3E4CA

Procaspase-1 zymogen domain crystal strucutre
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
279
structure length
271
Chain Sequence
SSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKDSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of procaspase-1 zymogen domain reveals insight into inflammatory caspase autoactivation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-1
total genus 82
structure length 271
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2008-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e4cA00
2XYGA 2J31A 5IAKA 1RWKA 1RWOA 1ICEA 2K7ZA 3H0EA 4LSZA 3PCXA 4DCJA 4NBNA 4JR1A 4JR2A 4QU5A 4D3XA 3PD0A 4DCPA 3H1PA 4NBLA 5I9TA 3DEIA 2CNNA 1NMEA 2QL5A 4QUIA 3H11B 1NMSA 2J32A 1CVRA 4JB8A 4EHDA 3E4CA 4I1PA 3IBCA 4IEFB 3OD5A 4JJ7A 4AWBA 4JJ8A 3H13A 4PRYA 3SIRA 2H51A 3GJQA 1F9EA 4EHAA 1K86A 4N6GA 5IAGA 4FDLA 4N7JA 4NOKA 1SC4A 2C2MA 1I51A 4N6NA 1RHRA 4QUAA 3ITNA 3R5JA 4QUJA 4ZVOA 1SHJA 3EDQA 5IC6A 4QUEA 3DEKA 4ZVRA 3DEHA 3NR2A 4IYRA 5IBPA 3PD1A 1PYOA 2HBYA 2QLBA 4AWAA 1JXQA 3V6MA 4EHNA 2H5JA 4ZVTA 4PS0A 5IANA 1RWMA 5IC4A 3V4OA 3R5KA 4EJFA 3GJSA 2C2KA 1RHJA 4D3ZA 3S70A 1RE1A 2Y0BA 2C2OA 3R7BA 3V3KA 2H65A 5IBCA 2FP3A 4QU0A 5K20A 1RHKA 4NOMA 4D3YA 1RWXA 3EDRA 3GJRA 4PS1A 3R7NA 4QUHA 2HBRA 1RWWA 1F1JA 3QNWA 4EHKA 2HBQA 2H5IA 4ZVSA 1I4OA 1M72A 2QLFA 1GFWA 2FQQA 1RHUA 3DEJA 3V6LA 3V55A 2NN3C 4EHHA 3P45A 1GQFA 4N5DA 1SHLA 5H0IA 3P4UA 2AR9A 1SC1A 3D6FA 3R6LA 3NKFA 4FEAA 5I9BA 3RJMA 1QX3A 3KJFA 4QUGA 3SIPA 4NBKA 1I3OA 5IAJA 2CNOA 4M9RA 5LUAA 1I4EB 4DCOA 2QLJA 2WDPA 3V4LA 2CJXA 2J33A 1QDUA 3H11A 1RWPA 2CNKA 1RHQA 5IAEA 4QUDA 4N7MA 4QU9A 2FUNB 2H4WA 2XZDA 4FGUA 4JQYA 2DKOA 4NOLA 4ZVPA 3KJNA 4NOJA 5LUBA 3S8EA 2C2ZA 4I1RA 4HQ0A 4QTXA 1BMQA 3R7SA 3KJQA 3R6GA 1NW9B 4QUBA 3UOAB 4JJEA 4ZVUA 2HBZA 2H54A 4HVAA 3UO8B 5JFTA 2Y1LA 4N6OA 4QU8A 1PAUA 3GJTA 2CJYA 1K88A 5IBRA 3D6HA 5IABA 1NMQA 3K7EA 2XZTA 4PRZA 5IARA 1QTNA 3IBFA 4QTYA 4ZVQA 5LU8A 1RHMA 1SC3A 1KMCA 2CNLA 4AW9A 1CP3A 3D6MA 2C1EA 4FXOA 1RWNA 4JR0A 2H48A 2QL9A 4EHLA 2CDRA 1IBCA 4EHFA 2J30A 2XYHA 2P2CA 3NS7A 4HQRA 4QULA 1RWVA 2XYPA 3BIJA 2H4YA 5IASA 4JQZA 2QL7A 5LU9A
chains in the Genus database with same CATH superfamily
3OE5A 3C16C 5HM6A 4H0FA 1V5GA 3DEFA 4P7GA 5JY1A 4P81A 1USVA 3OX3A 1OAOA 1UT8A 1ZH4A 3ITKA 3IJEB 2BKEA 3MIIA 4KXYA 3VAAA 3T3HA 5ITZA 1CUDA 4JI4B 2Y92A 3SEQA 2HDHA 5LNK1 1M1YB 3VR5A 1ZL2A 4KKXB 3IPYA 4B83A 4RJJA 2J3HA 2UV8A 2XXAA 4GMGA 1MW9X 2QOEA 4RY8A 2IOQA 2H51A 1K6IA 5D51S 1DU4A 1DAOA 1MJ5A 2AZ4A 3GFOA 1Q22A 4GMXA 1Z37A 1GKIA 3BFJA 3OIUA 1N5KA 2YFKA 1KXZA 1R0WA 3OEED 4H60A 5IUKC 5DIZA 4F93B 3FDZA 1E7YA 4M49A 2XDAA 2AEEA 4G63A 1YV9A 1UFVA 4JVMA 4YV7A 3LD9A 1WW3A 2BDTA 3T5PA 3LOPA 2Q1YA 3LLVA 4DWOA 3OD1A 2A9PA 1JHPA 2HMUA 2FB9A 3OQJA 1CQZA 1UBGA 4AZSA 2WRZA 2CZQA 2V9PA 4MV5A 1G2QA 1NYRA 4XWOA 1XD2B 3OLWA 1PR5A 2I2WA 2XRFA 3MM4A 3MBKA 4IQGA 4BFCA 4EI9A 1ECPA 3A05A 3GD5A 3DZIA 4FEGA 4KDRA 4OFXA 4R8MA 2VK8A 3H3JA 2TMYA 5KTSA 3HKEB 3ED5A 4O4IB 4IIJF 1WM1A 4EYKA 2Q0XA 2ZYIA 4X62B 4RJLA 4RVFA 3NX4A 1X1RA 2DUJA 4WCFA 4Z2YA 2VPXA 3WP1B 4TWBA 4QKQA 1J5PA 1NXSA 2CZCA 2ONKA 3OF2A 4MGIR 3R0JA 4NBSA 1HZJA 6PFKA 5JMWA 2HL6A 1PK7A 3VU9A 4P3KA 2F4VB 3ZIAD 3WLLA 2JLUA 3MCAA 4ONEA 4YMUA 2LD4A 2MU1A 1G8YA 3OZFA 4KYIB 2AMLA 1OUMA 3NTRA 1NXQA 3HVIA 4IQFA 4JBGA 5M29A 3NHLA 1LFAA 1VPDA 4HDOB 2FCAA 2RONA 4HZIA 5I4CA 2V3CC 1W9HA 3CRZA 3BEDA 4CMEA 4PYLA 2I7XA 3KVOA 2JA2A 1Z08A 1P5FA 2BTOA 2GKSA 2GILA 3F2VA 4XDGA 3THYB 2AG6A 4L85A 3TJRA 1NF3A 3DMTA 3QWFA 5TQ0A 1W0JA 3C3CA 2D1RA 5AMXA 5G0SA 3KUDA 4H17A 1Z5VA 2VR1A 4O1HA 2B1JA 2Z5LA 2Q8NA 4JLWA 2NWQA 2X6QA 3E1GA 1AK1A 2FR8C 2GPYA 3KWLA 2PRIA 1BS1A 5CLIA 3IVAA 1ZP6A 2WA1A 1UKAA 3TPZA 2HJSA 3URKA 4YX9A 2AR7A 4TKUB 4FB4A 1HQDA 4AJHA 4CV2A 2GXUA 1LDBA 4Q5IA 4QC2A 4F1KA 1R9GA 2CFIA 2BEWB 3WWEA 4QXOA 1PJTA 4MW5A 4BVKA 1Z83A 3SGLA 1AHIA 1DX9A 3VTKA 2BT4A 2X8LA 3ZGXA 1NG9A 1FYXA 3MNFA 2AB0A 2BEWA 3NOQA 3ANSA 3MJCA 4JSYA 4PQRA 4EFLA 5F9HA 1SKAA 4R71A 2RG1A 3IQXA 3BMNB 1SXJC 2GNPA 2PS3A 3DAOA 3DTYA 4CN8A 4EP1A 1WPGA 3D4LA 1DL5A 4G1FA 3PDJA 3IMCA 1UPAA 5AM1A 2ZSDA 4FOSA 3CVXA 4F0JA 4O2BF 2FN3A 5BSMA 3H0EA 2QE6A 5CJPA 3ROMA 1CX9B 1RVDA 5TQ0B 4Q7LA 1EJ2A 3KSDO 4PGMA 1WA5A 1O4WA 2K87A 5AVXA 1R50A 2HHJA 4LXTA 1YQTA 3PPVA 4QUIA 1VPWA 1EQ2A 1J2RA 1JP7A 3QYPA 5JYDA 1T8UA 2QR2A 1OT3A 2FP4A 1HYGA 4URVR 1Z6TA 4ZN6A 1K86A 3I2JA 4IVRA 1S7GA 3ZVKA 1CTQA 5TARA 4JBYA 2G25A 2JGEA 4XQEA 3PVSA 1EDOA 1Z2CA 3OOJA 4GUDA 3NH9A 1CF9A 2J48A 2PT6A 3PFBA 1WW8A 1JKMA 5CDFE 2WJ3A 2V7QD 2ZJ4A 3BGWA 5KPDA 2P6MA 3UCXA 1LBTA 3HGTA 3LQQA 3TLBA 1TK2A 1RRFA 1DC5A 4XSHA 3GEPA 5HE9A 3VISA 4JB3A 2OK8A 1TEHA 3OFSA 3IUPA 3LQ4A 3OUZA 5BSEA 1JDPA 2JI7A 5TY0A 1YI1A 3V4FA 2G88A 1RIFA 2HZ7A 1OBVA 1NVTA 4MWOA 3S29A 5KKNB 3AVQA 3CWZA 5DHFA 4TM7A 3JQFA 1X94A 4A0RA 4EBFA 2B8EA 3DFFA 4AZ3B 2IH4A 4X54A 3OPNA 1JB9A 2KLHA 5LL6P 3VU0A 3BXZA 2WF6A 4AG3A 2EFDB 4FS8A 4ZTUB 1BFDA 5AKGA 3GLHE 4PPQA 4J0JA 1XF9A 2I55A 5ALRA 4ZHQA 1S8AA 1II8B 1J39A 3WNVA 4E22A 1XDZA 4EK9A 3EPRA 1I2BA 1PNOA 4KUGA 4CF4A 1DIRA 1KMHA 2QYTA 3UICA 2B4QA 4FDAA 2JBAB 3BK7A 5FNVF 2JCGA 3NG1A 4GSKA 2BFEA 5HBGA 5AW0A 1QFMA 3DP9A 4YLGA 1JXAA 1LXCA 4MLPA 1VJRA 3QVSA 1ZYUA 3B6KA 3HZRA 1Y6ZA 3QW2A 2IOFK 2GM5A 3DZCA 3NCTA 3I76A 2D2VA 5B58C 3B1VA 1T6XA 3OZTA 3KJQA 4MB2A 5IH3A 4CIAA 3DQZA 3TF5A 4QBHA 2C7RA 4XIGS 4DEYA 2DH6A 3UK1A 1JV2B 4CM7A 4RTRA 1FTGA 2D54A 3DLCA 2FJ0A 2WNSA 5TDHA 1MA0A 1R12A 2Q6TA 4M76B 1RZUA 5JWOA 1G38A 5ALKA 1CHDA 2RKWA 3PUJA 4J1NA 2E48A 3VYTB 1RKVA 4OBWA 1PL0A 3FWKA 1E4YA 1XOIA 5BRNA 1OI4A 2HRCA 2EDCA 1V0JA 5ERGB 2BOVA 2CJPA 1NULA 3GDOA 1PL7A 4GPZA 1U9ZA 1D07A 2Z2YA 4GX0A 2OAGA 1KEEB 3L49A 4OXKA 3QVTA 1RWVA 1YDFA 3D0KA 1TC1A 4YR7A 5I9NA 3EJ6A 3U1TA 1RQ7A 3DBHB 2FW0A 5JDIC 3K9GA 1FU7A 1ND6A 4FGJA 4NMLA 3AYXB 3HJAA 2ZYRA 5FJIA 4MUMA 1E2JA 1QR2A 2VWQA 3GLTA 4V38A 5KVVA 2H85A 3UATA 1KQOA 4R1PA 2CNWD 3JVVA 1E9DA 1YASA 3G6WA 4ZPJA 3DZBA 2Z6AA 4JYZA 1NUHA 9LDBA 2VHCA 3ACDA 4JIMA 2FSHA 3PGJA 3DE3X 1SIBE 2X0KA 2A67A 3UWMA 4R2JA 2H2DA 2AFHB 4ZANA 1NLFA 4EEXA 4OIFA 4MSUA 1H9AA 4NBRA 1DQSA 5LBIA 1MVLA 2YWXA 3FAKA 3OFKA 4EL0A 2OE2A 3EGXA 2OBBA 3OJXA 3GUZA 2AEFA 3SCZA 2QM7A 2V97A 5CDUA 1OFUA 3E8MA 4QNRA 5FBZA 1JYSA 4ECEA 2J5KA 4G09A 3W1WA 2VTBA 2IUTA 3BWMA 4F4CA 4PLHA 1QB7A 2ARKA 1T2AA 3HBNA 3U7FB 2O8FA 5G02A 3RUAA 1NLYA 3T1QA 1GKUB 4I50F 1RWMA 4R9SA 1C1DA 1WEHA 4EQ6A 1C9YA 2HV8A 5F5LA 5KCMA 5I45A 4N40A 3S0JA 3YASA 2GEFA 3SR3A 4X6XA 4NHOA 2FI1A 4YRFA 3PENA 4BMNA 3KFVA 1E0KA 2FG6C 3WL6A 1KJ9A 1U2GC 2QYHA 5AK6A 5FA6A 1G63A 4INZA 4NH4A 2CLKB 3KWJA 3EN0A 5EAIA 5CITA 2UZ0A 5ICFA 2D7CA 3DMPA 1JN0A 4LWPA 3SX4A 4C3UA 1GZUA 1G5PA 5DGDA 4FGSA 3W2TA 2CB0A 1RHUA 1NPDA 1P3Y1 2R97A 3FKSD 4JNKA 3LE8A 1QV9A 3FI0A 4L4YA 4LHZA 4UE2A 4YAOA 1AQYA 5CLJA 5KDOA 1O08A 3RRYA 1S3GA 5GJCA 4YXWD 2HDNB 4H27A 4BQEA 5IDWA 3MJEA 4R8VA 2EGHA 2B35A 3WGZA 2OCPA 4D9HA 4XB2A 1V95A 1MNAA 1SR8A 3HNRA 2HA2A 1HOXA 2OORC 4F6RB 5IAJA 3DBVO 4WSOA 3NTOA 4ZO9A 1HUQA 4M8KA 4P4SA 2C3MA 3SM3A 4D0SA 3H99A 5K6TA 3WQQA 1X38A 1M1NA 2VDKB 3EXEA 3GJ4A 1LBHA 2O2IA 3MAAC 4PRLA 3SBXA 3U1BA 4YJ3F 4Z4CA 1U7TA 4OB8A 3DCJA 2NAPA 2C2GA 3OHSX 2NV0A 3ERCA 3SF8B 2I2AA 4Z5XA 1VCOA 4LBWA 4DQDA 5C34B 4IYJA 3EIEA 3SPXA 5JO9A 2ZVJA 5F33A 1SU6A 2WAOA 1ZN9A 2JGJA 4LCBA 1BMQA 1KIFA 5ES4B 2H2GA 2WKPA 5EIOA 5JLJA 1E3WA 2WF9A 4RX1A 1B73A 3F0TA 5YASA 3GMSA 3UJ9A 2DSNA 3VYWA 8GPBA 2J9YB 2R7AA 3KZ1E 4JYMA 3NIGB 1A8SA 4CGZA 2CGEA 3ECSA 3PHGA 5H68A 3KSMA 1NVWQ 3COYA 1Q7BA 2XR1A 3S5UA 1A27A 5AJTA 1E3SA 4ZOLB 3WB0A 2CFSA 4PF1A 4ABYA 1K92A 1B4DA 4Y1EA 2VPQA 2BJHA 421PA 4EKDA 2IS1A 1R6XA 1UP4A 3HN6A 2H9YA 2VDQB 4KXWA 2Q4BA 3G7NA 2HQOA 4RZQA 4AJJA 2G5PA 4BU0A 1VJGA 1Q7RA 1MOQA 4DC0A 2H2HA 5KTYA 3WI7A 2EEZA 1U9IC 1A9XB 3I4LA 5JNRA 1F7UA 2PO5A 1EUCA 4Q1FA 1X8XA 5JCOC 4IAOA 1RZRA 1A8PA 1G64A 4LOKA 3SZMA 1L8LA 2L0XA 3BCHA 1EFKA 5KYUB 2JJQA 5E4FA 3OIGA 2WJZB 2XCLA 1L7MA 2ZFUA 4WVFA 1MJGA 1XK7A 1BQ4A 3KS9A 4G1MB 1KERA 1F8FA 3AR4A 4LYEA 3UQZA 3IA2A 2XT0A 3N2EA 1HRDA 3VGJA 3BB3A 2C4TA 3FKJA 4ALMA 2E18A 2MJLA 1XEWY 2H8GA 1D0VA 2BMFA 3HG7A 1OB5A 3N39C 2WIGA 4MKXA 5FF9A 4KLCA 2C5AA 2IE8A 4OHWA 5CB4F 2QE7D 2BZGA 1HFJA 1USUA 3R5JA 4Y6OA 1LDEA 1QANA 4LTNA 1TQ6A 1TT5A 1YR9A 5G3ZA 3N5CA 3V2GA 3R8FA 2YCBA 1KYXA 2FGJA 3DEHA 3NHPA 2W6ID 3KXKA 1UINA 4GYWA 4C08A 3AM5A 3GCDA 4TYYA 5I8PA 1M6HA 1PYOA 4BKOA 5LP6A 1GGNA 1PE0A 3AY0A 1ULHA 3H5AA 1NRJB 3D3QA 5BUSA 1PJBA 1YBFA 3T4EA 3M3DA 1YE5A 2D3TA 2K2QB 3EGWA 3VSBA 3BF8A 4EZIA 4HNVA 721PA 3OCUA 4XX0A 2OG1A 4M87A 1ZICA 4X95A 5CD1A 3ESZA 2OR3A 5LKAA 2JVJA 3HKDB 2QUJA 5M3BA 3NDBB 1GT91 1EG2A 3LCMA 3FTDA 3L8MA 3B85A 2CEKA 3EDRA 1XVAA 1IOVA 4KTVE 2OGUA 3NYQA 4R3NA 1L5NA 5GOTA 3WGTA 1SXPA 3TL3A 2RHHA 2QLLA 4KRXA 4OX9B 3QOYA 1KEKA 3L84A 2AYXA 1ZK4A 4MS3B 4UVDA 5IM4F 2AOUA 4OQDA 1CY1A 1ODSA 2JFQA 1VP9A 1WUJS 4R31A 5TPWB 5JDCC 1OU0A 2EJCA 1FFWA 3TYXA 3UJCA 3GY0A 4ED9A 1BDIA 4BNWA 3CG0A 4M54A 2IU3A 2ZYSA 3AFMA 5IBQA 3ZKAA 5KS2A 3M4JA 3A9RA 1I2AA 3O47A 2WMOB 4WFKA 3VPXA 3MJDA 4JOCA 1IBSA 2GBGA 3HY3A 5KU7A 4UREA 3G8CA 3K0EA 1EFVA 5EQTA 2E3JA 2FZ5A 3AY7A 2XA1A 4GQBA 4HWGA 2WDPA 1UC8A 6LDHA 1NF9A 2OQIA 4UMFA 2G8NA 4PWZA 5JTUA 4HWPA 1X9HA 2GLTA 4B33A 3L8YA 4L07A 1JPVA 1JHZA 3PDWA 3QPCA 4MH0R 5C4MA 2XMBA 5C53B 1QAQA 1WB5A 3SNHA 4MRMA 3OPVA 2DPXA 3E5HA 2G9ZA 2F9LA 3DDWA 4J2OA 4OVKA 5I48A 1KDOA 1LDGA 4FP9A 2Q2NA 4AZ0B 3CV3A 4YV1A 621PA 2IEGA 5JS1A 1GVNB 1UEIA 1Z2EA 2Q3HA 1NE7A 1KVSA 3AP1A 4ZAZA 1IZ8A 4G1UC 5GTDA 1FSSA 2HEIA 1DJPA 2QN9A 1R37A 3L6DA 4OYRA 1PZEA 4G9EA 1LZLA 2GBFA 2VL7A 3EOBI 3R8XA 1JI3A 4G26A 5LQMA 4KREA 3MCUA 4QVGA 4J76A 3WYBA 3GEEA 4DNXA 3PQ6A 2VJDA 4RY9A 3NTUA 5C80A 5HGXA 1KL7A 4DS3A 1Z0UA 1K8YB 4DIUA 3JPYA 1I3CA 1LPMA 2XGGA 3WHIA 2POQX 4BB9A 1FRNA 2AMYA 1Q17A 2AF3C 1ZAKA 2IE0A 2FSFA 3VR4H 2O4UX 3K4HA 4KE9A 1BQEA 2GF9A 3JQ7A 4W5RA 4C6RA 2I3AA 1ZHFA 1L8AA 1XSEA 4NECA 1L7AA 2R1TA 1XI2A 2WF5A 2DPLA 3H2YA 4L0QA 4MWGA 3D59A 2X0NA 5F4ZA 2IWHA 2QAJA 1B6TA 2FZLA 4PCLA 2IDZA 3AR8A 4JJKA 4B4VA 4B9EA 5A7HA 2G9UA 5LFAA 4XD2A 2R6R1 3RC7A 3VJKA 4I99A 1GU7A 4GPD1 2Q5CA 1YBVA 3DH0A 2CXSA 3E03A 3KRTA 4MW2A 1R27A 4TWRA 1CUYA 2WM8A 3ET4A 2JATA 3RIXA 5BV8A 1DRUA 4UDOA 4G07A 3ADBA 4KFTA 5TB5A 1O1YA 3A27A 2E4VA 4M89A 4OYHA 1I3KA 2XNSA 5KHLB 3EWNA 4EVSA 2G9NA 5CA1B 3LUGA 5CEJA 4XGIA 1NZDA 3ROEA 1V8OA 3HRHA 2H1FA 5DCYA 4KC0A 3CNQS 4MIYA 2HU7A 4QLOA 2DGDA 4F2GA 1AKRA 1OWOA 3DMGA 3NYRA 1M6EX 3MTDA 4CN9A 3THWA 3G5TA 5C3UA 2D00A 1U0TA 4B1FA 4X85A 5BVGB 2VAPA 3KQOA 4OHBA 1AM4D 3REGA 1NJ6A 1K66A 3WNQA 2W8ZA 3UMSA 1E61A 2IUFA 3BMXA 1HNXB 2XRYA 3BWXA 1XN1A 4OOFA 1R0XA 2DC1A 1TUEA 4OD0A 4Y9RA 3LLCA 5HR5A 4DUPA 4ZK6A 4KGXA 4PW0A 1Y8RB 3T7KA 2ISSD 5HBRA 3VV2A 3BFXA 2I4TA 4Y0NA 3JY6A 3U3KA 2A33A 1WDTA 2W6ZA 2XOKA 4GAEA 1WRBA 2BISA 1XUOA 3GYBA 3Q5DA 3V6LA 4B2LA 2REQA 4WZZA 3AT1A 2YQ5A 2EX0A 2VJCA 3BK2A 4C03A 5JALA 2I2DA 1YZQA 2C7BA 2NU9A 2WK1A 3IAEA 3MJRA 3ONEA 2J3LA 3R6LA 4UC0A 3U37A 3CVWA 1ZI9A 1ULUA 3REQA 4AKEA 1U4NA 3OC6A 4A26A 1U63A 3D8RA 3DNFA 4DCVA 2XCUA 5G40A 2PLNA 5AVRA 3R24A 2QUZA 4M9CA 4HY3A 3O0TA 1FVHA 4IF6A 4JROA 3WMWA 5KQPA 2BRUC 4WLOA 4BFLA 4C22A 4IG9A 4CKYA 1E79D 4WK2B 5ICEA 1Z06A 2C03A 1EBFA 3SN6A 2WHPB 1M54A 4EUEA 4MQEA 1M5RA 2NT3A 4IGKA 4MROA 4PZZA 1EUDB 4C7XA 1Z34A 1NIJA 1RLTA 3OOHA 3I9MA 3UHOA 3KQKA 3CLHA 3O1LA 4X1KB 4HNTA 1LX7A 3HCFA 2C82A 2PT7A 3GT0A 3UBTA 1VECA 3H2GA 4XJXA 4G8DA 3VC7A 2NXEA 1BD3A 1SK8A 3H5RA 2JGDB 2DFVA 1M2NA 5F1OA 1GCAA 4F2WA 2V6BA 4UXJA 4DIMA 3ZDAA 3CF2A 1G2OA 5EZYB 1D2MA 4RVOA 4LXHA 3GLSA 4FMDF 1IBCA 4D82A 4HDKA 3UWPA 1MCZA 1UH5A 3WO1A 3RRXA 5TMDA 5TVKA 2W93A 1BJRE 4W8GA 4AF8A 1Y3DE 1BDMA 1WUHS 2QD2A 2IYWA 3BXFA 1XQVA 4MR8B 4UOEA 2O8CB 2GA9A 4EX7A 4CM6A 4Z7OB 1QK5A 1YACA 1W8DA 2O8BA 3ZDFA 4TVBA 2F1KA 4JLPA 3BEOA 5FWAA 5HS6A 5LZ9A 1EUZA 2XTZA 5CDFA 1LKZA 3MUNA 1PR9A 3UUWA 4CU5A 4WADA 2I4RA 1W2WB 5ED4A 4KK3A 1JAXA 3KD2A 1XLTC 4N9WA 1TCCA 4AZ0A 2VKTA 3UENA 1MU0A 3DEIA 3IPRA 4RKEA 5ALOA 4EYGA 4BFYA 5LR6A 3EAQA 4GFDA 1U4SA 2P69A 3ZYZA 4EHDA 3EXEB 3CWQA 4KFCA 1M8KA 1XMSA 5KYWA 4GR4A 2VVTA 3ZHCA 1P77A 2QT0A 4RPIA 3EUWA 2ZBDA 4FQ7A 1R4MA 2BHSA 1FFSA 2UKDA 2YMMA 3F4KA 2PN1A 1JFFB 1TGYA 3ZWMA 1DKPA 3JS5A 4WA7A 4HLDA 5CH8A 4FYVA 4PLPA 3SC2A 4Z54A 2CVPA 4BVLA 1ZSVA 1FA9A 1ABEA 3UT0A 4TUYB 1BHQ1 2FR0A 1EG7A 1CUJA 4MJXA 1H0HA 1DX4A 2YTZA 4V3BA 1Y89A 2B4KA 1SKBA 4R6WA 3OESA 3P27A 3DHYA 5G3YA 3DD5A 1A5BB 3TW8A 3GMTA 2NZUG 5L7TA 2DSTA 1ZSNA 3LCRA 2Y6UA 2ZM6B 4RYLA 2QZ9A 4QNMA 2OV1A 4V2UA 1DO0A 3WS7A 3N8IA 1N2CB 3D81A 4ESHA 3T7TA 4FHZA 4BJ3A 2YHBA 5M2QA 1T6YA 4Z4HA 5U9CA 1GFSA 3H9BA 2J85A 1BKYA 1YR2A 3M5PA 3ZHBA 5JS8A 4M9UA 4GKKB 4LRWA 5KVQA 1C4XA 1C2TA 1KJYA 1Y8QB 1J22A 1M34B 2AXEA 1NMZA 3BSYA 1MTOA 1EX6A 2FZEA 1AQLA 3GUVA 3NIFB 3TTSA 3MTAA 3BWYA 3SFTA 1QPZA 3A4VA 3CO0S 3H4TA 2JASA 5I9BA 4IVNA 4L0CA 2X9QA 3KJFA 4REQA 5J4KA 3QEAZ 4XB6B 3RR2A 1VJ5A 4YCCA 3KAJA 2QB5A 1R15A 2WDZA 4JX9A 3FLBA 4EITA 1FX0B 3F3YA 2VHEA 3GRKA 3TINA 4P6VF 1V8ZA 1P45A 3EFEA 4XUDA 1M2GA 3FMPB 4MB0A 4DRXA 2G71A 1ZS9A 2OVBA 1BS9A 1K5GA 1XZHA 4HI0E 4X1YA 4XAQA 4INPA 2J46A 4DDHA 5A03A 4KH1A 4R8LA 1QYIA 2AE1A 3LUBA 3F8TA 4A5SA 2OV3A 2A1TS 4Y1RA 3AP2A 3UO8B 2P4EA 3BIOA 1SBQA 4QOFA 1G42A 3RVDA 1E9VA 1K88A 5CFRA 3KUUA 2O1EA 4KMRA 1P19A 4LGCA 4P3XA 4JOBA 3U81A 3PNKA 3E58A 4WECA 3V5NA 1Y9ZA 1LGYA 3RNLA 3LQ2A 4E08A 4B4KA 3W5CA 3FYUA 2FMXA 2O14A 3Q7RA 3R6DA 4MVXA 1NC3A 4HNHA 2WICA 2J30A 3PUIA 2V03A 4PG4A 2XYHA 1PEYA 4BMSA 2C4WA 3KL4A 4IJMA 2F90A 5P8WA 1QXSA 3B3FA 1N6PA 4Y9UA 4HH3C 5H5JA 3UPTA 3HWRA 4RO0A 5K4GA 4FFWA 4TTVA 2VHXA 1PVVA 1ODIA 3WLAA 2FPRA 4M1EA 3LC1O 3STVA 3K70B 5D2CA 3GEIA 3NHBA 4LISA 5FADA 1FS4A 2PKQP 5E9WA 3VDXA 3R5HA 5A5FA 1YRQA 2PGAA 1Q1AA 2IP1A 4P82A 4MHOA 1AGRA 5KYGA 1HYEA 2ZTLA 5TPZD 2CMKA 2YUTA 2WFLA 2XVZA 4QYXA 1A4IA 1WF3A 1T3TA 2YOHA 3L7IA 4IQ8A 1QQ5A 4KODA 5J59A 3RVQA 5FT9A 3GRZA 1PZNA 3BE8A 4P4SB 2VBFA 1T3GA 3F6RA 2JFPA 4YJHA 2YWGA 3HA2A 3ZV3A 2BDUA 3U3DA 4DV3B 3BXEA 4MKHA 4UBNA 1WCIA 3RFXA 1COWA 3GAAA 5CYOA 1AN9A 2P4QA 1ESDA 2WV7A 1LVHA 5BNIA 1DKUA 3W5UA 2LW7A 2PU5A 4A82A 2JCVA 5IANA 2JHGA 2ZSBA 4M0EA 4D5GA 4JQOA 2ROQA 2TRSB 1BTOA 2AEJA 1MGOA 4LDRA 4KXFB 1TIBA 1H2AS 3T94A 3B53X 1EFPB 1OR8A 3VHQA 3OFND 5A71A 3V48A 5D5PA 5KWEA 1U7DA 4NYJR 1NUUA 3HE3A 2OBXA 4HDRB 2LTAA 4HN2A 3T0FA 2SNIE 3GROA 4Z2AA 3SD7A 4EHKA 2CV1A 2JJ8A 2C9DA 3W79A 1NATA 4QOHA 5D1HA 5BYKA 4DRZA 2CNWA 1DT5A 3FB1A 5F21A 2ZIGA 3NHAA 3H83A 3V9PA 4ZKEA 4DLYA 3D7SA 2IOHA 2W6OA 3U7HB 3MB8A 4WDQA 4HNSA 2W37A 1DTSA 4MZXA 4CIWA 2OYSA 2WC1A 3ZLJA 2CL0X 1VIAA 4L8WB 4D9NA 1MQ9A 4GEGA 4NBKA 4OSEA 2CUZA 4UDYX 3STXA 1S7CA 3R3WA 1PKXA 3PLAE 2ZRKA 4DG9A 3SHQA 2GPBA 2QTAA 3E05A 4UU7A 4UTXA 2HCFA 3BRWD 3ENVA 1GRRA 4FFNA 2G07A 3D8BA 3ANMA 5D7NA 4BO7A 4OHFA 3K15A 4ZI7A 1ZRSA 2F4NA 2P68A 3EQ7A 3IKLA 4MGKR 5DGTA 4IMPA 5J40A 2ZWVA 4JODA 4TL9A 3PBKA 1H0KA 3BS4A 2ZSHA 1XPJA 3E9EA 3PIIA 5D84A 4E33A 5KO2A 1NQOA 3M89A 1V8BA 2JGKA 3I2FA 5ELMA 1IXYA 1KP9A 3EAGA 3OU6A 1XTTA 3D6HA 1LTHR 2WMDA 3HP7A 2ZAYA 3ISTA 1T34A 3NNSA 4FR2A 3RVJA 3TNDA 4OMCA 1Z4QA 5ALPA 3RQSA 2XD4A 2PSDA 3STWA 3BH6A 5EWMB 2H2WA 1DQYA 5EJ7A 3RVSA 1JWLA 4JI0B 5JI3E 3COSA 3IT0A 4LBVA 4ZDIA 3Q85A 2RHOA 3C3YA 1MP0A 4LI3X 3NJRA 5DZSA 5JS6A 3BF7A 2Q3BA 2B98A 2VK2A 4XPZA 4TTJA 2C98A 1JG6A 2NU9B 4MS1B 5IG2A 5A5EA 4DMMA 4BXOA 1S8FA 3T5GA 1NT4A 5TMEA 3PNPA 4TYPA 4F1JA 5C4IA 4Z9YA 4MI9A 3R7AA 2QMUA 3AQIA 5DF1A 5IDYA 1XNJA 3KR2A 5EA2A 1GTSA 1O0SA 1S4QA 2R7MA 4Y18A 1QHXA 4JWTA 4I1SA 4IDPA 3DFIA 2E82A 2OP0A 3DBLB 2I4OA 1Y3CE 3GFGA 3I4CA 3NBXX 1KOLA 2IS2A 4ZV7A 2ADOA 4A23A 2C84A 3OQ6A 1IPEA 4O8ZA 5P21A 3ER8A 3NVAA 2C94A 1I94B 1QRDA 3Q0IA 1GN9A 1OTXA 1X8JA 3GDFA 1HYQA 1U7XA 1PT8A 2GT1A 2DRIA 4J49A 3K0HA 3F7NA 4I19A 5IBPA 3NBYC 1E9FA 1A97A 2HNBA 2YXNA 5F2OA 4Z8XA 3ZI7A 3E9QA 3VNSA 4ZAWA 1T9BA 4ZCPA 5EESA 5FTLA 1GQOA 3HM9A 2E5FA 3OZAA 3LNTA 3CQ9A 1PT9A 4MEAA 3T3MB 3JQBC 4LVUA 1XTKA 4QDUA 3IALA 2CT8A 4GS5A 3NW9A 3EXIB 3V3KA 2HWXA 2ZUUA 3WJ1A 4ZYVA 2ECKA 2JLQA 1J9EA 3FNBA 4Q3NA 4AG5A 2UUOA 1GD1O 5C1OA 1ACMA 1LX6A 3T34A 1IHUA 2W98A 2QN8A 4MAFA 4NZMA 5JDIA 1ZAYA 1S1MA 2R00A 4R98A 3QF4A 4HAOA 4C6SA 4D6YA 1T10A 3EF0A 4GGPA 1V9LA 1ATZA 2VH5R 3BDAA 1W47A 3OEYA 3V55A 3LTNC 2B8NA 1Y5MA 1Y1QA 4E32A 1FXWF 3P9NA 5JH7B 2REXB 3OE7A 1PJRA 2PQ6A 4GYJA 1DFHA 3ND6A 3A0RB 4MQBA 5E4YA 5REQB 4I8IA 3VSAA 3OOWA 4NFLA 3MVEA 4QE3A 3ZW7A 2XBUA 4D9GA 3THXB 1YFKA 1ULBA 3F9CA 1V41E 3G7SA 3X2EA 1PHPA 1U1EA 3P0JA 5F78A 3KQWA 4M0PA 1A9PA 1XL0A 2X5OA 2XMSA 2QF7A 1LLFA 4G5SA 1CP2A 4EIWA 1C9EA 1NOKA 1ST3A 8MHTA 3OF5A 5ECDA 1QFZA 3AUJB 3OTQA 1UJCA 5AOBA 1X15A 1ZZGA 1I7NA 2P4HX 3NPAA 3OQMA 3WIUA 2FFAA 2FH5B 4BCBA 1C4WA 5JFGA 2ODQA 4PO3X 4K7JA 5T8KC 3TTXA 4OF4A 4JAVC 5FTJA 3ICEA 3D1VA 3W2HA 1A5ZA 1DKRA 2IITA 3HI6A 2AQHA 3QFTA 4IINA 3S2UA 2FOXA 2ZQ5A 4L3WA 1JXMA 4S1PA 5ER6A 3HSSA 4YWHA 5DM0A 4M99A 2UZ1B 3W2IA 1G9XA 1GTL1 4WFJA 4JXZA 1IOWA 3EVCA 4Z1OA 3INGA 2PLAA 1Y6GA 5ESRA 2YHAA 1QGAA 3A36A 4LHWA 3FWYA 4CWAA 1Y0BA 1XXHB 1LDNA 4UZEA 3VKUA 2BBOA 5A3JA 4YJDA 3SX2A 1OLOA 1YKGA 3FMGA 1TYZA 1XE3A 3CINA 3FPCA 2CCJA 3A1DA 3L0OA 3QHQA 3OECA 4RHCA 5BQPA 3IGFA 5HM8A 2GO7A 2IOYA 3U4IA 1WETA 5L3SB 4LE2A 4RVSA 3NMUF 3ONDA 3E1SA 3MWFA 2Q5FA 3BD9A 2B83A 4RY0A 2GAFA 1CS0A 1CUAA 5CJ2A 2HUNA 1U1DA 1XJ5A 3LVRE 4NX2A 3D5QA 4ZFNA 5I9IA 2NQ2C 1LY1A 3H4MA 1XMQB 2P2DA 1GLGA 1S2OA 1LDMA 2IYUA 2L42A 3FPAA 4AWBA 5K8VA 3RTAA 1EFVB 2BMJA 2ZJ7A 1OQAA 4J90A 3F96A 3D8SA 4CG2A 3M4NA 4JP1A 3IUNA 1JSLA 1JYFA 2FFJA 2UDPA 2NZ2A 4K6KA 1J2YA 4M0CA 1HEUA 1JEQA 1K6XA 2KWIA 3H5LA 1T9CA 2QT9A 1U90A 4NR0A 1GPKA 1JTVA 1A7JA 1X7WB 1Q0LA 3MWDB 3TAXA 3WK4A 1JR2A 3L82B 4JUDX 4IG4A 2IA5A 4Z8YA 1M0SA 1NRXA 4ZQIA 4G5GA 1O5IA 2QI9C 3P5SA 3ZD8A 4PG8A 1IU9A 1J2JA 3QFRA 1KZHA 4HQ6A 5BWCA 2UUCB 1ZMTA 4Q1CA 2LCFA 2QM0A 3DWFA 4TV9B 2CXPA 3PE3A 3O90A 3GCZA 5JAOA 3Q3JB 2Q8PA 3G82C 1J8VA 3JQAA 1TO2E 4YRCA 4NE7A 3ROKA 5JAIA 1TVMA 1G7RA 1DEOA 1KNXA 4I81A 3KZNA 1TMKA 4XQCA 1B2LA 2HSJA 4WESA 1O6CA 2JIZA 4HGPA 3WK9A 4YRZA 1DBVO 2G1JA 1GN8A 1ORIA 1XZBA 1A4XA 3B60A 3OX4A 3T0IA 4B3MB 3O94A 4M83A 3GCXA 4FLMA 3RDPA 3QUTA 1KAQA 2XBLA 4N49A 4RK5A 2I4LA 3JQBA 1OF1A 3JRXA 4LZAA 1R9JA 2P1ZA 3FCEA 1DARA 2G08A 1K7SN 2I1VB 5D5HA 2XV1A 2OPHA 4YS6A 2BF4A 3GNTA 1UXJA 2Q50A 3NFRA 3THOA 4DADA 2QI9F 2YMLA 3OT5A 4K9SA 3LC0A 2X7JA 3GVIA 4KX5A 3TB4A 1JNXX 1EA5A 1U2SA 4BP1A 1TEZA 3TAUA 2D5CA 2PUDA 2FUNB 2YN0A 5C1IA 1T91A 2MR6A 3KDPA 3U7QB 4E46A 2P6UA 3GJZA 1TM7E 1WR8A 3C48A 4G37A 1Y42X 4YK7A 1KVUA 1UF9A 4WINA 3WMGA 4C76A 2OCKA 1ADBA 1T4BA 2EAUA 3LYAA 3P52A 3Q41A 3HCWA 4HRYA 3S5JA 3SSNA 1PRYA 5EERA 2BBTA 1ZNWA 2HBZA 3HB1A 3S2ZA 4RTOA 2GK7A 3WDSA 1FP4B 1C0EA 2A7QA 2DFTA 3CXUA 4P9NA 4K6OA 4HH1A 2NUPA 1UZMA 4TL7A 1JEDA 4Y2PA 4MARA 4W82A 4URWR 5IARA 4ZZ1A 5HKKA 1E9AA 3GR6A 1BD4A 4IPTA 3LO5A 3PIRA 1TTTA 1JYEA 1QFXA 1M7BA 1U0JA 2BWJA 4MR9A 1NONA 1T0JB 4P5PA 5AKHA 4GPTA 3SAJA 4EO4A 4IXDA 2NW6A 2PT9A 4ZRMA 4RKQA 1JSRA 1QHHA 3SHOA 1P2UA 1P6UA 2FW8A 4RZIA 4WLVA 1JPNA 4UAUA 5FPQA 5IUNC 1XZCA 3AB3A 4P4NA 1WXDA 4TWZA 3V4ZA 3WYCA 4TSRA 5DCLA 1HK7A 1GV0A 5LU9A 3CLUC 4I0WB 5JSYA 4TTAA 2WTXA 1RAIA 1B8OA 1DC6A 1B6RA 2YL2A 4IBOA 2V6IA 1XD9A 5GV8A 5JSUA 3VA7A 2HI0A 1BGWA 3UAOA 2FMHA 4ZHSA 4ZCQA 4B46A 2WR8A 1JZQA 3EISA 3QXCA 2C97A 1NHWA 2J9FA 1Z4OA 2ASEA 3KV3O 3WIDA 3OFVA 2JLYA 5DBEX 3GU3A 1T1EA 1WXEA 3BXOA 3HVHA 4JJ6A 3AETB 4CQLB 3AW9A 3PTZA 2OZLB 1KO7A 1KY5A 2XTJA 3R9XB 1IY8A 2QQFA 1IB6A 1QB8A 3UK6A 2EFYA 4YMVA 4EL5A 4RADA 1GNPA 2H5EA 2JARA 4IF4A 4HK4A 4CQLA 4MGZR 4R9RA 1IWBB 1X13A 1EX9A 1WNFA 4DR2B 4BBAA 2JVIA 4GP7A 3C5WP 5IAOA 3U39A 3UTCA 4X24A 3C3MA 5TGTA 3WSWA 3WLPA 1BIFA 1WVMA 3PUXA 1Y4AE 3TLGA 4R9UC 3KALA 2XB2A 3F49S 4ZDWA 1S3SA 1T2EA 4I2VA 1ZY2A 2OQ2A 3ESCA 5F2NA 5GM2A 3V8BA 5CGZA 1HY3A 1PR1A 3WG9A 2OZKA 1BXRB 1UK9A 5ITZB 1BX1A 1WCIB 5DRTA 2G1UA 1OWMA 1SQ5A 4JC4A 3GFFA 4GP6A 4Z4QA 4RH0A 4LFBB 3CISA 3W5AA 3JQAB 4B09A 1R3DA 3IQWA 3MBIA 2P2LA 3OQIB 3QMVA 3HY4A 2KB0A 4RL4A 4UVHA 5FULA 4QZVA 4TROA 3INRA 1QAOA 3I3OA 4OY3A 3QMWA 1A4RA 4P0PB 3IAHA 3TE6A 2O52A 4BWGA 5D5QA 3D6NB 2QZZA 3L7DA 4LJ4A 4A8JB 2K7FA 2FLVA 2F8TA 1CR1A 3W5VA 1AN0A 4DXDA 1DTEA 1GUDA 3RT7A 3ZY4A 5FIUA 4PGHA 3M3PA 1V26A 5DCWA 4XVUA 1XNHA 3A25A 4V0RA 1IZZA 3AONB 5EWLB 4BBPA 4X90A 3I2IA 3RABA 5TLSA 2CHUA 1YGYA 2I6QA 3MJSA 3WY9A 1JBEA 4FILA 5DT2A 1MTZA 1XNGA 1RPAA 2C9YA 2GPSA 1T4DA 3JZDA 2V0GA 1WXFA 5FWYB 1GV1A 3L1HA 4J03A 4Q1EA 3VI4B 2FSIA 3NOOA 4QX6A 2Q1XA 3TSOA 2ZIEA 3CJRA 4LMAA 4R81A 2I29A 1ISHA 4RK6A 3MUOA 3QVGB 1YZYA 5K0FA 2UZAA 4I1IA 2VZ9A 3Q98A 2NXWA 3DCYA 3E2MA 3E9MA 4PYNA 2ZUTA 2J59A 2A5GA 3ESRA 3ZDYB 1NBWB 1L4GA 4Z7NB 4YRBA 1RYMA 3DCNA 2Y4NA 3IVCA 2WEKA 1N3BA 3IMGA 4BMDA 2H0QA 1EM6A 3VDRA 4HGOA 5H3CA 1AMUA 1U0SY 2PSJA 1EB9A 2Q9CA 3R7WA 2V6FA 2GCIA 1YZVA 3LVFO 2GTPA 5CNIA 3RTEA 1ONBA 2ATIA 4OK3A 3DYVA 2ADMA 1WOMA 3NCHA 3JAMA 3N05A 3U4QB 1JTEA 2YFQA 4E5YA 2AZXA 1RFGE 4DT1B 4Q9LA 1H1LA 3MMXA 2JJ1D 1NUTA 3MSCA 4PSAA 3R9WA 1ISFA 4QYIA 2CDRA 1W5BA 5D3KA 5LQNA 4DF3A 1ENPA 1D0IA 3H86A 1DBPA 4YPFA 2XEDA 4P86A 1LLDA 4MYSA 4M0MA 2V7GA 3FG9A 3WKEA 4BMOB 1UBLS 1G8SA 1IOLA 4BWFB 2EV9A 4URFA 3CH7A 5TGZA 1TCAA 5A9SA 1QH8A 4KLNA 1G6KA 1L5QA 1VXRA 2EHDA 2J4CA 3AL0C 1MO4A 4MR7A 5EIFA 3VR6A 2H9AA 3TPCA 5B53A 1W36D 1Y8QA 2H2IA 3F67A 3AVWA 4Q47A 1VLHA 3HCEA 5KOHB 4R6XA 1HV8A 2C4VA 4Q3OA 4BIMA 3I64A 4EF5A 3O1IC 1TKCA 2Q45A 1ZQ9A 4TPKA 1Q74A 1NN0A 3U3RA 3MUFA 2M32A 3LCUA 4ALIA 3AV0B 3NC4A 3MCVA 4I08A 2XZOA 5DHQA 4NULA 1X70A 5AUPB 6ABPA 4MGHA 4B43A 3VDMA 3R3SA 1Y8AA 4KN5A 4PC7A 4YQFA 4A6PA 1XZNA 4I9GA 3TR5A 4RSMA 1Z07A 3HHPA 4J0FA 4MQMA 4RM3A 3IKJA 3TW4A 2P0AA 3KQMA 3DOOA 4OBXA 4N0EA 1DO2A 3DKRA 2G1PA 3BD7A 1TJ4A 2W2PA 3A1VA 4PYIA 4X5OA 4CMEC 4QQFA 1YL7A 3DBHA 1FPQA 1E4OA 1V4VA 4Q7QA 3BGSA 3Q7IA 2A9FA 2PRKA 5TNXA 5FL7A 1RIIA 2GUGA 2GM9A 2PDAA 3HCBA 3KZCA 1L6IA 4CG1A 2HBRA 1TYAE 4KG7A 4YMIA 4ZO8A 2ZIVB 1GRCA 3RK4A 1M33A 4H2DA 2VDMB 5ALFA 4BNIA 2UXCB 1A77A 1GZDA 2OBLA 3DMDA 4FDVA 1GTG1 1B8VA 4LOHA 1IK6A 1S3IA 2IIPA 3RM3A 5K8JB 1VFNA 3LP8A 2W83A 3WMFA 3EQZA 4QG7A 3T6KA 1T6BY 3RCBA 2ZITA 4QO7A 3O75A 2CYCA 3LF1A 2QEQA 3PC4A 4OKNA 1DB3A 2RHGB 3DG9A 1EX7A 4DC1A 2WB4A 3KQYA 2QL6A 1LLQA 1G55A 1SZJG 2P62A 3LK6A 2AG1A 3C1TA 5G0VA 4D9MA 4EKNB 1CLEA 3E8SA 3AWDA 5JQWA 1F5NA 2WU3A 5AH0A 1U2TA 2ATEA 2M6SA 2FPWA 2GEDA 4EPYA 3GLIB 1OFIA 3ZNQA 2WJVA 4RW0A 1OGJA 2QXUA 3CFYA 2F6RA 1H5UA 1SVOA 3TL2A 3O4FA 3INYA 3P9ZA 5KC9A 2FQXA 4ERNA 4IDCA 2RH4A 1C4OA 1CY6A 2LDBA 2Y4OA 4IGFA 4UARA 3ZV5A 2PA3A 4QFCA 5CFQA 2PKRA 2QVXX 1T9DA 2V3WA 1NAIA 2VLIA 2E5WA 3PXAA 3L1IA 4DMCA 3RRFA 3AFGA 5D8DA 5HYVA 1QIHA 4CM8A 2WE8A 1U7OA 4FT4A 4EMTA 2DY0A 1HDGO 2O7VA 4PZAA 3ZGNA 4OLHA 1YRAA 1GTRA 2P9TA 1NKSA 3EIWA 2GMWA 2C1EA 2PH1A 1U28A 1UMDA 3FOFC 4UUMA 4PLGA 4GOOD 1V7CA 4L76A 4AN0A 1SOAA 5TMPA 2ZZKA 1QNFA 1Y4ZA 3AEUA 4E21A 3PSHA 4NYIQ 5LXTB 2XUKA 5K0SA 1EUYA 2PSHA 3AGQA 1J90A 1XXHE 3D3EA 5FLEX 4JWKA 3RE1A 3T4XA 5JPDA 1NXVA 5H9WA 1QP7A 1HLPA 3BA6A 4YAUA 3Q6NA 5TSDA 4CM5A 3H65A 3DEAA 3TTUA 3X43A 3L0PA 3TNLA 2QUBA 3ZE9A 1UAYA 5LJLA 4KQ1A 2VPPA 1HFEL 4FCWA 5EKDA 1X1TA 1ZONA 4LXXA 4NRDA 4K5QA 3ZXUB 1AV7A 1TFUA 2PD4A 5FUVA 4FKBA 1TRKA 5ARCA 5TXGA 4M9SA 2UZ3A 1T8RA 3PEVA 4ARUA 2FG5A 5L3RA 1UFRA 1VPVA 1CF2O 3TI9A 4FDLA 1N1DA 1SC4A 2QHXA 5BQOA 3ADPA 3I6IA 2CDNA 1G1AA 1T8PA 2GEJA 4FYIA 4KQ6A 5BSVA 1QRUA 4TT8A 4UD2A 5D3MA 2FZGA 1MAVA 5AVWA 1KZYC 3HJNA 2PUAA 4GBGA 3ZWBA 3HXOA 2PRZA 5FUXA 4HZUB 3ZGYA 4P84A 2XMRA 3I6YA 3TUJC 2RHWA 4FTWA 4FZVA 4DUYB 1IQUA 1I4DD 3MZ0A 2IS4A 3PPIA 2NO0A 3GJSA 3QVKA 1E64A 1DBSA 1VHDA 4FE3A 3R74A 2WU8A 3G02A 4KO4S 1PJAA 1WWKA 1VCHA 2AC4A 3AG6A 3O4IA 4GLOA 4G4SP 4G8CA 2IBSA 4HN9A 3DDZX 2BHNA 4RPLA 4AJKA 4OL0A 2CJFA 1F8GA 1GY8A 1TZJA 2OHGA 2PZJA 4GLFA 4II7A 3TWOA 4BV8A 2PL5A 4OQPA 4MP6A 1H42A 1THGA 5CM9C 5EIBC 3HACA 1OXVA 2FK7A 4A9AA 2NN3C 4G8BA 4QHTA 1SUIA 2X3FA 1TUIA 4F1WA 5CA1F 3RSQA 2M6KA 2CCGA 4UHJA 2ZRBA 3KV1A 1H9BA 3RYHB 3TVTA 4NBTA 4UD6A 5L4LA 1TOAA 3SI7A 3FTQA 1WS6A 3QTTA 2BGNA 3VV3A 1SBZA 3AF5A 1L8OA 1PS9A 3I32A 4ROTA 2QVLA 2IYPA 3SQMA 2HIMA 4M7WA 2XLCA 3QK7A 3SJUA 1FDRA 3VR4D 3NWOA 1MRZA 2ZSIA 5HFAA 4BVAA 2CDBA 3PDIA 1NBIA 4LZJA 4HL6A 4K03A 2QVBA 4ZYUA 3VJRA 4ZMRA 4BUJA 3KSBC 1TVKA 4EO9A 1YL5A 4IVPA 5E7QA 4CF5A 2W2MA 2A7XA 2VAMA 3I2HA 3K9NA 4E5NA 3CJTA 2C1ZA 4ABTA 1E3WB 1E2HA 4LBZA 2A86A 2WG1A 3CNBA 2V1XA 5G1OA 3L1UA 4GLJA 1JH8A 2BTEA 3UJBA 4HGNA 1GUYA 1QHEA 1W46A 3NV9A 5HQ3B 5EJ6A 1LTKA 3ZHSA 4R1SA 1H23A 5LA6F 3A06A 2HRDA 1NBMA 1Z6XA 1G291 4OHUA 4J7UA 3IJRA 1RXIA 1OB2A 3MTIA 1VLQA 3KPUA 3L6RA 2G82A 1YU9A 2CLDX 3OEEA 4EFDA 4R1LA 3KXLA 1P4AA 1XNQB 1XRJA 4EJSC 4ZJYA 4HLUA 2JIRA 2JHAA 1MB0A 5G4KB 1D03A 5CT9A 3RV4A 3PCRB 1EFCA 2O1WA 3OUUA 4LV6A 4J29A 1DAFA 4AFNA 1E5LA 2HU8A 1IY0A 1JIVA 1PGOA 4Y2JA 4IJ5A 2CXQA 1DJQA 4H6PA 4KDFA 3VHRA 4C2BA 2OOSA 4E5PA 4ZCRA 1HTBA 1W0CA 2CK3A 4G81A 3BH7A 2I91A 3VR6H 4IGAA 3IEVA 2Q28A 3OZVA 5EMNA 4TXJA 4BGIA 2ZVPX 3P1JA 4BN5A 4L9RA 1RJDA 1PDVA 1U2DA 1PT6A 3RVMA 1N3IA 1H2BA 1OI7A 4YALA 4BE9A 2QLMA 3K0KA 4RMGA 4J94A 4RK0A 4FE7A 4BDTA 1ULZA 4HYQA 2YQ4A 3I9OA 3CWCA 1Z35A 2QRJA 3NATA 4LWOA 1QKKA 3EMVA 4FDTA 4IH1A 1YT5A 5ALSA 4HUJA 3T5TA 2Y0EA 3FCAA 4O0MA 4EAAA 5TE9A 2D74A 3O8OA 4I9FA 5HK8A 5K45A 1J5XA 1H6DA 4GH5A 3V7NA 2ZUEA 3HCOA 2WT9A 3QE4A 3K6SA 3RHZA 2XW6A 4U2GA 4BQQA 3D6TB 3KK0A 2E6KA 3W34A 3ZGZA 3TTVA 3ZIDA 3OJEA 2GPWA 5COQA 4QPPA 4BU1A 4MV6A 2E21A 1WEKA 4POAA 4NOMA 4PR0A 2WZCA 1GSIA 1Z0JA 3SXUB 5HG0A 3CR3C 2O5EA 1XCPA 1VLVA 2UVPB 3M1YA 2PQ2A 1XKXA 3P2YA 4Q3KA 1KMNA 4IGEA 3OY7A 4H31A 4Q7JB 2NAFA 3QLTA 1GIAA 5C5IA 1Y34E 1FDTA 3N86A 5E6UA 5KSPA 1SY7A 1SUEA 2HF2A 2WM9B 3DWGA 3G9QA 3G2IA 1Z7WA 4IJQA 3R0XA 4JBIA 3RJ9A 2YWRA 1L4KA 1ZC4A 2PGLA 2V0NA 3DDSA 3L43A 2R2GA 1ETUA 5DHTA 4BFUA 4BX2A 1T35A 1ZCZA 4RD4A 5ENDA 3SYLA 1B8PA 4JP3A 1W4LA 1Y9EA 3A1TA 3O8QA 3E5MA 1E3JA 2IYZA 4FCTA 4Q66C 5F2EA 4FN5A 2DF8A 1TXGA 3OWOA 5EMKA 4R0NA 1PR3A 2UXBB 2JKZA 1U2RA 3GGCA 3L07A 3QPUA 4EB3A 4EG5A 1O57A 2HWUA 4L9WA 4DQUA 3VVMA 5ITSA 3O4RA 1G3MA 4IQ0A 4YAJA 3WL8A 4AMUA 1W0KA 5BP7A 5EJMA 2DERA 3D31A 1KSHA 1UJ6A 5IWAB 1RBYA 4D80A 4ZT2A 4B6PA 1X74A 1WXXA 3PNMA 4RPCA 4C7MA 7MHTA 3D3WA 3ZJUA 3ESDA 4GKVA 5FR1A 4IHAA 2VRCA 1LK0A 5HIIA 1P3DA 3Q6IA 3H2SA 1C9JA 4CHTA 1Y37A 2ZGVA 3EODA 4JYCA 4L08A 4C4XA 1ID8A 2G7ZA 4ZZ2A 3OICA 4GXQA 4KV9A 3C98A 3L8GA 3FTEA 3QPDA 4YJ2A 1SXJE 4OXNA 1JHXA 4FXOA 4ZJPA 1SMKA 2HK8A 5DH9A 4HAWA 2NSJA 3JWIA 4J3JA 1E1QD 2OP1A 3OUTA 2P35A 3E6AA 4WV3A 3SR0A 2P40A 4P3NA 5M34A 1Y7LA 2F43A 1NU6A 4X00A 4BRSA 5LLDA 1O96B 4JQZA 1GG2A 1P3JA 1RTTA 3CTPA 4U6NA 3HK2A 5BWMA 2AIRA 3U17A 2OFOA 3RADC 1H6AA 4FR5A 3D1LA 3JWHA 1F14A 3PC2A 1GG5A 5CXSA 4HVTA 2WFMA 2BCEA 1BWSA 2DPHA 4HAYA 4K6GA 4EATA 4W5OA 2Z08A 2QQGA 1CRQA 4JQCA 4RF4A 4AZTA 3OA0A 2NZVG 3BSWA 4AF6A 1KYQA 1JJFA 2G0TA 2HPZA 3F46A 1DAIA 3JD2A 2XUOA 3M1AA 1TQ8A 1C9DB 4HRVA 3I58A 4CKCB 2D0DA 3MHTA 1PGPA 2BFDA 3C3AA 2GK4A 2OXTA 1T2FA 3N7AA 4N48A 2WYHA 4Y2QA 5DTIA 2BELA 3B9QA 1OBFO 1C81A 1Z5NA 3QKWA 2E2WA 1RRKA 1WIWA 3A32A 4XWYA 1KRHA 2VNAA 3MTQA 5JCXA 1ZO8A 1G8MA 2PGXA 3EDMA 2C8VA 3WWZA 3INNA 2Y1OA 3DYBA 3BICA 2GKOA 4O2AB 3H5IA 4EWLA 5A3RA 3RUPA 2NQTA 2OEPA 2PSFA 5H80A 5K3CA 5CA1A 2V4MA 2HREA 4XR4A 2HN9A 1GNTA 2MYNA 1JDBB 3IAFA 4B40A 2FW9A 4YQYA 4ZOQI 2VTBB 4ICIA 5B1HA 3GJ3A 5FJJA 1N6OA 3UJDA 3RU9A 1E8NA 3TSYA 3WGGA 1GM5A 3AC0A 3DEZA 2GZ2A 2NSHA 3P9XA 4RKWA 5BV1A 4ZYLA 1AZWA 3DGEC 3EVNA 3PUKA 2QNBA 3IILA 4XLZA 4OK6A 1J7JA 1P1KA 3JARA 3G6KA 3LUDA 5K8TA 4LF5B 3OO0A 5K3BA 5CDSA 3AMVA 5G1NA 2XNCA 3WRYC 1BMFA 1J23A 1RQRA 1U3WA 3MTJA 2K5UA 5K3FA 4F9EA 3AR5A 1OHHA 4AYTA 5KKAA 1G20A 1AC5A 1JF8A 3PFCA 4QDXA 4TZTA 2VTEA 1UMCA 4ZOCA 2E4UA 5HJ2A 3OLVA 2AHOA 1E1CA 1M0WA 1V7QA 5T3YA 4LDJA 5AESA 2X6RA 1XU7A 1SNYA 3HBAA 3TSCA 4RK1A 5B6IA 3SQNA 4DA7A 4XJSA 4DDMA 5I01A 3FZNA 3GCWA 1ZGCA 1O03A 3JWJA 1JDVA 4B7CA 3QRWA 4X60A 3A28A 4DCNA 2WU0A 2IWRA 1JIKA 3IODA 3E70C 3PEWA 1LU9A 2P3SA 1NA5A 2BH9A 3EA5A 5I5GA 4EEZA 4Q3AA 2WW8A 5KWJA 1A1VA 5I7AA 2V7UA 4PC3A 4HXGA 2YDXA 3DV2A 4BCCA 3DE7X 1BWRA 3JSXA 3MYYA 2H4JA 4ZI5A 5K09A 4UHFA 2G04A 1GT6A 4KKVA 5T6BA 1GCGA 1OREA 2O20A 4Z0PA 1D6MA 3AERA 4OXYA 2CJYA 2JGAA 5IBRA 3CONA 2HYDA 3QFFA 3NEJA 1W34A 5A1JA 3LPAA 1K06A 1RYYA 2RCYA 3I9FA 3THYA 4WKBA 5IDQA 1F20A 4Z1MD 3UAGA 3CUTA 3PZBA 2C3PA 1BE0A 3I83A 3D2LA 1I1NA 1E9SA 1XFAA 3IAUA 3ASZA 4LYYA 4RL6A 4C0JA 1MJFA 1U7HA 3C7CB 1PLKA 2VPWA 4F3CA 4RNCA 2PNJA 1QHIA 4IJKA 4JB0A 4UKDA 3ECCA 3WJAA 4P3OA 1JLHA 3ORFA 2CFTA 3UMCA 5DTQA 3C3DA 3FPJA 3Q2OA 1N6RA 4BQOA 1M74A 4J7CA 1CQIA 5GONB 3W9BA 2EZUA 1YZLA 3Q7TA 1Y3IA 4AJ9A 3EPHA 4EPWA 2NP7A 3U3MA 3HVRA 3ITEA 4CQNA 3OE7D 2Q07A 5HOEA 4BFVA 1LEHA 2BM9A 4JR2A 3IUMA 3AJ9A 3SG0A 3B1ZA 1W1UA 1KYIA 3Q7SA 1MIOB 4RM2A 1DRWA 4AKGA 3QV1A 2BPOA 1MB2A 4KO1S 2YIMA 2UYCA 1JT9A 3BHJA 5E9JA 2RBKA 3OM8A 2J3JA 3MGAA 2FWAA 1VHJA 3NC0C 5CFMA 1BHJA 3RBVA 4UHHA 1M6VB 1OTHA 3I5UA 4N7JA 1OROA 4U0KA 4UEWA 1AGYA 4AN1A 1FFXA 5C8YB 5HIAA 5L4NA 3TD2A 4KGDA 1GZ3A 3CNOA 2NPFA 4A6XA 4JP2A 4U63A 3ZBTA 1KSFX 1FTWA 2QT1A 2VS1A 1TKRA 2HJWA 2WWWA 4Y6RA 3BA1A 1OFHA 3P0RA 2DUWA 3AUFA 3P2EA 1I5RA 4PSVA 3HMKA 3AHCA 5MGNA 5ALWA 5A5VA 2NSYA 2WU1A 3BD6A 3ZXIA 4FLFA 1C30A 1JBQA 1DP4A 1U8YA 1WKVA 3DULA 1TDJA 2JAQA 3PYMA 4HR7A 2LDXA 3TUIC 4BNVA 5J58A 5JFOA 2JGFA 2VUIB 5JANA 3KQHA 3FE2A 1V7ZA 4QAJA 2PMWB 1KWKA 2O8DB 4KYVA 4RS4A 3I23A 2ZWOA 2XGSA 5MF6A 3A1CA 3I0MA 2FSGA 3OETA 4BAGA 1U2GA 1UBEA 4KXVA 4QOIA 5EOVA 5H70A 3VYUB 4DCUA 1RFLA 2QLFA 4QFBA 4RQBA 3BWBA 2ZI5A 4OU5A 2QM8A 1Y7IA 1DJLA 3KFLA 3QNUA 4LX0A 3NVDA 4TT3A 2CZGA 4V0SA 4S24A 4O4LB 2CV0A 4FGLA 4FLEA 3O2QB 2Z58A 3WNDA 4TUYA 4Z4FA 2J4FA 4N5LA 2X13A 1PZHA 1WF6A 4L5BA 2GXQA 3RRMA 4DJEC 5I6DA 2GNAA 5AR1A 2ZK7A 3DT9A 1QX3A 1FXUA 2WIKA 2FMFA 2O57A 1TJYA 3K0AB 1LBIA 4KAXA 4R2IA 1A72A 3WTBA 2IGBA 1JA1A 1W4BA 4G5QA 3T35A 2HB6A 1NNSA 4P31A 4AD8A 1R74A 1X14A 4DCOA 4DSNA 1M73E 3DE0X 3IDOA 3L7KA 3CEMA 3UJPA 3P8ZA 1W5FA 3NDIA 1DRVA 4ISCA 2XZDA 5FHRA 1AKTA 2ZWAA 5L9AA 3CVYA 2IP4A 1YVRA 4A2QA 3SICE 4YDQA 4BPBA 1HO3A 5FO0A 4F5ZA 5CW2A 2XMCA 3NHUA 2ACEA 3N2KB 2MMCA 2VHUA 4CT5A 2ZCJA 3TVYA 1O95A 3ABOB 2ECQA 3DOUA 4Q9IA 3TQTA 1KEWA 1I5EA 3SMVA 1BDBA 3ITDA 4YRMA 2ORIA 1W44A 4J43A 5FPSA 1UBKS 4FYXA 1GEEA 2XT9A 2XZTA 3RTGA 4AAYA 2BZSA 1UJBA 3E53A 1J7KA 3P2OA 4HX9A 4ZREA 3DPUA 1SCJA 3C7AA 1E89A 1UDWA 4NAVA 4JLMA 1FDSA 1A98A 3F5SA 3GEHA 4NMHA 4AM8A 3FNGA 5SYMA 2G1KA 3N6XA 1LV8A 3TEFA 1A88A 3TR6A 4CQMD 5ELLA 4A73A 1KYTA 3O31A 2CL7X 5DM1A 1XZDA 5BQ3A 3PTAA 4C2UA 1JS1X 1XMXA 1VIYA 2KM1A 4LI0A 3UYKA 4QHSA 2J6CA 4ZARA 2J0EA 2EJVA 1CQIB 4PNEA 3PQ2A 5K05A 4M1MA 3C4VA 3F6PA 4QU5A 4F6CA 5CFZA 4LQDA 3S8MA 2Y9PB 1YIDA 2W6NA 1H2YA 3WA7A 3NDRA 1NMEA 1Y6JA 2PSEA 5AUNB 1ZJZA 3C0KA 2O3UA 3LHSA 5AWFC 2GFQA 4BUCA 1Z25A 3V1MA 3RC3A 1JHAA 3W9SA 4BP8A 1NW6A 2PAAA 4CTOA 4BVGA 2BEUB 1CD5A 3IQIX 2WU4A 4K9LA 1MRSA 2QJFA 4L2IA 1LBEA 3PLRA 3THRA 4A2WA 3E4DA 3ENNA 5I7FA 3IA7A 2JVKA 5JW6A 3QELB 4FFDA 3EARA 5DK4A 3WE7A 2H2FA 1V25A 4LCEA 4UBLA 2BSXA 3K2BA 1DJNA 1EKXA 4K3VA 3IUBA 1ZIOA 1DI0A 3BFVA 3G8DA 4JJ4A 1NLUA 3TTTA 2VWGA 4N8EA 1JIIA 1YJQA 2JLZA 4K9OA 2OHIA 1TA4A 1E1MA 1G17A 3V2HA 4HDQB 3I30X 3RYHA 1XRSB 4XYGA 5JHHB 4ID3A 2ZI6A 5EC8A 5EKTA 2H1RA 1PVDA 2FX2A 1S2LA 2Y0BA 1GP2A 2YS7A 5IEBA 1A8IA 2QSJA 4BL5A 1TLTA 1V1MB 3F8SA 2Y27A 3LSYA 1GG8A 1XJWA 3PE4A 5JZVA 4NZYA 1KC3A 4U3JB 1QHNA 4DLSA 2FEXA 5BVGA 3W1EA 4TWAA 3KE9A 4BZPA 2AEMA 2ZS9A 2BM8A 1A2KC 4FHGA 4IKOA 2IX9A 2AL7A 5KYNA 5LOVF 2DETA 1GPMA 3KG2A 2IH2A 2CVZA 3L8HA 2FUEA 3WGLA 2D7DA 5CFOA 2GCGA 4E94A 4GKAA 1T1JA 4FHFA 1JEYB 1QONA 4N5DA 2XCTB 1SHZA 3RYFA 1LBQA 2FZKA 3WKAA 1KZGB 3OPMA 1WUYA 2I3ZA 3EIUA 3NKFA 2GOYA 2OM2A 3KHUA 4JXKA 3VO2A 1KETA 5JXGA 5JXWA 4G1CA 2MINA 4RQUA 1PEAA 1SVIA 2ZIAA 1IE3A 3I1YA 3NNDA 4RGVA 4UM8B 1A69A 3GARA 3KKPA 4BO9A 2YHIB 5E2IA 3AFHA 2A1TR 1S89A 2X5JO 4P93A 5B6JA 1SVUA 1RWPA 4WBSA 4PLZA 3FPBA 4N7MA 1P4RA 4BNXA 1K89A 5TT1A 2DKOA 5FBHA 4JFRA 5BT9A 2YIJA 5JD6A 3O21A 3QUQA 1B3BA 2NZJA 3FDFA 4R5MA 5ENVA 5FQOA 3ZWXA 2QW1A 2P27A 3P0FA 3KBOA 2B4TO 2I71A 4QUBA 4BX3A 5KX5B 4PAQA 1Q44A 3LJKA 5BR1A 5HPYB 2KHZA 1OLXA 2XQVA 4DA8A 1E9RA 1G18A 3B8HA 3N8HA 4MUYA 3Q11A 1KR2A 2P9CA 3VPGA 1NXWA 2ECFA 3FPLA 4DMFA 3OZWA 2JRCA 1SA0A 2AFRA 4X20A 1GXSB 5J1SB 3WV4A 2GJSA 4XVHA 1OPRA 1E8DA 2WHYA 4B2PA 1LF5A 2W43A 2H48A 2WI8A 1SVKA 1WZCA 4F86A 2FN8A 5DKFA 3OZXA 1LS6A 4E5UA 4B3TB 3FTCA 5ILGA 2FY8A 4AKSA 4GG1A 2IIQA 3JALA 1A5SB 2RKBA 4B48A 3GFVA 3L6OO 4CV1A 5H8WA 1XPOA 1AZTA 1FNDA 4L9AA 5DXJA 3DYIA 2FSVC 1HQYE 5BOSB 5MFPA 3UYLA 1K5PA 1O96A 2GAOA 1TCVA 3FRIA 4TX1A 3NNNA 3RJZA 4KL8S 2WIBA 3EZNA 4GOMD 4JX8A 1NSTA 1E58A 4PVCA 1ODFA 2OO5A 1VKOA 2ETXA 3BBPA 4C2AA 1C3OB 2GZMA 1J09A 2BFEB 3O82A 5K2OA 1HM5A 1O6BA 2X86A 2NT4A 4KR2A 1D4FA 1N3LA 2JANA 4G8JA 4WKOA 1Q5PA 1R4NA 1T24A 4Z4EA 1CNMA 1WL8A 2C42A 4IWNA 4J1SA 2BLNA 1D7AA 4JI5B 4RTJA 1M8JA 1T8YA 2DHEA 4NOKA 3UG6A 3BX1A 4CR7A 1T9GS 2NQ8A 4KWCA 1YOBA 2YZGA 1XDBA 3H2JA 2FFQA 1CYDA 2A4KA 2FG7C 4OG2A 1EIWA 4FNGA 3D7MA 5INTA 2XKAA 3QE3A 2W70A 4JT8A 5B4UA 2QRZA 1DAEA 1Y9DA 3NIBA 2ZATA 3AJDA 4IGIA 1OYYA 4IHJA 1HURA 2VWHA 3BSSA 3UJAA 1I9CA 4I6JA 4II3A 3WLRA 3AJRA 2WA2A 2F48A 2J7PD 2WT8A 2Q4OA 1ZESA 4O2AA 1PTJC 3X1KA 5A4KA 3OLQA 4FUTA 2Y05A 4MS4B 4IP0A 2C2OA 3VI3B 3I0NA 1QVVA 4BX0A 3EXIA 5LZ7A 4PVDA 1BHO1 2NUTA 1MC5A 1F60A 1IHPA 4C2TA 4JLKA 2FTKE 1EFLA 2QNRA 2OV2A 5FBRB 2CFCA 2GN6A 5CT4A 5JJCA 1SH7A 3T4UA 3COJA 1UBSB 3VO1A 2RHDA 3RS2A 4TKVB 2ZTHA 3ZXXA 1U5BA 2YVKA 2GN0A 4BGEA 2L17A 2OC4A 1QBKC 3MGCA 4A27A 4UPEA 4IIBA 4WUVA 5FBLB 4ZCIA 3CVUA 1X80A 5IM4A 5BUQA 1R5BA 1P9OA 2O5VA 3P0EA 3LDHA 4PAOA 3O4JA 1NTOA 4GO1A 4XSVA 2LKCA 1JMYA 5LA6A 4EZEA 4IOKA 2PFSA 4YT5A 1EA7A 1I2MA 1Z16A 3K92A 4ME6A 3MWLA 5D01A 4TYQA 3PQ5A 1NF8A 3K1TA 2YRWA 3QBJA 1E1LA 1G1MA 2VUTA 3EMBA 3K1AB 3MQ4A 4R2HA 4TV8F 5HZGA 2EBFX 1E2UA 4REMA 2VHQA 4XOIA 1LQ2A 4R1UA 3UKJA 4BPRA 3T3NA 2MDTA 3RHTA 3EVTA 2WVAA 4A4DA 2GQ0A 2JI6A 5JSFA 4J0KA 2V5UA 4UBMA 4C07A 5LMCA 2VHJA 3L6BA 3GVPA 4KQIA 4X97A 5CAEA 1KEEA 2BFBA 2XYVA 2BBSA 4I46A 4PICA 3K4PA 2C0QA 2N0SA 4YAWA 4UM7A 1ZIDA 2AFIA 3NLLA 3PFNA 2V5AA 3RC1A 3NTVA 3EVBA 1SAYA 3MIZA 4HVAA 3UJNA 5AKXA 5T5QA 4FFOA 1MLDA 2E4WA 5JH7A 4FSDA 5BMOA 1C4KA 2C96A 4QREA 5CX1B 3KSUA 4C4AA 3R3XA 4FOLA 4U39A 3U6KA 3QF4B 3T7AA 4YAIA 2ZRQA 1I32A 4JU8A 4X64B 3PVCA 4D43A 5HW0A 3DOHA 1F6WA 1XJQA 5LZ2A 1VB5A 1FVXA 2NO6A 1OWLA 3PYXA 4J07A 3REFA 3RWOA 1SG0A 4KW7A 2OCBA 4PFJA 4WFQA 3WFJA 2ZBUA 5HCIA 3KU1A 1SWVA 2HSEA 2Q5OA 4OHYA 1E1RA 5BN5B 1RWKA 1Q1ZA 1QCZA 1VSVA 2AF4C 1WZEA 3E82A 1QE3A 4PNZA 2Y0DA 2HH9A 4QJBA 5CDYA 5FBVB 2XAAA 1UWCA 3E9RA 3QXHA 4HH0A 4K9KA 3AO0B 3M70A 2X2PA 2HRRA 3DLAA 1MIHA 4UMDA 3OURA 2XQJA 3CU5A 5DMHA 3UK2A 4BFXA 5L4SA 5JAUA 2PH5A 4P22A 4S35A 3E81A 4KAJA 1KI6A 2P8JA 3N5KA 4L8LA 5BSUA 2ZANA 5ERXA 3K0BA 1PJ8A 1V1RA 1YWGO 2C4UA 2VSQA 3DZHA 3GJQA 4YHBA 3A6DA 4WDRA 3TZQA 3GRRA 4D44A 4XDZA 1PZXA 3TN7A 4NABA 5I3ZA 5K6RA 1EYZA 1KVRA 5DM4A 4H7FA 3AINA 5C52B 5JHGB 2JB9A 3B6MA 3VHLB 2ENUA 2YYSA 5GM1A 1YO6A 3ZQKA 1WUTA 3ZDBA 1ZNQO 4JQSA 2JLWA 1SIWA 3LLMA 3RS3A 1RBQA 3SYNA 4BWVA 4OJKA 3KKQA 3MCTA 3GLGE 2P5YA 3V4OA 2HF9A 3AEKA 5KTTA 1R0RE 3NC1C 3W4IA 4M0FA 4GX2A 1N8KA 1Y98A 5J5AA 1V5EA 2DWCA 2ZW9A 1E4VA 1THTA 2WTMA 3C1AA 3MQ2A 2QLNA 4QGBA 4Z3KA 2HTEA 1YRYE 2CB9A 3EG9A 4HLQB 3L1KA 4URXR 3TM4A 1KY3A 4YCSA 1G7TA 1QH0A 4LUCA 4BGDA 3KSRA 1WV0A 1CY7A 1KSJA 2OMKA 1XVLA 4KN6A 4WZ6A 4RGBA 4J1QA 2ZSUA 2FWIA 3TCKA 1Y8CA 3LPLA 4Y6PA 3L0BA 3ZWAA 5DN6A 2XMGA 4DNQA 5J3JA 4AMVA 4YMLA 5KYVA 4JBNA 3FR7A 2BR4A 1ZWLA 4BQSA 1R8QA 4G4JA 2GEKA 5EE1A 1HMYA 5FOVA 2AJTA 2NOAA 3E7PA 1ZD9A 4MZDA 4M9RA 3G17A 2AOXA 1JXOA 4N8DA 4AO7A 1LUAA 5JO0A 3VNAA 3SZRA 2JHFA 4XRGA 4L4XA 4DDWA 1VE7A 2Q2VA 4IV5A 2PA0A 4RZ3A 1XRRA 3ZWDA 4C78A 3BTOA 5F76A 1UBTS 3DVSX 4DJAA 1O9HA 4GIBA 2ZRPA 1X7ZB 4BNLA 1JIUA 5J2UA 5FPHA 3B89A 2HF7A 4M88A 1T2NA 5CP8A 4K81B 1EWVA 3KKMA 4FW8A 1BW9B 5K0EA 4IL5A 3OJLA 2AYYA 1D2HA 1YJCA 1OAKA 3O8NA 4ZAGA 1UZNA 3EAFA 3VNQA 4F11A 3EA4A 1SOVA 3Q1KA 4TYMA 4F72A 2PUEA 4MVJG 1R0BA 2X40A 3G5LA 4G23A 5ESXA 3H9GA 5AHOA 5JATA 2CL5A 4EKEA 4X9XA 1XZ8A 1I0IA 1YQGA 4YMGA 3HEAA 2V9CA 1GKKA 3BWVA 3C24A 1Z62A 2ZYAA 7GPBA 2J0SA 4BLWA 1Q0ZA 4O4IA 3U0BA 3V00A 1IH8A 3B1JA 4K9NA 3OX2A 4PZUA 3C14C 2OHVA 1GPDG 4XR9A 4YDHB 3KZKA 5CG1A 5ILOA 2AW3A 1L5FA 3PGXA 4IDAA 2Z3VA 1SVWA 3EZLA 4D9KA 1SBIA 5F5NA 3LXRA 3DGFC 3HABA 1YKSA 2O0MA 4R3UC 1U8UA 3S28A 3V46A 4DFDA 3AVYA 1B7GO 3CZCA 3C70A 3JAWB 2R00C 1YJ5A 5AXBA 5GVSA 5BYAA 3RYFB 3BXXA 1RACA 2XUQA 1EH5A 5CLHA 5A4DA 5LZ8A 5K0JA 4I4IA 2C9ZA 4BMCA 3F1LA 3I2YX 3KZMA 2OKGA 3FOZA 2EQBA 2XMPA 3I04M 3DAYA 4WOPA 2XQGA 5AJWA 5J2UB 3B12A 3GLVA 4UXIA 3T9DA 4DSTA 4CEHA 1RMQA 5T4HA 4JXJA 4ZCMA 1P29A 3E27A 4KLAA 2HHAA 1EX1A 3PQFA 1VB3A 3ABZA 3H18A 2HSWA 3OT1B 2AG8A 3A1FA 2ZRJA 1E2BA 1UDBA 1QDEA 4ZQGA 1ZGGA 3WYDA 4IHKA 3ESBA 1KAEA 2HWYA 3IUQA 2X8JB 2QAGB 1NV8A 3SSOA 1SB8A 3V1NA 3VAZA 4IV8A 4KQFA 4N54A 5ALXA 4QJ4A 4URUR 1DAKA 1OXMA 5MHTA 4LRXA 1FYFA 1QO9A 4GXRA 4LYJA 1FMLA 5EVJA 1L8XA 5AOAA 1Y6QA 3M1LA 3OQPA 1XLWA 2JD0A 4J8PA 4KVFA 3U13A 3RGWS 3W2GA 2RGNC 3S7ZA 3QSGA 5DRYA 4HP8A 1EI9A 2FZVA 3GWZA 6Q21A 2OBFA 1MJHA 3BB1A 3MCWA 3HA3A 3PUVA 4RD3A 1TUBA 3BL6A 1BWQA 1VTKA 3JD0A 2A0XA 2H9IA 3BE4A 3D0QA 3QKUA 4ROSA 5CYFA 5AW9A 2JGRA 1MFZA 1W85B 5GZ1A 2PCJA 5CK5A 4NE2A 1TIPA 3GNLA 5EP2A 1U2DC 2CV2A 3H87A 4MKIA 2WJHA 3TIGA 1Q92A 4YLEA 4CCWA 5FLXA 3FRHA 1ODLA 3IYLW 2VSOA 2VF7A 4UFOA 2YUIA 2JIZD 1ZFNA 1QGUB 3JWEA 2W2LA 5DYNA 3ZE7A 1C9MA 1F8YA 4FEAA 5IXJA 2EW1A 3ZVMA 5DLDA 5T57A 4JLDA 4JT9A 3FVWA 3AF1A 5IJXA 3P32A 4HXYA 3MGKA 4KRFA 1ZUNB 2Q0HA 3B9PA 4BO0A 2JRLA 4NDNE 2QU7A 1WE2A 4HPJB 3ETJA 2QDXA 4F3RA 1LQTA 3AL3A 3SSAA 4LJ8A 4TMFA 2XY4A 2OVFA 4JMLA 5JSZA 2HT6A 2OMEA 5E1OA 1CEEA 1E0JA 3GLKA 4RDXA 1C9NA 1K27A 1L4LA 4DV6B 4JJAA 1J1IA 3AVUA 1F12A 1TFRA 5JG7A 3TECE 2P2ZA 2XECA 1VSTA 3K05A 1U31A 4CKEA 2PGJA 1NURA 1IM5A 4MVYA 5TQ2A 1P2VA 2VHWA 3M2PA 1W6UA 3N2ZB 3TRIA 1RU3A 3VNBA 2PWPA 3E3AA 3DV0B 5E6SB 5DM70 1GAJA 1XTZA 4ZVQA 3SOZA 2J3EA 2IW3A 3LRXA 1YA4A 3FBGA 4HNAA 1NI5A 2CLHB 4BLOA 1CW2B 4YWJA 2WHQA 4KQGA 1EWTA 3NHZA 1HL7A 1QHFA 3T7JA 5MN4A 2GESA 1OLUB 4CM9D 3DMYA 1ADGA 3KTAB 1SXJB 1YUBA 3I9V1 3ND9A 4RZSA 1KDPA 3QVLA 1M6NA 4K2HA 4MUGA 1CUHA 4FWBA 4DLXA 4F38A 4Z7JA 5IASA 4BLVA 3K0AA 4DV1B 4TQUS 1P62B 1ZD4A 5ALLA 4B0PA 3SJ7A 2J31A 1URPA 1SHKA 3NBKA 1DV2A 4MCJA 3RS5A 4R1TA 1X9GA 3RUFA 1JJIA 1U8TA 3N6VA 4NBNA 3OQVA 4O4LA 4CLHA 1H0SA 4JZKA 3I1FA 4X66B 3LGSA 1LNQA 5ELXA 3CX6A 3O8RA 4N5NA 3SE0A 4CUJA 1C7EA 1F4PA 3TSWA 2DQKA 2MSDB 3E4CA 4LQCA 1N7JA 3SZLA 1L7OA 4CHGA 2IQIA 1UWVA 2B6HA 1VMAA 3PV0A 4UEKA 3LHDA 5DGCA 3CX4A 5DYWA 1PUJA 2VJMB 2YY6A 1NBEA 3PXCX 3QI7A 2R8ZA 5E1BA 3TW0A 1C7RA 1ZD2P 2A8YA 2XWPA 3WISA 3GJ0A 3FPKA 4ANFA 5LQKA 4MICA 4IIUA 5B7NA 2FPUA 5LWQA 4HWKA 4AY3A 5CHYA 2Q9BA 4IYRA 5HVNA 1CETA 4YAFA 3AR7A 1E2DA 3TRFA 121PA 1UJ2A 3OEWA 3HTXA 1QIFA 1X7XA 1FNBA 2JFYA 3BE6A 3BJEA 3SEZA 4DNPA 2FF5A 1KPGA 4K9RA 2GARA 4O4JA 1P0MA 1LVUA 4PQYA 1GFZA 1T36A 2QTWB 3CLRD 3D2CA 1IDOA 4W8OA 1YVDA 4HDRA 1DQNA 2HLHA 1CKEA 2R6DA 5B36A 4UMVA 4MHTA 3EOAI 4XWGA 4MJ3A 4OGLA 1RWXA 3P9SA 4RDHA 2OPBA 3IE2A 4Q7EA 3CUVA 4B3CA 3VVBA 2ZIZA 4MV1A 4HD8A 2EGUA 2FWRA 2EF0A 1K8RA 2QX7A 3A9TA 1M8FA 3FZEA 3IPLA 4TQAA 1D7OA 2VF4X 5E8RA 4LAFA 4Q6WA 1QIDA 4CLEA 3AUKA 3OZRA 1PF7E 1YQ9A 1NMYA 1RS0A 4TSFA 2LR0A 1VCNA 4BB0A 1B23P 3IPCA 5CB6A 2WSYB 3WWOA 4QXAA 1Q0HA 2H1IA 1H05A 3VOTA 1ORHA 2O48X 4JKIA 5JU6A 5AJYA 1Q0QA 4E1AA 1QIIA 4U2BA 4MR7B 5EFOA 3DLHA 3RJMA 5DW3A 5GONA 1R3UA 1ZHHA 3DVAB 2CLMB 2W0MA 3GH3A 2XSZD 3AB8A 2VDRB 1FSPA 2CD9A 2WFLB 5BW4A 3UOGA 2X4LA 4NAHA 2ZYWX 4KXXA 3PF9A 4OHMA 2E85A 1L1RA 4M0DA 3EZFA 4PV7A 5ALJA 1P7VA 1MXHA 1ZUD1 4LXGA 2VXYA 2MWMA 1ZW1A 3WR5A 2B25A 1B14A 4W9NA 5DM2A 2B78A 1E9EA 4JELA 3F6CA 4L72A 1KYZA 2ZJ5A 3EWSA 4Q9JA 3R7WB 3JZIA 4YJGA 4HWSA 1HETA 3PR3A 4BQIA 2EZ8A 1E1RD 2DQSA 1U0RA 4WOKA 3T7EA 2NO7A 2GN2A 4F21A 3BTSA 4R1QA 3LZDA 1MW8X 1N78A 3LVBA 1QTNA 2H06A 4MQLA 1H65A 1LJLA 2AW5A 4UULA 5F77A 2Y6VA 2JS7A 5EJGA 3A1UA 5DTRA 5KYYB 1NBMD 3GX1A 2R66A 2Z2KA 3H75A 4TGLA 3U61B 2CD7A 5BN4B 5HQ3A 1KXJA 3CKLA 5HIJA 1AKWA 4AK9A 1POWA 1W9MA 2UYYA 2R85A 3H0CA 3IDFA 3O95A 3U40A 2ID8A 2C2HA 3QENA 4H4EA 1LK5A 4M21A 4D3SA 5ALMA 4HRXA 4I55F 4OLBA 4GZ3A 1MAUA 1HG1A 1LF0A 1N1GA 1E1CB 2P9ZA 2CVQA 2Q3LA 4FBMA 3LS2A 4BLQA 3H2IA 4D4JA 4ZIRA 2IXAA 4LKOA 2Z09A 1NQUA 3PP8A 3PRYA 1ADJA 5AHRA 3ZWNA 3L6UA 4EHJA 5LKRA 4TM8A 2VBCA 1QYWA 2VKQA 3E18A 3N2GB 4Y6GB 5HFNA 2QL5A 1M7GA 1H8EA 3O8BA 1M5UA 4OOEA 1P72A 3D6UA 3ZDZB 3EDYA 2BCGY 3A6FA 4Y98A 3TH5A 4P7JA 3JCZA 4Q1VA 4FGWA 3HKBA 3MA0A 4RMHA 1EAMA 2NUPB 4HNQA 2H17A 2B6NA 1DIOB 2YZMA 4HLCA 4RDIA 3COWA 4DSZA 1JPJA 4S1OA 4LYAA 1XJ0A 5G0TA 4YUXA