3E3TA

Structure of porcine pancreatic elastase with the magic triangle i3c
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
molecule tags Hydrolase
publication title A magic triangle for experimental phasing of macromolecules
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e3tA01
1LPZB 2XTTB 3KCGH 2OXSA 1E35B 2RG3A 3ZYDA 3P8NA 2UUKB 4FU7A 1V2UT 3LIWA 1O2JA 3SGBE 5EGMA 3S7KB 1GI8B 1TGBA 4NIXA 1NRQH 1V2KT 3U69H 3TPIZ 1TA6A 1T4UH 1L4DA 1RD3B 2CJIA 5E0GA 2O8TA 2FLRH 1ELBA 4NSYA 4DG4A 4D7FA 3ESTA 1CQQA 2W7SA 2VGCC 3LONA 3UNSA 3SU1A 1O32A 5DO4H 2G51A 1SSXA 1VR1H 1FIWA 1S0QA 2OLGA 1UHBA 1KLIH 1K22H 1GDUA 1ELTA 1AFQB 3AAVA 2FO9A 1Y8TA 3CS0A 1VJAU 3GCOA 1TX7A 1F0RA 2WPKS 5HM2A 1OP8A 1LVOA 1O3OA 1EOJA 2W7UA 1YCPK 1OWJA 3JZ1B 2GD4B 4YT6H 1S6FA 2PUQH 1D3TB 1YLDA 1GBHA 3ZVGA 4OS4A 1GBJA 2VVUA 2A5KA 2XBXA 3L33A 3MU0A 1WOFA 1GCDA 2VB0A 2KAIA 1CGIE 2XRCA 3GCNA 3GY5A 1C5NH 5LPEA 1W3CA 1UCYK 1DY8A 4RKOB 3QLPH 4X1QU 2ZPSA 3SJIA 4KELA 4ABIA 1BMLA 2OD3B 1YM0A 2ZTYA 2C8XB 2LNCA 1EKBB 1C9PA 2BD3A 1GJCB 4K2YA 1N1LA 3RXFA 1K1JA 1GI2A 1W10U 1QQUA 5GPIB 1KLJH 1GL1A 1BMNH 1ZJKA 1RS0A 1UK4A 1EJNA 2BDHA 3TGJE 1XXFA 1P8VC 2FDAA 1O34A 2O8UA 1KXBA 2P8OB 4NIVA 5EOKA 5TCAA 1SL3A 1AHTH 1NT1A 4AZ2B 5EQQA 1NROH 1D4PB 3PO1B 3SHAH 4F4OC 1CT0E 1F0SA 3GYLB 4IN1A 1IHSH 2IPHA 1SPJA 3WY8A 1A0LA 1FUJA 1HPGA 1AFQC 1FAXA 3TIUA 3MH5A 1YC0A 2FOGA 1CA8B 2SGDE 3KQCA 4FVDA 2FX6A 1GI3A 2FODA 3LPRA 3Q00A 3BTEE 3BF6H 2XW9A 4NA7A 1AE8H 2GP9B 1O38A 3GOVB 3U1JB 2Z7FE 3MH6A 4MVNA 4ZH8A 5E0JA 5FX5A 1O5BB 4Q7XA 4ISLA 5HGGA 1SGEE 8LPRA 1TIOA 3GY2A 3SV6A 2OC1A 1BMAA 3LGTA 2Z9KA 2Z9JA 1EPTB 2J94A 1DDJA 1EAIA 2XC5A 3HPTB 3RU4T 3ODFA 1LKBA 3K65B 2WPIS 4WXIA 2AFQB 3U8RH 4FUCA 2A7JA 2BYAX 1CBWC 2BHGA 3W95A 3W94A 1OP0A 1MCVA 2Q1JA 2BOKA 1ZPCA 1IQNA 2O8MA 2WYGA 1BBRK 1LPGB 2V0BA 8GCHG 1LHFH 1GHYH 1G3CA 1PPZA 3BTDE 3NK8A 4Y71A 3B23B 1OYTH 1MUEB 3ZZDA 2UWPA 3QGNB 1CHOG 4ZKRU 1QA0A 1GHWH 3MH4A 1O2NA 3T2NA 3EYDA 1TFXA 2BM2A 5C67A 3TK5A 2F9PA 2C8YB 2AMDA 1ELEE 3ZV8A 3CP7A 5J4QA 4DT7B 3LGWA 3KN2A 1G3DA 3HKJB 3TVJB 9LPRA 3TGIE 1HB0B 1C2LA 3KQEA 1MD7A 3M5OA 4MPVA 5C2ZA 1O2XA 3SV9A 3L3TA 7KMEH 1GGDB 1GCTB 1O0DH 1XUKA 3U8TH 1TLDA 4HGCA 5F8TA 5K7RA 1FN6A 5FBIA 1NFWA 5A0BA 4NFEA 1BJVA 4NCYA 1V2ST 1O2TA 1GJ5H 2C90B 1GMCG 2BY7X 3FP8E 4U2WA 1PQ8A 2C3SA 5DP7A 1BHXF 5A8ZA 3TK9A 1ZPZA 2IOTA 5C1YA 1A1RA 1C1NA 3M3SA 1D6WA 2GCHF 5JBBS 5EU8A 2V3HH 4TYDA 1BJUA 4ZHAA 4KGAA 4BANB 2CGAA 1T31A 4E06H 2ZP0H 1A4WH 5EQSA 4Z6AH 3GDVA 1PPEE 1W8BH 3A7WA 2R3YA 5F03A 3LJJA 4B74A 1Z71A 1PPCE 4DCDA 3S9BA 1T8NA 1UCYE 3A7VA 3NPSA 1OS8A 1B5GH 3VFEA 3QZQA 1C2IA 5JB8S 1TGNA 2Z6BD 1FMGA 4Z0KA 2H9TH 4IN2A 3I78A 1DLKB 3ZVFA 1H1BA 5DJ7A 1FAKH 3RXDA 2ODYB 4JK5A 1ZHMA 2IN2A 4CBNA 1Y3XA 1XXDA 1DWCH 1JIMA 1JMOH 4CR5A 5DPAA 4LZ4B 3A7ZA 4YESB 1SHHB 1YCPH 7ESTE 1S5SA 2ALPA 5A09A 1TNHA 5ESBA 2SFAA 1TNJA 4DIIH 2HNTE 1N8OB 1NFYA 1PQ7A 2FZZA 2Y7ZA 1GVZA 4ABFA 2Z9LA 1P2QA 3S0NA 1C5QA 4K3JA 4D7GA 2QXGA 3BEUA 1DOJA 2XWBI 1GBIA 1GJ6A 1HAHH 4YLQH 2PTCE 3T62A 2FEQH 2PTNA 1NU9A 2BDAA 1EJAA 4IGDA 4A7IB 2B8OH 1EASA 3L6PA 1O2MA 2BD7A 4FUFA 2Y82A 2Y81A 2ZGHA 1EB2A 2Y6TA 1LVMA 1GI4A 1ANDA 1O2QA 2ZHFH 1DE7H 3A81A 2ZU4A 3GCTG 1GI6A 3U98H 2J38A 1P2MA 5JBAS 1O2LA 1XM1A 3NXPA 1YPLH 4MPWA 5FXLA 1RTKA 1KTTB 2EI6A 2FYRA 1GDQA 1HFDA 2THFB 5A0CA 1THRH 4H6SB 5I25A 1S84A 2J34A 4CHAC 2HPQH 2ZQ1A 1TGSZ 3E3TA 1KTSB 1TOCB 2ASUB 4OS6A 1LVBA 2G00A 3MOCA 1WTGH 1GHBF 1QBNA 1O5GH 3PLKA 3I77A 3EA7A 1FIZA 1ESAA 4RN6A 1TNKA 3M7TA 1MTVA 1NESE 2DE8A 5FAHA 1IQHA 1AVXA 5FCRA 4JZIA 3GY3A 4UEHH 5EODA 2XWAA 1GBFA 2UWOA 1LDTT 2A7CA 1GJAB 4K1TA 4I8KA 2AIQA 4BAOB 3TNSA 1EZUC 1SI5H 3BTFE 1KXDA 1FQ3A 1H4WA 1PYTC 4DW2U 5ABWA 3AASA 3ODDA 4YO9A 1CGJE 1UVOA 1ZSLA 1GJ4H 4AG1A 1NZQH 2FOMB 4O3TA 5C5NA 2FOFA 1L0ZA 2ZQ2A 1GJ9B 1GBCA 1P9SA 1QCPA 2PKAB 4A1XA 1HLTH 3BTQE 1GI9B 3PLPA 3LT3A 1AVGH 5DP5A 2A45B 1O3LA 1PQAA 2BXTH 2ZGCA 1TPAE 1WBGB 3P17H 2QCYA 3F9EA 1MBQA 1Q3XA 4NZLA 1A5IA 3NWUA 1F5KU 1C2FA 1PPGE 1XUJA 3SOSA 2GMTB 3V12A 3KNXA 5C1UA 1FPCH 2ALVA 5T6GA 1SFIA 4X6OA 1AMHA 1GJDB 4FUBA 3ZZ8A 5GCHF 1O39A 5FCKA 3RXTA 2ZDNA 1SLVB 4WMFA 3SNEA 2BX3A 3IITA 4GPGA 2FS9A 3OY6U 3RC4A 2PR3A 1LPKB 2BLQA 1TBRH 2F91A 4FXGH 1P2IA 1UK3A 1K1MA 2HNTC 3NKKA 1RTFB 1WU1A 1Z6EA 2CXVA 3H7TA 3OY5U 1TPSA 6CHAC 2H5DA 1Y5AT 4NIWA 2Z3EA 3R0FA 3O8CA 3UIRA 1KXFA 4FU8A 4TPYA 3Q3XA 1RGQA 1WAYB 1BTUA 3RXMA 1XUFA 2G5NA 1Y3WA 4GHTA 3IWMA 4OGYA 3C27B 3BTME 1OWDA 2A1DB 1G3BA 4D76A 2V6NA 1ESTA 4X8TH 3OX7U 2HPPH 2H6MA 4F49A 3V7TA 1OWKA 2ZHDA 4Y7AA 1MTWA 4AB8A 1ZLRA 4FUHA 1INCA 1TWXB 1KXEA 1AKSA 1TB6H 2RDLA 4XSKU 1VCWA 4CRGA 1AIXH 3TH4H 3S69A 4GAWA 1FY4A 3FZDA 3SN8A 4KP0A 1Q2WA 1O2YA 3RXCA 2OP9A 2A4OA 1P09A 1QRZA 3VB4A 1Z1IA 1TNGA 4MG3A 4XBBA 3PYHA 2FP7B 1FZZA 1SGYE 2BMGB 1CGHA 6ESTA 2O8LA 2NU4E 4Y7BA 3RMMH 5FBEA 5DP8A 4BTUB 4MNYA 2JH5D 4MNWA 1C5YB 1EXFA 2F9OA 4ESTE 4MNXA 4KKDA 3F9FA 2ANWA 3BTHE 1MKXK 1D3DB 3PMBB 2ZC9H 1UK2A 4I7YH 2ZCKP 5K0HA 2SNVA 1DX5M 3M37A 1QHRB 3AW1A 1RXPA 3BG8A 2B0FA 2RCEA 3RXRA 2BY6X 4X8VH 2XBYA 1P2KA 1N8OC 1MTSA 1N6YA 2F9VA 4H4FA 3S7HB 3GDUA 3LC5A 1DSTA 1TPPA 1C5XB 4LOYH 4GVUA 2BD2A 1C2MA 3VXEH 1F5LA 1AD8H 3LGIA 1ARCA 2QGRA 1O3DA 5LH8A 1YGCH 3MO6A 1AI8H 3BTTE 1Y3YA 3BEIB 1GJ7B 2FS8A 1HAVA 1KXCA 1OPHB 1IQJA 1C9TA 4JZEH 1PPBH 1ZOMA 1EPTC 3ZZ4A 1GI7B 3RXIA 3NZIA 1A5HA 2ZHWH 1V2VT 1RIWC 1OYQA 1FNIA 1MD8A 2W3IA 1H8DH 1NPMA 1TYNA 3F1SB 8ESTE 1DANH 1BTXA 2NU1E 4Q2KA 4E05H 1F5RA 1AB9C 3LC3A 2AS9A 2OINA 4I8LA 2GZ9A 3A82A 2Q6GA 2A5AA 2BDBA 1YPHE 3SU6A 1W2KH 4X6MA 1GBBA 3QN7A 4CRCA 1O2RA 3M7QA 1YLCA 5T6FA 3A7YA 1BTZA 2JETC 5IYTA 2BLWA 2WPLS 3VB6A 3GY6A 4JCNA 4CREA 1FY5A 3SBKA 2W26A 1E34B 1ZGVA 2VH6A 3BN9A 2H2ZA 1QB9A 3ZVEA 1ZRKA 1O3IA 2D8WA 1GHXH 1V2QT 3MI4A 3RMNH 3SU2A 5C3NA 4MPXA 1BTWA 1GBMA 4U32A 5HYOA 1D9IA 4AG2A 3TGKE 4INHA 1UVPA 1NO9H 1TABE 2HNTF 1A3BH 2PSXA 2F9NA 1TBZH 1LMWB 3LH1A 1HBTH 1VITH 4X2WA 3TITA 2R9PA 2GCTC 3A80A 1JWTA 3SU4A 1BRBE 5FPTA 2QXJA 3P92A 2J4IA 1HAZB 1W11U 3SUFA 1OWIA 2XXLA 1EJMA 1MKWK 4ABEA 4X8SH 5GJ4B 4WMDA 1QQ4A 2HGTH 1TALA 2ODPA 5E2PA 1TA2A 1THSH 4YT7H 2ZFRH 2BQ7B 1F0TA 4WF8A 3KGPA 3ZZCA 2VU8E 5CHAC 1HAIH 1S82A 1MU6B 1LHEH 1W7GH 1MBMA 3A8CA 2OC8A 1GMHF 3ZZAA 1C1WH 2QYIA 6LPRA 2ZTZA 2C4FH 3K6YA 1S85A 1T32A 1V2JT 1LTOA 1HYLA 1A3EH 3RC6A 5BPEA 1O2KA 1P04A 1SGCA 2A2XH 3UFAA 3TH2H 4JYUH 4DGJA 2P3UB 2AEIH 4IC6A 2VVCA 2ZHEH 1WCZA 1LO6A 1HJ8A 1SGFG 1C5RA 1CA0C 1GGDC 1HGTH 4NA9H 3QUMP 2FOCA 4NGAH 1ZR0A 2VIDA 2QF3A 3H7OA 2R2MB 1KSNA 3HKIB 2J2UA 4UFFH 3RXEA 1T4VH 1KLTA 1OWHA 3ZVAA 4DIHH 1AUJA 1VITG 1RRKA 1YP9A 3ITIA 1PPHE 2VGCB 3PWBA 1UO6A 4ZROA 1U6QA 3ZYEA 1LCYA 4BOHA 2GKVE 2BLOA 1P3CA 4CRDA 3N7OA 1YPJH 3SNAA 2ZKSA 1K28D 2VVVA 3GYMA 1AQ7A 3KQBA 5L6NH 5CE1A 3GCHB 1BRUP 3HK3B 1J8AA 4ZMAH 4YOGA 2BDIA 1FV9A 4DY7B 3BTKE 3TLOA 3T5FH 1ANEA 3RU4D 5L2YH 1C5OH 1DLEA 4OS2A 3SQEE 1C1SA 5HM9A 4OS5A 2PFEA 3BIVH 1P05A 2JETB 2JKHA 1ZGIA 3PTBA 3M5LA 1MAXA 3Q76A 1Q31A 1DM4B 3SQHE 2HALA 1KXAA 2ZO3H 3MNXA 2ZFQH 1SQOA 1BHXB 4FUJA 2Z94A 1EZSC 1O3CA 2W3KA 3SU0A 4I32A 2EEKA 3SJKA 5T3HA 1O2HA 3MU8A 1P10A 3T29A 1AU8A 3SU5A 3AVZA 4CRAA 3UQVA 4ISHH 1K1OA 2BQ6B 1W0ZU 1ABIH 3KHVA 4IC5A 1GI0A 3PM3A 3PB1E 2WV4A 4LK4A 3A84A 2G55A 2ZFPH 2GZ7A 2WV5A 5AHGH 5JB9S 3E8LA 1NTPA 4TWWA 1UVSH 2C93B 1GBDA 4XBDA 1C5SA 2D2DA 4Y10E 4FUEA 2ZHQH 3ELAH 2A0QB 3TJUA 3SI3H 4Y11E 4MNVA 2F9UA 2QXIA 1HAYB 3A8BA 1O3GA 2FESH 2FI3E 3GCHC 1LQEA 1UMAH 5CHAB 1XUIA 4ISIH 3GDSA 2Y80A 1EP6A 1ESBA 3FVFB 3MNBA 4K60A 1QJ6B 1AZ8A 4AFUA 2TRMA 3SUEA 1F2SE 4Y8ZA 1SFQB 2QY0B 5B6OA 2IJOB 4YM9A 2FOHA 4ZUHA 3DT0H 2ESTE 1P06A 3SW2B 1TMTH 3MU1A 2OC7A 3BV9B 2TPIZ 5E2OA 3ZZ5A 3SNCA 1KYNA 2BZAA 1SGPE 3VB5A 4MDSA 3RXVA 4ABDA 2QAAA 2FTMA 5L30H 1BB0B 3O8BA 1Y59T 5EXNA 1PQ5A 1VITF 1D6RA 1QA7A 4ABHA 9ESTA 1P9UA 1AZZA 5G4BA 1YPMH 5FPYA 1O5AB 2FIRH 2ZFTA 1DWEH 4ABBA 4GCHG 1FY1A 3LDXH 5JBTA 2O9QA 3R3GB 2BVXH 3BTWE 3SU3A 3ZVDA 4ABAA 1ZRBA 2CHAC 1SGDE 3MO9A 4Y6DA 2OBOA 4CR9A 3SNDA 1E36B 3PLBA 1AO5A 3SNBA 3RXQA 1TQ0B 1GHAF 1XKAC 2V3OH 4WH8A 1UVTH 4WMEA 2OUAA 1O2OA 1VJ9U 2WUCA 3EA8A 2BY9X 4K8YA 4OGXA 2DUCA 3MYWA 1DT2A 4NG9H 3SV8A 1UTPA 1BTPA 3M35A 2FLBH 1C2GA 2R0KA 1MKWH 4TY7A 4ZKNU 5LGOA 4HZHA 3P8OA 2FOAA 4X0WU 2A4QA 1ARBA 5A2MH 4RSPA 1AB9B 1P3EA 2D26C 1IQFA 4OS1A 2P8OC 1EAUA 1O2SA 1SLUB 4DURA 3ATMA 2BTCE 3TH3H 1G36A 2K1QA 1ELGA 1O3FA 1SVPA 4UFDH 4NFFA 1UCYH 5FHTA 4NSVA 1GHBG 1BT7A 1AFEH 1ZTLA 2V35A 2Z9GA 2ZWLH 3VGCB 1SGNE 1QFKH 2ZDVH 5F8ZA 2B5TB 2BD4A 3P8FA 2ZEBA 4AYYB 1C1OA 4AGKA 1HDTH 1EATA 3BTGE 1HUTH 2XCNA 4X6PA 2QF0A 2ANKH 5FX6A 1TOMH 5LPRA 1GBTA 4BTIB 2H1UA 2F83A 1P0SH 3UUZA 1BZXE 1C5UA 3CENA 3MU4A 1E0FD 1AGJA 1XMNB 3LKWA 1X7AC 4BNRA 3SV2H 3URCA 1OXGA 3E0PB 3LGUA 3RU4E 2XBWA 5EW1H 4IMZA 4HTCH 1GHZA 5A0AE 1NRPH 1XUGA 3RXJA 1UTJA 1EOLA 3TK6A 3OSYA 1J9CH 3ATLA 4MTBA 1A46H 2AGIX 1XVOA 1HCGA 2PSYA 1XX9A 1CT2E 2P93A 1SQAA 2RA0A 1WTHD 2BXUH 1T8LA 1Z8JB 1QIXB 2B7DH 4MPUA 2J92A 1HIAA 2BY5X 4PROA 1BTHH 1YPKH 1O3HA 4WH6A 2QIQA 3RXBA 5BRRE 3UPEA 4TPIZ 1MMJN 1IQGA 2BOHB 1L4ZA 4ZXXH 1FXYA 1Y5UT 1P11E 3M61U 1C1PA 4DOQA 1A0HB 2VWOA 2BX4A 1SHYA 1BOQA 2VINA 1V2RT 5DGJA 3E90B 3F6UH 1GMHG 1V2MT 4BXSA 1C4Y2 1ZSKA 2B9LA 2FOEA 1YYY1 1C2KA 4TY6A 1IQMA 4NWLA 6GCHG 1DWBH 3VB3A 1G30B 1W14U 5DP9A 1IOEA 1GBEA 4H6TA 1DS2E 3LGVA 4UDWH 5CMXH 1UHBB 3RXAA 5IDKA 1O2ZA 2H9EH 2C8ZB 5AF9H 1DY9A 1IQLA 2XC0A 2VIQA 2YNAA 2PKSC 2UUFB 1F7ZA 1WYKA 4Y8XA 2FOBA 1G2LA 4Y0ZE 4U01A 1VZQH 1YBWA 2TGPZ 2GCHG 3GY8A 1K9OE 1A2CH 2BD8A 3PMJA 3RMLH 1MTNB 1UTOA 1GMCF 2CMYA 3LU9B 3DFLA 2NU0E 4A1VA 1J15A 4BAKB 2UWLA 1JXPA 1O3AA 3SJ9A 1SB1H 3RXKA 3LGYA 2WINI 3K2UA 3UOPA 3RXUA 1O3BA 1DSUA 1XUHA 1AE5A 4FUDA 4O3UA 1CU1A 1JOUB 1ZSJA 3ATKA 7GCHF 4Y8YA 2BDCA 5PTPA 1C4U2 2VJ1A 4YLUA 1C2EA 1YPGH 1NRRH 2A4RA 5EQRA 1GHAG 1DICA 1NC6A 2GTBA 1NS3A 2I6QA 1L1NA 2PW8H 2GDEH 5TJXA 1NY22 4LXBH 3V3MA 3ZZ3A 2STBE 4IW4E 2UUJB 3MFJA 3M5NA 4VGCB 5JDUB 4KTUA 3RLYH 1Z1JA 1SGRE 4KTSA 3A88A 1CO7E 2BY8X 2OQ5A 2TBSA 1FI8A 3URDA 1OOKB 3RXLA 1CSOE 1GJ8B 1P2JA 1ACBE 2VNTA 3QTOH 3E16B 1ELFA 4AGJA 1GPZA 1QRWA 4Y76A 1GG6C 3T27A 1DVAH 2P16A 2ZFSA 1MTNC 1ETSH 1JIRA 1SOTA 4UFEH 2ZU2A 1J16A 4VGCC 1Y3VA 3RM2H 1O2WA 2KAIB 5C5OA 1P01A 1B0FA 5E8EH 1F92A 4ABJA 1TQ7B 1O33A 4XE4A 3MNCA 1S81A 4ZHLU 2ZDLA 1Z6JH 2M5TA 1K1NA 3U8OH 2LPRA 4K5ZA 2SGPE 6GCHF 1ZTKA 1DWDH 3GY7A 3K6ZA 4JMYA 3MO3A 1GMDG 4WVPE 2AIPA 1GL0E 1O3JA 1GHVH 3KQDA 1HAPH 2WPHS 3HGPA 2ZZUH 4RKJB 3T26A 1UTMA 4JZ1A 1QB1A 1BUIA 1OKXA 1O5FH 3A7XA 3A8AA 4XBCA 4XDEA 3UR9A 4NWKA 2ZDKA 2A31A 4ABGA 1LQDB 3A86A 3ENSB 1T8OA 1UTQA 1TGTA 2FI4E 1IQEA 1WV7H 4Q7YA 2ANMH 1FJSA 4B76A 2ZG0H 2VIOA 3FP6E 3TNTA 3PV4A 2G81E 2ZNKH 4Y0YE 1TE0A 1LHCH 1Z7KA 1UVUH 1Z8GA 2GV7A 3PTNA 3NUMA 5JPMH 1MZAA 1ZYOA 1C5MD 1SGIB 3EE0B 2OBQA 3RDZA 3E1XB 1KDQA 3SJOA 2RA3A 1J14A 1BDAA 1YF4A 1HAXB 1DXWA 5F8XA 8KME2 4AB9A 1DXPA 2TGTA 2XNIA 3I29A 1GWAA 2VWLA 4WJG2 3T25A 1JRTA 4MQAA 4K1SA 4NIYA 3Q77A 3KF2A 1GDNA 2BDYA 3EGKH 4X1NU 2Q6FA 1ANBA 2GZ8A 4D9QA 1SLXB 3AAUA 1A61H 4AOQA 3S9AA 1ABJH 2FTLE 2FI5E 2A7HA 2H5CA 3ZZ9A 3S9CA 2TGAA 2GCTB 4X2YA 3UWJH 1SR5C 1C4V2 2QC2A 3V0XA 1SGQE 1C5WB 3O8RA 3BIUH 1WQSA 2P3TB 3FANA 1G9IE 1CHGA 3KIDU 1SG8B 1EP5A 1TNIA 1AWFH 1FONA 3MNSA 1O37A 1S83A 3UREA 1GI5A 1G2MA 5I46H 1SMFE 1CT4E 2W5EA 1L2EA 1QR3E 2NWNA 4AFZA 1ZTJA 1T7CA 5A8XA 2Y5HA 4ZAEA 1BQYA 2PV9B 1RIWB 1OX1A 1AY6H 4AYVB 2HWLB 3D23A 4QT8C 1HJAC 1PYTD 1GI1A 1ELAA 1W12U 2WYJA 3ATIA 3SUGA 2OTVA 5L2ZH 4Y79A 3STJA 4U30A 2QA9E 1GJBB 4K1EA 1QURH 4FUGA 4O03A 2AYWA 2GDDA 4ZHMU 2STAE 3UQOA 2ZA5A 2EC9H 3RXHA 1ELDE 4I31A 2TIOA 2VIPA 1BA8B 1C1VH 2PUXB 1T8MA 2EI7A 2FPZA 1O2IA 4I8GA 4A92A 1DUEA 1TGCA 3QWCH 2CN0H 1QTFA 3ATWA 1O3PB 2CF9H 2GT8A 2BQWB 2P3FH 1C2JA 1UJ1A 1KDQB 1GCTC 1BBRH 3TJVA 1ID5H 1PJPA 1G32B 3OYPA 5TCCA 1O36A 1F0UA 2BLVA 5LPFA 1O3NA 1THPB 2QN5T 2PGBB 2ODQA 4CBOA 2SNWA 1K1LA 1FLEE 4YOIA 4X8UH 2SGAA 3VB7A 3MMGA 1E38B 2R3UA 4AX9H 4BAQB 3OTJE 1P02A 2PLXA 5ESTE 1MAYA 1SQTA 3RP2A 1B0EA 3G01A 4J1YA 2G5VA 4AN7A 1IQIA 2A5IA 3VGCC 3ZV9A 3U9AH 3BSQA 3QDZB 5DP3A 2CV3A 1MH0A 1V2TT 1O2GH 1ETRH 4GHQA 1V2LT 2R0LA 3JZ2B 3B9FH 4JZFH 5EXMA 2BVRH 1Y3UA 2FX4A 1W0YH 3QZRA 3SGQE 2FMJA 3E6PH 1AN1E 3GISB 3RXSA 3FP7E 4IBLH 2PKSB 4WXVA 4SGBE 2ULLA 4J2YB 4YTAA 1ORFA 1TX6A 2G8TA 3UNQA 5H4IB 3KL6A 2AGEX 2YNBA 3HATH 1SOZA 1CHOF 2PGQB 3LJOA 1HXFH 1KIGH 1M9UA 2Z3CA 2AERH 2BD9A 1EX3A 1Z8RA 3OU0A 1RFNA 1AVWA 3ZZBA 3P8GA 1DITH 4IMQA 1P2NA 8GCHF 3QX5H 2TGDA 1QGFA 4BXWA 3VXFH 1K1PA 2ZECA 1V2PT 4BAMB 3EQ0H 3FFGA 5AFYH 1TRMA 1C2HA 2Y5FA 3ZZ6A 1VCQA 5JBCS 3RM0H 3RXGA 4XFQA 2SGEE 1LHGH 1L1JA 4GSOA 1O5EH 1OP2A 1IHTH 4O9VA 3A7TA 1C5LH 1SGTA 3SUDA 2XYAA 1VGCC 2Z9IA 1CE5A 4UE7H 1EQ9A 1NU7B 2BZ6H 5DK1A 5C1XA 2EI8A 3SJ8A 1GMDF 2WPJS 6CHAB 1NRNH 3P95A 1O2UA 4I8HA 4IS5A 4A5TS 2FWWA 2ZDAH 1XVMA 1OSSA 2G52A 1UTKA 3SI4H 1O3KA 1QJ7B 2J9NA 4ZXYH 1O2VA 4ZKSU 1QL8A 1O2PA 3A8DA 1MKXH 2BDGA 4CHAB 1C1MA 3DFJA 3KEEA 1HNEE 4BAHB 1EAXA 1QY6A 3LH3A 2FYQA 3NCLA 1HV7A 1NFXA 1Z8IB 3ZZ7A 1QB6A 3UWIA 5EW2H 2UUYA 4B71A 1OWEA 2QXHA 1RTLA 4JYVH 1O5CB 2G4TA 4Q7ZA 3MU5A 3SHCH 4NZQA 2AMPA 2XCFA 2QV1A 1HJAB 1H9HE 2DE9A 1GBLA 4HI3A 3K9XB 1CBWB 1PFXC 2ZIQH 3F9GA 3TJNA 1SBWA 4JZDH 4THNH 2A32A 4JK6A 1NRSH 4CH8B 1EB1H 2ZPQA 2VIWA 3FZZA 4B2AA 2ZI2H 4INLA 4X6NA 1NM6A 3HGNA 5DKMA 1BRCE 3SO3A 4K8BA 1EPTA 5GWZA 3P70B 1SLWB 4CRBA 1ZMNA 3A87A 1EUFA 2NU2E 3MH7A 1D3PB 1MQ6A 3EDXB 4Q80A 1TMUH 1XKBC 2J95A 4GUXA 3UOUA 1H8IH 1HAOH 1C1TA 1O5DH 1GVKB 1TX8A 2YOLA 3MTYA 5ETXA 4B2CA 5DP6A 5HXFA 7LPRA 1CA0B 2PKAA 2D1JA 5A8YA 3M3VA 4JYTA 1A5GH 1QBVH 4B1TA 2Q6DA 5GDSH 2H9HA 3EAJA 4ZKOU 1TMBH 2FM2A 1O3EA 1TNLA 1ELCA 1RJXB 2CF8H 1O3MA 5DP4A 3MWIU 5GCHG 1G3EA 1TONA 3EA9A 1QJ1B 4R8TB 4AFQA 4UD9H 2A2QH 4TWYA 3A83A 3U1IB 3M7UA 3FAOA 1ZZZA 2WUBA 3A85A 3PWCA 2VWMA 4YOJA 1WSSH 4SGAE 1O35A 1ELVA 3D62A 1H9IE 5C20A 2ZFFH 4AFSA 2XC4A 3STIA 4X2VA 1HAGE 4R0IA 1K1IA 1EZQA 4FUIA 1S0RA 2EA3A 1C5VA 2WPMS 2ANYA 3RC5A 3M3TA 2Y7XA 2GX4A 1HRTH 1J17T 2AGGX 3SGAE 3RUOA 2F9BH 1ZHPA 2ZU1A 3IG6B 4O97A 3D65E 3M36A 1FY3A 1V2OT 3TJOA 3RXOA 4DVAU 3SV7A 4MLFB 2F3CE 1O30A 2HRVA 3E0NB 4INKA 1V3XA 1C2DA 3SORA 3QGJA 3RXPA 5EPNA 1UTLM 1C1RA 2ZPRA 1DUAA 2BVSH 3VPKA 2PWXA 2VH0A 1LKAA 4B75A 3PMHB 1HXEH 3MHWU 4GCHF 1QL9A 3ZVCA 4B73A 2ZGJA 2R2WU 3T28A 1W7XH 4ISNA 3BG4C 2JH6D 1K2I1 3QTVH 1AWHB 1BRAA 3F68H 4E7NA 4WWYA 1P57B 1EAWA 3PMAB 4X1SU 1PPFE 4H42U 3QO6A 4I8JA 3AW0A 1G37A 4X1PU 3C1KA 3HK6B 2OQUA 1C5PA 4NA8A 1SC8U 5HMAA 1YPEH 5SGAE 2ZU3A 2OC0A 3BEFB 2VWNA 4D8NA 2ZF0H 4KTCA 2ZU5A 1HAVB 1V2NT 1A0JA 1IAUA 3DD2H 4GLYA 2ZDMA 4M7GA 3GCTF 2FXRA 1C1UH 3B8JA 2GGVB 1EZXC 1QNJA 5T6DA 1W13U 5JYIA 4FVBA 2G4UA 3QK1A 1IQKA 2NU3E 4ISOA 4WY3A 2SGQE 5FPSA 1D3QB 4DJZB 1QBOA 3RLWH 2HLCA 3Q3YA 1UTNA 1BIOA 1A7SA 3LOXA 4A1TA 1ZPBA 1MCTA 1LVYA 1WQVH 1ETTH 1LHDH 2OCVB 1VCPA 3D49H 4HFPB 3CS7A 1Y5BT 3V13A 1MQ5A 1HJ9A 3Q3KA 2ILNA 3E91A 1WUNH 3DUXH 3H5CB 1MU8B 2ZCLP 4BTTB 4UONA 2CHAB 1S6HA 2JH0D 2C8WB 2I6SA 1JRSA 1MTUA 1YPHC 4ASHA 4XOJA 4A6LA 4B2BA 2O8WA 2P94A 1B7XB 3UY9A 2A4GA 1NN6A 3UTUH 1GBAA 2Z3DA 1DPOA 3GY4A 2GT7A 1ZHRA 1FDPA 1BMMH 1ZMLA 2P59A 4AORA 1N6XA 1P12E 3P6ZB 3M5MA 4I33A 2ZTXA 1O31A 1P03A 1GG6B 1GVLA 1L1GA 1V2WT 1ANCA 4X2XA 2AMQA 3F9HA 3A89A 4X1RU 5GXPA 1AKSB 1K21H 5DG6A 2PHBA 3SZNA 1BITA 2ZGBH 1VGCB 3VEQB 1P2OA 3DA9B 4E7RG 4FU9A 2HVXA 4YZUA 4UFGH 1FN8A 2GMTC 1HIAB 1SGFA 2P95A 1YCPM 1QL7A 1KY9A 5F6MA 3O8DA 2HOBA 3ZVBA 5EPYA 3GICB 1MZDA 3UNRA 3BG4B 4K69A 1BCUH 2XBVA 5EG4A 3PROA 5E0HA 3RMOH 1AUTC 1QRXA 1TBQH 2AH4X 2BB4A 2VIVA 1C1QA 4CRFA 5AFZH 1V6DA 1H9LB 4CH2B 1C5ZB 1FPHH 5EXLA 1TAWA 3PO1C 3DHKH 1BTYA 1YKTA 1JBUH 5GIBA 3UR6A 5J4SA 1ZJDA 3TU7H 1TRNA 1TPOA 2ZCHP 5AVDA 1FY8E 4LZ1H 1TRYA 2GV6A 2BD5A 1NFUA 1BBRE 4OS7A 1GBKA 1E37B 1CVWH 1DFPA 2GVFA 2Y5GA 4D9RA 2SGFE 2ZGXH 1ZMJA 7GCHG 1C5TA
chains in the Genus database with same CATH superfamily
1LPZB 2XTTB 3KCGH 2OXSA 1E35B 2RG3A 3ZYDA 3P8NA 2UUKB 4FU7A 1V2UT 3LIWA 1O2JA 3SGBE 5EGMA 3S7KB 1GI8B 1TGBA 4NIXA 1NRQH 1V2KT 3U69H 4ACBA 3TPIZ 1TA6A 1T4UH 1L4DA 1RD3B 2CJIA 5E0GA 2O8TA 2FLRH 1ELBA 4NSYA 4DG4A 4D7FA 3ESTA 1CQQA 2W7SA 2VGCC 3DCLA 3LONA 3UNSA 3SU1A 1O32A 5DO4H 2G51A 1SSXA 1VR1H 1FIWA 1S0QA 2OLGA 1UHBA 1KLIH 1K22H 1GDUA 1ELTA 1AFQB 3AAVA 2FO9A 1Y8TA 3CS0A 1VJAU 3GCOA 1TX7A 1F0RA 2WPKS 5HM2A 1OP8A 1LVOA 1O3OA 1EOJA 3PRDA 2W7UA 1YCPK 1OWJA 3JZ1B 2GD4B 4YT6H 1S6FA 2PUQH 1D3TB 1YLDA 1GBHA 3ZVGA 4OS4A 1GBJA 2VVUA 2A5KA 2XBXA 3L33A 3MU0A 1WOFA 1GCDA 2VB0A 2KAIA 1CGIE 2XRCA 3GCNA 3GY5A 1C5NH 5LPEA 1W3CA 3OE7D 1UCYK 1DY8A 4RKOB 3QLPH 4X1QU 2ZPSA 3SJIA 4KELA 4ABIA 1BMLA 2OD3B 1YM0A 2ZTYA 2C8XB 2LNCA 1EKBB 1C9PA 2BD3A 2W6ID 1GJCB 4K2YA 1N1LA 3RXFA 1K1JA 1GI2A 1W10U 1QQUA 5GPIB 1KLJH 1GL1A 1BMNH 1ZJKA 1RS0A 1UK4A 1EJNA 2BDHA 3TGJE 1XXFA 1P8VC 2FDAA 1O34A 2O8UA 1KXBA 2P8OB 4NIVA 5EOKA 5TCAA 1SL3A 1AHTH 1NT1A 4AZ2B 5EQQA 1NROH 1D4PB 3PO1B 3SHAH 4F4OC 1CT0E 1F0SA 3GYLB 4IN1A 1IHSH 2IPHA 1SPJA 3WY8A 1A0LA 1FUJA 1HPGA 1COWD 2XNDD 1AFQC 1FAXA 3TIUA 3MH5A 1YC0A 2FOGA 3DSPA 1CA8B 2SGDE 3KQCA 4FVDA 2FX6A 4RT1A 1GI3A 2FODA 3LPRA 3Q00A 3BTEE 3BF6H 2XW9A 4NA7A 1AE8H 2GP9B 1O38A 3GOVB 2QE7D 3U1JB 2Z7FE 3MH6A 4MVNA 4ZH8A 5E0JA 2CK3D 5FX5A 1O5BB 4Q7XA 4ISLA 5HGGA 1SGEE 8LPRA 1TIOA 2WPDD 3GY2A 3SV6A 2OC1A 1BMAA 3LGTA 2Z9KA 2Z9JA 1EPTB 2J94A 1DDJA 1EAIA 2XC5A 3HPTB 3RU4T 3ODFA 1LKBA 3K65B 2WPIS 4WXIA 2AFQB 3U8RH 4FUCA 2A7JA 2BYAX 1CBWC 2BHGA 3W95A 3W94A 1OP0A 1MCVA 2Q1JA 2BOKA 1ZPCA 1IQNA 2O8MA 2WYGA 1BBRK 1LPGB 2V0BA 8GCHG 1LHFH 1GHYH 1G3CA 1PPZA 3BTDE 3NK8A 4Y71A 3B23B 1OYTH 1MUEB 3ZZDA 2UWPA 3QGNB 1CHOG 4ZKRU 1QA0A 1GHWH 3MH4A 4RI0A 1O2NA 2J98B 3T2NA 3EYDA 1TFXA 2BM2A 5C67A 3TK5A 2F9PA 2C8YB 2AMDA 1ELEE 3ZV8A 3CP7A 5J4QA 4DT7B 3LGWA 3KN2A 1G3DA 3HKJB 3TVJB 9LPRA 2GJGA 3TGIE 1HB0B 1C2LA 3KQEA 1MD7A 3M5OA 4MPVA 5C2ZA 1O2XA 3SV9A 3L3TA 7KMEH 1GGDB 1GCTB 1O0DH 1XUKA 3U8TH 1TLDA 4HGCA 3PRBA 5F8TA 5K7RA 1FN6A 5FBIA 1NFWA 5A0BA 4NFEA 1BJVA 4NCYA 1V2ST 1O2TA 1GJ5H 2C90B 1GMCG 2BY7X 3FP8E 4U2WA 1PQ8A 2C3SA 5DP7A 1BHXF 5A8ZA 3TK9A 1ZPZA 2IOTA 5C1YA 1A1RA 1C1NA 3M3SA 1D6WA 2GCHF 5JBBS 5EU8A 2V3HH 4TYDA 1BJUA 4ZHAA 4KGAA 4BANB 2CGAA 4HG6A 5EJZA 1T31A 4E06H 2ZP0H 1A4WH 5EQSA 5T1VA 4Z6AH 3GDVA 1PPEE 1W8BH 3A7WA 2R3YA 5F03A 3LJJA 4B74A 1Z71A 1PPCE 4DCDA 3S9BA 1T8NA 1UCYE 5KEDA 3A7VA 3NPSA 1OS8A 1B5GH 3VFEA 3QZQA 1C2IA 5JB8S 1TGNA 2Z6BD 1FMGA 4Z0KA 2H9TH 4IN2A 3I78A 1DLKB 3ZVFA 1H1BA 5DJ7A 1FAKH 3RXDA 2ODYB 4JK5A 4B6EA 1ZHMA 2IN2A 4CBNA 1Y3XA 1XXDA 1DWCH 1JIMA 1JMOH 4CR5A 3H09A 5DPAA 4LZ4B 3A7ZA 4YESB 1SHHB 1YCPH 7ESTE 1S5SA 2ALPA 5A09A 1TNHA 5ESBA 2SFAA 1TNJA 4DIIH 2HNTE 1N8OB 1NFYA 1PQ7A 3FO8D 2FZZA 2Y7ZA 1GVZA 3F3BA 4ABFA 2Z9LA 1P2QA 3S0NA 1C5QA 4K3JA 4D7GA 2QXGA 3BEUA 1DOJA 2XWBI 1GBIA 1GJ6A 1HAHH 4YLQH 2PTCE 3T62A 2FEQH 2PTNA 1NU9A 3GS9A 2BDAA 1EJAA 4IGDA 4A7IB 2B8OH 1EASA 3L6PA 1O2MA 2BD7A 2JDID 4FUFA 2Y82A 2Y81A 2ZGHA 1EB2A 2Y6TA 1LVMA 1GI4A 1ANDA 1O2QA 2ZHFH 1DE7H 3A81A 2ZU4A 3GCTG 1GI6A 3U98H 2J38A 5F53A 1P2MA 5JBAS 1O2LA 1XM1A 3NXPA 1YPLH 4MPWA 5FXLA 1RTKA 1KTTB 2EI6A 2FYRA 3PV5A 1GDQA 1HFDA 2THFB 5A0CA 1THRH 4H6SB 5I25A 1S84A 2J34A 4CHAC 2HPQH 2ZQ1A 1TGSZ 3E3TA 4OM9A 1KTSB 1TOCB 2ASUB 1NBMD 4OS6A 1LVBA 2G00A 3MOCA 1WTGH 1GHBF 1QBNA 1O5GH 3PLKA 3I77A 3EA7A 1FIZA 1ESAA 3PV2A 4RN6A 1TNKA 3M7TA 1MTVA 1NESE 1QZ8A 2DE8A 3FKSD 1IQHA 1AVXA 5FCRA 5FAHA 4JZIA 3GY3A 4UEHH 5EODA 2XWAA 2UWOA 1GBFA 1LDTT 2KZ4A 2F43B 2A7CA 3OTPA 1GJAB 4K1TA 4I8KA 2AIQA 4BAOB 3TNSA 1EZUC 1SI5H 3BTFE 1KXDA 1H8HD 1FQ3A 1H4WA 1PYTC 4DW2U 5ABWA 3AASA 3ODDA 4YO9A 1CGJE 1UVOA 1ZSLA 1GJ4H 4AG1A 1NZQH 2FOMB 2EY4C 4O3TA 2FOFA 5C5NA 1L0ZA 2ZQ2A 1GJ9B 1GBCA 1P9SA 1QCPA 2PKAB 4A1XA 1HLTH 3BTQE 1GI9B 3PLPA 3LT3A 1AVGH 5DP5A 2A45B 1O3LA 1PQAA 2BXTH 2ZGCA 1TPAE 1WBGB 3P17H 2QCYA 3F9EA 1MBQA 1Q3XA 2L74A 4NZLA 1A5IA 3NWUA 1F5KU 1C2FA 1PPGE 2RDEA 2KX4A 1XUJA 3SOSA 2GMTB 3V12A 3KNXA 5C1UA 1FPCH 2ALVA 5T6GA 1SFIA 4X6OA 1AMHA 1GJDB 4FUBA 3ZZ8A 5GCHF 1O39A 5FCKA 3RXTA 2ZDNA 1SLVB 4WMFA 3SNEA 2BX3A 3IITA 4GPGA 2FS9A 3OY6U 3RC4A 2PR3A 1LPKB 2BLQA 1TBRH 2F91A 4FXGH 1P2IA 1UK3A 1K1MA 2HNTC 3NKKA 4FOUC 5DN6D 1RTFB 1WU1A 1Z6EA 2CXVA 3H7TA 3OY5U 1TPSA 6CHAC 2H5DA 1Y5AT 4NIWA 2Z3EA 3R0FA 3O8CA 3UIRA 1KXFA 4FU8A 4TPYA 3Q3XA 1RGQA 1WAYB 1BTUA 3RXMA 1XUFA 4TT3D 2G5NA 1Y3WA 4GHTA 3IWMA 4OGYA 3C27B 3BTME 1OWDA 2A1DB 1G3BA 4D76A 2V6NA 1ESTA 4X8TH 3OX7U 2HPPH 2H6MA 4F49A 3V7TA 1OWKA 2ZHDA 4Y7AA 1MTWA 4AB8A 1ZLRA 4FUHA 1INCA 1TWXB 1KXEA 1AKSA 1TB6H 2RDLA 4XSKU 1VCWA 4CRGA 1AIXH 3TH4H 3S69A 2WSSD 3F0OA 4GAWA 1FY4A 3FZDA 3SN8A 4KP0A 1Q2WA 1O2YA 3RXCA 2OP9A 2A4OA 2KFWA 1P09A 1QRZA 3VB4A 1Z1IA 1TNGA 4MG3A 4XBBA 2KR7A 3PYHA 2FP7B 1FZZA 1SGYE 2BMGB 1CGHA 6ESTA 2O8LA 2NU4E 4Y7BA 3RMMH 5FBEA 5DP8A 4BTUB 4MNYA 2JH5D 4MNWA 1C5YB 1EXFA 2F9OA 4ESTE 4MNXA 4KKDA 3F9FA 2ANWA 3BTHE 1MKXK 1D3DB 3PMBB 2ZC9H 1UK2A 4I7YH 2ZCKP 5K0HA 2SNVA 1DX5M 3M37A 1QHRB 3AW1A 1RXPA 3BG8A 2B0FA 2RCEA 3RXRA 2BY6X 4X8VH 5CDFE 2XBYA 1P2KA 1N8OC 1MTSA 1N6YA 2F9VA 4H4FA 3S7HB 2QF5A 3GDUA 3LC5A 1DSTA 1TPPA 1C5XB 4LOYH 4GVUA 2BD2A 1C2MA 3VXEH 1F5LA 1AD8H 3LGIA 1ARCA 2QGRA 1O3DA 5LH8A 1YGCH 3MO6A 1AI8H 3BTTE 5CHBA 1Y3YA 3BEIB 1GJ7B 2FS8A 1HAVA 1KXCA 1OPHB 1IQJA 1C9TA 4JZEH 1PPBH 1ZOMA 1EPTC 3ZZ4A 1GI7B 3RXIA 3NZIA 1A5HA 2ZHWH 1V2VT 1RIWC 1OYQA 1FNIA 2J5UA 1MD8A 2W3IA 1H8DH 1NPMA 1TYNA 1EFRD 3F1SB 4YXWD 8ESTE 1DANH 1BTXA 2NU1E 4Q2KA 4E05H 1F5RA 1AB9C 3LC3A 2AS9A 2OINA 4I8LA 2GZ9A 3A82A 3F0PA 2Q6GA 2A5AA 2BDBA 1YPHE 3SU6A 1W2KH 4X6MA 1GBBA 3QN7A 4CRCA 3U28C 1O2RA 3M7QA 1YLCA 5T6FA 3A7YA 5EJ1A 1BTZA 2JETC 5IYTA 2BLWA 3WWBA 2WPLS 3VB6A 3GY6A 3UAIC 4JCNA 4CREA 1FY5A 3SBKA 1E34B 2W26A 1ZGVA 2VH6A 3BN9A 2H2ZA 1QB9A 3ZVEA 1ZRKA 1O3IA 2D8WA 1GHXH 1V2QT 3MI4A 3RMNH 3SU2A 5C3NA 4MPXA 1BTWA 1GBMA 4U32A 5HYOA 1D9IA 5DSFA 4AG2A 3TGKE 4INHA 1UVPA 1NO9H 1TABE 2HNTF 1A3BH 2PSXA 2F9NA 1TBZH 1LMWB 3LH1A 1HBTH 1VITH 4X2WA 3TITA 2R9PA 2GCTC 3A80A 1JWTA 3SU4A 1BRBE 5FPTA 2QXJA 3P92A 2J4IA 1HAZB 1W11U 3SUFA 1OWIA 2XXLA 1EJMA 1MKWK 4ABEA 4X8SH 5GJ4B 4WMDA 1QQ4A 5GNDA 2HGTH 1TALA 2ODPA 5E2PA 1TA2A 1THSH 4YT7H 2ZFRH 2BQ7B 1F0TA 4WF8A 3KGPA 3ZZCA 2VU8E 5CHAC 1HAIH 1S82A 1MU6B 1LHEH 1W7GH 1MBMA 3A8CA 2OC8A 1GMHF 3ZZAA 1C1WH 2QYIA 6LPRA 2ZTZA 2C4FH 3K6YA 1S85A 1T32A 1V2JT 1LTOA 1HYLA 1A3EH 3RC6A 4Q80A 5BPEA 1O2KA 1P04A 1SGCA 2A2XH 3UFAA 3TH2H 4JYUH 4DGJA 2P3UB 2AEIH 4IC6A 2VVCA 2ZHEH 1WCZA 1LO6A 1HJ8A 1SGFG 1C5RA 1CA0C 1GGDC 1HGTH 4NA9H 3QUMP 2FOCA 4NGAH 1ZR0A 2VIDA 2QF3A 3H7OA 2R2MB 1KSNA 3HKIB 2J2UA 4UFFH 3RXEA 5EIYA 1T4VH 1KLTA 1OWHA 3ZVAA 4DIHH 1AUJA 1E1QD 1VITG 1RRKA 1YP9A 3ITIA 1PPHE 2VGCB 3PWBA 1UO6A 4ZROA 1U6QA 3ZYEA 1LCYA 4P02A 4BOHA 2GKVE 2BLOA 1P3CA 4CRDA 3N7OA 1YPJH 2WHXA 3SNAA 2ZKSA 1K28D 2VVVA 3GYMA 1AQ7A 3KQBA 5L6NH 5CE1A 3GCHB 1BRUP 3HK3B 1J8AA 4ZMAH 4YOGA 2BDIA 1FV9A 4DY7B 3BTKE 3TLOA 3T5FH 1ANEA 3RU4D 5L2YH 1C5OH 1DLEA 4OS2A 3SQEE 1C1SA 5HM9A 4OS5A 2PFEA 3BIVH 1BMFD 1P05A 2JETB 2JKHA 1ZGIA 3PTBA 3M5LA 1MAXA 3Q76A 1Q31A 1DM4B 3SQHE 2HALA 1KXAA 5B6LA 2ZO3H 3MNXA 2ZFQH 1SQOA 1BHXB 4FUJA 2Z94A 3VG8A 1EZSC 1O3CA 2W3KA 3SU0A 4I32A 2EEKA 3SJKA 5T3HA 1O2HA 3MU8A 1P10A 3T29A 1AU8A 3SU5A 3AVZA 4CRAA 3UQVA 4ISHH 1K1OA 2BQ6B 1W0ZU 4Q4LA 1ABIH 3KHVA 4IC5A 1GI0A 3PM3A 3PB1E 2WV4A 4LK4A 3A84A 2G55A 2ZFPH 2GZ7A 2WV5A 5AHGH 3SYJA 5JB9S 3E8LA 1NTPA 4TWWA 1UVSH 2C93B 1GBDA 4XBDA 1C5SA 2D2DA 4Y10E 4FUEA 2ZHQH 3ELAH 2A0QB 3TJUA 3SI3H 4Y11E 4MNVA 2KCOA 2F9UA 2QXIA 1HAYB 3A8BA 1O3GA 2FESH 2FI3E 3GCHC 1LQEA 1UMAH 5CHAB 1XUIA 4ISIH 3GDSA 2Y80A 1EP6A 1ESBA 3FVFB 3MNBA 4K60A 1QJ6B 1AZ8A 2KCPA 4AFUA 2TRMA 3SUEA 1F2SE 4Y8ZA 1SFQB 2QY0B 3KQ5A 5B6OA 2IJOB 4YM9A 2FOHA 4ZUHA 3DT0H 2ESTE 1P06A 2JJ1D 3SW2B 1TMTH 4AC9A 3MU1A 2OC7A 3BV9B 2TPIZ 5E2OA 3ZZ5A 1YLNA 3SNCA 1KYNA 2BZAA 1SGPE 3VB5A 4MDSA 3RXVA 4ABDA 2QAAA 2FTMA 5L30H 1BB0B 3O8BA 1Y59T 5EXNA 2EQNA 1PQ5A 1VITF 1D6RA 1QA7A 4ABHA 9ESTA 1P9UA 1AZZA 5G4BA 1YPMH 5FPYA 1MABB 1O5AB 2FIRH 2ZFTA 1DWEH 4ABBA 4GCHG 1FY1A 3LDXH 5JBTA 2O9QA 3R3GB 2BVXH 3BTWE 3SU3A 3ZVDA 4ABAA 1ZRBA 2CHAC 1SGDE 3MO9A 4Y6DA 2OBOA 4CR9A 3SNDA 1W0KD 2IJD1 1E36B 3PLBA 1AO5A 3SNBA 3RXQA 1TQ0B 1GHAF 1XKAC 2V3OH 4WH8A 1UVTH 4WMEA 2OUAA 1O2OA 1VJ9U 2WUCA 3EA8A 2BY9X 4K8YA 4OGXA 2DUCA 5C17A 3MYWA 1DT2A 4NG9H 4Z1MD 3SV8A 1UTPA 1BTPA 3M35A 2FLBH 1C2GA 2R0KA 1MKWH 4TY7A 4ZKNU 5LGOA 4HZHA 3P8OA 2FOAA 4X0WU 2A4QA 1VKYA 1ARBA 1FX0B 5A2MH 4RSPA 1AB9B 1P3EA 2D26C 1IQFA 4OS1A 2P8OC 1EAUA 2L6OA 1O2SA 1SLUB 4DURA 3ATMA 2BTCE 3TH3H 1G36A 2K1QA 1ELGA 1O3FA 3F2GA 1SVPA 4UFDH 4NFFA 1UCYH 5FHTA 4NSVA 1GHBG 1BT7A 4FETA 1AFEH 4RT0A 1ZTLA 2V35A 2V7QD 2Z9GA 2ZWLH 3VGCB 1SGNE 1QFKH 2ZDVH 5F8ZA 2B5TB 2BD4A 5HIYA 3P8FA 2ZEBA 4AYYB 1C1OA 4AGKA 1HDTH 1EATA 3BTGE 1HUTH 2XCNA 3KYGA 2QF0A 2ANKH 4X6PA 5FX6A 1TOMH 5LPRA 1GBTA 4BTIB 2H1UA 2F83A 1P0SH 3UUZA 1BZXE 1C5UA 3CENA 3MU4A 1E0FD 1AGJA 1XMNB 3LKWA 1X7AC 5C0TA 4BNRA 3SV2H 3URCA 1OXGA 3E0PB 3LGUA 3RU4E 2XBWA 5EW1H 4IMZA 4HTCH 1GHZA 5A0AE 1NRPH 2QF4A 1XUGA 3RXJA 1UTJA 1EOLA 3TK6A 3OSYA 1J9CH 3ATLA 4MTBA 1A46H 2AGIX 1XVOA 1HCGA 2PSYA 1XX9A 1CT2E 2P93A 1SQAA 2RA0A 1WTHD 2BXUH 4B6FA 1T8LA 1Z8JB 1QIXB 2B7DH 4MPUA 2J92A 1HIAA 2BY5X 4PROA 1BTHH 1YPKH 1O3HA 4WH6A 2QIQA 3RXBA 5BRRE 3UPEA 4TPIZ 1MMJN 1IQGA 2OK5A 2BOHB 1L4ZA 4ZXXH 1FXYA 1Y5UT 1P11E 3M61U 1C1PA 4DOQA 1A0HB 2VWOA 2BX4A 1SHYA 1BOQA 2VINA 1V2RT 5DGJA 3E90B 3F6UH 1K0HA 1GMHG 1V2MT 4BXSA 1C4Y2 1YY3A 1ZSKA 2B9LA 2FOEA 1YYY1 1C2KA 4TY6A 1IQMA 4P00A 4NWLA 6GCHG 3OFND 1DWBH 3VB3A 1G30B 1W14U 2LP6A 5DP9A 1IOEA 4F55A 1GBEA 4H6TA 1DS2E 3LGVA 4UDWH 5CMXH 1UHBB 3RXAA 5IDKA 1O2ZA 2H9EH 2C8ZB 2W6JD 5AF9H 1DY9A 1IQLA 2XC0A 4XRNA 2VIQA 2YNAA 2PKSC 2UUFB 1F7ZA 1WYKA 4Y8XA 2FOBA 1G2LA 4Y0ZE 4U01A 1VZQH 1YBWA 2TGPZ 2GCHG 3GY8A 1K9OE 1A2CH 2BD8A 3PMJA 3RMLH 1MTNB 1UTOA 4XD7D 1GMCF 2CMYA 3LU9B 3DFLA 2NU0E 5C0UA 4A1VA 1J15A 4BAKB 2UWLA 1JXPA 1O3AA 3SJ9A 1SB1H 3RXKA 1W0JD 3LGYA 2WINI 3K2UA 3UOPA 3RXUA 1O3BA 1DSUA 1XUHA 1AE5A 4FUDA 4O3UA 1CU1A 1JOUB 1ZSJA 3ATKA 7GCHF 4Y8YA 2BDCA 5PTPA 3WW7A 1C4U2 2VJ1A 4YLUA 1C2EA 1YPGH 1NRRH 2A4RA 5EQRA 1GHAG 1DICA 1NC6A 2GTBA 1NS3A 2I6QA 1L1NA 2K0QA 2PW8H 2GDEH 5TJXA 1NY22 4LXBH 5FL7D 3V3MA 3ZZ3A 2STBE 4IW4E 2UUJB 3MFJA 3M5NA 4VGCB 5JDUB 4KTUA 3RLYH 1Z1JA 1SGRE 4KTSA 3A88A 1CO7E 2VBCA 2BY8X 2OQ5A 2TBSA 1FI8A 3URDA 1OOKB 3RXLA 1CSOE 1GJ8B 1P2JA 1ACBE 2VNTA 3QTOH 3E16B 1ELFA 4AGJA 1GPZA 1QRWA 4Y76A 1GG6C 3T27A 1DVAH 2P16A 2ZFSA 1MTNC 1ETSH 1JIRA 1NBME 1SOTA 4UFEH 2ZU2A 1J16A 4VGCC 1Y3VA 3RM2H 1O2WA 2KAIB 2YMSB 5C5OA 1P01A 1B0FA 5E8EH 1F92A 3ZIAD 5KECA 4ABJA 1TQ7B 1O33A 4XE4A 3MNCA 1S81A 4ZHLU 2ZDLA 2YMSD 3CNRA 1Z6JH 3UB0A 2M5TA 1K1NA 3U8OH 2LPRA 4K5ZA 2SGPE 6GCHF 1WXRA 1ZTKA 1DWDH 3GY7A 3K6ZA 4JMYA 3MO3A 1GMDG 4WVPE 2AIPA 1GL0E 1O3JA 1GHVH 3KQDA 1HAPH 2WPHS 3HGPA 2ZZUH 4RKJB 3T26A 1UTMA 4JZ1A 1QB1A 1BUIA 1OKXA 1O5FH 3A7XA 3A8AA 4XBCA 3N7DA 4XDEA 3UR9A 4NWKA 2ZDKA 2A31A 4ABGA 1LQDB 3A86A 3ENSB 1T8OA 1UTQA 1TGTA 2FI4E 3F2FA 1IQEA 1WV7H 4Q7YA 2ANMH 1FJSA 4B76A 2ZG0H 2VIOA 3FP6E 3TNTA 3PV4A 2G81E 2ZNKH 4Y0YE 1TE0A 1LHCH 4M9FA 1Z7KA 1UVUH 1Z8GA 2GV7A 3PTNA 3NUMA 5JPMH 1MZAA 1ZYOA 1C5MD 1SGIB 3EE0B 2OBQA 3RDZA 3E1XB 1KDQA 3SJOA 2IPQX 2RA3A 1J14A 1BDAA 1YF4A 1HAXB 1DXWA 5F8XA 8KME2 4AB9A 1DXPA 2RFKC 2TGTA 2XNIA 3I29A 1GWAA 2VWLA 4WJG2 3T25A 1JRTA 4MQAA 4K1SA 4NIYA 3Q77A 3KF2A 1GDNA 2BDYA 3EGKH 4X1NU 2Q6FA 1ANBA 2GZ8A 4D9QA 1SLXB 3AAUA 1A61H 4AOQA 3S9AA 3WWFA 1ABJH 2FTLE 2FI5E 2A7HA 2H5CA 3ZZ9A 3S9CA 2TGAA 2GCTB 4X2YA 3UWJH 1SR5C 1C4V2 2QC2A 3V0XA 1SGQE 1C5WB 3O8RA 2J98A 3BIUH 1WQSA 2P3TB 3FANA 1G9IE 1CHGA 3KIDU 1SG8B 1EP5A 1TNIA 1AWFH 1FONA 1WDIA 3MNSA 1O37A 1S83A 3UREA 1GI5A 1G2MA 5I46H 1SMFE 1CT4E 2W5EA 1L2EA 1QR3E 2NWNA 4AFZA 1ZTJA 1T7CA 5A8XA 2Y5HA 4ZAEA 1BQYA 2PV9B 1RIWB 1OX1A 1AY6H 4AYVB 2HWLB 3D23A 4QT8C 1HJAC 1PYTD 1GI1A 1ELAA 1W12U 2WYJA 3ATIA 3SUGA 2OTVA 5L2ZH 4Y79A 3STJA 4U30A 2QA9E 1GJBB 4K1EA 1QURH 4FUGA 4O03A 2AYWA 2GDDA 4ZHMU 2STAE 3UQOA 2ZA5A 2EC9H 3RXHA 1ELDE 4I31A 2TIOA 2VIPA 1BA8B 1C1VH 2PUXB 3KYFA 1T8MA 2EI7A 2FPZA 1O2IA 2HVYB 4I8GA 4A92A 1DUEA 1TGCA 3DSOA 3QWCH 2CN0H 1QTFA 3ATWA 1O3PB 2CF9H 2GT8A 2BQWB 2P3FH 1C2JA 1UJ1A 1KDQB 5IK2D 1GCTC 1BBRH 3TJVA 1ID5H 1PJPA 1G32B 3OYPA 4F48B 5KGOA 5TCCA 1O36A 1F0UA 2BLVA 3N7EA 5LPFA 1O3NA 1THPB 2QN5T 2PGBB 2ODQA 1E79D 4CBOA 2SNWA 1K1LA 1FLEE 4YOIA 4X8UH 2SGAA 4ASUD 3VB7A 3MMGA 1E38B 2R3UA 4AX9H 4BAQB 3OTJE 1P02A 2PLXA 5ESTE 1MAYA 1SQTA 3RP2A 1B0EA 3G01A 4J1YA 2G5VA 4AN7A 1IQIA 2A5IA 3VGCC 3ZV9A 3U9AH 3BSQA 3QDZB 5DP3A 2CV3A 1MH0A 1V2TT 1O2GH 1ETRH 4GHQA 1V2LT 2R0LA 3JZ2B 2F4LA 3B9FH 4JZFH 3OEHD 5EXMA 2WV9A 2BVRH 1Y3UA 2FX4A 1W0YH 3QZRA 3SGQE 2FMJA 3E6PH 1AN1E 3GISB 3RXSA 3FP7E 4IBLH 2PKSB 4WXVA 3DSGA 4SGBE 2ULLA 4J2YB 4YTAA 1ORFA 1TX6A 2G8TA 3UNQA 5H4IB 3KL6A 2AGEX 2YNBA 5C94A 3HATH 1SOZA 1CHOF 2PGQB 3LJOA 1HXFH 1KIGH 1M9UA 2HLDD 2AERH 2Z3CA 2BD9A 1EX3A 1Z8RA 3OU0A 1RFNA 1AVWA 3ZZBA 3P8GA 1DITH 1KMHB 1P2NA 4IMQA 2K8IA 3QX5H 8GCHF 2TGDA 1QGFA 4BXWA 3VXFH 1K1PA 2ZECA 1V2PT 4BAMB 3EQ0H 3FFGA 5AFYH 1TRMA 1C2HA 2Y5FA 1YWUA 3ZZ6A 1VCQA 5JBCS 5HIZA 3RM0H 3RXGA 4XFQA 2SGEE 1LHGH 1L1JA 1SKYE 4GSOA 1O5EH 1OP2A 1IHTH 4O9VA 3A7TA 1C5LH 1SGTA 3SUDA 2XYAA 1VGCC 2Z9IA 1CE5A 4UE7H 1EQ9A 1NU7B 2BZ6H 5DK1A 5C1XA 2EI8A 3SJ8A 1GMDF 2WPJS 6CHAB 1NRNH 3P95A 1O2UA 4I8HA 4IS5A 4A5TS 2FWWA 2ZDAH 1XVMA 1OSSA 2G52A 1UTKA 3SI4H 1O3KA 1QJ7B 2J9NA 4ZXYH 1O2VA 4ZKSU 1QL8A 1O2PA 3A8DA 1MKXH 2BDGA 4CHAB 1C1MA 3DFJA 3KEEA 3NRLA 1HNEE 4BAHB 1EAXA 1QY6A 3LH3A 2FYQA 3NCLA 1HV7A 1NFXA 1Z8IB 2M2AA 3ZZ7A 1QB6A 3UWIA 5EW2H 2UUYA 4B71A 1OWEA 2QXHA 1RTLA 4JYVH 1O5CB 2G4TA 4Q7ZA 3MU5A 3SHCH 4NZQA 2AMPA 2XCFA 2QV1A 1HJAB 1H9HE 2DE9A 1GBLA 5HKKD 4HI3A 3K9XB 1CBWB 1PFXC 1OHHD 2ZIQH 3F9GA 3TJNA 1SBWA 4JZDH 4THNH 2A32A 4JK6A 1NRSH 4CH8B 1EB1H 2ZPQA 2VIWA 3FZZA 4B2AA 2ZI2H 4INLA 4X6NA 1NM6A 3HGNA 5DKMA 1BRCE 3SO3A 4K8BA 1EPTA 5GWZA 3P70B 1SLWB 2PP6A 1E1RD 4CRBA 1ZMNA 3A87A 3OEED 1EUFA 2NU2E 3FOAA 1D3PB 1MQ6A 3EDXB 3MH7A 1TMUH 1XKBC 2J95A 3N99A 4GUXA 3UOUA 1H8IH 1HAOH 1C1TA 2LELA 1O5DH 1GVKB 1TX8A 1S6LA 2JJ2D 2YOLA 3MTYA 5ETXA 4B2CA 5DP6A 4DT4A 5HXFA 7LPRA 1CA0B 2PKAA 2D1JA 5A8YA 3M3VA 4JYTA 1A5GH 1QBVH 4B1TA 2Q6DA 5GDSH 2H9HA 2KM0A 3EAJA 4ZKOU 1TMBH 2FM2A 1O3EA 2V3MA 1TNLA 1ELCA 1RJXB 2CF8H 1O3MA 3W1EA 5DP4A 3MWIU 3EE7A 5GCHG 3FN8A 1G3EA 1TONA 3EA9A 1QJ1B 4R8TB 4AFQA 4UD9H 2A2QH 4TWYA 3A83A 3U1IB 3M7UA 3FAOA 1ZZZA 2WUBA 3A85A 3PWCA 2VWMA 4YOJA 1WSSH 4SGAE 2YMSC 1O35A 1ELVA 3D62A 1H9IE 4I86A 5C20A 1UW7A 2ZFFH 4AFSA 2XC4A 3STIA 4X2VA 1HAGE 4R0IA 1K1IA 1EZQA 4FUIA 1S0RA 2EA3A 1C5VA 2WPMS 2ANYA 3OAAD 3RC5A 3M3TA 2Y7XA 2GX4A 1HRTH 1J17T 2AGGX 3SGAE 3RUOA 2F9BH 1ZHPA 2ZU1A 3IG6B 4O97A 3D65E 5EJLA 3M36A 1FY3A 1V2OT 3TJOA 3RXOA 4DVAU 3SV7A 4MLFB 2F3CE 1O30A 2HRVA 3E0NB 4INKA 1V3XA 1C2DA 3SORA 3QGJA 2KCAA 3RXPA 5EPNA 2J97A 1UTLM 1C1RA 2ZPRA 1DUAA 2BVSH 3VPKA 2PWXA 2VH0A 1LKAA 4B75A 3PMHB 1HXEH 3MHWU 4GCHF 1QL9A 3ZVCA 4B73A 2ZGJA 2R2WU 3T28A 1W7XH 4ISNA 3BG4C 2JH6D 1K2I1 3QTVH 1AWHB 1BRAA 3F68H 4E7NA 4WWYA 1P57B 1EAWA 3PMAB 4X1SU 1PPFE 4H42U 4Q63A 3QO6A 4I8JA 3AW0A 1G37A 4X1PU 3C1KA 3HK6B 2OQUA 1C5PA 4NA8A 1SC8U 5HMAA 1YPEH 5SGAE 2ZU3A 2OC0A 3BEFB 2VWNA 4D8NA 2ZF0H 4KTCA 2ZU5A 1HAVB 1V2NT 1A0JA 1IAUA 3DD2H 4GLYA 2ZDMA 4M7GA 3GCTF 2FXRA 4TSFD 1C1UH 3B8JA 2GGVB 1EZXC 1QNJA 1H8ED 5T6DA 1W13U 2XOKD 5JYIA 4FVBA 2G4UA 3QK1A 1IQKA 2WZQA 2NU3E 4ISOA 4WY3A 2SGQE 5FPSA 1D3QB 4DJZB 1QBOA 3RLWH 2HLCA 3Q3YA 1UTNA 1BIOA 1A7SA 2AHME 3F2HA 3LOXA 4A1TA 1ZPBA 1MCTA 1LVYA 1WQVH 1ETTH 1LHDH 2OCVB 1VCPA 3MQKC 3D49H 4HFPB 3CS7A 1Y5BT 3V13A 1MQ5A 1HJ9A 3Q3KA 2ILNA 3E91A 1WUNH 3DUXH 3H5CB 1MU8B 2ZCLP 4BTTB 4UONA 2CHAB 1S6HA 2JH0D 2C8WB 2I6SA 1JRSA 1MTUA 1YPHC 4ASHA 4XOJA 4A6LA 4B2BA 2O8WA 2P94A 1B7XB 3UY9A 2A4GA 1NN6A 3UTUH 1GBAA 2Z3DA 1DPOA 3GY4A 2GT7A 1ZHRA 1FDPA 2KCYA 1BMMH 1ZMLA 2P59A 4AORA 1N6XA 1P12E 3P6ZB 3M5MA 4I33A 2ZTXA 1O31A 1P03A 1GG6B 1GVLA 1L1GA 1V2WT 1ANCA 4X2XA 2AMQA 3F9HA 3A89A 4X1RU 5GXPA 1AKSB 1K21H 5DG6A 2PHBA 3SZNA 1BITA 2ZGBH 1VGCB 3VEQB 1P2OA 3DA9B 4E7RG 4FU9A 4ZCNA 2HVXA 4YZUA 4UFGH 1FN8A 2GMTC 3SZEA 1HIAB 1SGFA 2P95A 1YCPM 1QL7A 1KY9A 5F6MA 3O8DA 2HOBA 3ZVBA 5EPYA 3GICB 1MZDA 3UNRA 3BG4B 4K69A 1BCUH 2XBVA 5EG4A 3PROA 5E0HA 3AK5A 3RMOH 1AUTC 1QRXA 1TBQH 2AH4X 2BB4A 2JIZD 2VIVA 1C1QA 4CRFA 5AFZH 1V6DA 1H9LB 4CH2B 1C5ZB 1FPHH 5EXLA 1TAWA 3PO1C 3DHKH 1BTYA 1YKTA 1JBUH 5GIBA 3UR6A 1SQRA 5J4SA 1ZJDA 3TU7H 1TRNA 1TPOA 2ZCHP 5AVDA 1FY8E 4LZ1H 1TRYA 2GV6A 2BD5A 1NFUA 1BBRE 4OS7A 1GBKA 1E37B 1CVWH 1DFPA 2GVFA 2Y5GA 4D9RA 2SGFE 2ZGXH 4ACAA 1ZMJA 7GCHG 1C5TA
chains in the Genus database with same CATH topology
1LPZB 2XTTB 3KCGH 2OXSA 1E35B 2RG3A 3ZYDA 3P8NA 2UUKB 4FU7A 1V2UT 3LIWA 1O2JA 3SGBE 5EGMA 3S7KB 1GI8B 1TGBA 4NIXA 1NRQH 1V2KT 3U69H 3TPIZ 1TA6A 1T4UH 1L4DA 1RD3B 2CJIA 5E0GA 2O8TA 2FLRH 1ELBA 4NSYA 4DG4A 4D7FA 3ESTA 1CQQA 2W7SA 2VGCC 3LONA 3UNSA 3SU1A 1O32A 5DO4H 2G51A 1SSXA 1VR1H 1FIWA 1S0QA 2OLGA 1UHBA 1KLIH 1K22H 1GDUA 1ELTA 1AFQB 3AAVA 2FO9A 1Y8TA 3CS0A 1VJAU 3GCOA 1TX7A 1F0RA 2WPKS 5HM2A 1OP8A 1LVOA 1O3OA 1EOJA 2W7UA 1YCPK 1OWJA 3JZ1B 2GD4B 4YT6H 1S6FA 2PUQH 1D3TB 1YLDA 1GBHA 3ZVGA 4OS4A 1GBJA 2VVUA 2A5KA 2XBXA 3L33A 3MU0A 1WOFA 1GCDA 2VB0A 2KAIA 1CGIE 2XRCA 3GCNA 3GY5A 1C5NH 5LPEA 1W3CA 1UCYK 1DY8A 4RKOB 3QLPH 4X1QU 2ZPSA 3SJIA 4KELA 4ABIA 1BMLA 2OD3B 1YM0A 2ZTYA 2C8XB 2LNCA 1EKBB 1C9PA 2BD3A 1GJCB 4K2YA 1N1LA 3RXFA 1K1JA 1GI2A 1W10U 1QQUA 5GPIB 1KLJH 1GL1A 1BMNH 1ZJKA 1RS0A 1UK4A 1EJNA 2BDHA 3TGJE 1XXFA 1P8VC 2FDAA 1O34A 2O8UA 1KXBA 2P8OB 4NIVA 5EOKA 5TCAA 1SL3A 1AHTH 1NT1A 4AZ2B 5EQQA 1NROH 1D4PB 3PO1B 3SHAH 4F4OC 1CT0E 1F0SA 3GYLB 4IN1A 1IHSH 2IPHA 1SPJA 3WY8A 1A0LA 1FUJA 1HPGA 1AFQC 1FAXA 3TIUA 3MH5A 1YC0A 2FOGA 1CA8B 2SGDE 3KQCA 4FVDA 2FX6A 1GI3A 2FODA 3LPRA 3Q00A 3BTEE 3BF6H 2XW9A 4NA7A 1AE8H 2GP9B 1O38A 3GOVB 3U1JB 2Z7FE 3MH6A 4MVNA 4ZH8A 5E0JA 5FX5A 1O5BB 4Q7XA 4ISLA 5HGGA 1SGEE 8LPRA 1TIOA 3GY2A 3SV6A 2OC1A 1BMAA 3LGTA 2Z9KA 2Z9JA 1EPTB 2J94A 1DDJA 1EAIA 2XC5A 3HPTB 3RU4T 3ODFA 1LKBA 3K65B 2WPIS 4WXIA 2AFQB 3U8RH 4FUCA 2A7JA 2BYAX 1CBWC 2BHGA 3W95A 3W94A 1OP0A 1MCVA 2Q1JA 2BOKA 1ZPCA 1IQNA 2O8MA 2WYGA 1BBRK 1LPGB 2V0BA 8GCHG 1LHFH 1GHYH 1G3CA 1PPZA 3BTDE 3NK8A 4Y71A 3B23B 1OYTH 1MUEB 3ZZDA 2UWPA 3QGNB 1CHOG 4ZKRU 1QA0A 1GHWH 3MH4A 1O2NA 3T2NA 3EYDA 1TFXA 2BM2A 5C67A 3TK5A 2F9PA 2C8YB 2AMDA 1ELEE 3ZV8A 3CP7A 5J4QA 4DT7B 3LGWA 3KN2A 1G3DA 3HKJB 3TVJB 9LPRA 3TGIE 1HB0B 1C2LA 3KQEA 1MD7A 3M5OA 4MPVA 5C2ZA 1O2XA 3SV9A 3L3TA 7KMEH 1GGDB 1GCTB 1O0DH 1XUKA 3U8TH 1TLDA 4HGCA 5F8TA 5K7RA 1FN6A 5FBIA 1NFWA 5A0BA 4NFEA 1BJVA 4NCYA 1V2ST 1O2TA 1GJ5H 2C90B 1GMCG 2BY7X 3FP8E 4U2WA 1PQ8A 2C3SA 5DP7A 1BHXF 5A8ZA 3TK9A 1ZPZA 2IOTA 5C1YA 1A1RA 1C1NA 3M3SA 1D6WA 2GCHF 5JBBS 5EU8A 2V3HH 4TYDA 1BJUA 4ZHAA 4KGAA 4BANB 2CGAA 1T31A 4E06H 2ZP0H 1A4WH 5EQSA 4Z6AH 3GDVA 1PPEE 1W8BH 3A7WA 2R3YA 5F03A 3LJJA 4B74A 1Z71A 1PPCE 4DCDA 3S9BA 1T8NA 1UCYE 3A7VA 3NPSA 1OS8A 1B5GH 3VFEA 3QZQA 1C2IA 5JB8S 1TGNA 2Z6BD 1FMGA 4Z0KA 2H9TH 4IN2A 3I78A 1DLKB 3ZVFA 1H1BA 5DJ7A 1FAKH 3RXDA 2ODYB 4JK5A 1ZHMA 2IN2A 4CBNA 1Y3XA 1XXDA 1DWCH 1JIMA 1JMOH 4CR5A 5DPAA 4LZ4B 3A7ZA 4YESB 1SHHB 1YCPH 7ESTE 1S5SA 2ALPA 5A09A 1TNHA 5ESBA 2SFAA 1TNJA 4DIIH 2HNTE 1N8OB 1NFYA 1PQ7A 2FZZA 2Y7ZA 1GVZA 4ABFA 2Z9LA 1P2QA 3S0NA 1C5QA 4K3JA 4D7GA 2QXGA 3BEUA 1DOJA 2XWBI 1GBIA 1GJ6A 1HAHH 4YLQH 2PTCE 3T62A 2FEQH 2PTNA 1NU9A 2BDAA 1EJAA 4IGDA 4A7IB 2B8OH 1EASA 3L6PA 1O2MA 2BD7A 4FUFA 2Y82A 2Y81A 2ZGHA 1EB2A 2Y6TA 1LVMA 1GI4A 1ANDA 1O2QA 2ZHFH 1DE7H 3A81A 2ZU4A 3GCTG 1GI6A 3U98H 2J38A 1P2MA 5JBAS 1O2LA 1XM1A 3NXPA 1YPLH 4MPWA 5FXLA 1RTKA 1KTTB 2EI6A 2FYRA 1GDQA 1HFDA 2THFB 5A0CA 1THRH 4H6SB 5I25A 1S84A 2J34A 4CHAC 2HPQH 2ZQ1A 1TGSZ 3E3TA 1KTSB 1TOCB 2ASUB 4OS6A 1LVBA 2G00A 3MOCA 1WTGH 1GHBF 1QBNA 1O5GH 3PLKA 3I77A 3EA7A 1FIZA 1ESAA 4RN6A 1TNKA 3M7TA 1MTVA 1NESE 2DE8A 5FAHA 1IQHA 1AVXA 5FCRA 4JZIA 3GY3A 4UEHH 5EODA 2XWAA 1GBFA 2UWOA 1LDTT 2A7CA 1GJAB 4K1TA 4I8KA 2AIQA 4BAOB 3TNSA 1EZUC 1SI5H 3BTFE 1KXDA 1FQ3A 1H4WA 1PYTC 4DW2U 5ABWA 3AASA 3ODDA 4YO9A 1CGJE 1UVOA 1ZSLA 1GJ4H 4AG1A 1NZQH 2FOMB 4O3TA 5C5NA 2FOFA 1L0ZA 2ZQ2A 1GJ9B 1GBCA 1P9SA 1QCPA 2PKAB 4A1XA 1HLTH 3BTQE 1GI9B 3PLPA 3LT3A 1AVGH 5DP5A 2A45B 1O3LA 1PQAA 2BXTH 2ZGCA 1TPAE 1WBGB 3P17H 2QCYA 3F9EA 1MBQA 1Q3XA 4NZLA 1A5IA 3NWUA 1F5KU 1C2FA 1PPGE 1XUJA 3SOSA 2GMTB 3V12A 3KNXA 5C1UA 1FPCH 2ALVA 5T6GA 1SFIA 4X6OA 1AMHA 1GJDB 4FUBA 3ZZ8A 5GCHF 1O39A 5FCKA 3RXTA 2ZDNA 1SLVB 4WMFA 3SNEA 2BX3A 3IITA 4GPGA 2FS9A 3OY6U 3RC4A 2PR3A 1LPKB 2BLQA 1TBRH 2F91A 4FXGH 1P2IA 1UK3A 1K1MA 2HNTC 3NKKA 1RTFB 1WU1A 1Z6EA 2CXVA 3H7TA 3OY5U 1TPSA 6CHAC 2H5DA 1Y5AT 4NIWA 2Z3EA 3R0FA 3O8CA 3UIRA 1KXFA 4FU8A 4TPYA 3Q3XA 1RGQA 1WAYB 1BTUA 3RXMA 1XUFA 2G5NA 1Y3WA 4GHTA 3IWMA 4OGYA 3C27B 3BTME 1OWDA 2A1DB 1G3BA 4D76A 2V6NA 1ESTA 4X8TH 3OX7U 2HPPH 2H6MA 4F49A 3V7TA 1OWKA 2ZHDA 4Y7AA 1MTWA 4AB8A 1ZLRA 4FUHA 1INCA 1TWXB 1KXEA 1AKSA 1TB6H 2RDLA 4XSKU 1VCWA 4CRGA 1AIXH 3TH4H 3S69A 4GAWA 1FY4A 3FZDA 3SN8A 4KP0A 1Q2WA 1O2YA 3RXCA 2OP9A 2A4OA 1P09A 1QRZA 3VB4A 1Z1IA 1TNGA 4MG3A 4XBBA 3PYHA 2FP7B 1FZZA 1SGYE 2BMGB 1CGHA 6ESTA 2O8LA 2NU4E 4Y7BA 3RMMH 5FBEA 5DP8A 4BTUB 4MNYA 2JH5D 4MNWA 1C5YB 1EXFA 2F9OA 4ESTE 4MNXA 4KKDA 3F9FA 2ANWA 3BTHE 1MKXK 1D3DB 3PMBB 2ZC9H 1UK2A 4I7YH 2ZCKP 5K0HA 2SNVA 1DX5M 3M37A 1QHRB 3AW1A 1RXPA 3BG8A 2B0FA 2RCEA 3RXRA 2BY6X 4X8VH 2XBYA 1P2KA 1N8OC 1MTSA 1N6YA 2F9VA 4H4FA 3S7HB 3GDUA 3LC5A 1DSTA 1TPPA 1C5XB 4LOYH 4GVUA 2BD2A 1C2MA 3VXEH 1F5LA 1AD8H 3LGIA 1ARCA 2QGRA 1O3DA 5LH8A 1YGCH 3MO6A 1AI8H 3BTTE 1Y3YA 3BEIB 1GJ7B 2FS8A 1HAVA 1KXCA 1OPHB 1IQJA 1C9TA 4JZEH 1PPBH 1ZOMA 1EPTC 3ZZ4A 1GI7B 3RXIA 3NZIA 1A5HA 2ZHWH 1V2VT 1RIWC 1OYQA 1FNIA 1MD8A 2W3IA 1H8DH 1NPMA 1TYNA 3F1SB 8ESTE 1DANH 1BTXA 2NU1E 4Q2KA 4E05H 1F5RA 1AB9C 3LC3A 2AS9A 2OINA 4I8LA 2GZ9A 3A82A 2Q6GA 2A5AA 2BDBA 1YPHE 3SU6A 1W2KH 4X6MA 1GBBA 3QN7A 4CRCA 1O2RA 3M7QA 1YLCA 5T6FA 3A7YA 1BTZA 2JETC 5IYTA 2BLWA 2WPLS 3VB6A 3GY6A 4JCNA 4CREA 1FY5A 3SBKA 2W26A 1E34B 1ZGVA 2VH6A 3BN9A 2H2ZA 1QB9A 3ZVEA 1ZRKA 1O3IA 2D8WA 1GHXH 1V2QT 3MI4A 3RMNH 3SU2A 5C3NA 4MPXA 1BTWA 1GBMA 4U32A 5HYOA 1D9IA 4AG2A 3TGKE 4INHA 1UVPA 1NO9H 1TABE 2HNTF 1A3BH 2PSXA 2F9NA 1TBZH 1LMWB 3LH1A 1HBTH 1VITH 4X2WA 3TITA 2R9PA 2GCTC 3A80A 1JWTA 3SU4A 1BRBE 5FPTA 2QXJA 3P92A 2J4IA 1HAZB 1W11U 3SUFA 1OWIA 2XXLA 1EJMA 1MKWK 4ABEA 4X8SH 5GJ4B 4WMDA 1QQ4A 2HGTH 1TALA 2ODPA 5E2PA 1TA2A 1THSH 4YT7H 2ZFRH 2BQ7B 1F0TA 4WF8A 3KGPA 3ZZCA 2VU8E 5CHAC 1HAIH 1S82A 1MU6B 1LHEH 1W7GH 1MBMA 3A8CA 2OC8A 1GMHF 3ZZAA 1C1WH 2QYIA 6LPRA 2ZTZA 2C4FH 3K6YA 1S85A 1T32A 1V2JT 1LTOA 1HYLA 1A3EH 3RC6A 5BPEA 1O2KA 1P04A 1SGCA 2A2XH 3UFAA 3TH2H 4JYUH 4DGJA 2P3UB 2AEIH 4IC6A 2VVCA 2ZHEH 1WCZA 1LO6A 1HJ8A 1SGFG 1C5RA 1CA0C 1GGDC 1HGTH 4NA9H 3QUMP 2FOCA 4NGAH 1ZR0A 2VIDA 2QF3A 3H7OA 2R2MB 1KSNA 3HKIB 2J2UA 4UFFH 3RXEA 1T4VH 1KLTA 1OWHA 3ZVAA 4DIHH 1AUJA 1VITG 1RRKA 1YP9A 3ITIA 1PPHE 2VGCB 3PWBA 1UO6A 4ZROA 1U6QA 3ZYEA 1LCYA 4BOHA 2GKVE 2BLOA 1P3CA 4CRDA 3N7OA 1YPJH 3SNAA 2ZKSA 1K28D 2VVVA 3GYMA 1AQ7A 3KQBA 5L6NH 5CE1A 3GCHB 1BRUP 3HK3B 1J8AA 4ZMAH 4YOGA 2BDIA 1FV9A 4DY7B 3BTKE 3TLOA 3T5FH 1ANEA 3RU4D 5L2YH 1C5OH 1DLEA 4OS2A 3SQEE 1C1SA 5HM9A 4OS5A 2PFEA 3BIVH 1P05A 2JETB 2JKHA 1ZGIA 3PTBA 3M5LA 1MAXA 3Q76A 1Q31A 1DM4B 3SQHE 2HALA 1KXAA 2ZO3H 3MNXA 2ZFQH 1SQOA 1BHXB 4FUJA 2Z94A 1EZSC 1O3CA 2W3KA 3SU0A 4I32A 2EEKA 3SJKA 5T3HA 1O2HA 3MU8A 1P10A 3T29A 1AU8A 3SU5A 3AVZA 4CRAA 3UQVA 4ISHH 1K1OA 2BQ6B 1W0ZU 1ABIH 3KHVA 4IC5A 1GI0A 3PM3A 3PB1E 2WV4A 4LK4A 3A84A 2G55A 2ZFPH 2GZ7A 2WV5A 5AHGH 5JB9S 3E8LA 1NTPA 4TWWA 1UVSH 2C93B 1GBDA 4XBDA 1C5SA 2D2DA 4Y10E 4FUEA 2ZHQH 3ELAH 2A0QB 3TJUA 3SI3H 4Y11E 4MNVA 2F9UA 2QXIA 1HAYB 3A8BA 1O3GA 2FESH 2FI3E 3GCHC 1LQEA 1UMAH 5CHAB 1XUIA 4ISIH 3GDSA 2Y80A 1EP6A 1ESBA 3FVFB 3MNBA 4K60A 1QJ6B 1AZ8A 4AFUA 2TRMA 3SUEA 1F2SE 4Y8ZA 1SFQB 2QY0B 5B6OA 2IJOB 4YM9A 2FOHA 4ZUHA 3DT0H 2ESTE 1P06A 3SW2B 1TMTH 3MU1A 2OC7A 3BV9B 2TPIZ 5E2OA 3ZZ5A 3SNCA 1KYNA 2BZAA 1SGPE 3VB5A 4MDSA 3RXVA 4ABDA 2QAAA 2FTMA 5L30H 1BB0B 3O8BA 1Y59T 5EXNA 1PQ5A 1VITF 1D6RA 1QA7A 4ABHA 9ESTA 1P9UA 1AZZA 5G4BA 1YPMH 5FPYA 1O5AB 2FIRH 2ZFTA 1DWEH 4ABBA 4GCHG 1FY1A 3LDXH 5JBTA 2O9QA 3R3GB 2BVXH 3BTWE 3SU3A 3ZVDA 4ABAA 1ZRBA 2CHAC 1SGDE 3MO9A 4Y6DA 2OBOA 4CR9A 3SNDA 1E36B 3PLBA 1AO5A 3SNBA 3RXQA 1TQ0B 1GHAF 1XKAC 2V3OH 4WH8A 1UVTH 4WMEA 2OUAA 1O2OA 1VJ9U 2WUCA 3EA8A 2BY9X 4K8YA 4OGXA 2DUCA 3MYWA 1DT2A 4NG9H 3SV8A 1UTPA 1BTPA 3M35A 2FLBH 1C2GA 2R0KA 1MKWH 4TY7A 4ZKNU 5LGOA 4HZHA 3P8OA 2FOAA 4X0WU 2A4QA