1H 2QXJA 1SLUB 1V2NT 2SGAA 1CA8B 1BMLA 4XOJA 2V3OH 3PWBA 2F3CE 3NWUA 1RJXB 1QRWA 2IOTA 4AYVB 1IQJA 1C1MA 1AWFH 4IN1A 4OS2A 2NU4E 1ZPBA 2I6QA 4IGDA 4YOGA 4LZ4B 3RXPA 3ZYDA 1B5GH 3MO9A 3HGPA 5LPRA 8GCHG 1UTOA 3CS0A 2WV4A 3HGNA 5I25A 1A3BH 4WVPE 1LQDB 4MPXA 4JZIA 3RDZA 1GHZA 2ZG0H 5HGGA 2NU1E 2W3KA 3TJUA 1V2JT 4I8LA 1Y59T 4BOHA 4Q2KA 1JIRA 1G32B 3O8DA 4D9QA 1C1SA 1MQ5A 1BHXF 4INLA 2BD9A 3M3SA 4H4FA 1Q31A 3SUEA 1V2MT 2QV1A 4UD9H 1V2TT 4CBNA 2BDGA 2HNTF 2J2UA 1HJAB 5TCCA 4IN2A 1OS8A 3M5NA 2XW9A 1O5DH 3KQEA 4E06H 3KQCA 2A31A 5T3HA 1HXEH 1IQKA 1C5YB 1SQOA 2FDAA 2G52A 2RCEA 3P70B 5GIBA 1MBQA 3KQDA 2PKAB 1BJVA 2ANYA 4TY7A 5DK1A 1W2KH 1CT0E 3BEIB 1P9SA 5DP7A 1W11U 3UQOA 1WTGH 1DWCH 1QB6A 1SI5H 1C5PA 1DUEA 2PFEA 3A83A 1O2PA 1A4WH 1F0TA 2O8MA 3NCLA 5EG4A 2XBYA 1GBKA 1WU1A 1K9OE 3ZZ9A 1D3PB 1UTMA 4ABEA 1GHBG 4X6MA 2ANWA 4DOQA 1YCPK 4JYTA 1KXEA 2ZC9H 2BLVA 3VB3A 3G01A 1GBFA 1P2OA 4I8KA 1GL0E 1GDQA 3SQHE 3RXSA 2ZFFH 2GP9B 4FUJA 2AS9A 3M35A 4YM9A 4KKDA 2QF0A 3RUOA 3E3TA 3P6ZB 2WINI 1SGQE 3VXEH 1IQHA
chains in the Genus database with same CATH superfamily
2AH4X 4HI3A 1G3DA 4B6FA 1KXAA 1G3BA 2BD3A 3SU1A 3IG6B 1QCPA 4ZROA 4MPUA 2PWXA 5C1XA 3RXUA 1AFEH 1J16A 2SNVA 4K5ZA 1P2QA 3ZZ4A 5HXFA 2G5VA 3E0PB 1DXPA 3NPSA 3BIVH 4Y76A 4WXVA 2HLDD 2J98B 4Z1MD 2KAIA 1P2JA 1GHAF 1T4VH 3RXLA 1SLVB 1TX6A 1P09A 4GAWA 3QWCH 4HG6A 5ESBA 3A81A 5C5OA 5A09A 2K1QA 2Z9JA 4ZHLU 1SBWA 1FUJA 5E8EH 1UTQA 3HKIB 2W6ID 3DSPA 4AFZA 2SGDE 1Z1IA 1TRMA 3BTME 7GCHF 2FOCA 4I33A 2BY6X 1CBWB 4O3UA 1Q2WA 3SU3A 4AB9A 1O38A 1SPJA 3LGVA 4NG9H 1RTFB 2GCTC 3QTVH 2EQNA 3U8RH 1MBMA 3MO3A 1FY5A 2ZDMA 1Y3XA 5JBTA 1WDIA 1W0KD 1E0FD 3V0XA 4ZKRU 3DFLA 3MH7A 1TMBH 1SR5C 4AN7A 2J9NA 4FUDA 3KYGA 3SV8A 4UONA 1H8HD 2Z3EA 3H7TA 1Z8JB 3SGBE 2O8UA 4BAMB 1A0HB 2D8WA 1F7ZA 5DPAA 1GVKB 1P0SH 1AKSB 1TPPA 2STAE 1SGIB 3K6YA 1MUEB 4TWYA 2OC0A 3T29A 3A7XA 1D3TB 1FY1A 1HAVA 1XUIA 2JH0D 1CGIE 3DT0H 4I32A 3UTUH 4Y11E 4ACBA 1QNJA 1O37A 2VWLA 3LGWA 1A0LA 1H9IE 3TH3H 2W7UA 4Y8XA 1O3BA 1HFDA 2J34A 3W94A 1CT2E 2ZFRH 2OQ5A 5SGAE 2H9HA 1EPTA 4IC5A 3TGIE 2ESTE 3N99A 3TJVA 2P16A 3F0OA 1Y5UT 1A0JA 1LHFH 1WUNH 2VIQA 3HK6B 2ALPA 2FWWA 1QJ7B 3TJOA 2GZ8A 1UO6A 2KCPA 5C17A 2PKSB 4B2BA 1IAUA 1TQ7B 3UB0A 2W6JD 3CS7A 4WJG2 1NT1A 1O2JA 1GI4A 2BD8A 3URCA 5C20A 5A0CA 2OBQA 1H8DH 2FO9A 3MFJA 3GDSA 4X2XA 3RXQA 2WZQA 1O35A 1O30A 4UFDH 1C5TA 1AY6H 1F0UA 5FPSA 1GHAG 1QHRB 1BBRE 1D4PB 2GMTC 3FVFB 3SNAA 3ZIAD 1C2FA 1QIXB 2NU3E 1LVOA 1EP5A 4WH6A 4Y7BA 1HJ9A 1ZTJA 1TPOA 5KEDA 1O2SA 5FL7D 1ZYOA 7GCHG 1TPSA 3GYLB 3W1EA 4WF8A 1OKXA 2J97A 2PHBA 1QR3E 1L2EA 2A45B 2WSSD 5EJLA 4ABFA 1XUGA 3DSOA 4YZUA 5EW1H 4NZLA 3OEHD 1W7XH 2BVRH 1PJPA 1FX0B 3OX7U 2OC8A 2P8OB 1IQEA 2THFB 1DLEA 8LPRA 2JKHA 2OUAA 1ANDA 2ZP0H 2OINA 2OBOA 1BUIA 2ZTZA 3W95A 4CRDA 2J38A 4WY3A 3BTEE 1GJBB 1MD7A 4H6SB 4I86A 5FCRA 1X7AC 3Q3KA 2XBVA 3TK5A 4FXGH 2PKAA 1MQ6A 4ABHA 1YLCA 3TITA 3V12A 1KMHB 1UVTH 1YPHE 2BOHB 4F55A 2RFKC 1C5SA 1TA2A 2TIOA 1YLNA 1SQTA 3LU9B 4YT6H 1K2I1 3F2HA 6GCHF 1QBOA 5JYIA 5F8XA 1QBVH 1GG6B 3GISB 2CXVA 1DITH 1P2MA 1C5OH 4RSPA 2VIOA 1EAUA 1T32A 4X6OA 2OP9A 4A6LA 3HKJB 1XXDA 4AX9H 1XKBC 1P2KA 3RMMH 3SUFA 1TRYA 1K21H 5JPMH 3V7TA 3FN8A 2AGGX 3S7HB 1UTKA 2PTCE 3KHVA 3SV2H 3SW2B 4HZHA 1ESTA 2ZU3A 2GCHF 1BTWA 2W5EA 1FQ3A 3PLPA 4JZFH 3BTQE 1N8OC 2PSXA 1TOCB 2Y80A 8ESTE 4J2YB 1G37A 1GI0A 2FOGA 1GJ5H 1WYKA 2BXTH 3F3BA 4DG4A 1FJSA 3SHAH 3UPEA 1C5ZB 4BAKB 5IDKA 1O5CB 2VB0A 1J17T 3N7OA 4JYVH 4X0WU 1O3OA 3A7VA 1BMMH 3MI4A 1P9UA 1PPEE 4U2WA 4B73A 1OWJA 1SOTA 4X2VA 2WPIS 1OXGA 2J98A 3RXMA 3TH2H 1DX5M 1A3EH 4FU9A 5GNDA 1ORFA 2PLXA 4AFUA 1BOQA 4TPYA 1TGTA 1TFXA 1MD8A 1HAGE 1TQ0B 1W0YH 5JBBS 2OTVA 3KGPA 2BQ7B 4MQAA 1ARBA 5FPYA 1HLTH 2HVXA 4INKA 1ANBA 2B8OH 3LGTA 2BX4A 3A89A 1S82A 3AW1A 3BN9A 3GS9A 3SBKA 1ESBA 1UJ1A 3SUGA 1DWBH 1O2MA 2GX4A 4I7YH 1MTSA 3PV2A 2CHAC 5DKMA 3TNSA 2RDLA 1O2ZA 1GBDA 2GZ7A 4BAQB 4AZ2B 1OWHA 4FETA 4XRNA 3GY3A 1BZXE 4YOJA 1KDQB 3OSYA 2TGTA 1ZPCA 2ZA5A 1E37B 4X2YA 1C5UA 1K1PA 5FPTA 3OU0A 3E6PH 2H5DA 4WMDA 2QA9E 1O2VA 1ZHMA 4NA8A 4FUCA 2CV3A 5B6LA 3ATWA 1KIGH 2ZKSA 3BTDE 5EXNA 1S0RA 2B5TB 6GCHG 3U1JB 4ZUHA 4K3JA 1MKWH 1AKSA 5LPEA 1LKBA 4CR9A 1FY8E 2VGCB 2R2WU 2QN5T 2A5IA 4O3TA 2D2DA 3KN2A 4JK6A 1DOJA 1NZQH 1O2QA 3MOCA 1HDTH 3SI4H 4J1YA 1TX7A 2ZHDA 4FVBA 4X2WA 2A4GA 2P59A 1O2YA 4OM9A 2ZQ1A 1YY3A 3PROA 3ZVAA 3SU0A 3TIUA 1G30B 2B0FA 2ZGXH 1AVXA 1VJAU 2GCHG 2L74A 4K1SA 1E79D 1DY9A 3MU8A 3SJ8A 1HB0B 4WXIA 2WV9A 3ATLA 2PSYA 1QRXA 1PQ8A 5E2OA 1SKYE 3UUZA 4E7NA 2ASUB 1ELAA 3NUMA 2CN0H 2BLOA 2GT8A 1N1LA 2HLCA 1GI7B 2GV6A 1O3PB 4BAHB 1P04A 3ZZ6A 1TX8A 1CA0C 3WY8A 3SN8A 4CHAB 1FMGA 1KYNA 1Z8IB 2ZPQA 2OC1A 4Q7ZA 1UK4A 1DUAA 5A0AE 5FXLA 2ZEBA 2PGQB 1AU8A 1J14A 4XSKU 1LO6A 1P05A 3SJ9A 5EIYA 1C1VH 4D8NA 2AGIX 2EI6A 1NN6A 3LH3A 4WWYA 1W14U 3VGCC 2HNTC 1HAYB 2UWOA 3UREA 1SVPA 1O5EH 1D6WA 2UUFB 1VCQA 1MTWA 5AHGH 2YNAA 4KELA 4ZXYH 1IQFA 3OAAD 4E7RG 1FY4A 2FESH 3ATKA 2Z7FE 4IBLH 3LH1A 3RC5A 3S9BA 4O9VA 2F9UA 2C8ZB 1BITA 1GCDA 1MH0A 1Z6JH 2B7DH 3KCGH 1L1NA 3OEED 5DP4A 4UEHH 3ZV9A 3F9FA 4DIIH 3S7KB 1TWXB 4NIXA 5LGOA 3P17H 3F68H 5DO4H 4OGXA 4XBBA 1IHTH 4I31A 3BTKE 5TJXA 2AMPA 4ABGA 2A7JA 2PW8H 4ZKNU 1S0QA 2XC0A 3T62A 3UY9A 1KSNA 1TNGA 3AVZA 3SJIA 1ZSLA 3P95A 3FZDA 1ZTKA 1GBJA 3AK5A 3QO6A 1YYY1 2AFQB 2O8TA 1O3JA 1RTLA 2ZDVH 1XUKA 4ZCNA 1E1RD 1WQVH 1LHGH 2XBXA 4CR5A 3MNBA 1SGPE 1PFXC 2M2AA 2SFAA 2QAAA 2A4OA 2YNBA 2ZFTA 5T6GA 2G81E 1TONA 4NA7A 2AEIH 1OP0A 1XMNB 5EJZA 6CHAC 3MQKC 1ELFA 4ZKSU 3PYHA 1HAIH 1GGDC 1SGFA 4GVUA 4KTCA 3L33A 1TMTH 5T1VA 5AF9H 1ZMNA 3SNDA 3FO8D 1C2EA 1EX3A 1RGQA 4D76A 2XNDD 2AIPA 4JZDH 3N7DA 5FX6A 2V3MA 3ZVBA 1WSSH 4ZMAH 2LP6A 3LIWA 3LT3A 2ZZUH 1VCPA 1VR1H 5CHAC 1V2WT 1GCTB 1FPHH 3ZZ8A 3MYWA 3S9AA 1ACBE 2ZDLA 1L4ZA 2XXLA 3RXAA 1QURH 1MTNB 2FOEA 4FUGA 5IK2D 4MVNA 3A88A 2A1DB 1NFWA 3CNRA 1CT4E 1UVUH 1TNKA 1C4Y2 2QGRA 3P8NA 1EKBB 1C1WH 2TBSA 3HK3B 2YMSD 3F0PA 1C2MA 4X1RU 5FBIA 3Q00A 3BF6H 2FEQH 4AFSA 2YMSC 4MNVA 2ZFSA 3BEFB 1J15A 1AB9B 1EOLA 3SYJA 1PQ7A 1HYLA 1AD8H 2R3UA 4DT7B 1UCYH 3VXFH 3ATMA 3PO1C 1O5GH 2A4RA 1GMDF 4Y71A 3MHWU 1GJ9B 4BTIB 5C0UA 5C94A 1TNJA 3P8GA 4DIHH 4TPIZ 1DWDH 1KDQA 3PRBA 2Q6FA 2P95A 1TE0A 5E2PA 3K65B 1AZZA 4K8BA 3RXOA 5E0JA 3T26A 1GI8B 1ZSJA 1GHXH 2BMGB 1AFQB 1GI1A 2A0QB 3EA9A 2P3UB 5GJ4B 1AWHB 1GI2A 2C8WB 2VWOA 2XWBI 1A7SA 5FBEA 1KY9A 1XUJA 1EAIA 1Y3YA 1V2VT 3L6PA 5EU8A 2UWPA 1O5BB 2K0QA 1NRQH 3RU4T 1ZRBA 4JK5A 2VWNA 5C2ZA 1DS2E 1N6XA 5E0GA 1OYQA 1ARCA 4VGCB 2ODQA 4K8YA 4IW4E 1EOJA 2RDEA 3ZVGA 1NY22 1RIWB 1SLWB 1HXFH 2WYGA 3ZZ5A 1HAPH 1C5QA 4B76A 3ELAH 3RM2H 1MU6B 1LHEH 1BMAA 3ITIA 3UR6A 3H09A 4ASUD 2O9QA 4Z0KA 1YPHC 2A2QH 3SQEE 1O36A 3F9GA 2XNIA 1GI3A 2HNTE 4X1QU 4B6EA 1L4DA 5JB9S 2R3YA 1W7GH 1VZQH 1YKTA 3Q3XA 1AMHA 1P8VC 3A7YA 3A8BA 4YLQH 4A7IB 3UQVA 1BJUA 2Y5GA 4ISIH 1THSH 2BZAA 2Z3DA 3RC4A 1UK2A 2AIQA 1JMOH 4AYYB 1ETSH 1AUJA 2CGAA 1GI6A 1UTLM 2FS8A 4CH2B 1TLDA 3UR9A 4RI0A 2HOBA 1GHWH 3BG4C 2R9PA 2FI4E 3RXFA 4HFPB 1C1PA 4D7GA 2BDBA 4JCNA 4K2YA 4X8TH 1UTPA 2JETC 3C27B 3M7TA 4MNWA 2Q1JA 1H8ED 1NFUA 1FIWA 2FXRA 1ZHPA 3KF2A 3U8OH 1NC6A 1GMDG 3OTJE 3ZVCA 3U1IB 1Z8GA 1P2NA 4Q80A 5EQSA 3VG8A 1C1OA 2ZQ2A 5ABWA 4X1SU 3PV5A 4UFGH 1UTNA 2PTNA 3MWIU 3UWIA 1S6LA 1U6QA 1VGCB 5DP3A 3SI3H 1K28D 3PM3A 5L2ZH 4DJZB 2VU8E 3QGJA 4NIVA 4X6PA 1QFKH 4DT4A 1A2CH 5EQQA 1O2HA 3GY7A 3P8FA 2BDHA 5G4BA 3MNSA 3SU6A 2FPZA 1GMCF 3FANA 2C8YB 2BVSH 4B2CA 2G55A 2UUKB 1AHTH 2JH5D 3MH6A 1G9IE 4UFEH 1C1RA 2J5UA 1S85A 5FAHA 1EFRD 1KXFA 1THRH 2ILNA 1JRTA 6LPRA 2KFWA 2ZHEH 1HCGA 1TGSZ 3PMAB 4X8VH 1SFIA 2BYAX 2BTCE 1A46H 1SL3A 4B71A 1V2OT 4DURA 1PYTC 3UNQA 4TSFD 2JJ2D 3EE0B 3K2UA 4CBOA 2BVXH 2GZ9A 1K1OA 1DSTA 1QB1A 3H7OA 1K1MA 3LGYA 2KX4A 4Q7YA 1S5SA 5GPIB 3EYDA 2ODPA 1TBZH 2UWLA 1OYTH 1BQYA 1UVSH 1O5AB 2QIQA 1MTUA 2ANKH 1PQ5A 3ATIA 2VH0A 4GCHF 2FTLE 3S69A 2OD3B 1CHOF 1RS0A 4XDEA 2VBCA 1OWDA 2XC4A 2KCAA 2ZGJA 3ZVEA 3A84A 1OPHB 1HGTH 1F0SA 3GCHB 1LPZB 1EPTC 4A1VA 4NCYA 3SJOA 1YPKH 4OS4A 4O03A 1OOKB 7KMEH 3GY6A 5JBAS 1F0RA 1BRAA 1TBRH 2BD7A 4OS1A 5HIYA 4MDSA 1SGFG 1SQRA 3U8TH 2BZ6H 2BDCA 4YLUA 1OX1A 3MH4A 1LMWB 2IJD1 3BTGE 3GDUA 3LONA 1O3IA 3ZZCA 3GY2A 1SGNE 1UVPA 1ZR0A 1QB9A 3TU7H 3QX5H 3PLBA 4MNYA 3EA7A 2P93A 1GI9B 3LOXA 3F2FA 4KGAA 3KNXA 1W13U 8KME2 2ZCLP 1O3EA 2H9TH 4ACAA 1O3DA 2Y6TA 1GWAA 3KIDU 3JZ2B 5L30H 1G2LA 2FODA 5DSFA 4RKJB 3WWBA 1E38B 3ZYEA 1K0HA 1DY8A 1XX9A 3F9HA 2PUXB 2BY7X 1FAKH 3LPRA 2DE8A 3MU4A 4BTTB 2FTMA 1GMCG 2O8LA 1L1GA 2KZ4A 1TGCA 4M7GA 2WPDD 3RM0H 4GSOA 1S6HA 3F9EA 1NS3A 1SGTA 2HRVA 2CMYA 5GDSH 1AE5A 3SORA 2W26A 3IITA 3OY6U 1H9HE 1TYNA 1C1TA 2DUCA 1T8OA 2ZPSA 4H42U 4Y7AA 2VIDA 3T2NA 1HJAC 4R8TB 2ZI2H 1O33A 5EPNA 4GUXA 2VWMA 4LOYH 2M5TA 4UFFH 3STIA 5CMXH 4AG1A 1ANEA 4OGYA 3TPIZ 1P10A 2KR7A 2VIVA 2FYQA 5EW2H 2NWNA 3K9XB 2STBE 6ESTA 1BBRH 3IWMA 4Y8ZA 9LPRA 2A5AA 1HPGA 4UE7H 3SOSA 3LGUA 1V2ST 4K69A 1NBME 1WOFA 1W0ZU 2W3IA 1Q3XA 1YPEH 4HTCH 3GCOA 4GCHG 1YC0A 2FLBH 4KTUA 3RMLH 1ZJKA 1GJ7B 1CHOG 5F8ZA 2JIZD 3QN7A 1EB1H 1NU7B 1TB6H 5A2MH 4GHQA 2FI3E 4Y0ZE 1E34B 2F83A 1FDPA 2XRCA 1V2PT 3FKSD 3A8AA 1FZZA 5HIZA 2FOHA 1JIMA 2A32A 4D9RA 9ESTA 1GJ4H 1WXRA 3PTBA 4ISHH 3VB7A 3NZIA 4I8JA 2FOBA 1V6DA 1J9CH 1QGFA 4OS5A 4CRFA 1DFPA 1K1IA 1F5LA 1O5FH 1UTJA 1TAWA 1CO7E 3A8CA 5DP9A 1O3AA 1Z8RA 5EODA 3SV6A 1MAXA 1G36A 1GL1A 3D49H 4JZEH 2Q6DA 1ZRKA 5HM2A 1FONA 1SOZA 4NIYA 3SZEA 1C5WB 3AAUA 2G4TA 2A7HA 1AE8H 3I77A 1QL7A 2HPPH 1CU1A 1MKXH 1K1JA 1HV7A 3BTTE 1T8LA 4AFQA 3M7QA 5C5NA 2VVCA 2WV5A 4YESB 3MO6A 2OC7A 5C3NA 5GXPA 3B23B 1VJ9U 1P3EA 1O3LA 5DP6A 1CBWC 3RXJA 4TY6A 5HKKD 1GBBA 1T31A 3VPKA 4FUFA 5I46H 4MNXA 5KECA 2IJOB 1C9TA 1F5RA 3R0FA 4IMZA 1EJMA 1O32A 3SV9A 1VITH 1CSOE 1EZUC 3R3GB 1EJAA 1XVMA 1SQAA 3SU5A 4BANB 1IOEA 1EZQA 1AZ8A 4X1NU 1O0DH 5F6MA 5DP8A 3DHKH 4AB8A 1F5KU 5HM9A 2EA3A 3Q3YA 2OCVB 1NESE 3OTPA 2ALVA 2OQUA 2TGAA 3DFJA 2GGVB 2EI7A 2ZF0H 2ZWLH 2QF5A 3EGKH 1O2WA 1FY3A 1GPZA 2WYJA 3RC6A 1ZMLA 1ELDE 1QJ6B 1S81A 2KCYA 4JZ1A 4D7FA 4DW2U 4YXWD 1SGEE 5BRRE 1A5HA 3MH5A 3ENSB 3SU4A 3ZVFA 2Z3CA 1ETTH 1P03A 3LGIA 3A85A 3KL6A 5AVDA 5GCHF 2XWAA 1ETRH 4I8HA 2UUJB 3WW7A 2VJ1A 3S0NA 3LJOA 3E8LA 4KP0A 1F92A 2ULLA 1GHVH 2BLQA 3QZRA 1LKAA 2ZFQH 1BMNH 2FOFA 1ELEE 1W8BH 1GBHA 2PKSC 3LC5A 4JYUH 2G5NA 2WPMS 1QTFA 1SLXB 1T8NA 1HIAB 1D3DB 1PPBH 5T6FA 1XM1A 2H2ZA 3BTWE 1XUHA 1QA7A 5EJ1A 2J92A 2FOAA 2NU2E 1SHYA 1S83A 3QTOH 3M5LA 1AVWA 4OS6A 3GY4A 5J4QA 4AGJA 4U01A 4NSYA 3E1XB 3NXPA 4AC9A 1NFYA 2A4QA 2WUCA 3HPTB 4FUHA 2V6NA 4GHTA 1H1BA 2A2XH 4BXWA 2R2MB 2ZECA 1SFQB 2GKVE 3A86A 4LK4A 1GJ6A 2HPQH 1D9IA 2CF9H 2WPJS 3CENA 2GCTB 3KQBA 1YCPH 4XD7D 1TBQH 4F48B 1LVMA 3M5MA 1TNLA 1AIXH 4NWKA 2F4LA 5DN6D 1FLEE 1QZ8A 3T25A 2FOMB 4P02A 1TNIA 5HYOA 3CP7A 2P8OC 2VIWA 3LDXH 1C5VA 1D3QB 3BG8A 2C3SA 1CHGA 1SHHB 2VVVA 4ESTE 2WPKS 1IHSH 1WBGB 3Q76A 4FUBA 5DJ7A 4Y8YA 2PR3A 4FUEA 3FP8E 3SNBA 4NFFA 3V3MA 3OFND 1MZAA 1B0FA 2Z94A 1GDNA 1QA0A 2F9PA 3ZVDA 2QF4A 2SGEE 2C90B 2PUQH 2DE9A 3RMOH 2QXGA 3GCTF 3UOUA 3QGNB 2AERH 2C8XB 1GG6C 2XCNA 2VH6A 1P06A 3E16B 3RLWH 2FS9A 1ZOMA 1FN8A 2ZGHA 3DA9B 4MTBA 5GCHG 4RT0A 1NM6A 1K1LA 2W7SA 4FVDA 1OWKA 3D65E 1UVOA 5A8ZA 1ZHRA 3LC3A 1C2KA 1NROH 1AO5A 1LQEA 1PPCE 2CJIA 2ZU4A 5BPEA 1XUFA 1C5RA 1O31A 2ZGCA 2GJGA 1TPAE 2RA0A 1MKWK 1FPCH 2H9EH 3BTHE 2FX4A 3AASA 2AYWA 2GMTB 1BRCE 1FAXA 2AHME 2FLRH 1W0JD 1ZTLA 1QQ4A 1YPLH 2VNTA 3BEUA 5C1YA 3TH4H 4ABBA 5C0TA 2J94A 3GCNA 4FU8A 2TPIZ 4XFQA 3TLOA 2Z9GA 1PPGE 3MTYA 1YPMH 1T7CA 5F53A 1RXPA 2XBWA 4XBCA 2VINA 5K0HA 1GBEA 3QK1A 1FI8A 4Y79A 3TK9A 4ZHMU 1IQGA 4TYDA 4AORA 2UUYA 3GYMA 3RXIA 2WPLS 1Y3VA 3U28C 2SGFE 3UIRA 1GJAB 3KYFA 1KTSB 4KTSA 3Q77A 5FHTA 1C9PA 3I29A 3M7UA 5ETXA 2XOKD 1C5XB 1S6FA 1W3CA 2BDIA 2GV7A 2KCOA 3QUMP 2ZGBH 3VFEA 1OWEA 4BXSA 5JBCS 1Z6EA 3A8DA 4CRCA 2JJ1D 5AFZH 1ZMJA 2ZU5A 1V2RT 2GTBA 1EUFA 2ZTXA 4X8SH 4X8UH 1SGDE 3UWJH 3TGJE 1EAWA 2F9NA 2R0LA 1NU9A 1KXCA 5ESTE 1ABJH 3F6UH 1Z7KA 2BLWA 5JB8S 3TNTA 3GCTG 1ZZZA 1SSXA 5C1UA 2Z9KA 1NFXA 2VGCC 3PTNA 3QDZB 2VVUA 1INCA 4BTUB 4OS7A 1C1NA 2BY8X 2ZHFH 2HWLB 1G3EA 3SU2A 3URDA 3B8JA 1O2RA 3A87A 1A1RA 1N8OB 3DUXH 1PPHE 1FV9A 1Y5BT 1O2TA 2J4IA 1W12U 1SC8U 2Y5HA 4DVAU 2ZHWH 2BB4A 1GJCB 4IC6A 3RXKA 2CK3D 1RD3B 3PRDA 1Y3UA 1DICA 1NBMD 1YPJH 2BX3A 2AMQA 1DVAH 2GVFA 4ABIA 1AVGH 4CRAA 2F9VA 1GVLA 1FIZA 2EY4C 3OYPA 3I78A 3SV7A 1HIAA 4GLYA 2A7CA 1BT7A 2F43B 4IS5A 5CHBA 4CHAC 1TABE 1IQNA 1O2UA 2L6OA 4MG3A 3FZZA 4DY7B 1O2KA 3ZZBA 3TVJB 5FX5A 1AI8H 3U9AH 1C5NH 1PPZA 2SGPE 2XC5A 3F1SB 2ZDNA 3M3TA 2F91A 3QZQA 1UHBB 1XKAC 1P01A 2D1JA 3M5OA 2Y7XA 3M61U 3ODDA 1DLKB 1TGBA 1YF4A 3ESTA 2CHAB 4SGAE 2BM2A 5EGMA 3S9CA 4LXBH 2EEKA 4WMEA 1K1NA 1DSUA 2QCYA 1DE7H 2QXHA 2Q6GA 4NGAH 5JDUB 4YTAA 3NK8A 1O2XA 3RMNH 1S84A 1TIOA 1EXFA 3P8OA 1BA8B 4GPGA 2D26C 2BXUH 1LCYA 2LPRA 2ZO3H 1BMFD 1JOUB 1ZJDA 1TA6A 1BRUP 3BSQA 1A5IA 2FZZA 4U32A 1CVWH 1O3GA 1QY6A 3RXRA 3RXGA 1BTZA 4H6TA 1QRZA 4Y10E 5PTPA 1BTPA 3SGQE 4B75A 1PYTD 3D23A 1GBTA 4QT8C 3PMJA 1QJ1B 4MPWA 3M3VA 5AFYH 4BNRA 1UCYK 3PMBB 4A92A 1C1UH 2ANMH 3ZZ3A 2V3HH 3U69H 3MNXA 1NO9H 1P11E 3EQ0H 3FFGA 3E91A 1Y5AT 5CE1A 1F2SE 1KXBA 2Z6BD 1NTPA 1FN6A 5EXLA 4WH8A 1MTVA 2IN2A 2BY5X 1O3CA 2CF8H 3A7ZA 2ZHQH 2FMJA 3PMHB 3ZZDA 1EAXA 1CA0B 1GDUA 3SUDA 2OXSA 4A5TS 3BTFE 1LPKB 4Y0YE 2BQWB 3RU4E 3RXCA 3VB6A 2JH6D 4CH8B 1RTKA 3EA8A 3EDXB 3GOVB 1HAOH 1QL8A 2LNCA 5CDFE 1O2LA 1G3CA 1OWIA 1O2NA 4X1PU 1NRNH 1GCTC 4FUIA 1O3NA 1BHXB 4A1TA 2FYRA 4CRBA 2H6MA 4B74A 3RLYH 2ZCKP 1O2IA 3GY5A 2V0BA 3VGCB 1ZPZA 1MTNC 3P92A 3U98H 2AMDA 3OY5U 4CREA 1ZSKA 3KEEA 1GBIA 1BTYA 4YOIA 4ABJA 3FAOA 2QY0B 2ZU1A 2J95A 1THPB 1C2JA 3SNEA 5DGJA 2TGDA 2G51A 3M37A 3RXTA 4THNH 4ZHAA 4NFEA 1GI5A 1T4UH 2O8WA 3RXHA 2GT7A 3STJA 3SGAE 1AB9C 1O39A 2FP7B 1H9LB 1XVOA 2XYAA 3QLPH 1LVYA 5E0HA 1SGRE 2PV9B 1C5LH 2GDDA 1LHCH 3A82A 1V3XA 1V2UT 1DXWA 1H8IH 3SO3A 2R0KA 4Z6AH 1EATA 3A80A 5J4SA 3EAJA 1WAYB 1E35B 3EE7A 2A5KA 3T5FH 2FI5E 1VITF 1HUTH 1N6YA 1UW7A 4K1TA 3UOPA 3VEQB 1SGYE 1IQIA 1AFQC 3RXDA 1VCWA 2C4FH 3PWCA 4Q7XA 1P57B 1CGHA 1O2GH 4FOUC 4PROA 4B2AA 1UMAH 1EJNA 1A5GH 4HGCA 1O3KA 1JXPA 4K1EA 2P3TB 3DD2H 6CHAB 1KTTB 4I8GA 1JRSA 1C2HA 1GGDB 3RXEA 1HAXB 2H5CA 1JBUH 3AW0A 5EPYA 1FNIA 1T8MA 1IQLA 1TNHA 4K60A 4INHA 3T28A 4MLFB 4Q4LA 3NRLA 4VGCC 5HMAA 4BAOB 3SJKA 3M36A 1RIWC 2QXIA 4DGJA 1FXYA 1L1JA 5CHAB 3FP7E 4ISOA 1GJDB 1OP2A 1ANCA 1GBMA 2ZCHP 1O34A 1MCTA 3DSGA 2ODYB 4NA9H 2BD2A 2QC2A 1YCPM 1CQQA 1TRNA 2XTTB 1EP6A 1EZXC 3B9FH 5A8XA 4ASHA 4ZH8A 5TCAA 1QQUA 1TALA 3RXBA 3AAVA 1YGCH 5A0BA 4FU7A 2C93B 2SNWA 1ID5H 2AGEX 3L3TA 3JZ1B 2HGTH 2ZDKA 3PLKA 1MABB 1SGCA 1NPMA 2WPHS 4P00A 3RP2A 5LH8A 4YO9A 2SGQE 3TK6A 1YBWA 2YMSB 2V7QD 1UHBA 3A7WA 2OLGA 5L6NH 2P94A 1BRBE 1GBLA 5EOKA 4F4OC 3PO1B 2Y7ZA 1O3FA 2BDAA 5LPFA 5EXMA 3BIUH 4B1TA 1HAZB 1PPFE 1ELCA 3ODFA 7ESTE 2EI8A 4X6NA 3VB5A 2BDYA 5DP5A 4RN6A 5DG6A 3GICB 3O8CA 4JMYA 3H5CB 1GMHF 2Y5FA 3LJJA 3RXVA 3UNRA 2YOLA 4AOQA 1BTXA 1CE5A 1DT2A 1VGCC 2BHGA 1W10U 1VITG 1Z71A 1WQSA 3NKKA 3SNCA 5T6DA 5EQRA 5GWZA 1GVZA 1DDJA 1L0ZA 2GD4B 4M9FA 1PQAA 1HRTH 2ZDAH 7LPRA 1BIOA 4R0IA 5L2YH 3ZZ7A 1AN1E 1MZDA 1P3CA 3MNCA 4U30A 2KM0A 1O3HA 4ZKOU 2EC9H 3SHCH 1DANH 4LZ1H 3LKWA 1TMUH 3UAIC 1XXFA 1P02A 1SG8B 5B6OA 3MMGA 4ABDA 2K8IA 1GHYH 1YP9A 1ELTA 1Z1JA 4ISLA 2B9LA 2G8TA 5C67A 4XE4A 5F03A 1ELVA 2PGBB 4Y6DA 1ELGA 3GDVA 2Z9LA 2H1UA 2BY9X 2ZPRA 1EQ9A 3C1KA 3GY8A 2F9BH 3PB1E 1VKYA 1HAHH 4AGKA 2BD5A 2GDEH 1BB0B 2HALA 3BG4B 4SGBE 1LVBA 4WMFA 3O8RA 1YLDA 5F8TA 1QL9A 1C2GA 2ZNKH 1KXDA 4IMQA 1V2KT 1NRSH 5IYTA 3WWFA 4XBDA 1C2DA 1C2IA 2JETB 3V13A 1OSSA 1AQ7A 3GCHC 1DWEH 3O8BA 4A1XA 1WTHD 1OP8A 1C2LA 4TT3D 1ZGIA 2F9OA 1P12E 5A8YA 3FP6E 1BBRK 1COWD 1LPGB 1MU8B 2HVYB 4ZXXH 1MCVA 2FM2A 1O3MA 2IPHA 1Y3WA 1D6RA 2Z9IA 3BV9B 1JWTA 1C4V2 1E36B 4ZAEA 2KAIB 2RA3A 2WUBA 1AGJA 4DCDA 8GCHF 1G2MA 1YWUA 2WHXA 2G00A 1ZLRA 1C4U2 2ZIQH 4ISNA 1GMHG 1LDTT 1O2OA 4NZQA 2QF3A 2QYIA 1WV7H 5FCKA 1CGJE 4F49A 1B7XB 1ZGVA 4TWWA 1RRKA 1YM0A 1ABIH 1KLIH 2PP6A 1BTUA 1EZSC 3TJNA 1TGNA 3VB4A 3HATH 1AUTC 1GJ8B 3A7TA 1V2LT 2LELA 4UDWH 1DM4B 1LHDH 1QBNA 2TGPZ 3K6ZA 4NSVA 1NRRH 1KLTA 1EB2A 2QE7D 2G4UA 1IQMA 1HBTH 1MAYA 2Y82A 3E0NB 1HJ8A 3TGKE 1Y8TA 1M9UA 2JDID 1MMJN 2ZFPH 2FIRH 2IPQX 2RG3A 1UCYE 1BCUH 4E05H 3ZZAA 1HNEE 3ZV8A 2FX6A 2V35A 1ELBA 1K22H 3PV4A 4RT1A 4O97A 1EASA 4RKOB 3SZNA 2ZTYA 1BDAA 1V2QT 1MKXK 4NWLA 1E1QD 2Y81A 4ABAA 4NIWA 1C5MD 3UFAA 1A61H 1WCZA 3MU5A 1HAVB 4AG2A 1KLJH 3D62A 1GBCA 2BOKA 1B0EA 2TRMA 1GHBF 1OHHD 2BD4A 1TOMH 2OK5A 2BQ6B 2VIPA 2XCFA 1ESAA 3E90B 4CRGA 2NU0E 1EPTB 3MU1A 1LTOA 5H4IB 1YPGH 1BTHH 5K7RA 1RFNA 1NRPH 1DPOA 3MU0A 1C1QA 1UK3A 1P2IA 4MPVA 3DCLA 3T27A 1H4WA 1SMFE 4Q63A 2I6SA 1GBAA 2P3FH 4YT7H 1J8AA 3UNSA 3RU4D 2ZU2A 1SB1H 2QXJA 1SLUB 1V2NT 2SGAA 1CA8B 1BMLA 4XOJA 2V3OH 3PWBA 2F3CE 3NWUA 1RJXB 1QRWA 2IOTA 4AYVB 1IQJA 1C1MA 1AWFH 4IN1A 4OS2A 2NU4E 1ZPBA 2I6QA 4IGDA 4YOGA 4LZ4B 3RXPA 3ZYDA 1B5GH 3FOAA 3HGPA 3MO9A 8GCHG 5LPRA 1UTOA 3CS0A 2WV4A 3HGNA 5I25A 1A3BH 4WVPE 1LQDB 4MPXA 4JZIA 3RDZA 1GHZA 2ZG0H 5HGGA 2NU1E 2W3KA 3TJUA 1V2JT 4I8LA 1Y59T 4BOHA 3KQ5A 4Q2KA 1JIRA 1G32B 3O8DA 4D9QA 1C1SA 1MQ5A 1BHXF 3F2GA 4INLA 2BD9A 3M3SA 4H4FA 1Q31A 3SUEA 1V2MT 2QV1A 4UD9H 1V2TT 4CBNA 2BDGA 2HNTF 2J2UA 1HJAB 5TCCA 4IN2A 1OS8A 3M5NA 2XW9A 1O5DH 3KQEA 4E06H 3KQCA 2A31A 5T3HA 1HXEH 1IQKA 1C5YB 1SQOA 2FDAA 2G52A 2RCEA 3P70B 5GIBA 1MBQA 3KQDA 2PKAB 1BJVA 2ANYA 4TY7A 5DK1A 1W2KH 1CT0E 3BEIB 1P9SA 5DP7A 1W11U 3UQOA 1WTGH 1DWCH 1QB6A 1SI5H 1C5PA 1DUEA 2PFEA 3A83A 1O2PA 1A4WH 1F0TA 2O8MA 3NCLA 5EG4A 2XBYA 1GBKA 1WU1A 1K9OE 3N7EA 3ZZ9A 1D3PB 1UTMA 3OE7D 4ABEA 1GHBG 4X6MA 2ANWA 4DOQA 1YCPK 4JYTA 1KXEA 2ZC9H 2BLVA 3VB3A 3G01A 1GBFA 1P2OA 4I8KA 1GL0E 5KGOA 1GDQA 3SQHE 3RXSA 2ZFFH 2GP9B 4FUJA 2AS9A 3M35A 4YM9A 4KKDA 2QF0A 3RUOA 3E3TA 3P6ZB 2WINI 1SGQE 3VXEH 1IQHA
chains in the Genus database with same CATH topology
2AH4X 4HI3A 1G3DA 1KXAA 1G3BA 2BD3A 3SU1A 3IG6B 1QCPA 4ZROA 4MPUA 2PWXA 5C1XA 3RXUA 1AFEH 1J16A 2SNVA 4K5ZA 1P2QA 3ZZ4A 5HXFA 2G5VA 3E0PB 1DXPA 3NPSA 3BIVH 4Y76A 4WXVA 2KAIA 1P2JA 1GHAF 1T4VH 3RXLA 1SLVB 1TX6A 1P09A 4GAWA 3QWCH 5ESBA 3A81A 5C5OA 5A09A 2K1QA 2Z9JA 4ZHLU 1SBWA 1FUJA 5E8EH 1UTQA 3HKIB 4AFZA 2SGDE 1Z1IA 1TRMA 3BTME 7GCHF 2FOCA 4I33A 2BY6X 1CBWB 4O3UA 1Q2WA 3SU3A 4AB9A 1O38A 1SPJA 3LGVA 4NG9H 1RTFB 2GCTC 3QTVH 3U8RH 1MBMA 3MO3A 1FY5A 2ZDMA 1Y3XA 5JBTA 1E0FD 3V0XA 4ZKRU 3DFLA 3MH7A 1TMBH 1SR5C 4AN7A 2J9NA 4FUDA 3SV8A 4UONA 2Z3EA 3H7TA 1Z8JB 3SGBE 2O8UA 4BAMB 1A0HB 2D8WA 1F7ZA 5DPAA 1GVKB 1P0SH 1AKSB 1TPPA 2STAE 1SGIB 3K6YA 1MUEB 4TWYA 2OC0A 3T29A 3A7XA 1D3TB 1FY1A 1HAVA 1XUIA 2JH0D 1CGIE 3DT0H 4I32A 3UTUH 4Y11E 1QNJA 1O37A 2VWLA 3LGWA 1A0LA 1H9IE 3TH3H 2W7UA 4Y8XA 1O3BA 1HFDA 2J34A 3W94A 1CT2E 2ZFRH 2OQ5A 5SGAE 2H9HA 1EPTA 4IC5A 3TGIE 2ESTE 3TJVA 2P16A 1Y5UT 1A0JA 1LHFH 1WUNH 2VIQA 3HK6B 2ALPA 2FWWA 1QJ7B 3TJOA 1UO6A 2GZ8A 2PKSB 4B2BA 1IAUA 1TQ7B 3CS7A 4WJG2 1NT1A 1O2JA 1GI4A 2BD8A 3URCA 5C20A 5A0CA 2OBQA 1H8DH 2FO9A 3MFJA 3GDSA 4X2XA 3RXQA 1O35A 1O30A 4UFDH 1C5TA 1AY6H 1F0UA 5FPSA 1GHAG 1QHRB 1BBRE 1D4PB 2GMTC 3FVFB 3SNAA 1C2FA 1QIXB 2NU3E 1LVOA 1EP5A 4WH6A 4Y7BA 1HJ9A 1ZTJA 1TPOA 1O2SA 1ZYOA 7GCHG 1TPSA 3GYLB 4WF8A 1OKXA 2PHBA 1QR3E 1L2EA 2A45B 4ABFA 1XUGA 4YZUA 5EW1H 4NZLA 1W7XH 2BVRH 1PJPA 3OX7U 2OC8A 2P8OB 1IQEA 2THFB 1DLEA 8LPRA 2JKHA 2OUAA 1ANDA 2ZP0H 2OINA 2OBOA 1BUIA 2ZTZA 3W95A 4CRDA 2J38A 4WY3A 3BTEE 1GJBB 1MD7A 4H6SB 5FCRA 1X7AC 3Q3KA 2XBVA 3TK5A 4FXGH 2PKAA 1MQ6A 4ABHA 1YLCA 3TITA 3V12A 1UVTH 1YPHE 2BOHB 1C5SA 1TA2A 2TIOA 1SQTA 3LU9B 4YT6H 1K2I1 6GCHF 1QBOA 5JYIA 5F8XA 1QBVH 1GG6B 3GISB 2CXVA 1DITH 1P2MA 1C5OH 4RSPA 2VIOA 1EAUA 1T32A 4X6OA 2OP9A 4A6LA 3HKJB 1XXDA 4AX9H 1XKBC 1P2KA 3RMMH 3SUFA 1TRYA 1K21H 5JPMH 3V7TA 2AGGX 3S7HB 1UTKA 2PTCE 3KHVA 3SV2H 3SW2B 4HZHA 1ESTA 2ZU3A 2GCHF 1BTWA 2W5EA 1FQ3A 3PLPA 4JZFH 3BTQE 1N8OC 2PSXA 1TOCB 2Y80A 8ESTE 4J2YB 1G37A 1GI0A 2FOGA 1GJ5H 1WYKA 2BXTH 4DG4A 1FJSA 3SHAH 3UPEA 1C5ZB 4BAKB 5IDKA 1O5CB 2VB0A 1J17T 3N7OA 4JYVH 4X0WU 1O3OA 3A7VA 1BMMH 3MI4A 1P9UA 1PPEE 4U2WA 4B73A 1OWJA 1SOTA 4X2VA 2WPIS 1OXGA 3RXMA 3TH2H 1DX5M 1A3EH 4FU9A 4AFUA 1ORFA 2PLXA 1BOQA 4TPYA 1TGTA 1TFXA 1MD8A 1HAGE 1TQ0B 1W0YH 5JBBS 2OTVA 3KGPA 2BQ7B 4MQAA 1ARBA 5FPYA 1HLTH 2HVXA 4INKA 1ANBA 2B8OH 3LGTA 2BX4A 3A89A 1S82A 3AW1A 3BN9A 3SBKA 1ESBA 1UJ1A 3SUGA 1DWBH 1O2MA 2GX4A 4I7YH 1MTSA 2CHAC 5DKMA 3TNSA 2RDLA 1O2ZA 1GBDA 2GZ7A 4BAQB 4AZ2B 1OWHA 3GY3A 1BZXE 4YOJA 1KDQB 3OSYA 2TGTA 1ZPCA 2ZA5A 1E37B 4X2YA 1C5UA 1K1PA 5FPTA 3OU0A 3E6PH 2H5DA 4WMDA 2QA9E 1O2VA 1ZHMA 4NA8A 4FUCA 2CV3A 3ATWA 1KIGH 2ZKSA 3BTDE 5EXNA 1S0RA 2B5TB 6GCHG 3U1JB 4ZUHA 4K3JA 1MKWH 1AKSA 5LPEA 1LKBA 4CR9A 1FY8E 2VGCB 2R2WU 2QN5T 2A5IA 4O3TA 2D2DA 3KN2A 4JK6A 1DOJA 1NZQH 1O2QA 3MOCA 1HDTH 3SI4H 4J1YA 1TX7A 2ZHDA 4FVBA 4X2WA 2A4GA 2P59A 1O2YA 2ZQ1A 3PROA 3ZVAA 3SU0A 3TIUA 1G30B 2B0FA 2ZGXH 1AVXA 1VJAU 2GCHG 4K1SA 1DY9A 3MU8A 3SJ8A 1HB0B 4WXIA 3ATLA 5E2OA 2PSYA 1QRXA 1PQ8A 3UUZA 4E7NA 2ASUB 1ELAA 3NUMA 2CN0H 2BLOA 2GT8A 1N1LA 2HLCA 1GI7B 2GV6A 1O3PB 4BAHB 1P04A 3ZZ6A 1TX8A 1CA0C 3WY8A 3SN8A 4CHAB 1FMGA 1KYNA 1Z8IB 2ZPQA 2OC1A 4Q7ZA 1UK4A 1DUAA 5A0AE 5FXLA 2ZEBA 2PGQB 1AU8A 1J14A 4XSKU 1LO6A 1P05A 3SJ9A 1C1VH 4D8NA 2AGIX 2EI6A 1NN6A 3LH3A 4WWYA 1W14U 3VGCC 2HNTC 1HAYB 2UWOA 3UREA 1SVPA 1O5EH 1D6WA 2UUFB 1VCQA 1MTWA 5AHGH 2YNAA 4KELA 4ZXYH 1IQFA 4E7RG 1FY4A 2FESH 3ATKA 2Z7FE 4IBLH 3LH1A 3RC5A 3S9BA 4O9VA 2F9UA 2C8ZB 1BITA 1GCDA 1MH0A 1Z6JH 2B7DH 3KCGH 1L1NA 5DP4A 4UEHH 3ZV9A 3F9FA 4DIIH 3S7KB 1TWXB 4NIXA 5LGOA 3P17H 3F68H 5DO4H 4OGXA 4XBBA 1IHTH 4I31A 3BTKE 5TJXA 2AMPA 4ABGA 2A7JA 2PW8H 4ZKNU 1S0QA 2XC0A 3T62A 3UY9A 1KSNA 1TNGA 3AVZA 3SJIA 1ZSLA 3P95A 3FZDA 1ZTKA 1GBJA 3QO6A 1YYY1 2AFQB 2O8TA 1O3JA 1RTLA 2ZDVH 1XUKA 1WQVH 1LHGH 2XBXA 4CR5A 3MNBA 1SGPE 1PFXC 2SFAA 2ZFTA 2QAAA 2A4OA 2YNBA 5T6GA 2G81E 1TONA 4NA7A 2AEIH 1OP0A 1XMNB 6CHAC 1ELFA 4ZKSU 3PYHA 1HAIH 1GGDC 1SGFA 4GVUA 4KTCA 3L33A 1TMTH 5AF9H 1ZMNA 3SNDA 1C2EA 1EX3A 1RGQA 4D76A 2AIPA 4JZDH 5FX6A 3ZVBA 1WSSH 4ZMAH 3LIWA 3LT3A 2ZZUH 1VCPA 1VR1H 5CHAC 1V2WT 1GCTB 1FPHH 3ZZ8A 3MYWA 3S9AA 1ACBE 2ZDLA 1L4ZA 2XXLA 3RXAA 1QURH 1MTNB 2FOEA 4FUGA 4MVNA 3A88A 2A1DB 1NFWA 1CT4E 1UVUH 1TNKA 1C4Y2 2QGRA 3P8NA 1EKBB 1C1WH 2TBSA 3HK3B 1C2MA 4X1RU 5FBIA 3Q00A 3BF6H 2FEQH 4AFSA 4MNVA 2ZFSA 3BEFB 1J15A 1AB9B 1EOLA 1PQ7A 1HYLA 1AD8H 2R3UA 4DT7B 1UCYH 3VXFH 3ATMA 3PO1C 1O5GH 2A4RA 1GMDF 4Y71A 3MHWU 1GJ9B 4BTIB 1TNJA 3P8GA 4DIHH 4TPIZ 1DWDH 1KDQA 2Q6FA 2P95A 1TE0A 5E2PA 3K65B 1AZZA 4K8BA 3RXOA 5E0JA 3T26A 1GI8B 1ZSJA 1GHXH 2BMGB 1AFQB 1GI1A 2A0QB 3EA9A 2P3UB 5GJ4B 1AWHB 1GI2A 2C8WB 2VWOA 2XWBI 1A7SA 5FBEA 1KY9A 1XUJA 1EAIA 1Y3YA 1V2VT 3L6PA 5EU8A 2UWPA 1O5BB 1NRQH 3RU4T 1ZRBA 4JK5A 2VWNA 5C2ZA 1DS2E 1N6XA 5E0GA 1OYQA 1ARCA 4VGCB 2ODQA 4K8YA 4IW4E 1EOJA 3ZVGA 1NY22 1RIWB 1SLWB 1HXFH 2WYGA 3ZZ5A 1HAPH 1C5QA 4B76A 3ELAH 3RM2H 1MU6B 1LHEH 1BMAA 3ITIA 3UR6A 2O9QA 4Z0KA 1YPHC 2A2QH 3SQEE 1O36A 3F9GA 2XNIA 1GI3A 2HNTE 4X1QU 1L4DA 5JB9S 2R3YA 1W7GH 1VZQH 1YKTA 3Q3XA 1AMHA 1P8VC 3A7YA 3A8BA 4YLQH 4A7IB 3UQVA 1BJUA 2Y5GA 4ISIH 1THSH 2BZAA 2Z3DA 3RC4A 1UK2A 2AIQA 1JMOH 4AYYB 1ETSH 1AUJA 2CGAA 1GI6A 1UTLM 2FS8A 4CH2B 1TLDA 3UR9A 2HOBA 1GHWH 3BG4C 2R9PA 2FI4E 3RXFA 4HFPB 1C1PA 4D7GA 2BDBA 4JCNA 4K2YA 4X8TH 1UTPA 2JETC 3C27B 3M7TA 4MNWA 2Q1JA 1NFUA 1FIWA 2FXRA 1ZHPA 3KF2A 3U8OH 1NC6A 1GMDG 3OTJE 3ZVCA 3U1IB 1Z8GA 1P2NA 4Q80A 5EQSA 1C1OA 2ZQ2A 5ABWA 4X1SU 4UFGH 1UTNA 2PTNA 3MWIU 3UWIA 1U6QA 1VGCB 5DP3A 3SI3H 1K28D 3PM3A 5L2ZH 4DJZB 2VU8E 3QGJA 4NIVA 4X6PA 1QFKH 1A2CH 5EQQA 1O2HA 3GY7A 3P8FA 2BDHA 5G4BA 3MNSA 3SU6A 2FPZA 1GMCF 3FANA 2C8YB 2BVSH 4B2CA 2G55A 2UUKB 1AHTH 2JH5D 3MH6A 1G9IE 4UFEH 1C1RA 1S85A 5FAHA 1KXFA 1THRH 2ILNA 1JRTA 6LPRA 2ZHEH 1HCGA 1TGSZ 3PMAB 4X8VH 1SFIA 2BYAX 2BTCE 1A46H 1SL3A 4B71A 1V2OT 4DURA 1PYTC 3UNQA 3EE0B 3K2UA 4CBOA 2BVXH 2GZ9A 1K1OA 1DSTA 1QB1A 3H7OA 1K1MA 3LGYA 4Q7YA 1S5SA 5GPIB 3EYDA 2ODPA 1TBZH 2UWLA 1OYTH 1BQYA 1UVSH 1O5AB 2QIQA 1MTUA 2ANKH 1PQ5A 3ATIA 2VH0A 4GCHF 2FTLE 3S69A 2OD3B 1CHOF 1RS0A 4XDEA 3ZVEA 1OWDA 2XC4A 2ZGJA 3A84A 1OPHB 1HGTH 1F0SA 3GCHB 1LPZB 1EPTC 4A1VA 4NCYA 3SJOA 1YPKH 4OS4A 4O03A 1OOKB 7KMEH 3GY6A 5JBAS 1F0RA 1BRAA 1TBRH 2BD7A 4OS1A 4MDSA 1SGFG 3U8TH 2BZ6H 2BDCA 4YLUA 1OX1A 3MH4A 1LMWB 3BTGE 3GDUA 3LONA 1O3IA 3ZZCA 3GY2A 1SGNE 1UVPA 1ZR0A 1QB9A 3TU7H 3QX5H 3PLBA 4MNYA 3EA7A 2P93A 1GI9B 3LOXA 4KGAA 3KNXA 1W13U 8KME2 2ZCLP 1O3EA 2H9TH 1O3DA 2Y6TA 1GWAA 3KIDU 3JZ2B 5L30H 1G2LA 2FODA 4RKJB 1E38B 3ZYEA 1DY8A 1XX9A 3F9HA 2PUXB 2BY7X 1FAKH 3LPRA 2DE8A 3MU4A 4BTTB 2FTMA 1GMCG 2O8LA 1L1GA 1TGCA 4M7GA 3RM0H 4GSOA 1S6HA 3F9EA 1NS3A 1SGTA 2HRVA 2CMYA 5GDSH 1AE5A 3SORA 2W26A 3IITA 3OY6U 1H9HE 1TYNA 1C1TA 2DUCA 1T8OA 2ZPSA 4H42U 4Y7AA 2VIDA 3T2NA 1HJAC 4R8TB 2ZI2H 1O33A 5EPNA 4GUXA 2VWMA 4LOYH 2M5TA 4UFFH 3STIA 5CMXH 4AG1A 1ANEA 4OGYA 3TPIZ 1P10A 2VIVA 2FYQA 5EW2H 2NWNA 3K9XB 2STBE 6ESTA 1BBRH 3IWMA 4Y8ZA 9LPRA 2A5AA 1HPGA 4UE7H 3SOSA 3LGUA 1V2ST 4K69A 1WOFA 1W0ZU 2W3IA 1Q3XA 1YPEH 4HTCH 3GCOA 4GCHG 1YC0A 2FLBH 4KTUA 3RMLH 1ZJKA 1GJ7B 1CHOG 5F8ZA 3QN7A 1EB1H 1NU7B 1TB6H 5A2MH 4GHQA 2FI3E 4Y0ZE 1E34B 2F83A 1FDPA 2XRCA 1V2PT 3A8AA 1FZZA 2FOHA 1JIMA 2A32A 4D9RA 9ESTA 1GJ4H 3PTBA 4ISHH 3VB7A 3NZIA 4I8JA 2FOBA 1V6DA 1J9CH 1QGFA 4OS5A 4CRFA 1DFPA 1K1IA 1F5LA 1O5FH 1UTJA 1TAWA 1CO7E 3A8CA 5DP9A 1O3AA 1Z8RA 5EODA 3SV6A 1MAXA 1G36A 1GL1A 3D49H 4JZEH 2Q6DA 1ZRKA 5HM2A 1FONA 1SOZA 4NIYA 1C5WB 3AAUA 2G4TA 2A7HA 1AE8H 3I77A 1QL7A 2HPPH 1CU1A 1MKXH 1K1JA 1HV7A 3BTTE 1T8LA 4AFQA 3M7QA 5C5NA 2VVCA 2WV5A 4YESB 3MO6A 2OC7A 5C3NA 5GXPA 3B23B 1VJ9U 1P3EA 1O3LA 5DP6A 1CBWC 3RXJA 4TY6A 1GBBA 1T31A 3VPKA 4FUFA 5I46H 4MNXA 2IJOB 1C9TA 1F5RA 3R0FA 4IMZA 1EJMA 1O32A 3SV9A 1VITH 1CSOE 1EZUC 3R3GB 1EJAA 1XVMA 1SQAA 3SU5A 4BANB 1IOEA 1EZQA