3E3ZA

Crystal structure of bovine coupling factor b bound with phenylarsine oxide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
176
structure length
176
Chain Sequence
b'SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 71
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3e3zA00
2Z66A 4MN8B 1FO1A 4U08A 4U06A 4BV4R 1O6SA 3ZYNA 5GQRK 4FDWA 4WYKA 1U0ND 4PERA 2O6QA 4CC4A 1FT8A 3WPGA 1O6TA 1H6UA 4L3AA 1ZIWA 4Q3GA 2XOTA 3FXIA 5B0NA 1OZNA 1XKUA 2Z65A 2CA6A 4HQ1A 4PQ8A 4RCWA 3G39A 1M10B 4PSJA 4CILA 3RJ0A 5IJDA 4P8SA 5AWDA 5IJBA 2WQVA 2Q4GW 2R9UA 4H09A 1OTOA 4R5DA 4AW4A 3W3NA 3E4GA 2P1PB 2RR6A 3G3AA 2Z82A 1OTMA 4YEBB 4XOSA 4TZHA 1K5DC 4C2BB 1P8TA 2O6RA 4Z8GA 2ID5A 5AWBA 2OMZA 1O6VA 2Z63A 4FCGA 2WQUA 4R09A 2OMUA 4ARRA 3CVRA 2O6SA 3WPEA 1IO0A 2Z64A 4PEQB 1H6TA 4V2CA 2WQXA 4K17A 2FT3A 2Y5QA 1FQVA 4EZGA 2V9SA 4R6JA 2JE0A 3RIZA 4M7EC 5GMGA 1KOOA 2OMYA 3ZYJA 1WWLA 4WP6A 2V9TB 3BZ5A 1LTXA 2ASTB 3E2JA 3REZA 3RFJA 4Q3IA 2OMXA 4IM6A 3W3MA 4C2AB 4ECOA 4M7EA 3WPIA 4CNMA 2OMWA 1G9UA 3OGKB 2Z81A 4Z94G 4GLPA 3UL9A 4QC0A 4KT1A 3UN9A 4XGOA 4FMZA 3ULUA 4RCAB 2OMTA 3P72A 2P1NB 4U09A 4R07A 4B8CD 2Z7XB 2IFGA 5HZLB 2UZYA 1M0ZA 3VQ1A 3WN4A 3CIYA 4V2DA 1XWDC 4NKHA 3WPBA 2ASSB 3PMHG 1M9SA 3RFSA 2XWTC 3O6NA 3OGMB 3ZYOA 2P1OB 1DCEA 1DS9A 4KNGA 4LSCA 3GOZA 4LXSA 4KXFB 5GS2B 5FTTB 5GMFA 3WPFA 2Z7XA 3W3JA 5A5CA 3RW7A 4R6AA 1OGQA 4QBZA 5AWCA 5HDHA 2Z62A 1K5GC 1DFJI 3RGXA 5GS0A 1PGVA 4FD0A 3WPCA 4V2EA 4CP6A 4PKIG 1A9NA 2P1QB 4BSUA 2JE1A 1D0BA 4P91A 4LI2A 3UL8A 4BSSA 5LFNA 1OTNA 1FS2A 4Y61B 3M18A 2JQDA 3DZEA 3RFEA 3WPDA 3C6PB 3W3LA 4R0AA 4UFRA 4XSQA 3SB4A 5B0TA 4Z61C 1YRGA 3ZYIA 3UL7A 3C6NB 5AZ5A 3C6OB 2ELLA 4J0MA 1OOKG 1SQ0B 3A79B 4CNCA 2V70A 1KOHA 4AY9X 4LSAA 4BSRA 2WFHA 4RWTC 1W8AA 4QXEA 4OQTA 1Z7XW 2RA8A 5CMPA 3TSRE 3G04C 1P8VA 3ULAA 4NKGA 2UZXA 4Z79A 1XECA 3ULVA 4FS7A 3W3GA 3OGLB 1JL5A 4LSXC 4Z64C 1P9AG 3OJAB 4GT6A 3RW6A 4MQWX 4L3FA 4R6FA 2A0ZA 3G06A 3M19A 4Q62A 5CMNA 4R58A 4FHOA 4R5CA 3JB9j 1QYYA 2OMVA 1A4YA 3G3BA 2BEXA 5IYXC 4J4LA 1XEUA 2WQWA 4LSXA 4LI1A 3KJ4A 1GWBA 2P1MB 4R08A 3RGZA 4R6GA 1XCDA 3E3ZA 4G8AA 3O53A 1M9LA 3OJAA 4ECNA 3E6JA 3CIGA 5IJCA 3WPHA 3W3KA 2BNHA 5D3IA 3VQ2A 4CC4C 4ARNA 5B4PA 5AWAA 5GMHA 4I6JB 4LXRA 4U7LA
chains in the Genus database with same CATH superfamily
2Z66A 4MN8B 1FO1A 4U08A 4U06A 4BV4R 1O6SA 3ZYNA 5GQRK 4FDWA 4WYKA 1U0ND 4PERA 2O6QA 4CC4A 1FT8A 3WPGA 1O6TA 1H6UA 4L3AA 1ZIWA 4Q3GA 2XOTA 3FXIA 5B0NA 1OZNA 1XKUA 2Z65A 2CA6A 4HQ1A 4PQ8A 4RCWA 3G39A 1M10B 4PSJA 4CILA 3RJ0A 5IJDA 4P8SA 5AWDA 5IJBA 2WQVA 2Q4GW 2R9UA 4H09A 1OTOA 4R5DA 4AW4A 3W3NA 3E4GA 2P1PB 2RR6A 3G3AA 2Z82A 1OTMA 4YEBB 4XOSA 4TZHA 1K5DC 4C2BB 1P8TA 2O6RA 4Z8GA 2ID5A 5AWBA 2OMZA 1O6VA 2Z63A 4FCGA 4NZRM 2WQUA 4R09A 2OMUA 4ARRA 3CVRA 2O6SA 3WPEA 1IO0A 2Z64A 4PEQB 1H6TA 4V2CA 2WQXA 4K17A 2FT3A 2Y5QA 1FQVA 4EZGA 2V9SA 4R6JA 2JE0A 3RIZA 4M7EC 5GMGA 1KOOA 2OMYA 3ZYJA 1WWLA 4WP6A 2V9TB 3BZ5A 1LTXA 2ASTB 3E2JA 3REZA 3RFJA 4Q3IA 2OMXA 4IM6A 3W3MA 4C2AB 4ECOA 4M7EA 3WPIA 4CNMA 2OMWA 1G9UA 3OGKB 2Z81A 4Z94G 4GLPA 3UL9A 4QC0A 4KT1A 3UN9A 4XGOA 4FMZA 3ULUA 4RCAB 2OMTA 3P72A 2P1NB 4U09A 4R07A 4B8CD 2Z7XB 2IFGA 5HZLB 2UZYA 1M0ZA 3VQ1A 3WN4A 3CIYA 4V2DA 1XWDC 4NKHA 3WPBA 2ASSB 3PMHG 1M9SA 3RFSA 2XWTC 3O6NA 3OGMB 3ZYOA 2P1OB 1DCEA 1DS9A 4KNGA 4LSCA 3GOZA 4LXSA 4KXFB 5GS2B 5FTTB 5GMFA 3WPFA 2Z7XA 3W3JA 5A5CA 3RW7A 4R6AA 1OGQA 4QBZA 5AWCA 5HDHA 2Z62A 1K5GC 1DFJI 3RGXA 5GS0A 1PGVA 4FD0A 3WPCA 4V2EA 4CP6A 4PKIG 1A9NA 2P1QB 4BSUA 2JE1A 1D0BA 4P91A 4LI2A 3UL8A 4BSSA 5LFNA 1OTNA 1FS2A 4Y61B 3M18A 2JQDA 3DZEA 3RFEA 3WPDA 4NZTM 3C6PB 3W3LA 4R0AA 4UFRA 4XSQA 3SB4A 5B0TA 4Z61C 1YRGA 3ZYIA 3UL7A 3C6NB 5AZ5A 3C6OB 2ELLA 4J0MA 1OOKG 1SQ0B 3A79B 4CNCA 2V70A 1KOHA 4AY9X 4LSAA 4BSRA 2WFHA 4RWTC 1W8AA 4QXEA 4OQTA 1Z7XW 2RA8A 5CMPA 3TSRE 3G04C 1P8VA 3ULAA 4NKGA 2UZXA 4Z79A 1XECA 3ULVA 4FS7A 3W3GA 3OGLB 1JL5A 4LSXC 4Z64C 1P9AG 3OJAB 4GT6A 3RW6A 4MQWX 4L3FA 4R6FA 2A0ZA 3G06A 3M19A 4Q62A 5CMNA 4R58A 4FHOA 4R5CA 3JB9j 1QYYA 2OMVA 1A4YA 3G3BA 2BEXA 5IYXC 4J4LA 1XEUA 2WQWA 4LSXA 4LI1A 3KJ4A 1GWBA 2P1MB 4R08A 3RGZA 4R6GA 1XCDA 3E3ZA 4G8AA 3O53A 1M9LA 3OJAA 4ECNA 3E6JA 3CIGA 5IJCA 3WPHA 3W3KA 2BNHA 5D3IA 3VQ2A 4CC4C 4ARNA 5B4PA 5AWAA 5GMHA 4I6JB 4LXRA 4U7LA
chains in the Genus database with same CATH topology
2Z66A 4MN8B 1FO1A 4U08A 4U06A 4BV4R 1O6SA 3ZYNA 5GQRK 4FDWA 4WYKA 1U0ND 4PERA 2O6QA 4CC4A 1FT8A 3WPGA 1O6TA 1H6UA 4L3AA 1ZIWA 4Q3GA 2XOTA 3FXIA 5B0NA 1OZNA 1XKUA 2Z65A 2CA6A 4HQ1A 4PQ8A 4RCWA 3G39A 1M10B 4PSJA 4CILA 3RJ0A 5IJDA 4P8SA 5AWDA 5IJBA 2WQVA 2Q4GW 2R9UA 4H09A 1OTOA 4R5DA 4AW4A 3W3NA 3E4GA 2P1PB 2RR6A 3G3AA 2Z82A 1OTMA 4YEBB 4XOSA 4TZHA 1K5DC 4C2BB 1P8TA 2O6RA 4Z8GA 2ID5A 5AWBA 2OMZA 1O6VA 2Z63A 4FCGA 2WQUA 4R09A 2OMUA 4ARRA 3CVRA 2O6SA 3WPEA 1IO0A 2Z64A 4PEQB 1H6TA 4V2CA 2WQXA 4K17A 2FT3A 2Y5QA 1FQVA 4EZGA 2V9SA 4R6JA 2JE0A 3RIZA 4M7EC 5GMGA 1KOOA 2OMYA 3ZYJA 1WWLA 4WP6A 2V9TB 3BZ5A 1LTXA 2ASTB 3E2JA 3REZA 3RFJA 4Q3IA 2OMXA 4IM6A 3W3MA 4C2AB 4ECOA 4M7EA 3WPIA 4CNMA 2OMWA 1G9UA 3OGKB 2Z81A 4Z94G 4GLPA 3UL9A 4QC0A 4KT1A 3UN9A 4XGOA 4FMZA 3ULUA 4RCAB 2OMTA 3P72A 2P1NB 4U09A 4R07A 4B8CD 2Z7XB 2IFGA 5HZLB 2UZYA 1M0ZA 3VQ1A 3WN4A 3CIYA 4V2DA 1XWDC 4NKHA 3WPBA 2ASSB 3PMHG 1M9SA 3RFSA 2XWTC 3O6NA 3OGMB 3ZYOA 2P1OB 1DCEA 1DS9A 4KNGA 4LSCA 3GOZA 4LXSA 4KXFB 5GS2B 5FTTB 5GMFA 3WPFA 2Z7XA 3W3JA 5A5CA 3RW7A 4R6AA 1OGQA 4QBZA 5AWCA 5HDHA 2Z62A 1K5GC 1DFJI 3RGXA 5GS0A 1PGVA 4FD0A 3WPCA 4V2EA 4CP6A 4PKIG 1A9NA 2P1QB 4BSUA 2JE1A 1D0BA 4P91A 4LI2A 3UL8A 4BSSA 5LFNA 1OTNA 1FS2A 4Y61B 3M18A 2JQDA 3DZEA 3RFEA 3WPDA 3C6PB 3W3LA 4R0AA 4UFRA 4XSQA 3SB4A 5B0TA 4Z61C 1YRGA 3ZYIA 3UL7A 3C6NB 5AZ5A 3C6OB 2ELLA 4J0MA 1OOKG 1SQ0B 3A79B 4CNCA 2V70A 1KOHA 4AY9X 4LSAA 4BSRA 2WFHA 4RWTC 1W8AA 4QXEA 4OQTA 1Z7XW 2RA8A 5CMPA 3TSRE 3G04C 1P8VA 3ULAA 4NKGA 2UZXA 4Z79A 1XECA 3ULVA 4FS7A 3W3GA 3OGLB 1JL5A 4LSXC 4Z64C 1P9AG 3OJAB 4GT6A 3RW6A 4MQWX 4L3FA 4R6FA 2A0ZA 3G06A 3M19A 4Q62A 5CMNA 4R58A 4FHOA 4R5CA 3JB9j 1QYYA 2OMVA 1A4YA 3G3BA 2BEXA 5IYXC 4J4LA 1XEUA 2WQWA 4LSXA 4LI1A 3KJ4A 1GWBA 2P1MB 4R08A 3RGZA 4R6GA 1XCDA 3E3ZA 4G8AA 3O53A 1M9LA 3OJAA 4ECNA 3E6JA 3CIGA 5IJCA 3WPHA 3W3KA 2BNHA 5D3IA 3VQ2A 4CC4C 4ARNA 5B4PA 5AWAA 5GMHA 4I6JB 4LXRA 4U7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z66 A;  4MN8 B;  1FO1 A;  4U08 A;  4U06 A;  4BV4 R;  1O6S A;  3ZYN A;  5GQR K;  4FDW A;  4WYK A;  1U0N D;  4PER A;  2O6Q A;  4CC4 A;  1FT8 A;  3WPG A;  1O6T A;  1H6U A;  4L3A A;  1ZIW A;  4Q3G A;  2XOT A;  3FXI A;  5B0N A;  1OZN A;  1XKU A;  2Z65 A;  2CA6 A;  4HQ1 A;  4PQ8 A;  4RCW A;  3G39 A;  1M10 B;  4PSJ A;  4CIL A;  3RJ0 A;  5IJD A;  4P8S A;  5AWD A;  5IJB A;  2WQV A;  2Q4G W;  2R9U A;  4H09 A;  1OTO A;  4R5D A;  4AW4 A;  3W3N A;  3E4G A;  2P1P B;  2RR6 A;  3G3A A;  2Z82 A;  1OTM A;  4YEB B;  4XOS A;  4TZH A;  1K5D C;  4C2B B;  1P8T A;  2O6R A;  4Z8G A;  2ID5 A;  5AWB A;  2OMZ A;  1O6V A;  2Z63 A;  4FCG A;  2WQU A;  4R09 A;  2OMU A;  4ARR A;  3CVR A;  2O6S A;  3WPE A;  1IO0 A;  2Z64 A;  4PEQ B;  1H6T A;  4V2C A;  2WQX A;  4K17 A;  2FT3 A;  2Y5Q A;  1FQV A;  4EZG A;  2V9S A;  4R6J A;  2JE0 A;  3RIZ A;  4M7E C;  5GMG A;  1KOO A;  2OMY A;  3ZYJ A;  1WWL A;  4WP6 A;  2V9T B;  3BZ5 A;  1LTX A;  2AST B;  3E2J A;  3REZ A;  3RFJ A;  4Q3I A;  2OMX A;  4IM6 A;  3W3M A;  4C2A B;  4ECO A;  4M7E A;  3WPI A;  4CNM A;  2OMW A;  1G9U A;  3OGK B;  2Z81 A;  4Z94 G;  4GLP A;  3UL9 A;  4QC0 A;  4KT1 A;  3UN9 A;  4XGO A;  4FMZ A;  3ULU A;  4RCA B;  2OMT A;  3P72 A;  2P1N B;  4U09 A;  4R07 A;  4B8C D;  2Z7X B;  2IFG A;  5HZL B;  2UZY A;  1M0Z A;  3VQ1 A;  3WN4 A;  3CIY A;  4V2D A;  1XWD C;  4NKH A;  3WPB A;  2ASS B;  3PMH G;  1M9S A;  3RFS A;  2XWT C;  3O6N A;  3OGM B;  3ZYO A;  2P1O B;  1DCE A;  1DS9 A;  4KNG A;  4LSC A;  3GOZ A;  4LXS A;  4KXF B;  5GS2 B;  5FTT B;  5GMF A;  3WPF A;  2Z7X A;  3W3J A;  5A5C A;  3RW7 A;  4R6A A;  1OGQ A;  4QBZ A;  5AWC A;  5HDH A;  2Z62 A;  1K5G C;  1DFJ I;  3RGX A;  5GS0 A;  1PGV A;  4FD0 A;  3WPC A;  4V2E A;  4CP6 A;  4PKI G;  1A9N A;  2P1Q B;  4BSU A;  2JE1 A;  1D0B A;  4P91 A;  4LI2 A;  3UL8 A;  4BSS A;  5LFN A;  1OTN A;  1FS2 A;  4Y61 B;  3M18 A;  2JQD A;  3DZE A;  3RFE A;  3WPD A;  3C6P B;  3W3L A;  4R0A A;  4UFR A;  4XSQ A;  3SB4 A;  5B0T A;  4Z61 C;  1YRG A;  3ZYI A;  3UL7 A;  3C6N B;  5AZ5 A;  3C6O B;  2ELL A;  4J0M A;  1OOK G;  1SQ0 B;  3A79 B;  4CNC A;  2V70 A;  1KOH A;  4AY9 X;  4LSA A;  4BSR A;  2WFH A;  4RWT C;  1W8A A;  4QXE A;  4OQT A;  1Z7X W;  2RA8 A;  5CMP A;  3TSR E;  3G04 C;  1P8V A;  3ULA A;  4NKG A;  2UZX A;  4Z79 A;  1XEC A;  3ULV A;  4FS7 A;  3W3G A;  3OGL B;  1JL5 A;  4LSX C;  4Z64 C;  1P9A G;  3OJA B;  4GT6 A;  3RW6 A;  4MQW X;  4L3F A;  4R6F A;  2A0Z A;  3G06 A;  3M19 A;  4Q62 A;  5CMN A;  4R58 A;  4FHO A;  4R5C A;  3JB9 j;  1QYY A;  2OMV A;  1A4Y A;  3G3B A;  2BEX A;  5IYX C;  4J4L A;  1XEU A;  2WQW A;  4LSX A;  4LI1 A;  3KJ4 A;  1GWB A;  2P1M B;  4R08 A;  3RGZ A;  4R6G A;  1XCD A;  3E3Z A;  4G8A A;  3O53 A;  1M9L A;  3OJA A;  4ECN A;  3E6J A;  3CIG A;  5IJC A;  3WPH A;  3W3K A;  2BNH A;  5D3I A;  3VQ2 A;  4CC4 C;  4ARN A;  5B4P A;  5AWA A;  5GMH A;  4I6J B;  4LXR A;  4U7L A; 
#chains in the Genus database with same CATH topology
 2Z66 A;  4MN8 B;  1FO1 A;  4U08 A;  4U06 A;  4BV4 R;  1O6S A;  3ZYN A;  5GQR K;  4FDW A;  4WYK A;  1U0N D;  4PER A;  2O6Q A;  4CC4 A;  1FT8 A;  3WPG A;  1O6T A;  1H6U A;  4L3A A;  1ZIW A;  4Q3G A;  2XOT A;  3FXI A;  5B0N A;  1OZN A;  1XKU A;  2Z65 A;  2CA6 A;  4HQ1 A;  4PQ8 A;  4RCW A;  3G39 A;  1M10 B;  4PSJ A;  4CIL A;  3RJ0 A;  5IJD A;  4P8S A;  5AWD A;  5IJB A;  2WQV A;  2Q4G W;  2R9U A;  4H09 A;  1OTO A;  4R5D A;  4AW4 A;  3W3N A;  3E4G A;  2P1P B;  2RR6 A;  3G3A A;  2Z82 A;  1OTM A;  4YEB B;  4XOS A;  4TZH A;  1K5D C;  4C2B B;  1P8T A;  2O6R A;  4Z8G A;  2ID5 A;  5AWB A;  2OMZ A;  1O6V A;  2Z63 A;  4FCG A;  4NZR M;  2WQU A;  4R09 A;  2OMU A;  4ARR A;  3CVR A;  2O6S A;  3WPE A;  1IO0 A;  2Z64 A;  4PEQ B;  1H6T A;  4V2C A;  2WQX A;  4K17 A;  2FT3 A;  2Y5Q A;  1FQV A;  4EZG A;  2V9S A;  4R6J A;  2JE0 A;  3RIZ A;  4M7E C;  5GMG A;  1KOO A;  2OMY A;  3ZYJ A;  1WWL A;  4WP6 A;  2V9T B;  3BZ5 A;  1LTX A;  2AST B;  3E2J A;  3REZ A;  3RFJ A;  4Q3I A;  2OMX A;  4IM6 A;  3W3M A;  4C2A B;  4ECO A;  4M7E A;  3WPI A;  4CNM A;  2OMW A;  1G9U A;  3OGK B;  2Z81 A;  4Z94 G;  4GLP A;  3UL9 A;  4QC0 A;  4KT1 A;  3UN9 A;  4XGO A;  4FMZ A;  3ULU A;  4RCA B;  2OMT A;  3P72 A;  2P1N B;  4U09 A;  4R07 A;  4B8C D;  2Z7X B;  2IFG A;  5HZL B;  2UZY A;  1M0Z A;  3VQ1 A;  3WN4 A;  3CIY A;  4V2D A;  1XWD C;  4NKH A;  3WPB A;  2ASS B;  3PMH G;  1M9S A;  3RFS A;  2XWT C;  3O6N A;  3OGM B;  3ZYO A;  2P1O B;  1DCE A;  1DS9 A;  4KNG A;  4LSC A;  3GOZ A;  4LXS A;  4KXF B;  5GS2 B;  5FTT B;  5GMF A;  3WPF A;  2Z7X A;  3W3J A;  5A5C A;  3RW7 A;  4R6A A;  1OGQ A;  4QBZ A;  5AWC A;  5HDH A;  2Z62 A;  1K5G C;  1DFJ I;  3RGX A;  5GS0 A;  1PGV A;  4FD0 A;  3WPC A;  4V2E A;  4CP6 A;  4PKI G;  1A9N A;  2P1Q B;  4BSU A;  2JE1 A;  1D0B A;  4P91 A;  4LI2 A;  3UL8 A;  4BSS A;  5LFN A;  1OTN A;  1FS2 A;  4Y61 B;  3M18 A;  2JQD A;  3DZE A;  3RFE A;  3WPD A;  4NZT M;  3C6P B;  3W3L A;  4R0A A;  4UFR A;  4XSQ A;  3SB4 A;  5B0T A;  4Z61 C;  1YRG A;  3ZYI A;  3UL7 A;  3C6N B;  5AZ5 A;  3C6O B;  2ELL A;  4J0M A;  1OOK G;  1SQ0 B;  3A79 B;  4CNC A;  2V70 A;  1KOH A;  4AY9 X;  4LSA A;  4BSR A;  2WFH A;  4RWT C;  1W8A A;  4QXE A;  4OQT A;  1Z7X W;  2RA8 A;  5CMP A;  3TSR E;  3G04 C;  1P8V A;  3ULA A;  4NKG A;  2UZX A;  4Z79 A;  1XEC A;  3ULV A;  4FS7 A;  3W3G A;  3OGL B;  1JL5 A;  4LSX C;  4Z64 C;  1P9A G;  3OJA B;  4GT6 A;  3RW6 A;  4MQW X;  4L3F A;  4R6F A;  2A0Z A;  3G06 A;  3M19 A;  4Q62 A;  5CMN A;  4R58 A;  4FHO A;  4R5C A;  3JB9 j;  1QYY A;  2OMV A;  1A4Y A;  3G3B A;  2BEX A;  5IYX C;  4J4L A;  1XEU A;  2WQW A;  4LSX A;  4LI1 A;  3KJ4 A;  1GWB A;  2P1M B;  4R08 A;  3RGZ A;  4R6G A;  1XCD A;  3E3Z A;  4G8A A;  3O53 A;  1M9L A;  3OJA A;  4ECN A;  3E6J A;  3CIG A;  5IJC A;  3WPH A;  3W3K A;  2BNH A;  5D3I A;  3VQ2 A;  4CC4 C;  4ARN A;  5B4P A;  5AWA A;  5GMH A;  4I6J B;  4LXR A;  4U7L A; 
#chains in the Genus database with same CATH homology
 2Z66 A;  4MN8 B;  1FO1 A;  4U08 A;  4U06 A;  4BV4 R;  1O6S A;  3ZYN A;  5GQR K;  4FDW A;  4WYK A;  1U0N D;  4PER A;  2O6Q A;  4CC4 A;  1FT8 A;  3WPG A;  1O6T A;  1H6U A;  4L3A A;  1ZIW A;  4Q3G A;  2XOT A;  3FXI A;  5B0N A;  1OZN A;  1XKU A;  2Z65 A;  2CA6 A;  4HQ1 A;  4PQ8 A;  4RCW A;  3G39 A;  1M10 B;  4PSJ A;  4CIL A;  3RJ0 A;  5IJD A;  4P8S A;  5AWD A;  5IJB A;  2WQV A;  2Q4G W;  2R9U A;  4H09 A;  1OTO A;  4R5D A;  4AW4 A;  3W3N A;  3E4G A;  2P1P B;  2RR6 A;  3G3A A;  2Z82 A;  1OTM A;  4YEB B;  4XOS A;  4TZH A;  1K5D C;  4C2B B;  1P8T A;  2O6R A;  4Z8G A;  2ID5 A;  5AWB A;  2OMZ A;  1O6V A;  2Z63 A;  4FCG A;  2WQU A;  4R09 A;  2OMU A;  4ARR A;  3CVR A;  2O6S A;  3WPE A;  1IO0 A;  2Z64 A;  4PEQ B;  1H6T A;  4V2C A;  2WQX A;  4K17 A;  2FT3 A;  2Y5Q A;  1FQV A;  4EZG A;  2V9S A;  4R6J A;  2JE0 A;  3RIZ A;  4M7E C;  5GMG A;  1KOO A;  2OMY A;  3ZYJ A;  1WWL A;  4WP6 A;  2V9T B;  3BZ5 A;  1LTX A;  2AST B;  3E2J A;  3REZ A;  3RFJ A;  4Q3I A;  2OMX A;  4IM6 A;  3W3M A;  4C2A B;  4ECO A;  4M7E A;  3WPI A;  4CNM A;  2OMW A;  1G9U A;  3OGK B;  2Z81 A;  4Z94 G;  4GLP A;  3UL9 A;  4QC0 A;  4KT1 A;  3UN9 A;  4XGO A;  4FMZ A;  3ULU A;  4RCA B;  2OMT A;  3P72 A;  2P1N B;  4U09 A;  4R07 A;  4B8C D;  2Z7X B;  2IFG A;  5HZL B;  2UZY A;  1M0Z A;  3VQ1 A;  3WN4 A;  3CIY A;  4V2D A;  1XWD C;  4NKH A;  3WPB A;  2ASS B;  3PMH G;  1M9S A;  3RFS A;  2XWT C;  3O6N A;  3OGM B;  3ZYO A;  2P1O B;  1DCE A;  1DS9 A;  4KNG A;  4LSC A;  3GOZ A;  4LXS A;  4KXF B;  5GS2 B;  5FTT B;  5GMF A;  3WPF A;  2Z7X A;  3W3J A;  5A5C A;  3RW7 A;  4R6A A;  1OGQ A;  4QBZ A;  5AWC A;  5HDH A;  2Z62 A;  1K5G C;  1DFJ I;  3RGX A;  5GS0 A;  1PGV A;  4FD0 A;  3WPC A;  4V2E A;  4CP6 A;  4PKI G;  1A9N A;  2P1Q B;  4BSU A;  2JE1 A;  1D0B A;  4P91 A;  4LI2 A;  3UL8 A;  4BSS A;  5LFN A;  1OTN A;  1FS2 A;  4Y61 B;  3M18 A;  2JQD A;  3DZE A;  3RFE A;  3WPD A;  3C6P B;  3W3L A;  4R0A A;  4UFR A;  4XSQ A;  3SB4 A;  5B0T A;  4Z61 C;  1YRG A;  3ZYI A;  3UL7 A;  3C6N B;  5AZ5 A;  3C6O B;  2ELL A;  4J0M A;  1OOK G;  1SQ0 B;  3A79 B;  4CNC A;  2V70 A;  1KOH A;  4AY9 X;  4LSA A;  4BSR A;  2WFH A;  4RWT C;  1W8A A;  4QXE A;  4OQT A;  1Z7X W;  2RA8 A;  5CMP A;  3TSR E;  3G04 C;  1P8V A;  3ULA A;  4NKG A;  2UZX A;  4Z79 A;  1XEC A;  3ULV A;  4FS7 A;  3W3G A;  3OGL B;  1JL5 A;  4LSX C;  4Z64 C;  1P9A G;  3OJA B;  4GT6 A;  3RW6 A;  4MQW X;  4L3F A;  4R6F A;  2A0Z A;  3G06 A;  3M19 A;  4Q62 A;  5CMN A;  4R58 A;  4FHO A;  4R5C A;  3JB9 j;  1QYY A;  2OMV A;  1A4Y A;  3G3B A;  2BEX A;  5IYX C;  4J4L A;  1XEU A;  2WQW A;  4LSX A;  4LI1 A;  3KJ4 A;  1GWB A;  2P1M B;  4R08 A;  3RGZ A;  4R6G A;  1XCD A;  3E3Z A;  4G8A A;  3O53 A;  1M9L A;  3OJA A;  4ECN A;  3E6J A;  3CIG A;  5IJC A;  3WPH A;  3W3K A;  2BNH A;  5D3I A;  3VQ2 A;  4CC4 C;  4ARN A;  5B4P A;  5AWA A;  5GMH A;  4I6J B;  4LXR A;  4U7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...