3E3TA

Structure of porcine pancreatic elastase with the magic triangle i3c
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title A magic triangle for experimental phasing of macromolecules
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA01
2ODPA 2Q6DA 2GMTB 2OC7A 1BRBE 2BLQA 5DK1A 3E1XB 1GJBB 3SU2A 5F8TA 1MTSA 3KQDA 3HGPA 5EGMA 2DUCA 1V2QT 5LPEA 4E7RG 2R2WU 3RMNH 3BTQE 1ELGA 1TONA 1EAUA 4XSKU 2Y5FA 2OP9A 2UUYA 3GY7A 1GJ7B 2O8MA 4NA8A 4NWLA 3KNXA 4ASHA 4KTUA 1DY8A 2EC9H 1BJUA 2PGBB 4VGCC 4YOIA 1SGIB 4BNRA 3PLKA 2A4OA 1BIOA 3FP8E 2ZU3A 2AIPA 3A82A 3VB4A 3ATWA 3KN2A 1T8MA 2W3IA 3ODFA 3NZIA 1O2WA 1GI1A 1WQVH 4ABEA 1TALA 2Z94A 1TA2A 2ZU1A 4I32A 1IQJA 1EP5A 5A8XA 3TLOA 2ZFRH 3UFAA 3URCA 1D3DB 1HXEH 2JH6D 4Y7AA 5C5NA 2VIVA 1V2OT 4IN1A 1P0SH 4K2YA 1P57B 5C1YA 2F9PA 1DICA 4CRDA 1P05A 1PPEE 5IDKA 3DHKH 1SGQE 4FU7A 1HGTH 2ZI2H 1TOMH 1EAXA 2ZDVH 1EQ9A 1O35A 1C5RA 4A6LA 1FIWA 1KLJH 3IITA 4ABDA 4FUEA 1C2EA 3M3VA 5BRRE 3U1IB 3BF6H 2DE8A 4K1TA 3T2NA 4Y8XA 2FI5E 2ZWLH 2FX6A 3O8DA 1NN6A 1ZJDA 1AVGH 3U9AH 1UK3A 1MQ5A 1MUEB 1XKBC 3O8BA 2R0LA 4HTCH 4RKJB 1RIWB 1GJCB 3GCNA 5EQRA 4PROA 3SV2H 1FIZA 2ZFFH 2WPKS 1LTOA 2ANMH 1YPKH 2PKAA 3TJVA 1CQQA 1NRPH 1FY5A 1YM0A 4NGAH 2J92A 5DGJA 4YESB 1SGRE 1K1OA 2HNTE 1AN1E 3LGTA 2JETC 2W7UA 1YP9A 3V3MA 2VH6A 3MH7A 2P94A 4GAWA 3QX5H 4GHTA 1LQEA 2VIWA 1HAYB 5A0BA 4K69A 1D6RA 1FUJA 5FBEA 2H9HA 2Z9GA 8GCHF 2HGTH 5EODA 1W0ZU 3KHVA 3VB6A 3BSQA 1QB1A 1C1OA 4ZUHA 2WV5A 4IC6A 3ZV8A 3DUXH 2BVRH 4AFUA 1MCTA 2BB4A 2VH0A 1MKXH 1DDJA 3GY3A 1C5VA 1P01A 3RMMH 3BN9A 1PPZA 2LPRA 4ZKSU 2AIQA 1TNKA 3PV4A 1A0HB 1NTPA 1DWDH 1CU1A 3VEQB 4FUGA 3A7ZA 3LGUA 2ZCHP 2ZDLA 3RDZA 1C9PA 2VJ1A 4JYVH 2ZTYA 4ABAA 1DE7H 4AGJA 3NK8A 1Z6EA 5AVDA 1PQ7A 2PKSB 4IGDA 3M3SA 1YCPM 1GJDB 2AGIX 4GVUA 5BPEA 1FY4A 4Y71A 3LGYA 3SU4A 4MPVA 1GI9B 1O3LA 1ZHPA 2BDBA 3T62A 4X1NU 1TQ7B 2BHGA 1THSH 3MU5A 5E0GA 1L1NA 4MPXA 1EB2A 1YPEH 3SQHE 1QCPA 3A89A 5JBCS 1KYNA 3QDZB 1DFPA 1YPHC 1QTFA 4SGBE 2AERH 3RXOA 2OBQA 4B2AA 1IQKA 3LC3A 1AUTC 3L6PA 2BOKA 1OWDA 5EU8A 2FDAA 2ALPA 3S7KB 1KXAA 2ESTE 3M3TA 3PO1B 2WUBA 5A8ZA 3FANA 2FM2A 4UDWH 1E36B 1ZTLA 4WWYA 3ZZBA 4UFEH 4RKOB 2ZDKA 3ZZ4A 2O9QA 4U2WA 3IG6B 1HAHH 2FS9A 2FLBH 4NIXA 1HAGE 1EJAA 1TQ0B 1UCYH 1RTFB 1F5KU 3K2UA 5GDSH 1O2TA 2QXIA 1Y3WA 1H8DH 3TK5A 2NU0E 5TCAA 3M7UA 3UUZA 3ZVAA 1KXEA 1QL9A 1PJPA 1TGTA 4DURA 1VITH 1JIMA 1VZQH 3PLBA 1EJNA 3SJ8A 1LO6A 4AN7A 3RXJA 2BD3A 3UR6A 2O8UA 4K1SA 1S6HA 2BD8A 4YLQH 1GMCF 1OWKA 4AZ2B 1QJ6B 1D6WA 2TGTA 3RXAA 2ZPSA 2A7HA 1ETTH 1QB9A 3GY2A 3ZZAA 1TPOA 4AG2A 3K65B 2R0KA 2BOHB 1GDUA 1N6YA 4YLUA 1RRKA 3QWCH 9LPRA 2FWWA 2XNIA 1AO5A 1F5LA 4Z0KA 1WSSH 1K1JA 2GV7A 2ZFQH 1F0RA 4K1EA 2OC1A 3E0PB 4K3JA 2Y7XA 1Y8TA 2AGGX 1O2YA 2B8OH 2GKVE 2QYIA 5FCKA 3E6PH 3ZZ8A 1BTHH 1QRXA 1C4U2 1W3CA 2Y82A 2XBXA 5K0HA 2QAAA 3SV6A 2OQ5A 2PKSC 4Y8ZA 3R3GB 3RU4T 3ZZ5A 3FAOA 4OS7A 3SV9A 4WXVA 1GBMA 1FY1A 4ISHH 2PR3A 3B23B 3F9FA 3A85A 4MTBA 3A7VA 4OS4A 4ISLA 5GCHG 3T25A 3F68H 2NU2E 1ELCA 1OWIA 4FXGH 1JWTA 4DY7B 5AFYH 4O03A 1CE5A 2EA3A 5TJXA 3W94A 2FODA 3GY6A 4FUCA 1LPZB 1SOTA 2FOHA 3LOXA 4NFEA 3RM2H 1J17T 2HNTF 1F92A 4KKDA 1W10U 3D65E 1UHBB 1GI5A 4KELA 2THFB 3MU4A 4TWYA 2C3SA 2FOCA 4CR5A 1ORFA 1MBMA 3EDXB 3A8AA 4WH6A 1WYKA 2G5VA 3BTDE 3ATMA 3K9XB 5T6GA 4AG1A 1OXGA 2TGPZ 1O2MA 2H5CA 1Z8GA 6ESTA 1L1GA 1GBKA 2SGQE 3GCHC 4XOJA 2ZFSA 4I8JA 1HAPH 1OKXA 1IQEA 1DM4B 1OWEA 5ESBA 4B73A 2B9LA 4LXBH 1ID5H 1TBQH 3M7QA 5EXLA 1MZAA 2GX4A 2GD4B 3QO6A 4ABBA 1IHSH 1MU8B 4U01A 1KLIH 1GJAB 1SMFE 1GPZA 2A4GA 1GBDA 4TYDA 2J94A 1SGEE 4GPGA 2A2QH 5CMXH 3GICB 1QA0A 1P3CA 1SPJA 3HKJB 1HV7A 3LC5A 1QB6A 1O2HA 3SBKA 1C9TA 2SNVA 3B9FH 1M9UA 2KAIA 1J15A 1TGSZ 1Z8IB 1QBOA 1H9LB 3JZ1B 1ELTA 1UTOA 1RS0A 1Y3UA 2YNBA 4FUBA 1YPMH 2WPLS 1YPHE 2OQUA 5DP9A 1QHRB 2H1UA 1O3KA 2ZGBH 1O32A 5GWZA 3NCLA 4AGKA 5FHTA 1SQTA 1B0EA 4O97A 1MMJN 1EP6A 1S85A 4UE7H 2BVXH 4I31A 5A2MH 5EQSA 1MD8A 5HYOA 1HAOH 1T32A 3MU8A 2ZCLP 4OS6A 1MKWH 2F91A 1GWAA 3HK6B 1TOCB 4NZLA 3O8CA 1P11E 4KTSA 1GI4A 4JCNA 1UVSH 3HATH 1BQYA 4FVBA 1GVZA 2QA9E 5L6NH 1NU9A 3O8RA 5C1XA 1FLEE 1NY22 1ACBE 4D9RA 1FI8A 2YNAA 2Z9JA 1DS2E 3BG4B 4D76A 3A84A 4O3UA 2Q1JA 4THNH 4I7YH 2BDGA 4BAMB 2V3OH 2SGAA 1P09A 2ZGCA 3MH4A 1TFXA 1NT1A 4FVDA 4H6TA 1LVYA 1C5YB 4K8YA 1OP0A 2VWOA 3MNSA 4X2XA 1GJ5H 2GZ8A 4FUIA 3QGJA 1WOFA 5C3NA 1GBBA 2BY5X 1VCPA 4MPUA 1ZHRA 1P2QA 3UTUH 2BDYA 3MH6A 3STJA 1F0SA 1GDQA 7LPRA 1SSXA 2BQ6B 4JZEH 2STBE 3SGAE 1PQ8A 1TNGA 1ZSKA 3FFGA 1BRCE 3S0NA 1QGFA 4TY6A 3GOVB 1SB1H 2VNTA 3UNSA 4ESTE 1C4V2 3RXLA 1G9IE 1SFIA 3Q3KA 1D3TB 2H5DA 3T27A 1ANDA 2G5NA 1P06A 1RFNA 4B2BA 1LVMA 3URDA 3BG8A 2QY0B 1VGCB 1AZ8A 1FAKH 1GI0A 1EJMA 2HPQH 2R9PA 2Z9LA 3P8NA 2GCTB 1XUGA 2OUAA 2ALVA 3KQEA 2ZGXH 3ZVEA 1ESBA 1N6XA 1ETRH 2HNTC 2PWXA 2W3KA 1O37A 3P70B 1O5DH 1RJXB 4E05H 8GCHG 4A1VA 1C5ZB 1SQAA 3EA7A 2ZHQH 1UVOA 2GZ9A 2PKAB 3BEIB 4BTUB 2XC0A 1O3OA 1BUIA 1N8OB 1FV9A 1C1VH 1XVOA 1DUEA 1BMMH 4B2CA 1S82A 1O3HA 1EZUC 3RUOA 1CBWB 4FUFA 4ZXYH 3TJOA 2BYAX 4CHAC 3TJUA 2BMGB 1GHXH 4OS1A 1K2I1 3TK6A 1CHOG 1O34A 1GHAF 1TWXB 3FP7E 4AFSA 1K22H 1DXPA 4UEHH 1Q31A 2O8TA 1GJ4H 2OC8A 2HLCA 1DWBH 3WY8A 2J38A 1FPHH 1GMDF 3MNXA 1V2NT 5ABWA 2OXSA 3BTME 1C1RA 1IHTH 1O39A 3A87A 4X6OA 1EB1H 1O2KA 2P3UB 2A4QA 2BDAA 2AMDA 1BTZA 1THRH 1BTUA 1TRMA 1O5GH 1NPMA 3S9BA 2ZECA 2F9OA 2HALA 1T7CA 1GI8B 5AFZH 3T28A 1SBWA 1AGJA 5CE1A 5JYIA 4FUJA 4YOGA 1XM1A 2I6QA 2F3CE 1AKSA 5JBAS 1V2LT 4DT7B 1DSUA 1YLCA 4CRFA 3CENA 3FZZA 3ATLA 1NFUA 4XDEA 3T5FH 3PROA 1WAYB 1SI5H 1MTUA 1XX9A 2XXLA 1MTVA 1WUNH 1TGCA 3U69H 3T29A 3SO3A 1FN8A 4M7GA 4BAQB 1LCYA 3BTHE 1HJAB 5EG4A 5IYTA 6GCHG 3SV8A 2B0FA 4J1YA 3RXIA 1SLUB 2A7CA 1JXPA 4GSOA 1BHXB 1GHBG 2VGCB 3ZV9A 3UQOA 4Y7BA 6CHAB 2GCHF 5LPRA 3KGPA 4XFQA 1QRWA 2XCFA 1XMNB 4NIYA 5T6DA 3OTJE 4NFFA 3P6ZB 2WINI 4UD9H 4Y11E 4IN2A 1J16A 1FPCH 1BBRE 1HAIH 2ZHEH 1SLXB 1MZDA 2P95A 3E90B 1AU8A 1C2GA 1V2PT 1Z71A 3SNAA 1ZLRA 2A2XH 1CGHA 3RXFA 3DFJA 4INHA 1LHDH 1P2NA 1XUHA 1XUKA 5E0HA 1B5GH 5FAHA 1CSOE 1A61H 2IN2A 1T8OA 2STAE 2J9NA 3V13A 2OBOA 1L4ZA 1ZTJA 1ESAA 1TLDA 1N8OC 1BTXA 2PUQH 3SI4H 4WMFA 3QN7A 4H6SB 4DIHH 4Y0YE 1CBWC 1PYTD 1TMTH 3V0XA 1IOEA 4BOHA 1BBRK 2FOFA 1D3QB 2V35A 3D62A 4JZ1A 1A1RA 2C8WB 2UUFB 2BVSH 1UTPA 2BQWB 2RCEA 1TX8A 2PGQB 1BITA 1DVAH 1GBFA 1SGFA 2P8OB 5DP3A 2HVXA 5DPAA 2QV1A 1S84A 4K5ZA 1LKBA 2BM2A 1AFEH 2QXJA 4Q7YA 1O3GA 1E37B 1UVPA 5JB8S 3MTYA 4MLFB 3RXCA 4Q7XA 5GIBA 3RM0H 1C2FA 1HLTH 1V2UT 4E06H 1T31A 5J4QA 4UFFH 8KME2 3SU0A 3LH3A 5DKMA 1C1TA 3QUMP 4ZHMU 3TGKE 1O2JA 2ZC9H 3IWMA 5TCCA 1G3CA 1XKAC 2B5TB 2UUJB 2FI3E 4CH8B 4WVPE 2BX3A 2GMTC 1L4DA 1O38A 1LPKB 1C2MA 3S9AA 1SHHB 3V7TA 1BRAA 1C2JA 2Z7FE 2XYAA 1ZPBA 3EA8A 4MNYA 1AE5A 3L3TA 1PPBH 2NU3E 3BTGE 1QFKH 3MO6A 4MNVA 5DP5A 3GCTF 1GI6A 1E35B 2ZU2A 2WYGA 5DP6A 2OLGA 1D4PB 2VGCC 1VR1H 4CBOA 3SU5A 2BZAA 1SGCA 1AZZA 1MTWA 2A4RA 3RMOH 1P04A 7KMEH 1ZYOA 2FYQA 1FY8E 1QR3E 5HM9A 2ZCKP 1YCPH 3RXDA 1CA0B 1S6FA 4LK4A 4U30A 1DITH 3MYWA 1O3BA 4JZDH 1ELDE 3Q77A 2BXUH 4ZHAA 1ZJKA 2GT8A 3NUMA 1BZXE 1AWFH 4X1PU 2IOTA 3PWCA 2WPMS 2EI7A 2J34A 5GJ4B 5L30H 1UJ1A 3MU0A 1GHVH 3SJOA 3VXEH 3SNCA 1OYTH 2P16A 4OS5A 3AAUA 2PW8H 2FMJA 4YO9A 4YZUA 3DFLA 3RMLH 2SGEE 1A0LA 3RXKA 2C93B 1E38B 2XC4A 2KAIB 1GJ8B 1K21H 3RXVA 1V2ST 1AB9B 1EUFA 4IC5A 5C1UA 3GYMA 4IBLH 2F9VA 3EE0B 4NG9H 3SUEA 2EI8A 1FJSA 4F49A 1IQGA 1BTPA 3RC5A 2GV6A 2OCVB 2ZHFH 2Z3CA 3UOPA 1KTTB 1OWJA 3ODDA 3QTOH 5L2ZH 1NFXA 1AD8H 4CRAA 1WBGB 1C5XB 1O3DA 1YYY1 4X1SU 1RIWC 1VITF 2TGAA 3TH3H 2AH4X 2CHAB 1A5HA 3UNRA 2P8OC 1ELEE 3TNSA 2ZFTA 1BCUH 4INLA 2ZQ1A 2BLOA 1C2IA 2ZO3H 3UREA 5GPIB 1GGDB 3RXRA 1P2KA 2A45B 2Y80A 4HI3A 3KEEA 2BD9A 1F0UA 1K9OE 2BY9X 5LH8A 1AHTH 1SGPE 1QBNA 1TRNA 2PUXB 2EI6A 1SGFG 2UWOA 2ZNKH 1LHGH 1ESTA 2W26A 1C5WB 1EKBB 4UONA 1C5OH 1FN6A 5LPFA 1O3PB 1PQ5A 1P8VC 1A2CH 5G4BA 1H4WA 1GI2A 4X8VH 1C5MD 1IQMA 3LGWA 2ZF0H 3GDUA 3SJKA 1P9UA 3PTNA 1YPLH 4Y0ZE 3SNDA 2UWLA 1CT4E 3FVFB 3MO9A 1NESE 2D1JA 4IMZA 4WJG2 2ZGHA 2TRMA 1QURH 2VVVA 3B8JA 1BBRH 2QF3A 2TGDA 2PV9B 2CF9H 1LHCH 4O3TA 2GDEH 2R2MB 1K1PA 1KY9A 2ZGJA 3VB3A 4ZH8A 2ZKSA 2ANWA 1D3PB 1GDNA 1KTSB 1MH0A 1O2ZA 3H7TA 5E8EH 5F8ZA 3M5MA 1A7SA 1CA8B 4B74A 3U8TH 1ZR0A 5E2OA 5FPYA 2JKHA 1KSNA 4ABHA 3ZVCA 1L0ZA 5C67A 1GBEA 3KIDU 4X8TH 1GBAA 4I8HA 4YOJA 2Y6TA 3LJJA 5ESTE 3RXEA 1P12E 4RSPA 1V2WT 1SG8B 3PM3A 1CA0C 2A0QB 3SN8A 5EPYA 1W7XH 2A31A 4H4FA 2FS8A 1O33A 2AS9A 2GDDA 1EX3A 2FP7B 5DP7A 2ODQA 1ANBA 2XCNA 4X8SH 1HJ9A 1S0RA 2Y5GA 1O3MA 1EZSC 1TGNA 3HPTB 4Y76A 2CV3A 2ODYB 2F83A 5FCRA 3ZZ9A 4I8GA 2SGDE 1EPTB 5EXMA 3GY8A 1ZGVA 5DP8A 2IPHA 2HWLB 3PMJA 4X2WA 2V0BA 1SHYA 2ZU5A 1G37A 2CN0H 1HBTH 3QGNB 4NA7A 4NIWA 1EZQA 2CGAA 3PMHB 1BMAA 2QGRA 2ULLA 3PO1C 2ZIQH 3SUGA 3SGBE 1HAVB 4NCYA 1GHZA 1UTQA 3LDXH 3AW0A 4B1TA 2VVCA 1C5TA 1GI7B 1LPGB 1TMUH 3BEFB 1O2OA 5I25A 5EXNA 4NSYA 1PQAA 2F9UA 2OTVA 3MMGA 2CHAC 2XW9A 1XUJA 3A8BA 1AIXH 2FTMA 1Q3XA 2B7DH 2FO9A 2JH5D 4D8NA 1BB0B 1KDQA 1NFYA 4ISOA 4ISNA 2ZFPH 5F8XA 2D8WA 3ZYDA 1SLVB 4DCDA 1G32B 4IW4E 1AUJA 1ANEA 5HM2A 4WMEA 1SL3A 4DGJA 1UO6A 1Y5BT 2AEIH 2Z6BD 3MO3A 1TNHA 3KQBA 1C2KA 3BIVH 3ZVFA 4ZKNU 1TX7A 1ZPZA 1A5IA 5JDUB 2PSYA 2GCHG 4GLYA 1GVLA 1GBHA 1HYLA 1LHEH 1G30B 1Y5AT 3SW2B 3VB7A 1OP2A 3AW1A 4WMDA 3RLYH 2FOEA 1TNLA 3VXFH 3VFEA 4JYUH 1JOUB 4BXWA 4NZQA 3I29A 1TGBA 2ANKH 4IS5A 1DT2A 1W11U 3TIUA 3TGJE 1VCQA 4HZHA 1ZRBA 4ZKOU 1F0TA 3ITIA 1O3IA 1O2SA 3SUDA 3F9GA 2P59A 1TNJA 1HCGA 3KL6A 1F2SE 4NA9H 1MAXA 1L2EA 3A8CA 5EW2H 3PB1E 1V2KT 2G51A 1SGNE 4UFGH 1GBIA 1V2RT 7GCHF 3OX7U 1WCZA 1X7AC 1L1JA 2WYJA 3MHWU 1ZGIA 4NSVA 3VB5A 4A92A 3F6UH 1YLDA 4AORA 2AMQA 1G3DA 2VB0A 2BY6X 3RXQA 1THPB 4DIIH 1EOJA 1CT0E 3LGVA 4KTCA 2ZDNA 3JZ2B 4X2VA 2IJOB 4QT8C 1V2VT 2VIDA 2G4TA 4TWWA 2BX4A 4CRGA 4AOQA 1C2LA 1QJ1B 4Y6DA 3UR9A 4X6PA 4OGYA 2D2DA 1VJAU 4CR9A 1A5GH 1EPTC 5F03A 5JB9S 1XVMA 4OS2A 1F5RA 1TPAE 3GISB 2PTCE 1E0FD 1KXFA 1O5CB 1TPSA 4B75A 5EPNA 1DX5M 2FOAA 1V2MT 3D23A 1TX6A 4WF8A 5DG6A 2UWPA 2ZPRA 1NS3A 1DWCH 3NWUA 2RDLA 3SHCH 3F9HA 4D9QA 3K6ZA 3H7OA 3RU4D 2JH0D 1YPJH 3VPKA 3P17H 1P3EA 1EAIA 5E2PA 4CRCA 1AWHB 1H8IH 3RXTA 3BEUA 3N7OA 3RP2A 4DVAU 2ZG0H 1ZTKA 3TH4H 3I77A 4YT7H 4X6MA 2C8ZB 2CF8H 4XE4A 2WUCA 3SUFA 4B76A 1FZZA 3RLWH 2ILNA 1MTNB 3BTEE 4ZMAH 1Y3VA 1K1NA 2O8LA 2FOBA 1BDAA 3CS7A 5FXLA 2ZZUH 3PLPA 4BAHB 3UIRA 2QN5T 2VWNA 4Y79A 3A86A 1UK4A 3D49H 3Q00A 1QQ4A 5GCHF 4ZHLU 1O5EH 3OSYA 1INCA 4ABFA 2VINA 1QRZA 1BTYA 1GBLA 4FUHA 2LNCA 2BDHA 2FTLE 3S7HB 1AE8H 3CS0A 4DW2U 1BOQA 1HRTH 1YGCH 4E7NA 1C2HA 1PPFE 1UMAH 1O36A 3HGNA 2BY7X 1NC6A 3BG4C 3M37A 4DG4A 5JBTA 2I6SA 4AB9A 9ESTA 3TVJB 1UTKA 3QK1A 2GT7A 2Z3DA 1JRTA 1BHXF 3E8LA 1BTWA 2H9TH 4X2YA 3F1SB 4BXSA 1DY9A 1C5LH 2FOGA 1H9HE 4BAOB 1V2JT 3RC6A 3U1JB 1Y5UT 1K1MA 3EQ0H 1ZMJA 3KF2A 1Z6JH 4KP0A 1NRRH 3BIUH 3TGIE 1CGJE 3EA9A 1GL0E 1TNIA 4HFPB 2G8TA 4H42U 4TPIZ 1NRQH 1VITG 2RA3A 2TBSA 1BRUP 4TY7A 1W7GH 3ELAH 3UOUA 3OY6U 1C5SA 3EGKH 1O2XA 1K28D 2W5EA 4UFDH 1VGCC 3MI4A 2ZP0H 1RTKA 4X8UH 4XBCA 2H6MA 1TBZH 3OU0A 3Q3XA 3DD2H 2GCTC 2O8WA 3SJIA 1PPHE 5FX6A 3LGIA 4ZAEA 2XTTB 1GL1A 8LPRA 1SFQB 2BD4A 3P8OA 1S83A 2Y7ZA 3LU9B 2WV4A 1QA7A 2FESH 1UCYK 5HMAA 4Q2KA 1CHGA 4MPWA 1GMCG 3A80A 4I33A 1HB0B 1O2QA 3Q3YA 3STIA 1PPCE 1T8LA 1W14U 3A7YA 2M5TA 4K60A 1CT2E 1XUFA 1KLTA 1DLEA 3A7XA 1G2MA 3LONA 1YF4A 1MU6B 2C8YB 1F7ZA 2NU4E 3E16B 1C5UA 4JK6A 1TAWA 3RC4A 4GCHF 1P10A 1T4VH 1JBUH 1MTNC 4ISIH 2FX4A 1TMBH 3T26A 3RXPA 2QCYA 2K1QA 1GBJA 1GG6B 2WPHS 1W8BH 4NWKA 3SZNA 1GJ6A 1C1MA 3P8FA 4MNXA 3SQEE 1O30A 1UK2A 4TPYA 1O2LA 5F6MA 4LZ1H 2GTBA 3TJNA 1K1IA 5B6OA 1GCDA 1Z8JB 1SC8U 1IQIA 3TU7H 5E0JA 3UWJH 3SGQE 5A09A 1NFWA 3BTKE 3FZDA 3RXBA 4JZIA 3ZZ6A 3NPSA 3KQCA 2BDCA 1NRSH 2AGEX 1XXFA 5EQQA 1SR5C 1FY3A 1W2KH 1UTMA 2OD3B 4Z6AH 1QL7A 1HAXB 1DANH 5T3HA 1OPHB 2AFQB 1SLWB 1JIRA 5H4IB 1PPGE 1DXWA 3LJOA 3AASA 4Y8YA 3TPIZ 3TK9A 1ANCA 3SV7A 1IQHA 3RXMA 1C1WH 3LH1A 4BTTB 1KXDA 1BT7A 1HIAA 1HJAC 4A1XA 1PFXC 1O2VA 3GYLB 2FI4E 2XBYA 5C20A 3DA9B 2NWNA 2OC0A 2H2ZA 3AVZA 4I8LA 2G4UA 2FEQH 6CHAC 1ZZZA 4NIVA 3LT3A 2J2UA 5A0CA 5JBBS 1AMHA 4LOYH 1C1QA 4X6NA 1VJ9U 1ZSJA 2VWMA 4X0WU 1CHOF 1EAWA 2P3TB 3AAVA 2BZ6H 3P92A 2FLRH 2J4IA 3M35A 3V12A 3H5CB 1LMWB 4MNWA 1VCWA 5HGGA 3UPEA 1GHWH 1Y3YA 4BANB 8ESTE 3UQVA 1ZRKA 2XBVA 3ATIA 2SFAA 4R0IA 3QTVH 1SQOA 1ELAA 1ELBA 3TITA 2A32A 3KCGH 2F9BH 1NO9H 2SGPE 1ARBA 1P9SA 3PYHA 2CMYA 2WPJS 4AFQA 1O2PA 3BTTE 5K7RA 1S0QA 1TBRH 1KDQB 1MAYA 2TPIZ 5DP4A 3ZVBA 2VIQA 2FZZA 2ZTXA 1GMHF 1SGYE 4J2YB 5T6FA 2BLWA 2QF0A 3SORA 1HJ8A 5DO4H 1YPGH 2NU1E 3OYPA 3MU1A 3C1KA 1C1SA 1EZXC 2HPPH 1O3JA 3M5LA 1GG6C 2C90B 1MKWK 2UUKB 2V6NA 2VVUA 3A81A 2R3UA 3GCHB 3QLPH 2GVFA 1C1NA 4WY3A 1UVTH 6GCHF 1Q2WA 2ZDAH 7GCHG 4KGAA 2ZHWH 2BY8X 1A46H 1UTJA 1V6DA 1GHBF 4JMYA 1ELFA 1G36A 1ZMNA 3M7TA 4CH2B 5ETXA 1XUIA 2ANYA 3PMAB 5JPMH 5FBIA 2ZDMA 1SVPA 1YC0A 4AX9H 1LVBA 2DE9A 3LKWA 4MG3A 3MNBA 1T4UH 1ARCA 3GY4A 3EYDA 1O3EA 1KXBA 6LPRA 5GXPA 1HFDA 1DOJA 3R0FA 3ZVGA 4A1TA 2FOMB 4RN6A 3RXGA 2P3FH 1TYNA 1HXFH 4Q7ZA 2ZU4A 2PTNA 3PWBA 5EOKA 3RXUA 4CREA 3TH2H 3SNEA 1TPPA 1ZOMA 1A4WH 1UTLM 1N1LA 2FYRA 3QZQA 3E3TA 4O9VA 4ABJA 4WH8A 3MH5A 1C1UH 3SOSA 3NXPA 1EATA 1GJ9B 5L2YH 1KIGH 1HAZB 2H9EH 3M36A 2EEKA 3GDVA 3F9EA 3SU1A 1OS8A 3QZRA 3VGCB 2PSXA 1O31A 2G55A 1Y3XA 1J14A 2FPZA 2GP9B 1EXFA 1C1PA 1GVKB 2SGFE 1O5BB 5PTPA 4JYTA 1P02A 3U98H 1GI3A 1SOZA 1TIOA 2WPIS 1J8AA 1K1LA 1LDTT 5AHGH 1U6QA 1RGQA 1PYTC 1CVWH 1WTHD 1GHAG 4MQAA 3CP7A 2Q6FA 4XBBA 1OWHA 2A5IA 4AB8A 1TA6A 3C27B 1GCTB 1GMDG 4R8TB 1QIXB 1NROH 1NRNH 2A7JA 2OINA 4AYYB 1C5PA 2QC2A 5CHAB 3A7WA 5LGOA 1LHFH 3BTFE 1O5AB 4X1RU 1IAUA 2C4FH 2GZ7A 1AB9C 2VIPA 1S81A 4ZXXH 1ZSLA 3SHAH 1XXDA 1O2NA 3RU4E 1O0DH 4Y10E 4IMQA 3SI3H 3SJ9A 1OOKB 1JMOH 1G3EA 2VWLA 1GHYH 3RXHA 1G3BA 2P93A 1RD3B 1Y59T 1JRSA 1O3CA 3GY5A 2CXVA 1C5NH 1P2MA 3HKIB 2VIOA 3E91A 1TB6H 4WXIA 1NM6A 4FUDA 3ZZ3A 5A0AE 1OSSA 1RTLA 1S5SA 3DT0H 4YTAA 1DSTA 1GGDC 1AFQB 3U8OH 1FAXA 1H1BA 1O2RA 1O2UA 3SU3A 1KXCA 2BXTH 4AYVB 1Z1JA 1UVUH 1WU1A 1O3FA 1WQSA 1P2IA 1LKAA 2V3HH 3ESTA 2PFEA 1AKSB 2SNWA 3GDSA 1ETSH 2D26C 3ZZ7A 3A83A 1IQFA 1EASA 1AI8H 3UWIA 1QQUA 2HOBA 4CHAB 2RA0A 2CJIA 3TNTA 1B0FA 1AVWA 2G52A 1O5FH 2ZQ2A 3ZZCA 3G01A 1DUAA 2AYWA 3SU6A 1B7XB 1A0JA 4ZKRU 1AQ7A 1ABIH 2R3YA 1CO7E 4GHQA 1FONA 1YBWA 1FXYA 5SGAE 1O3AA 2QXHA 1ELVA 1UTNA 2C8XB 2A5AA 2HRVA 1FNIA 1LVOA 1P2JA 1SGTA 2W7SA 3MWIU 7ESTE 4YT6H 1CGIE 1GBCA 1O3NA 5A8YA 1ZPCA 3W95A 1C4Y2 1HUTH 5I46H 3OY5U 2G81E 1RXPA 1HNEE 4MVNA 3HK3B 4ABIA 3VGCC 4F4OC 3BV9B 1T8NA 3EAJA 4D7GA 3BTWE 2PLXA 2ASUB 3S69A 3Q76A 3GCOA 2PHBA 4GCHG 3FP6E 1BA8B 4GUXA 2QIQA 3A7TA 2Q6GA 1O2GH 2XRCA 4SGAE 1QNJA 3LPRA 3UNQA 3A88A 3MOCA 1BMLA 5HXFA 2BD2A 1QY6A 1J9CH 2BDIA 3ZYEA 2A1DB 4A5TS 4A7IB 5FX5A 5C2ZA 1MD7A 1FMGA 1GCTC 1V3XA 1W13U 4LZ4B 4X1QU 5CHAC 5DJ7A 2VU8E 4HGCA 1IQLA 1V2TT 1P2OA 2BD5A 4D7FA 2BD7A 1EOLA 2FIRH 1AY6H 2RG3A 5J4SA 1OX1A 5C5OA 4AFZA 4OGXA 4XBDA 1YKTA 4U32A 4VGCB 4CRBA 1DPOA 1WTGH 3ZZDA 1SGDE 3A8DA 4BTIB 1WV7H 4CBNA 1ABJH 1ZHMA 3M5NA 1QJ7B 4ZROA 1AVXA 5FPSA 3P95A 1LQDB 2BTCE 4K8BA 1W0YH 2XWBI 1W12U 1AFQC 4JK5A 2ZA5A 1ZMLA 1Z1IA 3M5OA 2TIOA 2BQ7B 2YOLA 1TABE 1A3EH 3SNBA 4BAKB 1GBTA 1FDPA 2ZEBA 1UHBA 1EPTA 1QL8A 3L33A 2G00A 3MNCA 3ATKA 2J95A 1P03A 3GCTG 1BMNH 4ABGA 3PMBB 1MKXK 1C2DA 1Z8RA 3U8RH 1MBQA 2BLVA 2ZPQA 3RXSA 3ENSB 4MDSA 2QXGA 1OYQA 3LIWA 4Q80A 1C5QA 1IQNA 1A3BH 3M61U 3I78A 1HAVA 2Z3EA 2Y81A 1HIAB 1OP8A 2XWAA 3K6YA 1QBVH 4INKA 3ZVDA 2Z9IA 1Z7KA 1D9IA 1G2LA 5AF9H 3PTBA 1MQ6A 1DWEH 2FXRA 2ZHDA 3E0NB 2Z9KA 5EW1H 4FU8A 2JETB 1FQ3A 1TRYA 1YCPK 2GGVB 4B71A 3UY9A 1E34B 5FPTA 1O2IA 4I8KA 1HPGA 2F9NA 2Y5HA 4YM9A 3NKKA 4DOQA 1H9IE 1NU7B 2ZTZA 4DJZB 1HDTH 1MCVA 4FU9A 2A5KA 4JZFH 2XC5A 3P8GA 3MFJA 3S9CA 2AMPA 1TE0A 1GMHG 1UCYE 1DLKB 1NZQH 2XBWA 1BJVA
chains in the Genus database with same CATH superfamily
2ODPA 3PV2A 2Q6DA 2GMTB 2OC7A 1BRBE 2BLQA 5DK1A 3E1XB 1GJBB 3SU2A 5F8TA 1MTSA 3KQDA 3HGPA 5EGMA 2DUCA 1V2QT 5LPEA 4E7RG 2R2WU 3RMNH 3BTQE 1ELGA 1TONA 1EAUA 4XSKU 2Y5FA 2OP9A 4P00A 2UUYA 3GY7A 3OAAD 1GJ7B 2O8MA 4NA8A 4NWLA 3KNXA 4ASHA 4KTUA 1DY8A 2EC9H 1BJUA 2PGBB 1E1RD 4VGCC 4YOIA 1SGIB 4BNRA 3PLKA 2A4OA 1BIOA 3FP8E 2ZU3A 2AIPA 3A82A 3VB4A 3ATWA 3KN2A 1T8MA 2W3IA 3ODFA 3NZIA 1O2WA 1GI1A 1WQVH 4ABEA 1TALA 2Z94A 1TA2A 2ZU1A 4I32A 1IQJA 1EP5A 5A8XA 3TLOA 2ZFRH 3UFAA 3URCA 1D3DB 1HXEH 2JH6D 4Y7AA 5C5NA 2VIVA 1V2OT 4IN1A 1P0SH 4K2YA 1P57B 5C1YA 2F9PA 1DICA 4CRDA 1P05A 1PPEE 5IDKA 3DHKH 1SGQE 4FU7A 1HGTH 2ZI2H 1TOMH 1EAXA 2ZDVH 1EQ9A 1O35A 1C5RA 2W6JD 1FIWA 1KLJH 3IITA 4A6LA 4ABDA 4FUEA 1C2EA 3M3VA 5BRRE 3U1IB 3BF6H 2DE8A 4K1TA 3T2NA 4Y8XA 2FI5E 2ZWLH 2FX6A 3O8DA 1NN6A 1ZJDA 1AVGH 3UB0A 3U9AH 1UK3A 1MQ5A 1MUEB 1XKBC 1VKYA 3O8BA 2R0LA 4HTCH 4RKJB 1RIWB 1GJCB 2GJGA 3GCNA 4PROA 5EQRA 3SV2H 1FIZA 2ZFFH 2WPKS 1LTOA 2ANMH 1YPKH 2PKAA 3TJVA 1K0HA 1CQQA 1NRPH 1FY5A 1YM0A 4NGAH 2J92A 5DGJA 4YESB 1SGRE 1K1OA 2HNTE 1AN1E 3LGTA 2JETC 2W7UA 1YP9A 3V3MA 2VH6A 3MH7A 2P94A 4GAWA 3SYJA 3QX5H 4GHTA 1LQEA 3OFND 2VIWA 1HAYB 4AC9A 5A0BA 4K69A 1D6RA 1FUJA 5FBEA 2H9HA 2Z9GA 8GCHF 2HGTH 5EODA 1W0ZU 3KHVA 4FETA 3BSQA 3VB6A 1QB1A 1C1OA 4ZUHA 2WV5A 4IC6A 3ZV8A 3DUXH 2BVRH 4AFUA 3U28C 1MCTA 2BB4A 2VH0A 1MKXH 1DDJA 3GY3A 1C5VA 1P01A 3RMMH 3BN9A 1PPZA 2LPRA 4ZKSU 2AIQA 1TNKA 3PV4A 1A0HB 1NTPA 1DWDH 1CU1A 3VEQB 4FUGA 3A7ZA 3LGUA 2ZCHP 2ZDLA 3RDZA 1C9PA 2VJ1A 4JYVH 2ZTYA 4ABAA 1DE7H 4AGJA 3NK8A 3WW7A 1Z6EA 5AVDA 1PQ7A 2PKSB 3N99A 4IGDA 3M3SA 1YCPM 1GJDB 2AGIX 4GVUA 5BPEA 4TT3D 1FY4A 4Y71A 3LGYA 3SU4A 4MPVA 1GI9B 1O3LA 1ZHPA 2BDBA 3T62A 4X1NU 1TQ7B 2BHGA 1THSH 3MU5A 5E0GA 1L1NA 4MPXA 1UW7A 1EB2A 1YPEH 3SQHE 1QCPA 3A89A 5JBCS 1KYNA 3QDZB 1DFPA 5CDFE 1YPHC 1QTFA 4SGBE 2AERH 3RXOA 2OBQA 4B2AA 1IQKA 3LC3A 1AUTC 3L6PA 2BOKA 1OWDA 5EU8A 2FDAA 2ALPA 3S7KB 1KXAA 3DCLA 2ESTE 3M3TA 3PO1B 2WUBA 5A8ZA 3FANA 2FM2A 4UDWH 1E36B 1ZTLA 4WWYA 3ZZBA 2RFKC 4UFEH 2WPDD 4RKOB 2F4LA 2ZDKA 3ZZ4A 4I86A 2O9QA 4U2WA 3IG6B 4YXWD 1HAHH 2FS9A 4FOUC 2FLBH 4NIXA 1HAGE 4TSFD 1EJAA 1TQ0B 1UCYH 1RTFB 2J97A 1F5KU 3DSOA 3K2UA 5GDSH 1O2TA 2QXIA 1Y3WA 4ACAA 1H8DH 3TK5A 2NU0E 5TCAA 3M7UA 3UUZA 3ZVAA 1KXEA 1QL9A 1PJPA 1TGTA 4DURA 5EJZA 1VITH 1JIMA 1VZQH 3PLBA 1EJNA 3SJ8A 3WWBA 1LO6A 4AN7A 2LELA 3RXJA 2BD3A 3UR6A 2O8UA 4K1SA 1S6HA 2BD8A 2KCOA 4YLQH 1GMCF 1OWKA 4AZ2B 1QJ6B 5T1VA 1D6WA 2TGTA 3RXAA 2ZPSA 2A7HA 1ETTH 2IJD1 1QB9A 3GY2A 3ZZAA 1TPOA 4AG2A 3K65B 2R0KA 2BOHB 1GDUA 1N6YA 4YLUA 1RRKA 2EY4C 3QWCH 9LPRA 2FWWA 2XNIA 1AO5A 1F5LA 4Z0KA 1WSSH 1K1JA 2GV7A 2ZFQH 1F0RA 4K1EA 2OC1A 3E0PB 4K3JA 2Y7XA 1Y8TA 2AGGX 1O2YA 2B8OH 2GKVE 2V3MA 2QYIA 5FCKA 3E6PH 3ZZ8A 1BTHH 1QRXA 1C4U2 1W3CA 2Y82A 2XBXA 5K0HA 2QAAA 3SV6A 2OQ5A 2PKSC 4Y8ZA 3R3GB 3RU4T 3ZZ5A 3FAOA 2JJ1D 4OS7A 3SV9A 4WXVA 4OM9A 1GBMA 1FY1A 4ISHH 2PR3A 3B23B 3F9FA 3A85A 4MTBA 3A7VA 4OS4A 4ISLA 5GCHG 3T25A 3F68H 2NU2E 2YMSD 1ELCA 1OWIA 4FXGH 1JWTA 4DY7B 5AFYH 4O03A 1CE5A 2EA3A 5TJXA 3W94A 2FODA 3GY6A 4FUCA 2AHME 1LPZB 1SOTA 2FOHA 3LOXA 4NFEA 3RM2H 1J17T 2HNTF 1F92A 4KKDA 1W10U 2WSSD 2KFWA 3D65E 1UHBB 1GI5A 4KELA 2THFB 3MU4A 4TWYA 2C3SA 2FOCA 4CR5A 1ORFA 1MBMA 3EDXB 3A8AA 4WH6A 1WYKA 2F43B 2G5VA 3ATMA 3BTDE 3K9XB 5T6GA 4AG1A 1OXGA 2TGPZ 1O2MA 2H5CA 1Z8GA 6ESTA 1L1GA 1GBKA 2SGQE 3GCHC 2J5UA 4XOJA 2ZFSA 3KYFA 4I8JA 1HAPH 1OKXA 1IQEA 1DM4B 1OWEA 5ESBA 4B73A 2B9LA 4LXBH 1ID5H 1TBQH 3M7QA 5EXLA 1MZAA 2GX4A 2GD4B 3QO6A 4ABBA 1IHSH 1MU8B 4U01A 1KLIH 1GJAB 1SMFE 1GPZA 2A4GA 1GBDA 4TYDA 2J94A 5IK2D 1SGEE 4GPGA 2A2QH 5CMXH 3GICB 1QA0A 1P3CA 1SPJA 3HKJB 1HV7A 5C0UA 3LC5A 1H8HD 1QB6A 1O2HA 3SBKA 1C9TA 2SNVA 3B9FH 1M9UA 2KAIA 1J15A 1TGSZ 1Z8IB 1QBOA 1H9LB 3JZ1B 1ELTA 1UTOA 1RS0A 1Y3UA 2YNBA 4FUBA 1YPMH 2WPLS 1YPHE 2OQUA 5DP9A 1QHRB 2H1UA 1O3KA 2ZGBH 1O32A 5GWZA 3NCLA 4AGKA 1E1QD 5FHTA 1SQTA 1B0EA 4O97A 1MMJN 1EP6A 1S85A 4UE7H 2BVXH 4I31A 5A2MH 5EQSA 1MD8A 5HYOA 1HAOH 1T32A 3MU8A 2ZCLP 4OS6A 1MKWH 2F91A 1GWAA 3HK6B 1TOCB 4NZLA 3O8CA 1P11E 4KTSA 1GI4A 4JCNA 1UVSH 3HATH 1BQYA 4FVBA 1GVZA 2QA9E 5L6NH 1NU9A 3O8RA 5C1XA 1FLEE 1NY22 1ACBE 4D9RA 1FI8A 2YNAA 2Z9JA 1DS2E 3BG4B 4D76A 3A84A 4O3UA 2Q1JA 4THNH 2YMSB 4I7YH 2BDGA 4BAMB 2V3OH 2SGAA 1P09A 2ZGCA 3MH4A 1TFXA 1NT1A 4FVDA 4H6TA 1LVYA 1C5YB 4K8YA 1OP0A 2VWOA 3MNSA 4X2XA 1GJ5H 2GZ8A 4FUIA 3QGJA 1WOFA 5C3NA 1GBBA 2BY5X 1VCPA 3F0OA 4MPUA 1ZHRA 4B6EA 5GNDA 1P2QA 3UTUH 2BDYA 3MH6A 3STJA 1F0SA 1GDQA 3FO8D 1SSXA 7LPRA 2BQ6B 1H8ED 4JZEH 2STBE 3SGAE 1PQ8A 1TNGA 1ZSKA 2L74A 3FFGA 1BRCE 3S0NA 1QGFA 4TY6A 3GOVB 3PRBA 1SB1H 2VNTA 3UNSA 4ESTE 5EJ1A 1C4V2 3RXLA 1G9IE 1SFIA 3Q3KA 1D3TB 2H5DA 3T27A 1ANDA 2G5NA 1P06A 1RFNA 4B2BA 1LVMA 2V7QD 3URDA 3BG8A 2QY0B 1VGCB 1AZ8A 1FAKH 1GI0A 1EJMA 2HPQH 2R9PA 2Z9LA 3P8NA 2GCTB 1XUGA 2OUAA 2ALVA 3KQEA 3FN8A 2ZGXH 2L6OA 3ZVEA 1ESBA 1N6XA 1ETRH 2HNTC 2PWXA 2W3KA 1O37A 3P70B 1O5DH 1RJXB 4E05H 8GCHG 4A1VA 1C5ZB 1SQAA 3OEHD 3EA7A 2ZHQH 1UVOA 2GZ9A 2PKAB 3BEIB 3OTPA 4BTUB 2XC0A 1O3OA 1BUIA 1N8OB 1FV9A 1C1VH 1XVOA 1DUEA 1BMMH 4B2CA 1S82A 1O3HA 1EZUC 3RUOA 1CBWB 4FUFA 4ZXYH 3TJOA 2BYAX 4CHAC 3TJUA 2WHXA 2BMGB 1GHXH 4OS1A 1K2I1 3TK6A 1CHOG 1O34A 1GHAF 1TWXB 3FP7E 4AFSA 1K22H 1DXPA 4UEHH 1Q31A 2O8TA 1GJ4H 2OC8A 2HLCA 1DWBH 3WY8A 2J38A 1FPHH 1GMDF 1YY3A 3MNXA 1V2NT 5ABWA 2OXSA 3BTME 1C1RA 1IHTH 1O39A 3A87A 4X6OA 1EB1H 1O2KA 2P3UB 3UAIC 2A4QA 2BDAA 2AMDA 1BTZA 1THRH 1BTUA 1TRMA 1O5GH 1NPMA 3S9BA 2ZECA 2F9OA 2HALA 1T7CA 1GI8B 5AFZH 3T28A 1SBWA 4XRNA 1AGJA 5CE1A 2YMSC 5JYIA 4FUJA 4YOGA 1XM1A 2I6QA 2F3CE 1AKSA 5JBAS 1V2LT 4DT7B 1DSUA 1YLCA 4CRFA 3CENA 3FZZA 3ATLA 1NFUA 4XDEA 3T5FH 3PROA 1WAYB 1SI5H 1MTUA 1XX9A 4HG6A 2XXLA 1MTVA 1WUNH 1TGCA 3U69H 3T29A 3SO3A 1FN8A 4M7GA 4BAQB 1LCYA 3BTHE 1HJAB 5EG4A 5IYTA 6GCHG 3SV8A 2B0FA 4J1YA 3RXIA 1SLUB 2A7CA 1JXPA 4GSOA 1BHXB 1GHBG 2VGCB 3ZV9A 3UQOA 4Y7BA 6CHAB 2GCHF 5LPRA 3KGPA 4XFQA 1QRWA 2XCFA 1XMNB 4NIYA 5T6DA 1E79D 3OTJE 4NFFA 3P6ZB 2WINI 4UD9H 4Y11E 4IN2A 5FL7D 2KZ4A 1J16A 1FPCH 1BBRE 2KCPA 1HAIH 2ZHEH 1SLXB 1MZDA 2P95A 3E90B 1AU8A 1C2GA 1V2PT 1Z71A 3SNAA 1ZLRA 2A2XH 1OHHD 1CGHA 3RXFA 3DFJA 4INHA 1LHDH 1P2NA 1XUHA 1XUKA 5E0HA 1B5GH 5FAHA 1CSOE 1A61H 2IN2A 1T8OA 2STAE 2J9NA 3V13A 1L4ZA 2OBOA 1ZTJA 1ESAA 1TLDA 1N8OC 1BTXA 2PUQH 3SI4H 4RI0A 4WMFA 2RDEA 3QN7A 4H6SB 4DIHH 4Y0YE 1CBWC 1PYTD 1TMTH 3V0XA 1IOEA 4BOHA 1BBRK 2FOFA 1D3QB 2V35A 3D62A 4JZ1A 1A1RA 2C8WB 2UUFB 2BVSH 1UTPA 2BQWB 2RCEA 1TX8A 2PGQB 1BITA 1DVAH 1GBFA 1SGFA 2P8OB 5DP3A 2HVXA 5DPAA 2QV1A 1S84A 4K5ZA 1LKBA 2BM2A 1AFEH 2QXJA 4Q7YA 1O3GA 1E37B 1UVPA 3F3BA 3MTYA 4MLFB 5JB8S 3RXCA 5B6LA 4Q7XA 5GIBA 3RM0H 1C2FA 1HLTH 1V2UT 3FOAA 1T31A 4E06H 5J4QA 4UFFH 8KME2 3SU0A 3LH3A 5DKMA 1C1TA 3QUMP 4ZHMU 3TGKE 1O2JA 2ZC9H 3IWMA 5TCCA 1G3CA 2LP6A 1XKAC 2B5TB 2UUJB 2FI3E 4CH8B 4WVPE 2BX3A 2GMTC 1L4DA 1O38A 1LPKB 1C2MA 3S9AA 1SHHB 3V7TA 1S6LA 1BRAA 1C2JA 2Z7FE 2XYAA 1ZPBA 3EA8A 4MNYA 1AE5A 3L3TA 1PPBH 2NU3E 3BTGE 1QFKH 3MO6A 4MNVA 2HLDD 5DP5A 4Q4LA 3GCTF 1GI6A 1E35B 2ZU2A 2WYGA 5DP6A 2OLGA 1D4PB 2VGCC 1VR1H 4CBOA 2M2AA 3SU5A 2BZAA 1SGCA 1AZZA 1MTWA 2A4RA 3RMOH 1P04A 7KMEH 1ZYOA 2FYQA 1FY8E 1QR3E 5HM9A 2ZCKP 1YCPH 2WV9A 3RXDA 1CA0B 4RT1A 1S6FA 1YLNA 4LK4A 4U30A 1DITH 3MYWA 1O3BA 5KEDA 4JZDH 1ELDE 3Q77A 2BXUH 4ZHAA 1ZJKA 2GT8A 3NUMA 1BZXE 1AWFH 4X1PU 2IOTA 3PWCA 2WPMS 2EI7A 2J34A 5GJ4B 5L30H 1UJ1A 3MU0A 1GHVH 3SJOA 3PV5A 3VXEH 3SNCA 1OYTH 2P16A 1W0KD 4OS5A 3AAUA 2PW8H 2FMJA 4YO9A 4YZUA 3DFLA 3RMLH 2SGEE 1A0LA 3RXKA 2C93B 1E38B 2XC4A 2KAIB 1GJ8B 1K21H 3RXVA 1V2ST 1AB9B 1EUFA 4IC5A 5C1UA 3GYMA 4IBLH 2F9VA 3EE0B 4NG9H 3SUEA 2EI8A 1W0JD 1FJSA 4F49A 1IQGA 1BTPA 3RC5A 2GV6A 2OCVB 2ZHFH 2Z3CA 3UOPA 1KTTB 1OWJA 3ODDA 3QTOH 5L2ZH 1NFXA 1AD8H 4CRAA 1WBGB 1C5XB 1O3DA 1YYY1 4X1SU 1RIWC 1VITF 2TGAA 3TH3H 2AH4X 2CHAB 1A5HA 3UNRA 1ELEE 2P8OC 3TNSA 2ZFTA 1BCUH 4INLA 2ZQ1A 2BLOA 1C2IA 2ZO3H 3UREA 5GPIB 1GGDB 3RXRA 1P2KA 2A45B 2Y80A 4HI3A 3KEEA 2BD9A 1F0UA 1K9OE 5C94A 2BY9X 5LH8A 1AHTH 1SGPE 1QBNA 1TRNA 2PUXB 2EI6A 1SGFG 2UWOA 2ZNKH 1LHGH 1ESTA 2W26A 1C5WB 1EKBB 1MABB 4UONA 1C5OH 1FN6A 5LPFA 1O3PB 1PQ5A 1P8VC 1A2CH 5G4BA 1H4WA 1GI2A 4X8VH 4Z1MD 1C5MD 1IQMA 5CHBA 3LGWA 2ZF0H 3GDUA 3SJKA 1P9UA 3PTNA 1YPLH 4Y0ZE 3SNDA 2UWLA 1CT4E 3FVFB 3MO9A 1NESE 2D1JA 4IMZA 4WJG2 2ZGHA 2TRMA 1QURH 2VVVA 3B8JA 1BBRH 2QF3A 2TGDA 2PV9B 5HKKD 2CF9H 2K8IA 1LHCH 4O3TA 2GDEH 2R2MB 1K1PA 1KY9A 2ZGJA 3VB3A 4ZH8A 2ZKSA 2ANWA 1D3PB 1GDNA 1KTSB 1MH0A 1O2ZA 3H7TA 5E8EH 5F8ZA 3DSPA 3M5MA 1A7SA 1CA8B 4B74A 5C0TA 3U8TH 1ZR0A 5E2OA 5FPYA 2JKHA 1KSNA 4ABHA 3ZVCA 1L0ZA 5C67A 1GBEA 3KIDU 4X8TH 1GBAA 4I8HA 4YOJA 2Y6TA 3LJJA 5ESTE 4ZCNA 3RXEA 1P12E 4RSPA 1V2WT 1SG8B 3PM3A 1CA0C 2A0QB 3SN8A 5EPYA 1W7XH 2A31A 4H4FA 2FS8A 1O33A 2AS9A 2GDDA 1EX3A 2FP7B 5DP7A 2ODQA 1ANBA 2XCNA 4X8SH 1HJ9A 1S0RA 2Y5GA 1O3MA 1EZSC 1TGNA 3HPTB 4Y76A 2CV3A 2W6ID 2ODYB 2F83A 5FCRA 3ZZ9A 4I8GA 2SGDE 1EPTB 5EXMA 3GY8A 1ZGVA 5DP8A 2IPHA 2HWLB 3PMJA 4X2WA 2V0BA 1SHYA 2ZU5A 1G37A 2CN0H 1HBTH 2KCYA 3QGNB 4NA7A 4NIWA 1EZQA 2CGAA 3PMHB 1BMAA 2QGRA 2ULLA 3PO1C 2ZIQH 3SUGA 3SGBE 1HAVB 4NCYA 1GHZA 1UTQA 3LDXH 3AW0A 4B1TA 2VVCA 1C5TA 1GI7B 1LPGB 1TMUH 3BEFB 1O2OA 5I25A 5EXNA 4NSYA 1PQAA 2F9UA 2OTVA 3MMGA 2JJ2D 2CHAC 2XW9A 1XUJA 3A8BA 1AIXH 2FTMA 1Q3XA 2B7DH 2FO9A 2JH5D 4D8NA 1BB0B 1KDQA 1NFYA 4ISOA 4ISNA 5C17A 2ZFPH 5F8XA 2D8WA 3ZYDA 3AK5A 1SLVB 4DCDA 1G32B 4IW4E 1AUJA 1ANEA 5HM2A 4WMEA 1SL3A 4DGJA 1UO6A 1Y5BT 2AEIH 2Z6BD 3MO3A 1TNHA 3KQBA 1C2KA 3BIVH 3ZVFA 4ZKNU 3PRDA 1TX7A 1ZPZA 1A5IA 5JDUB 2PSYA 2GCHG 4GLYA 2PP6A 1GVLA 1GBHA 1HYLA 1LHEH 1G30B 1Y5AT 3SW2B 3VB7A 3GS9A 1OP2A 3AW1A 4WMDA 3RLYH 2FOEA 1TNLA 3VXFH 3VFEA 4JYUH 1JOUB 4BXWA 4NZQA 3I29A 1TGBA 2ANKH 4IS5A 1DT2A 1W11U 3TIUA 3TGJE 1VCQA 4HZHA 1ZRBA 4ZKOU 1F0TA 3ITIA 1O3IA 1O2SA 3SUDA 3F9GA 2P59A 1TNJA 1HCGA 3KL6A 1F2SE 4NA9H 1MAXA 1L2EA 3A8CA 5EW2H 3PB1E 1V2KT 3DSGA 2G51A 1SGNE 4UFGH 1GBIA 1V2RT 7GCHF 3F0PA 1WCZA 1X7AC 3OX7U 1L1JA 2WYJA 3MHWU 1ZGIA 4NSVA 3VB5A 4A92A 3F6UH 1YLDA 4AORA 2AMQA 1G3DA 2VB0A 2BY6X 3RXQA 1THPB 2IPQX 4DIIH 1EOJA 1CT0E 3LGVA 4KTCA 2ZDNA 2KX4A 3JZ2B 4X2VA 2IJOB 4QT8C 1V2VT 2VIDA 2G4TA 4TWWA 2BX4A 4CRGA 4AOQA 1C2LA 1QJ1B 4Y6DA 3UR9A 4X6PA 4OGYA 2D2DA 1VJAU 4CR9A 1A5GH 1EPTC 5F03A 5JB9S 1XVMA 4OS2A 3N7EA 1F5RA 1TPAE 3GISB 2PTCE 1E0FD 1KXFA 1O5CB 1TPSA 4B75A 2K0QA 5EPNA 1DX5M 2FOAA 1V2MT 3D23A 1TX6A 4WF8A 5DG6A 2UWPA 2ZPRA 1NS3A 1DWCH 3NWUA 2RDLA 1SQRA 3SHCH 3F9HA 4D9QA 3K6ZA 3H7OA 3RU4D 2JH0D 1YPJH 3VPKA 3P17H 2HVYB 1P3EA 1EAIA 5E2PA 4CRCA 1AWHB 1H8IH 3RXTA 3BEUA 3N7OA 3RP2A 4DVAU 2ZG0H 1ZTKA 3TH4H 3I77A 4DT4A 4YT7H 4X6MA 2C8ZB 2CF8H 4XE4A 2WUCA 3SUFA 4B76A 1FZZA 3RLWH 2ILNA 1MTNB 3BTEE 4ZMAH 1Y3VA 1K1NA 2O8LA 2FOBA 1BDAA 3CS7A 5FXLA 2ZZUH 3PLPA 4BAHB 5DN6D 3UIRA 2QN5T 2VWNA 4Y79A 3A86A 1UK4A 3D49H 3Q00A 1QQ4A 5GCHF 4ZHLU 1O5EH 3OSYA 1INCA 4ABFA 2VINA 1QRZA 1BTYA 1GBLA 4FUHA 2LNCA 2BDHA 2FTLE 3S7HB 1AE8H 3CS0A 4DW2U 1BOQA 1HRTH 1YGCH 4E7NA 1C2HA 1PPFE 1UMAH 1O36A 3HGNA 4RT0A 2BY7X 1NC6A 3BG4C 3M37A 4DG4A 5JBTA 2I6SA 4AB9A 9ESTA 3TVJB 1UTKA 3OEED 3QK1A 2GT7A 2Z3DA 1JRTA 1BHXF 1NBME 3E8LA 1BTWA 2H9TH 4X2YA 3F1SB 4BXSA 1DY9A 1C5LH 2FOGA 1H9HE 2VBCA 4BAOB 2KM0A 1V2JT 3RC6A 3U1JB 1Y5UT 1K1MA 3EQ0H 1ZMJA 3KF2A 1Z6JH 4KP0A 1NRRH 3BIUH 3TGIE 1CGJE 3EA9A 1GL0E 1TNIA 4HFPB 2G8TA 3NRLA 4H42U 4TPIZ 1NRQH 1VITG 2RA3A 2TBSA 1BRUP 4TY7A 1W7GH 3ELAH 3UOUA 3OY6U 1C5SA 3EGKH 1O2XA 3FKSD 1K28D 2W5EA 4UFDH 1VGCC 3MI4A 2ZP0H 1QZ8A 1RTKA 4X8UH 4XBCA 2H6MA 1TBZH 3OU0A 2QF4A 3Q3XA 3DD2H 2GCTC 2O8WA 3SJIA 1PPHE 5FX6A 3LGIA 4ZAEA 2XTTB 1GL1A 8LPRA 1SFQB 2BD4A 3P8OA 1S83A 2Y7ZA 3LU9B 2WV4A 1QA7A 2FESH 1UCYK 5HMAA 4Q2KA 1CHGA 4MPWA 1GMCG 3A80A 4I33A 1HB0B 1O2QA 3Q3YA 3STIA 2EQNA 1PPCE 1T8LA 1W14U 3A7YA 2M5TA 4K60A 1CT2E 1XUFA 1KLTA 1DLEA 3A7XA 1G2MA 3LONA 1YF4A 1MU6B 2C8YB 1F7ZA 2NU4E 3E16B 1C5UA 4JK6A 1TAWA 3RC4A 4GCHF 1P10A 1T4VH 1JBUH 1MTNC 4ISIH 2FX4A 1TMBH 3T26A 3RXPA 2QCYA 2K1QA 1GBJA 1GG6B 2WPHS 1W8BH 1EFRD 4NWKA 3SZNA 4F55A 1GJ6A 1C1MA 3P8FA 4MNXA 3SQEE 1O30A 1UK2A 4TPYA 1BMFD 1O2LA 5F6MA 4LZ1H 2GTBA 3TJNA 1K1IA 5B6OA 1GCDA 1Z8JB 1SC8U 1IQIA 3TU7H 5E0JA 3UWJH 4XD7D 3SGQE 5A09A 1NFWA 3BTKE 3FZDA 3RXBA 4JZIA 3ZZ6A 3NPSA 3KQCA 2BDCA 1NRSH 2AGEX 1XXFA 5EQQA 3VG8A 1SR5C 1FY3A 1W2KH 2J98A 1UTMA 2OD3B 4Z6AH 1QL7A 1HAXB 1DANH 5T3HA 1OPHB 2AFQB 1WXRA 1SLWB 1JIRA 5H4IB 1PPGE 1DXWA 3LJOA 3AASA 4Y8YA 3TPIZ 3TK9A 1ANCA 1NBMD 3SV7A 1IQHA 3RXMA 1C1WH 3LH1A 4BTTB 1KXDA 1BT7A 1HIAA 1HJAC 4A1XA 1PFXC 1O2VA 3GYLB 2FI4E 2XBYA 5C20A 3DA9B 2NWNA 3CNRA 2OC0A 2H2ZA 3AVZA 4I8LA 2G4UA 2FEQH 4P02A 6CHAC 1ZZZA 4NIVA 3LT3A 2J2UA 5A0CA 5JBBS 1AMHA 4LOYH 1C1QA 4X6NA 1YWUA 1VJ9U 1ZSJA 2VWMA 4X0WU 1CHOF 1EAWA 2P3TB 3AAVA 2BZ6H 3P92A 2FLRH 2J4IA 3M35A 3V12A 3H5CB 1LMWB 4MNWA 1VCWA 5HGGA 3UPEA 1GHWH 4F48B 1Y3YA 4BANB 8ESTE 3UQVA 1ZRKA 2XBVA 3ATIA 2SFAA 4R0IA 3QTVH 1SQOA 1ELAA 2KCAA 1ELBA 3TITA 2A32A 3KCGH 2F9BH 1NO9H 2SGPE 1ARBA 1P9SA 3PYHA 2CMYA 2WPJS 4AFQA 1O2PA 3BTTE 5K7RA 1S0QA 1TBRH 1KDQB 1MAYA 2TPIZ 5DP4A 3ZVBA 2VIQA 3F2HA 2FZZA 2ZTXA 1GMHF 1SGYE 4J2YB 5T6FA 2BLWA 2QF0A 3SORA 1HJ8A 5DO4H 1YPGH 2NU1E 3OYPA 3MU1A 3C1KA 1C1SA 1EZXC 2HPPH 1O3JA 3M5LA 1GG6C 2C90B 1MKWK 2UUKB 2V6NA 2VVUA 3A81A 2R3UA 3GCHB 3QLPH 2GVFA 1C1NA 4WY3A 1UVTH 6GCHF 1Q2WA 2ZDAH 7GCHG 4KGAA 3EE7A 2ZHWH 2BY8X 1A46H 1UTJA 1V6DA 1GHBF 4JMYA 1ELFA 1G36A 1ZMNA 3M7TA 4CH2B 5ETXA 1XUIA 2ANYA 3PMAB 3N7DA 5FBIA 2ZDMA 5JPMH 1SVPA 1YC0A 4AX9H 1LVBA 2DE9A 3LKWA 4MG3A 3MNBA 1T4UH 1ARCA 3GY4A 3EYDA 1O3EA 1KXBA 6LPRA 5GXPA 1HFDA 1DOJA 3R0FA 3ZIAD 3ZVGA 4A1TA 1FX0B 2FOMB 4RN6A 3RXGA 2P3FH 1TYNA 1HXFH 4Q7ZA 2ZU4A 2PTNA 3PWBA 5EOKA 3RXUA 4CREA 3TH2H 3SNEA 1TPPA 1ZOMA 1A4WH 5KECA 1UTLM 1N1LA 1COWD 4M9FA 2FYRA 3QZQA 3E3TA 4O9VA 4ABJA 4WH8A 3MH5A 1C1UH 3SOSA 3NXPA 1EATA 1KMHB 1GJ9B 5L2YH 1KIGH 5F53A 3KQ5A 1HAZB 2H9EH 4B6FA 3M36A 2EEKA 3GDVA 3F9EA 2OK5A 3SU1A 1OS8A 3OE7D 3QZRA 3VGCB 2PSXA 1O31A 2G55A 1Y3XA 1J14A 2FPZA 2GP9B 1EXFA 1C1PA 1GVKB 2SGFE 1O5BB 5PTPA 4JYTA 1P02A 3U98H 1GI3A 5DSFA 1SOZA 1TIOA 2WPIS 1J8AA 1K1LA 1LDTT 5AHGH 5EJLA 1U6QA 2CK3D 1RGQA 1PYTC 1CVWH 5HIYA 1WTHD 1GHAG 4MQAA 3CP7A 2Q6FA 4XBBA 1OWHA 2A5IA 3WWFA 4AB8A 1TA6A 3C27B 1GCTB 1GMDG 4R8TB 1QIXB 1NROH 1NRNH 2A7JA 2OINA 4AYYB 1C5PA 2QC2A 5CHAB 3A7WA 5LGOA 1LHFH 3BTFE 1O5AB 4X1RU 1IAUA 2C4FH 2GZ7A 1AB9C 2VIPA 1S81A 4ZXXH 1ZSLA 3SHAH 1XXDA 1O2NA 3RU4E 1O0DH 4Y10E 4IMQA 3SI3H 3SJ9A 1OOKB 1JMOH 1G3EA 2VWLA 1GHYH 3RXHA 1G3BA 2P93A 1RD3B 3F2FA 1Y59T 1JRSA 1O3CA 3GY5A 2CXVA 1C5NH 1P2MA 3HKIB 4ASUD 2VIOA 3E91A 1TB6H 4WXIA 1NM6A 4FUDA 5EIYA 3ZZ3A 5A0AE 1OSSA 1RTLA 1S5SA 3DT0H 4YTAA 1DSTA 1GGDC 1AFQB 3U8OH 1FAXA 1H1BA 1O2RA 1O2UA 3SU3A 1KXCA 2BXTH 4AYVB 2KR7A 2XOKD 3H09A 1Z1JA 1UVUH 1WU1A 1O3FA 1WQSA 1P2IA 1LKAA 2V3HH 3ESTA 2PFEA 1AKSB 2SNWA 3GDSA 1ETSH 2D26C 3KYGA 3ZZ7A 3A83A 1IQFA 1EASA 1AI8H 3UWIA 1QQUA 2HOBA 4CHAB 2RA0A 2CJIA 3TNTA 1B0FA 1AVWA 2G52A 1O5FH 2ZQ2A 3ZZCA 3G01A 1DUAA 2AYWA 3SU6A 1B7XB 1A0JA 4ZKRU 1AQ7A 1ABIH 2R3YA 1CO7E 4GHQA 1FONA 1YBWA 1FXYA 5SGAE 1O3AA 2WZQA 2QXHA 1ELVA 1UTNA 2C8XB 2A5AA 2HRVA 1FNIA 1LVOA 1P2JA 1SGTA 2JIZD 2W7SA 3MWIU 7ESTE 4YT6H 1CGIE 1GBCA 1O3NA 5A8YA 1ZPCA 3W95A 1C4Y2 1HUTH 5I46H 3OY5U 2G81E 1RXPA 1HNEE 4MVNA 3HK3B 4ABIA 3VGCC 4F4OC 2QE7D 3BV9B 1T8NA 3EAJA 4D7GA 3BTWE 2PLXA 2ASUB 3S69A 3Q76A 3GCOA 2PHBA 4GCHG 3FP6E 1BA8B 4GUXA 2QIQA 3A7TA 2Q6GA 1O2GH 2XRCA 4SGAE 1QNJA 3LPRA 3UNQA 3A88A 3MOCA 1BMLA 5HXFA 2BD2A 2QF5A 1QY6A 1J9CH 2BDIA 3ZYEA 1WDIA 2A1DB 4A7IB 5FX5A 4A5TS 5C2ZA 1MD7A 1FMGA 1GCTC 1V3XA 1W13U 4LZ4B 4X1QU 5CHAC 5DJ7A 2VU8E 4ACBA 4HGCA 1IQLA 1V2TT 1P2OA 2BD5A 4D7FA 2BD7A 1EOLA 2FIRH 1AY6H 2RG3A 5J4SA 1OX1A 5C5OA 4AFZA 4OGXA 4XBDA 1YKTA 4U32A 4VGCB 4CRBA 1DPOA 1WTGH 2JDID 3ZZDA 1SGDE 3A8DA 4BTIB 1WV7H 3MQKC 4CBNA 1ABJH 1ZHMA 3M5NA 1QJ7B 4ZROA 1AVXA 5FPSA 3P95A 1LQDB 2BTCE 4K8BA 1W0YH 2XWBI 1W12U 1AFQC 2XNDD 4JK5A 2ZA5A 1ZMLA 1Z1IA 3M5OA 2TIOA 2BQ7B 2YOLA 1TABE 1A3EH 2J98B 3SNBA 4BAKB 1GBTA 1FDPA 2ZEBA 1UHBA 1EPTA 1QL8A 3L33A 2G00A 3MNCA 5KGOA 3ATKA 2J95A 1P03A 3GCTG 1BMNH 4ABGA 3PMBB 1MKXK 1C2DA 1Z8RA 3U8RH 1MBQA 2BLVA 2ZPQA 3RXSA 3ENSB 4MDSA 2QXGA 1OYQA 3LIWA 4Q80A 1C5QA 1IQNA 1A3BH 3M61U 3I78A 1HAVA 2Z3EA 2Y81A 1HIAB 1OP8A 2XWAA 3K6YA 1QBVH 3F2GA 4INKA 3ZVDA 2Z9IA 1Z7KA 1D9IA 1G2LA 4Q63A 5AF9H 3PTBA 1MQ6A 1DWEH 2FXRA 2ZHDA 3E0NB 2Z9KA 5EW1H 4FU8A 2JETB 1SKYE 1FQ3A 1TRYA 1YCPK 2GGVB 4B71A 3UY9A 1E34B 5FPTA 3W1EA 1O2IA 4I8KA 1HPGA 2F9NA 2Y5HA 4YM9A 3NKKA 4DOQA 1H9IE 1NU7B 2ZTZA 5HIZA 4DJZB 1HDTH 1MCVA 4FU9A 2A5KA 3SZEA 4JZFH 2XC5A 3P8GA 3MFJA 3S9CA 2AMPA 1TE0A 1GMHG 1UCYE 1DLKB 1NZQH 2XBWA 1BJVA
chains in the Genus database with same CATH topology
2ODPA 2Q6DA 2GMTB 2OC7A 1BRBE 2BLQA 5DK1A 3E1XB 1GJBB 3SU2A 5F8TA 1MTSA 3KQDA 3HGPA 5EGMA 2DUCA 1V2QT 5LPEA 4E7RG 2R2WU 3RMNH 3BTQE 1ELGA 1TONA 1EAUA 4XSKU 2Y5FA 2OP9A 2UUYA 3GY7A 1GJ7B 2O8MA 4NA8A 4NWLA 3KNXA 4ASHA 4KTUA 1DY8A 2EC9H 1BJUA 2PGBB 4VGCC 4YOIA 1SGIB 4BNRA 3PLKA 2A4OA 1BIOA 3FP8E 2ZU3A 2AIPA 3A82A 3VB4A 3ATWA 3KN2A 1T8MA 2W3IA 3ODFA 3NZIA 1O2WA 1GI1A 1WQVH 4ABEA 1TALA 2Z94A 1TA2A 2ZU1A 4I32A 1IQJA 1EP5A 5A8XA 3TLOA 2ZFRH 3UFAA 3URCA 1D3DB 1HXEH 2JH6D 4Y7AA 5C5NA 2VIVA 1V2OT 4IN1A 1P0SH 4K2YA 1P57B 5C1YA 2F9PA 1DICA 4CRDA 1P05A 1PPEE 5IDKA 3DHKH 1SGQE 4FU7A 1HGTH 2ZI2H 1TOMH 1EAXA 2ZDVH 1EQ9A 1O35A 1C5RA 4A6LA 1FIWA 1KLJH 3IITA 4ABDA 4FUEA 1C2EA 3M3VA 5BRRE 3U1IB 3BF6H 2DE8A 4K1TA 3T2NA 4Y8XA 2FI5E 2ZWLH 2FX6A 3O8DA 1NN6A 1ZJDA 1AVGH 3U9AH 1UK3A 1MQ5A 1MUEB 1XKBC 3O8BA 2R0LA 4HTCH 4RKJB 1RIWB 1GJCB 3GCNA 5EQRA 4PROA 3SV2H 1FIZA 2ZFFH 2WPKS 1LTOA 2ANMH 1YPKH 2PKAA 3TJVA 1CQQA 1NRPH 1FY5A 1YM0A 4NGAH 2J92A 5DGJA 4YESB 1SGRE 1K1OA 2HNTE 1AN1E 3LGTA 2JETC 2W7UA 1YP9A 3V3MA 2VH6A 3MH7A 2P94A 4GAWA 3QX5H 4GHTA 1LQEA 2VIWA 1HAYB 5A0BA 4K69A 1D6RA 1FUJA 5FBEA 2H9HA 2Z9GA 8GCHF 2HGTH 5EODA 1W0ZU 3KHVA 3VB6A 3BSQA 1QB1A 1C1OA 4ZUHA 2WV5A 4IC6A 3ZV8A 3DUXH 2BVRH 4AFUA 1MCTA 2BB4A 2VH0A 1MKXH 1DDJA 3GY3A 1C5VA 1P01A 3RMMH 3BN9A 1PPZA 2LPRA 4ZKSU 2AIQA 1TNKA 3PV4A 1A0HB 1NTPA 1DWDH 1CU1A 3VEQB 4FUGA 3A7ZA 3LGUA 2ZCHP 2ZDLA 3RDZA 1C9PA 2VJ1A 4JYVH 2ZTYA 4ABAA 1DE7H 4AGJA 3NK8A 1Z6EA 5AVDA 1PQ7A 2PKSB 4IGDA 3M3SA 1YCPM 1GJDB 2AGIX 4GVUA 5BPEA 1FY4A 4Y71A 3LGYA 3SU4A 4MPVA 1GI9B 1O3LA 1ZHPA 2BDBA 3T62A 4X1NU 1TQ7B 2BHGA 1THSH 3MU5A 5E0GA 1L1NA 4MPXA 1EB2A 1YPEH 3SQHE 1QCPA 3A89A 5JBCS 1KYNA 3QDZB 1DFPA 1YPHC 1QTFA 4SGBE 2AERH 3RXOA 2OBQA 4B2AA 1IQKA 3LC3A 1AUTC 3L6PA 2BOKA 1OWDA 5EU8A 2FDAA 2ALPA 3S7KB 1KXAA 2ESTE 3M3TA 3PO1B 2WUBA 5A8ZA 3FANA 2FM2A 4UDWH 1E36B 1ZTLA 4WWYA 3ZZBA 4UFEH 4RKOB 2ZDKA 3ZZ4A 2O9QA 4U2WA 3IG6B 1HAHH 2FS9A 2FLBH 4NIXA 1HAGE 1EJAA 1TQ0B 1UCYH 1RTFB 1F5KU 3K2UA 5GDSH 1O2TA 2QXIA 1Y3WA 1H8DH 3TK5A 2NU0E 5TCAA 3M7UA 3UUZA 3ZVAA 1KXEA 1QL9A 1PJPA 1TGTA 4DURA 1VITH 1JIMA 1VZQH 3PLBA 1EJNA 3SJ8A 1LO6A 4AN7A 3RXJA 2BD3A 3UR6A 2O8UA 4K1SA 1S6HA 2BD8A 4YLQH 1GMCF 1OWKA 4AZ2B 1QJ6B 1D6WA 2TGTA 3RXAA 2ZPSA 2A7HA 1ETTH 1QB9A 3GY2A 3ZZAA 1TPOA 4AG2A 3K65B 2R0KA 2BOHB 1GDUA 1N6YA 4YLUA 1RRKA 3QWCH 9LPRA 2FWWA 2XNIA 1AO5A 1F5LA 4Z0KA 1WSSH 1K1JA 2GV7A 2ZFQH 1F0RA 4K1EA 2OC1A 3E0PB 4K3JA 2Y7XA 1Y8TA 2AGGX 1O2YA 2B8OH 2GKVE 2QYIA 5FCKA 3E6PH 3ZZ8A 1BTHH 1QRXA 1C4U2 1W3CA 2Y82A 2XBXA 5K0HA 2QAAA 3SV6A 2OQ5A 2PKSC 4Y8ZA 3R3GB 3RU4T 3ZZ5A 3FAOA 4OS7A 3SV9A 4WXVA 1GBMA 1FY1A 4ISHH 2PR3A 3B23B 3F9FA 3A85A 4MTBA 3A7VA 4OS4A 4ISLA 5GCHG 3T25A 3F68H 2NU2E 1ELCA 1OWIA 4FXGH 1JWTA 4DY7B 5AFYH 4O03A 1CE5A 2EA3A 5TJXA 3W94A 2FODA 3GY6A 4FUCA 1LPZB 1SOTA 2FOHA 3LOXA 4NFEA 3RM2H 1J17T 2HNTF 1F92A 4KKDA 1W10U 3D65E 1UHBB 1GI5A 4KELA 2THFB 3MU4A 4TWYA 2C3SA 2FOCA 4CR5A 1ORFA 1MBMA 3EDXB 3A8AA 4WH6A 1WYKA 2G5VA 3BTDE 3ATMA 3K9XB 5T6GA 4AG1A 1OXGA 2TGPZ 1O2MA 2H5CA 1Z8GA 6ESTA 1L1GA 1GBKA 2SGQE 3GCHC 4XOJA 2ZFSA 4I8JA 1HAPH 1OKXA 1IQEA 1DM4B 1OWEA 5ESBA 4B73A 2B9LA 4LXBH 1ID5H 1TBQH 3M7QA 5EXLA 1MZAA 2GX4A 2GD4B 3QO6A 4ABBA 1IHSH 1MU8B 4U01A 1KLIH 1GJAB 1SMFE 1GPZA 2A4GA 1GBDA 4TYDA 2J94A 1SGEE 4GPGA 2A2QH 5CMXH 3GICB 1QA0A 1P3CA 1SPJA 3HKJB 1HV7A 3LC5A 1QB6A 1O2HA 3SBKA 1C9TA 2SNVA 3B9FH 1M9UA 2KAIA 1J15A 1TGSZ 1Z8IB 1QBOA 1H9LB 3JZ1B 1ELTA 1UTOA 1RS0A 1Y3UA 2YNBA 4FUBA 1YPMH 2WPLS 1YPHE 2OQUA 5DP9A 1QHRB 2H1UA 1O3KA 2ZGBH 1O32A 5GWZA 3NCLA 4AGKA 5FHTA 1SQTA 1B0EA 4O97A 1MMJN 1EP6A 1S85A 4UE7H 2BVXH 4I31A 5A2MH 5EQSA 1MD8A 5HYOA 1HAOH 1T32A 3MU8A 2ZCLP 4OS6A 1MKWH 2F91A 1GWAA 3HK6B 1TOCB 4NZLA 3O8CA 1P11E 4KTSA 1GI4A 4JCNA 1UVSH 3HATH 1BQYA 4FVBA 1GVZA 2QA9E 5L6NH 1NU9A 3O8RA 5C1XA 1FLEE 1NY22 1ACBE 4D9RA 1FI8A 2YNAA 2Z9JA 1DS2E 3BG4B 4D76A 3A84A 4O3UA 2Q1JA 4THNH 4I7YH 2BDGA 4BAMB 2V3OH 2SGAA 1P09A 2ZGCA 3MH4A 1TFXA 1NT1A 4FVDA 4H6TA 1LVYA 1C5YB 4K8YA 1OP0A 2VWOA 3MNSA 4X2XA 1GJ5H 2GZ8A 4FUIA 3QGJA 1WOFA 5C3NA 1GBBA 2BY5X 1VCPA 4MPUA 1ZHRA 1P2QA 3UTUH 2BDYA 3MH6A 3STJA 1F0SA 1GDQA 7LPRA 1SSXA 2BQ6B 4JZEH 2STBE 3SGAE 1PQ8A 1TNGA 1ZSKA 3FFGA 1BRCE 3S0NA 1QGFA 4TY6A 3GOVB 1SB1H 2VNTA 3UNSA 4ESTE 1C4V2 3RXLA 1G9IE 1SFIA 3Q3KA 1D3TB 2H5DA 3T27A 1ANDA 2G5NA 1P06A 1RFNA 4B2BA 1LVMA 3URDA 3BG8A 2QY0B 1VGCB 1AZ8A 1FAKH 1GI0A 1EJMA 2HPQH 2R9PA 2Z9LA 3P8NA 2GCTB 1XUGA 2OUAA 2ALVA 3KQEA 2ZGXH 3ZVEA 1ESBA 1N6XA 1ETRH 2HNTC 2PWXA 2W3KA 1O37A 3P70B 1O5DH 1RJXB 4E05H 8GCHG 4A1VA 1C5ZB 1SQAA 3EA7A 2ZHQH 1UVOA 2GZ9A 2PKAB 3BEIB 4BTUB 2XC0A 1O3OA 1BUIA 1N8OB 1FV9A 1C1VH 1XVOA 1DUEA 1BMMH 4B2CA 1S82A 1O3HA 1EZUC 3RUOA 1CBWB 4FUFA 4ZXYH 3TJOA 2BYAX 4CHAC 3TJUA 2BMGB 1GHXH 4OS1A 1K2I1 3TK6A 1CHOG 1O34A 1GHAF 1TWXB 3FP7E 4AFSA 1K22H 1DXPA 4UEHH 1Q31A 2O8TA 1GJ4H 2OC8A 2HLCA 1DWBH 3WY8A 2J38A 1FPHH 1GMDF 3MNXA 1V2NT 5ABWA 2OXSA 3BTME 1C1RA 1IHTH 1O39A 3A87A 4X6OA 1EB1H 1O2KA 2P3UB 2A4QA 2BDAA 2AMDA 1BTZA 1THRH 1BTUA 1TRMA 1O5GH 1NPMA 3S9BA 2ZECA 2F9OA 2HALA 1T7CA 1GI8B 5AFZH 3T28A 1SBWA 1AGJA 5CE1A 5JYIA 4FUJA 4YOGA 1XM1A 2I6QA 2F3CE 1AKSA 5JBAS 1V2LT 4DT7B 1DSUA 1YLCA 4CRFA 3CENA 3FZZA 3ATLA 1NFUA 4XDEA 3T5FH 3PROA 1WAYB 1SI5H 1MTUA 1XX9A 2XXLA 1MTVA 1WUNH 1TGCA 3U69H 3T29A 3SO3A 1FN8A 4M7GA 4BAQB 1LCYA 3BTHE 1HJAB 5EG4A 5IYTA 6GCHG 3SV8A 2B0FA 4J1YA 3RXIA 1SLUB 2A7CA 1JXPA 4GSOA 1BHXB 1GHBG 2VGCB 3ZV9A 3UQOA 4Y7BA 6CHAB 2GCHF 5LPRA 3KGPA 4XFQA 1QRWA 2XCFA 1XMNB 4NIYA 5T6DA 3OTJE 4NFFA 3P6ZB 2WINI 4UD9H 4Y11E 4IN2A 1J16A 1FPCH 1BBRE 1HAIH 2ZHEH 1SLXB 1MZDA 2P95A 3E90B 1AU8A 1C2GA 1V2PT 1Z71A 3SNAA 1ZLRA 2A2XH 1CGHA 3RXFA 3DFJA 4INHA 1LHDH 1P2NA 1XUHA 1XUKA 5E0HA 1B5GH 5FAHA 1CSOE 1A61H 2IN2A 1T8OA 2STAE 2J9NA 3V13A 2OBOA 1L4ZA 1ZTJA 1ESAA 1TLDA 1N8OC 1BTXA 2PUQH 3SI4H 4WMFA 3QN7A 4H6SB 4DIHH 4Y0YE 1CBWC 1PYTD 1TMTH 3V0XA 1IOEA 4BOHA 1BBRK 2FOFA 1D3QB 2V35A 3D62A 4JZ1A 1A1RA 2C8WB 2UUFB 2BVSH 1UTPA 2BQWB 2RCEA 1TX8A 2PGQB 1BITA 1DVAH 1GBFA 1SGFA 2P8OB 5DP3A 2HVXA 5DPAA 2QV1A 1S84A 4K5ZA 1LKBA 2BM2A 1AFEH 2QXJA 4Q7YA 1O3GA 1E37B 1UVPA 5JB8S 3MTYA 4MLFB 3RXCA 4Q7XA 5GIBA 3RM0H 1C2FA 1HLTH 1V2UT 4E06H 1T31A 5J4QA 4UFFH 8KME2 3SU0A 3LH3A 5DKMA 1C1TA 3QUMP 4ZHMU 3TGKE 1O2JA 2ZC9H 3IWMA 5TCCA 1G3CA 1XKAC 2B5TB 2UUJB 2FI3E 4CH8B 4WVPE 2BX3A 2GMTC 1L4DA 1O38A 1LPKB 1C2MA 3S9AA 1SHHB 3V7TA 1BRAA 1C2JA 2Z7FE 2XYAA 1ZPBA 3EA8A 4MNYA 1AE5A 3L3TA 1PPBH 2NU3E 3BTGE 1QFKH 3MO6A 4MNVA 5DP5A 3GCTF 1GI6A 1E35B 2ZU2A 2WYGA 5DP6A 2OLGA 1D4PB 2VGCC 1VR1H 4CBOA 3SU5A 2BZAA 1SGCA 1AZZA 1MTWA 2A4RA 3RMOH 1P04A 7KMEH 1ZYOA 2FYQA 1FY8E 1QR3E 5HM9A 2ZCKP 1YCPH 3RXDA 1CA0B 1S6FA 4LK4A 4U30A 1DITH 3MYWA 1O3BA 4JZDH 1ELDE 3Q77A 2BXUH 4ZHAA 1ZJKA 2GT8A 3NUMA 1BZXE 1AWFH 4X1PU 2IOTA 3PWCA 2WPMS 2EI7A 2J34A 5GJ4B 5L30H 1UJ1A 3MU0A 1GHVH 3SJOA 3VXEH 3SNCA 1OYTH 2P16A 4OS5A 3AAUA 2PW8H 2FMJA 4YO9A 4YZUA 3DFLA 3RMLH 2SGEE 1A0LA 3RXKA 2C93B 1E38B 2XC4A 2KAIB 1GJ8B 1K21H 3RXVA 1V2ST 1AB9B 1EUFA 4IC5A 5C1UA 3GYMA 4IBLH 2F9VA 3EE0B 4NG9H 3SUEA 2EI8A 1FJSA 4F49A 1IQGA 1BTPA 3RC5A 2GV6A 2OCVB 2ZHFH 2Z3CA 3UOPA 1KTTB 1OWJA 3ODDA 3QTOH 5L2ZH 1NFXA 1AD8H 4CRAA 1WBGB 1C5XB 1O3DA 1YYY1 4X1SU 1RIWC 1VITF 2TGAA 3TH3H 2AH4X 2CHAB 1A5HA 3UNRA 2P8OC 1ELEE 3TNSA 2ZFTA 1BCUH 4INLA 2ZQ1A 2BLOA 1C2IA 2ZO3H 3UREA 5GPIB 1GGDB 3RXRA 1P2KA 2A45B 2Y80A 4HI3A 3KEEA 2BD9A 1F0UA 1K9OE 2BY9X 5LH8A 1AHTH 1SGPE 1QBNA 1TRNA 2PUXB 2EI6A 1SGFG 2UWOA 2ZNKH 1LHGH 1ESTA 2W26A 1C5WB 1EKBB 4UONA 1C5OH 1FN6A 5LPFA 1O3PB 1PQ5A 1P8VC 1A2CH 5G4BA 1H4WA 1GI2A 4X8VH 1C5MD 1IQMA 3LGWA 2ZF0H 3GDUA 3SJKA 1P9UA 3PTNA 1YPLH 4Y0ZE 3SNDA 2UWLA 1CT4E 3FVFB 3MO9A 1NESE 2D1JA 4IMZA 4WJG2 2ZGHA 2TRMA 1QURH 2VVVA 3B8JA 1BBRH 2QF3A 2TGDA 2PV9B 2CF9H 1LHCH 4O3TA 2GDEH 2R2MB 1K1PA 1KY9A 2ZGJA 3VB3A 4ZH8A 2ZKSA 2ANWA 1D3PB 1GDNA 1KTSB 1MH0A 1O2ZA 3H7TA 5E8EH 5F8ZA 3M5MA 1A7SA 1CA8B 4B74A 3U8TH