3E4GA

Crystal structure of bovine coupling factor b, g28e mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
176
structure length
176
Chain Sequence
SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 68
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3e4gA00
2O6QA 1G9UA 3OJAB 1O6VA 1OGQA 3RW6A 4R0AA 2Z65A 2OMWA 5CMNA 2OMVA 5IYXC 1XECA 5GS2B 1LTXA 3ZYOA 4Y61B 4CC4A 4L3AA 1FT8A 3VQ1A 2WQUA 1XWDC 3TSRE 4R09A 4C2AB 4KT1A 3M19A 4OQTA 3W3GA 4LI2A 5B0NA 1XCDA 4Q3IA 5AWDA 3A79B 5AWBA 1M10B 4CP6A 3BZ5A 2P1QB 4Z94G 3WPBA 3G3AA 1KOOA 3P72A 4G8AA 4Z79A 1OTMA 2JE1A 5B4PA 5LFNA 4K17A 1DCEA 4LSAA 1KOHA 2V9SA 4H09A 5FTTB 4LSXA 4MQWX 4R6JA 4Q62A 2OMZA 3RIZA 3OGLB 4FHOA 4U7LA 4C2BB 3O6NA 5AWCA 4M7EC 2ASSB 2UZYA 4PSJA 1XEUA 4WP6A 4BSUA 1IO0A 2IFGA 2Z7XB 5D3IA 3WN4A 3GOZA 4CNCA 1P9AG 3E4GA 3WPHA 4Z8GA 1XKUA 4U06A 4GLPA 4PEQB 1DS9A 1JL5A 2P1OB 4NKHA 3CIYA 3CVRA 3SB4A 4Z61C 4XSQA 4U09A 3UN9A 4R5DA 5GMFA 3PMHG 4I6JB 4RWTC 2V9TB 4NKGA 1PGVA 1O6SA 3C6OB 4PERA 2WQVA 3RGXA 3WPEA 3RW7A 1H6TA 2FT3A 4CC4C 4QC0A 3RFEA 5B0TA 4ECNA 3ULUA 4BV4R 1K5GC 4AY9X 2P1PB 1W8AA 3RGZA 2V70A 4V2CA 4XGOA 4PKIG 4P8SA 4P91A 4J4LA 3E3ZA 4CNMA 4TZHA 2RA8A 2OMUA 2ASTB 5GMHA 3ULAA 1OZNA 1FQVA 4IM6A 4Q3GA 2JE0A 4V2DA 2XWTC 4R07A 3W3JA 3KJ4A 5GMGA 2WFHA 5A5CA 3WPIA 4U08A 5HZLB 1OOKG 4LSXC 2ELLA 4R5CA 2P1NB 1P8TA 3DZEA 4R6GA 3ZYIA 2Z62A 2Y5QA 3RJ0A 4R58A 3C6NB 5GQRK 1WWLA 1GWBA 1P8VA 3G06A 4FD0A 4LXSA 4LXRA 4M7EA 1M0ZA 3ULVA 2JQDA 3OGMB 3UL9A 3M18A 3RFJA 4CILA 2WQXA 3OJAA 3REZA 3W3NA 3O53A 2Z66A 2Z82A 3G39A 4ARNA 4ECOA 1ZIWA 2Z63A 5AWAA 2OMTA 4YEBB 3VQ2A 3FXIA 1Z7XW 2Q4GW 2OMYA 3E2JA 4LSCA 4L3FA 3WPDA 4KNGA 3OGKB 1OTNA 1OTOA 5IJBA 4FS7A 4QXEA 3G04C 4V2EA 5IJDA 3W3KA 4BSSA 3C6PB 4FDWA 1D0BA 4B8CD 1M9SA 1DFJI 3CIGA 3WPGA 2CA6A 4MN8B 4UFRA 4WYKA 1O6TA 3ZYJA 1QYYA 1M9LA 4J0MA 4BSRA 3UL8A 3RFSA 3G3BA 1FO1A 1SQ0B 2XOTA 1FS2A 4R6AA 2WQWA 4QBZA 2RR6A 1U0ND 4KXFB 3WPCA 1A4YA 4FCGA 4R08A 4GT6A 3UL7A 4XOSA 1K5DC 4R6FA 4Z64C 3ZYNA 2O6SA 3W3LA 5HDHA 2Z81A 2BEXA 2R9UA 2UZXA 4LI1A 1YRGA 2Z64A 2BNHA 1H6UA 4AW4A 3WPFA 1A9NA 4EZGA 5IJCA 3W3MA 2P1MB 2Z7XA 4HQ1A 2ID5A 3E6JA 4ARRA 4PQ8A 5CMPA 2OMXA 5GS0A 4RCWA 2O6RA 4FMZA 4RCAB 5AZ5A 2A0ZA 3JB9j
chains in the Genus database with same CATH superfamily
2O6QA 1G9UA 3OJAB 1O6VA 1OGQA 3RW6A 4R0AA 2Z65A 2OMWA 5CMNA 2OMVA 5IYXC 1XECA 5GS2B 1LTXA 3ZYOA 4Y61B 4CC4A 4L3AA 1FT8A 3VQ1A 2WQUA 1XWDC 3TSRE 4R09A 4C2AB 4KT1A 3M19A 4OQTA 3W3GA 4LI2A 5B0NA 1XCDA 4Q3IA 5AWDA 3A79B 5AWBA 1M10B 4CP6A 3BZ5A 2P1QB 4Z94G 3WPBA 3G3AA 1KOOA 3P72A 4G8AA 4Z79A 1OTMA 2JE1A 5B4PA 5LFNA 4K17A 1DCEA 4LSAA 1KOHA 2V9SA 4H09A 5FTTB 4LSXA 4MQWX 4R6JA 4Q62A 2OMZA 3RIZA 3OGLB 4FHOA 4U7LA 4C2BB 3O6NA 5AWCA 4M7EC 2ASSB 2UZYA 4PSJA 1XEUA 4WP6A 4BSUA 1IO0A 2IFGA 2Z7XB 5D3IA 3WN4A 3GOZA 4CNCA 1P9AG 3E4GA 3WPHA 4Z8GA 1XKUA 4U06A 4GLPA 4PEQB 1DS9A 1JL5A 2P1OB 4NKHA 3CIYA 3CVRA 3SB4A 4Z61C 4XSQA 4U09A 3UN9A 4R5DA 4NZTM 5GMFA 3PMHG 4I6JB 4RWTC 2V9TB 4NKGA 1PGVA 1O6SA 3C6OB 4PERA 2WQVA 3RGXA 3WPEA 3RW7A 1H6TA 2FT3A 4CC4C 4QC0A 3RFEA 5B0TA 4ECNA 3ULUA 4BV4R 1K5GC 4AY9X 2P1PB 1W8AA 3RGZA 2V70A 4V2CA 4XGOA 4PKIG 4P8SA 4P91A 4J4LA 3E3ZA 4CNMA 4TZHA 2RA8A 2OMUA 2ASTB 5GMHA 3ULAA 1OZNA 1FQVA 4IM6A 4Q3GA 2JE0A 4V2DA 2XWTC 4R07A 3W3JA 3KJ4A 5GMGA 2WFHA 5A5CA 3WPIA 4U08A 5HZLB 1OOKG 4LSXC 2ELLA 4R5CA 2P1NB 1P8TA 3DZEA 4R6GA 3ZYIA 2Z62A 2Y5QA 3RJ0A 4R58A 3C6NB 5GQRK 1WWLA 1GWBA 1P8VA 3G06A 4FD0A 4LXSA 4LXRA 4M7EA 1M0ZA 3ULVA 2JQDA 3OGMB 3UL9A 3M18A 3RFJA 4CILA 2WQXA 3OJAA 3REZA 3W3NA 3O53A 2Z66A 2Z82A 3G39A 4ARNA 4ECOA 1ZIWA 2Z63A 5AWAA 2OMTA 4YEBB 3VQ2A 3FXIA 1Z7XW 2Q4GW 2OMYA 3E2JA 4LSCA 4L3FA 3WPDA 4KNGA 3OGKB 1OTNA 1OTOA 5IJBA 4FS7A 4QXEA 3G04C 4V2EA 5IJDA 3W3KA 4BSSA 3C6PB 4FDWA 1D0BA 4B8CD 1M9SA 1DFJI 3CIGA 3WPGA 2CA6A 4MN8B 4UFRA 4WYKA 1O6TA 3ZYJA 1QYYA 1M9LA 4J0MA 4BSRA 3UL8A 3RFSA 3G3BA 1FO1A 1SQ0B 2XOTA 1FS2A 4R6AA 2WQWA 4QBZA 2RR6A 1U0ND 4KXFB 3WPCA 1A4YA 4FCGA 4R08A 4GT6A 3UL7A 4XOSA 1K5DC 4R6FA 4Z64C 3ZYNA 2O6SA 3W3LA 5HDHA 2Z81A 2BEXA 2R9UA 2UZXA 4LI1A 1YRGA 2Z64A 2BNHA 1H6UA 4AW4A 3WPFA 1A9NA 4EZGA 5IJCA 3W3MA 2P1MB 2Z7XA 4HQ1A 2ID5A 3E6JA 4ARRA 4PQ8A 5CMPA 2OMXA 4NZRM 5GS0A 4RCWA 2O6RA 4FMZA 4RCAB 5AZ5A 2A0ZA 3JB9j
chains in the Genus database with same CATH topology
2O6QA 1G9UA 3OJAB 1O6VA 1OGQA 3RW6A 4R0AA 2Z65A 2OMWA 5CMNA 2OMVA 5IYXC 1XECA 5GS2B 1LTXA 3ZYOA 4Y61B 4CC4A 4L3AA 1FT8A 3VQ1A 2WQUA 1XWDC 3TSRE 4R09A 4C2AB 4KT1A 3M19A 4OQTA 3W3GA 4LI2A 5B0NA 1XCDA 4Q3IA 5AWDA 3A79B 5AWBA 1M10B 4CP6A 3BZ5A 2P1QB 4Z94G 3WPBA 3G3AA 1KOOA 3P72A 4G8AA 4Z79A 1OTMA 2JE1A 5B4PA 5LFNA 4K17A 1DCEA 4LSAA 1KOHA 2V9SA 4H09A 5FTTB 4LSXA 4MQWX 4R6JA 4Q62A 2OMZA 3RIZA 3OGLB 4FHOA 4U7LA 4C2BB 3O6NA 5AWCA 4M7EC 2ASSB 2UZYA 4PSJA 1XEUA 4WP6A 4BSUA 1IO0A 2IFGA 2Z7XB 5D3IA 3WN4A 3GOZA 4CNCA 1P9AG 3E4GA 3WPHA 4Z8GA 1XKUA 4U06A 4GLPA 4PEQB 1DS9A 1JL5A 2P1OB 4NKHA 3CIYA 3CVRA 3SB4A 4Z61C 4XSQA 4U09A 3UN9A 4R5DA 5GMFA 3PMHG 4I6JB 4RWTC 2V9TB 4NKGA 1PGVA 1O6SA 3C6OB 4PERA 2WQVA 3RGXA 3WPEA 3RW7A 1H6TA 2FT3A 4CC4C 4QC0A 3RFEA 5B0TA 4ECNA 3ULUA 4BV4R 1K5GC 4AY9X 2P1PB 1W8AA 3RGZA 2V70A 4V2CA 4XGOA 4PKIG 4P8SA 4P91A 4J4LA 3E3ZA 4CNMA 4TZHA 2RA8A 2OMUA 2ASTB 5GMHA 3ULAA 1OZNA 1FQVA 4IM6A 4Q3GA 2JE0A 4V2DA 2XWTC 4R07A 3W3JA 3KJ4A 5GMGA 2WFHA 5A5CA 3WPIA 4U08A 5HZLB 1OOKG 4LSXC 2ELLA 4R5CA 2P1NB 1P8TA 3DZEA 4R6GA 3ZYIA 2Z62A 2Y5QA 3RJ0A 4R58A 3C6NB 5GQRK 1WWLA 1GWBA 1P8VA 3G06A 4FD0A 4LXSA 4LXRA 4M7EA 1M0ZA 3ULVA 2JQDA 3OGMB 3UL9A 3M18A 3RFJA 4CILA 2WQXA 3OJAA 3REZA 3W3NA 3O53A 2Z66A 2Z82A 3G39A 4ARNA 4ECOA 1ZIWA 2Z63A 5AWAA 2OMTA 4YEBB 3VQ2A 3FXIA 1Z7XW 2Q4GW 2OMYA 3E2JA 4LSCA 4L3FA 3WPDA 4KNGA 3OGKB 1OTNA 1OTOA 5IJBA 4FS7A 4QXEA 3G04C 4V2EA 5IJDA 3W3KA 4BSSA 3C6PB 4FDWA 1D0BA 4B8CD 1M9SA 1DFJI 3CIGA 3WPGA 2CA6A 4MN8B 4UFRA 4WYKA 1O6TA 3ZYJA 1QYYA 1M9LA 4J0MA 4BSRA 3UL8A 3RFSA 3G3BA 1FO1A 1SQ0B 2XOTA 1FS2A 4R6AA 2WQWA 4QBZA 2RR6A 1U0ND 4KXFB 3WPCA 1A4YA 4FCGA 4R08A 4GT6A 3UL7A 4XOSA 1K5DC 4R6FA 4Z64C 3ZYNA 2O6SA 3W3LA 5HDHA 2Z81A 2BEXA 2R9UA 2UZXA 4LI1A 1YRGA 2Z64A 2BNHA 1H6UA 4AW4A 3WPFA 1A9NA 4EZGA 5IJCA 3W3MA 2P1MB 2Z7XA 4HQ1A 2ID5A 3E6JA 4ARRA 4PQ8A 5CMPA 2OMXA 5GS0A 4RCWA 2O6RA 4FMZA 4RCAB 5AZ5A 2A0ZA 3JB9j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6Q A;  1G9U A;  3OJA B;  1O6V A;  1OGQ A;  3RW6 A;  4R0A A;  2Z65 A;  2OMW A;  5CMN A;  2OMV A;  5IYX C;  1XEC A;  5GS2 B;  1LTX A;  3ZYO A;  4Y61 B;  4CC4 A;  4L3A A;  1FT8 A;  3VQ1 A;  2WQU A;  1XWD C;  3TSR E;  4R09 A;  4C2A B;  4KT1 A;  3M19 A;  4OQT A;  3W3G A;  4LI2 A;  5B0N A;  1XCD A;  4Q3I A;  5AWD A;  3A79 B;  5AWB A;  1M10 B;  4CP6 A;  3BZ5 A;  2P1Q B;  4Z94 G;  3WPB A;  3G3A A;  1KOO A;  3P72 A;  4G8A A;  4Z79 A;  1OTM A;  2JE1 A;  5B4P A;  5LFN A;  4K17 A;  1DCE A;  4LSA A;  1KOH A;  2V9S A;  4H09 A;  5FTT B;  4LSX A;  4MQW X;  4R6J A;  4Q62 A;  2OMZ A;  3RIZ A;  3OGL B;  4FHO A;  4U7L A;  4C2B B;  3O6N A;  5AWC A;  4M7E C;  2ASS B;  2UZY A;  4PSJ A;  1XEU A;  4WP6 A;  4BSU A;  1IO0 A;  2IFG A;  2Z7X B;  5D3I A;  3WN4 A;  3GOZ A;  4CNC A;  1P9A G;  3E4G A;  3WPH A;  4Z8G A;  1XKU A;  4U06 A;  4GLP A;  4PEQ B;  1DS9 A;  1JL5 A;  2P1O B;  4NKH A;  3CIY A;  3CVR A;  3SB4 A;  4Z61 C;  4XSQ A;  4U09 A;  3UN9 A;  4R5D A;  5GMF A;  3PMH G;  4I6J B;  4RWT C;  2V9T B;  4NKG A;  1PGV A;  1O6S A;  3C6O B;  4PER A;  2WQV A;  3RGX A;  3WPE A;  3RW7 A;  1H6T A;  2FT3 A;  4CC4 C;  4QC0 A;  3RFE A;  5B0T A;  4ECN A;  3ULU A;  4BV4 R;  1K5G C;  4AY9 X;  2P1P B;  1W8A A;  3RGZ A;  2V70 A;  4V2C A;  4XGO A;  4PKI G;  4P8S A;  4P91 A;  4J4L A;  3E3Z A;  4CNM A;  4TZH A;  2RA8 A;  2OMU A;  2AST B;  5GMH A;  3ULA A;  1OZN A;  1FQV A;  4IM6 A;  4Q3G A;  2JE0 A;  4V2D A;  2XWT C;  4R07 A;  3W3J A;  3KJ4 A;  5GMG A;  2WFH A;  5A5C A;  3WPI A;  4U08 A;  5HZL B;  1OOK G;  4LSX C;  2ELL A;  4R5C A;  2P1N B;  1P8T A;  3DZE A;  4R6G A;  3ZYI A;  2Z62 A;  2Y5Q A;  3RJ0 A;  4R58 A;  3C6N B;  5GQR K;  1WWL A;  1GWB A;  1P8V A;  3G06 A;  4FD0 A;  4LXS A;  4LXR A;  4M7E A;  1M0Z A;  3ULV A;  2JQD A;  3OGM B;  3UL9 A;  3M18 A;  3RFJ A;  4CIL A;  2WQX A;  3OJA A;  3REZ A;  3W3N A;  3O53 A;  2Z66 A;  2Z82 A;  3G39 A;  4ARN A;  4ECO A;  1ZIW A;  2Z63 A;  5AWA A;  2OMT A;  4YEB B;  3VQ2 A;  3FXI A;  1Z7X W;  2Q4G W;  2OMY A;  3E2J A;  4LSC A;  4L3F A;  3WPD A;  4KNG A;  3OGK B;  1OTN A;  1OTO A;  5IJB A;  4FS7 A;  4QXE A;  3G04 C;  4V2E A;  5IJD A;  3W3K A;  4BSS A;  3C6P B;  4FDW A;  1D0B A;  4B8C D;  1M9S A;  1DFJ I;  3CIG A;  3WPG A;  2CA6 A;  4MN8 B;  4UFR A;  4WYK A;  1O6T A;  3ZYJ A;  1QYY A;  1M9L A;  4J0M A;  4BSR A;  3UL8 A;  3RFS A;  3G3B A;  1FO1 A;  1SQ0 B;  2XOT A;  1FS2 A;  4R6A A;  2WQW A;  4QBZ A;  2RR6 A;  1U0N D;  4KXF B;  3WPC A;  1A4Y A;  4FCG A;  4R08 A;  4GT6 A;  3UL7 A;  4XOS A;  1K5D C;  4R6F A;  4Z64 C;  3ZYN A;  2O6S A;  3W3L A;  5HDH A;  2Z81 A;  2BEX A;  2R9U A;  2UZX A;  4LI1 A;  1YRG A;  2Z64 A;  2BNH A;  1H6U A;  4AW4 A;  3WPF A;  1A9N A;  4EZG A;  5IJC A;  3W3M A;  2P1M B;  2Z7X A;  4HQ1 A;  2ID5 A;  3E6J A;  4ARR A;  4PQ8 A;  5CMP A;  2OMX A;  5GS0 A;  4RCW A;  2O6R A;  4FMZ A;  4RCA B;  5AZ5 A;  2A0Z A;  3JB9 j; 
#chains in the Genus database with same CATH topology
 2O6Q A;  1G9U A;  3OJA B;  1O6V A;  1OGQ A;  3RW6 A;  4R0A A;  2Z65 A;  2OMW A;  5CMN A;  2OMV A;  5IYX C;  1XEC A;  5GS2 B;  1LTX A;  3ZYO A;  4Y61 B;  4CC4 A;  4L3A A;  1FT8 A;  3VQ1 A;  2WQU A;  1XWD C;  3TSR E;  4R09 A;  4C2A B;  4KT1 A;  3M19 A;  4OQT A;  3W3G A;  4LI2 A;  5B0N A;  1XCD A;  4Q3I A;  5AWD A;  3A79 B;  5AWB A;  1M10 B;  4CP6 A;  3BZ5 A;  2P1Q B;  4Z94 G;  3WPB A;  3G3A A;  1KOO A;  3P72 A;  4G8A A;  4Z79 A;  1OTM A;  2JE1 A;  5B4P A;  5LFN A;  4K17 A;  1DCE A;  4LSA A;  1KOH A;  2V9S A;  4H09 A;  5FTT B;  4LSX A;  4MQW X;  4R6J A;  4Q62 A;  2OMZ A;  3RIZ A;  3OGL B;  4FHO A;  4U7L A;  4C2B B;  3O6N A;  5AWC A;  4M7E C;  2ASS B;  2UZY A;  4PSJ A;  1XEU A;  4WP6 A;  4BSU A;  1IO0 A;  2IFG A;  2Z7X B;  5D3I A;  3WN4 A;  3GOZ A;  4CNC A;  1P9A G;  3E4G A;  3WPH A;  4Z8G A;  1XKU A;  4U06 A;  4GLP A;  4PEQ B;  1DS9 A;  1JL5 A;  2P1O B;  4NKH A;  3CIY A;  3CVR A;  3SB4 A;  4Z61 C;  4XSQ A;  4U09 A;  3UN9 A;  4R5D A;  4NZT M;  5GMF A;  3PMH G;  4I6J B;  4RWT C;  2V9T B;  4NKG A;  1PGV A;  1O6S A;  3C6O B;  4PER A;  2WQV A;  3RGX A;  3WPE A;  3RW7 A;  1H6T A;  2FT3 A;  4CC4 C;  4QC0 A;  3RFE A;  5B0T A;  4ECN A;  3ULU A;  4BV4 R;  1K5G C;  4AY9 X;  2P1P B;  1W8A A;  3RGZ A;  2V70 A;  4V2C A;  4XGO A;  4PKI G;  4P8S A;  4P91 A;  4J4L A;  3E3Z A;  4CNM A;  4TZH A;  2RA8 A;  2OMU A;  2AST B;  5GMH A;  3ULA A;  1OZN A;  1FQV A;  4IM6 A;  4Q3G A;  2JE0 A;  4V2D A;  2XWT C;  4R07 A;  3W3J A;  3KJ4 A;  5GMG A;  2WFH A;  5A5C A;  3WPI A;  4U08 A;  5HZL B;  1OOK G;  4LSX C;  2ELL A;  4R5C A;  2P1N B;  1P8T A;  3DZE A;  4R6G A;  3ZYI A;  2Z62 A;  2Y5Q A;  3RJ0 A;  4R58 A;  3C6N B;  5GQR K;  1WWL A;  1GWB A;  1P8V A;  3G06 A;  4FD0 A;  4LXS A;  4LXR A;  4M7E A;  1M0Z A;  3ULV A;  2JQD A;  3OGM B;  3UL9 A;  3M18 A;  3RFJ A;  4CIL A;  2WQX A;  3OJA A;  3REZ A;  3W3N A;  3O53 A;  2Z66 A;  2Z82 A;  3G39 A;  4ARN A;  4ECO A;  1ZIW A;  2Z63 A;  5AWA A;  2OMT A;  4YEB B;  3VQ2 A;  3FXI A;  1Z7X W;  2Q4G W;  2OMY A;  3E2J A;  4LSC A;  4L3F A;  3WPD A;  4KNG A;  3OGK B;  1OTN A;  1OTO A;  5IJB A;  4FS7 A;  4QXE A;  3G04 C;  4V2E A;  5IJD A;  3W3K A;  4BSS A;  3C6P B;  4FDW A;  1D0B A;  4B8C D;  1M9S A;  1DFJ I;  3CIG A;  3WPG A;  2CA6 A;  4MN8 B;  4UFR A;  4WYK A;  1O6T A;  3ZYJ A;  1QYY A;  1M9L A;  4J0M A;  4BSR A;  3UL8 A;  3RFS A;  3G3B A;  1FO1 A;  1SQ0 B;  2XOT A;  1FS2 A;  4R6A A;  2WQW A;  4QBZ A;  2RR6 A;  1U0N D;  4KXF B;  3WPC A;  1A4Y A;  4FCG A;  4R08 A;  4GT6 A;  3UL7 A;  4XOS A;  1K5D C;  4R6F A;  4Z64 C;  3ZYN A;  2O6S A;  3W3L A;  5HDH A;  2Z81 A;  2BEX A;  2R9U A;  2UZX A;  4LI1 A;  1YRG A;  2Z64 A;  2BNH A;  1H6U A;  4AW4 A;  3WPF A;  1A9N A;  4EZG A;  5IJC A;  3W3M A;  2P1M B;  2Z7X A;  4HQ1 A;  2ID5 A;  3E6J A;  4ARR A;  4PQ8 A;  5CMP A;  2OMX A;  4NZR M;  5GS0 A;  4RCW A;  2O6R A;  4FMZ A;  4RCA B;  5AZ5 A;  2A0Z A;  3JB9 j; 
#chains in the Genus database with same CATH homology
 2O6Q A;  1G9U A;  3OJA B;  1O6V A;  1OGQ A;  3RW6 A;  4R0A A;  2Z65 A;  2OMW A;  5CMN A;  2OMV A;  5IYX C;  1XEC A;  5GS2 B;  1LTX A;  3ZYO A;  4Y61 B;  4CC4 A;  4L3A A;  1FT8 A;  3VQ1 A;  2WQU A;  1XWD C;  3TSR E;  4R09 A;  4C2A B;  4KT1 A;  3M19 A;  4OQT A;  3W3G A;  4LI2 A;  5B0N A;  1XCD A;  4Q3I A;  5AWD A;  3A79 B;  5AWB A;  1M10 B;  4CP6 A;  3BZ5 A;  2P1Q B;  4Z94 G;  3WPB A;  3G3A A;  1KOO A;  3P72 A;  4G8A A;  4Z79 A;  1OTM A;  2JE1 A;  5B4P A;  5LFN A;  4K17 A;  1DCE A;  4LSA A;  1KOH A;  2V9S A;  4H09 A;  5FTT B;  4LSX A;  4MQW X;  4R6J A;  4Q62 A;  2OMZ A;  3RIZ A;  3OGL B;  4FHO A;  4U7L A;  4C2B B;  3O6N A;  5AWC A;  4M7E C;  2ASS B;  2UZY A;  4PSJ A;  1XEU A;  4WP6 A;  4BSU A;  1IO0 A;  2IFG A;  2Z7X B;  5D3I A;  3WN4 A;  3GOZ A;  4CNC A;  1P9A G;  3E4G A;  3WPH A;  4Z8G A;  1XKU A;  4U06 A;  4GLP A;  4PEQ B;  1DS9 A;  1JL5 A;  2P1O B;  4NKH A;  3CIY A;  3CVR A;  3SB4 A;  4Z61 C;  4XSQ A;  4U09 A;  3UN9 A;  4R5D A;  5GMF A;  3PMH G;  4I6J B;  4RWT C;  2V9T B;  4NKG A;  1PGV A;  1O6S A;  3C6O B;  4PER A;  2WQV A;  3RGX A;  3WPE A;  3RW7 A;  1H6T A;  2FT3 A;  4CC4 C;  4QC0 A;  3RFE A;  5B0T A;  4ECN A;  3ULU A;  4BV4 R;  1K5G C;  4AY9 X;  2P1P B;  1W8A A;  3RGZ A;  2V70 A;  4V2C A;  4XGO A;  4PKI G;  4P8S A;  4P91 A;  4J4L A;  3E3Z A;  4CNM A;  4TZH A;  2RA8 A;  2OMU A;  2AST B;  5GMH A;  3ULA A;  1OZN A;  1FQV A;  4IM6 A;  4Q3G A;  2JE0 A;  4V2D A;  2XWT C;  4R07 A;  3W3J A;  3KJ4 A;  5GMG A;  2WFH A;  5A5C A;  3WPI A;  4U08 A;  5HZL B;  1OOK G;  4LSX C;  2ELL A;  4R5C A;  2P1N B;  1P8T A;  3DZE A;  4R6G A;  3ZYI A;  2Z62 A;  2Y5Q A;  3RJ0 A;  4R58 A;  3C6N B;  5GQR K;  1WWL A;  1GWB A;  1P8V A;  3G06 A;  4FD0 A;  4LXS A;  4LXR A;  4M7E A;  1M0Z A;  3ULV A;  2JQD A;  3OGM B;  3UL9 A;  3M18 A;  3RFJ A;  4CIL A;  2WQX A;  3OJA A;  3REZ A;  3W3N A;  3O53 A;  2Z66 A;  2Z82 A;  3G39 A;  4ARN A;  4ECO A;  1ZIW A;  2Z63 A;  5AWA A;  2OMT A;  4YEB B;  3VQ2 A;  3FXI A;  1Z7X W;  2Q4G W;  2OMY A;  3E2J A;  4LSC A;  4L3F A;  3WPD A;  4KNG A;  3OGK B;  1OTN A;  1OTO A;  5IJB A;  4FS7 A;  4QXE A;  3G04 C;  4V2E A;  5IJD A;  3W3K A;  4BSS A;  3C6P B;  4FDW A;  1D0B A;  4B8C D;  1M9S A;  1DFJ I;  3CIG A;  3WPG A;  2CA6 A;  4MN8 B;  4UFR A;  4WYK A;  1O6T A;  3ZYJ A;  1QYY A;  1M9L A;  4J0M A;  4BSR A;  3UL8 A;  3RFS A;  3G3B A;  1FO1 A;  1SQ0 B;  2XOT A;  1FS2 A;  4R6A A;  2WQW A;  4QBZ A;  2RR6 A;  1U0N D;  4KXF B;  3WPC A;  1A4Y A;  4FCG A;  4R08 A;  4GT6 A;  3UL7 A;  4XOS A;  1K5D C;  4R6F A;  4Z64 C;  3ZYN A;  2O6S A;  3W3L A;  5HDH A;  2Z81 A;  2BEX A;  2R9U A;  2UZX A;  4LI1 A;  1YRG A;  2Z64 A;  2BNH A;  1H6U A;  4AW4 A;  3WPF A;  1A9N A;  4EZG A;  5IJC A;  3W3M A;  2P1M B;  2Z7X A;  4HQ1 A;  2ID5 A;  3E6J A;  4ARR A;  4PQ8 A;  5CMP A;  2OMX A;  5GS0 A;  4RCW A;  2O6R A;  4FMZ A;  4RCA B;  5AZ5 A;  2A0Z A;  3JB9 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...