3E56A

The 2.0 angstrom resolution crystal structure of npr1517, a putative heterocyst differentiation inhibitor from nostoc punctiforme
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
b'LEVGVYECEIHLKFRLIEEKSLLSDREQLLQVLLDALTEGSDDFLETLQASVKAQEVSEFKASPQMRRQLMRLRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of Npun_R1517, a putative negative regulator of heterocyst differentiation from Nostoc punctiforme PCC 73102.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18068 Npun_R1517 Npun R1517
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.450 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3e56A00
3E56A
chains in the Genus database with same CATH superfamily
2RMMA 2D3AA 2X38A 4A3OA 3VH4B 3ZNZB 2HJ1A 3H1UA 3ZNHB 3NHEB 1JMLA 1C77A 2KN5A 3HM6X 2K9XA 1I7HA 3L13A 1V1OA 2N9KA 2J52A 1WSPA 4NNJB 4NQKE 1JWUD 4UDUC 2WYQA 3HVZA 3GS2A 1D6EC 1C1YB 2NPTB 4KZ0A 2XN9C 4HROA 1V97A 1B9RA 2V4IB 2JU6X 3NJTA 4W9KA 2JXTA 4DWFA 5IO9A 1QOFA 1N60A 1TKGA 2AQ1B 4ZRQA 3CMMB 1PYWD 2DX5B 4MGKE 1JCKB 1WFYA 4E71A 1DOXA 2ACZB 2EELA 3UQAA 2LRWA 1ZKHA 4CQNA 4WAFA 1WGKA 4N58A 3DOWA 1HEZE 4WWPA 2K6DB 4PS8A 5CHVC 2M8SA 2D2QA 4W9EA 1KJTA 3DVNV 1EF1A 1I4QA 1N6ZA 1GB1A 3I5JC 3TUOA 3GOEA 2LRUA 1WMHB 1QILA 4C80A 4URKA 2JVCA 2KT7A 4CO7A 1CQVA 1WJ6A 1DGJA 1H4RA 2RPQA 2MBOA 4BBNF 4HJGE 1V5OA 1SBBB 4FULA 1T0RC 2ZNVC 4KX6B 2C7MB 3DBSA 3UIPB 3V05A 1FPYA 3AH7A 5IOIA 1MHHE 2LZ6A 2NTSA 2DAJA 5H92C 4BAXA 1K52A 4YSYB 4XWWA 1T5XD 4R3DA 2LWPA 3ZJVA 2AYOB 1Q10A 4LNOA 4DHJB 4JL9A 2LVQA 2J0MA 4LK0M 1FMAD 2KWVB 4YSXB 4HDOA 4GDKA 3ZQ4A 2KJ6A 5GXGB 2FBWB 2LXCA 2PW9A 3H7PB 3ZTDA 4BBNC 3LDZE 4C4VB 4RGOS 2ZNVB 3P4QB 2DBYA 5EE9A 3DBRI 1BUIC 1YMHE 2SEBD 1Q5WB 4IM3A 2D5GA 1F9JA 5AZFA 4WAAA 4AOFA 1V86A 5T8IA 4NPNA 2FAZA 4BOSC 3DBLI 2MWSB 2N9LA 4RH6A 3Q8FA 4W9IA 1AYFA 1NDDA 2VRRB 3KUZA 2BVCA 4NJCA 4GGQA 2N9XA 1IP9A 3NZ3A 3QA8A 3AMZA 2OJRA 2K8HA 4HPMB 4JWSC 2KDFB 1J7CA 5EE0A 4AWJA 2WGSA 2ICIA 2G45B 2W54A 3T9LA 4RGNA 3AE5B 1XLQA 4D2KA 2AEHA 2NBWB 4WH4A 4LJPB 2O2VB 3HIZA 4ITKA 1FNWA 2A4ZA 5HI1A 1M4VA 2NPTA 1JWBD 1BXTA 5AZGA 4YTMB 1WJ4A 3KYCD 3PV1A 1CZPA 5JH5C 2KC2A 3BVGA 2WXFA 2MP2B 4DHZB 3FAHA 3PHXB 4XGAB 3KUCB 1WX9A 4NQLB 3NZSA 3P4SB 5AEKB 1R4NB 2DYOA 3U7ZA 3VRAB 2M56B 1WGGA 2PMVA 5HG2A 2V3NA 1TS3A 4WJQA 1PUTA 4LNKA 3VQIA 5DPSA 3RI7C 3HM3A 2BT6A 1KM7A 2XEWA 1NENB 4I6LB 3Q3NC 1NYQA 2TSSA 2AL6A 2KQ4X 4GB9A 3A4SC 4ZHPA 2MCNB 3PLUA 3SFDB 2R2OA 4OZAA 1SE2A 4I6NB 4LNNA 4ICVA 5E6NA 4J6IA 1JW9D 3K9PB 2BGFA 3NG0A 2BYEA 2KYWA 4K7WA 3ZRFA 2PKOA 4WWOA 2JT4B 3SD5A 4C00A 1GJZA 3WAPA 4GDLB 3ZJUA 4ZRIA 4XWTA 4F7ZA 1C3TA 2BS3B 2FE8A 2PLPA 3RCZA 4KSKC 4FA6A 2N9EB 1EO6A 1SE9A 1UBQA 3GP7A 3RN9C 2IO1B 3VH3B 4P6VF 1C78A 4YTPB 2ASQA 1VCBA 1WY8A 2MA9B 2ON8A 3MC8A 4NAMA 1WXSA 2C7HA 1KRHA 3HVDA 3AXCA 1WR1A 1HA5A 2LGSA 4GU2A 2KO3A 1QT9A 3BZDB 3RNEC 1YJ1A 4GOCA 2D11A 4MJSA 4HLEA 3HHMA 1J0GA 3W1SA 4GLSC 3ZTCA 5DPWA 3BVMA 3E9SA 3ZW3A 2Y5CA 3IVFA 1FFVA 3PRZA 3KW5B 2KMCA 4WQMA 1HZ5A 3ML9A 1SSNA 2N1VA 2KANA 4N9F4 2WDQB 4IW0A 2ZVNA 5LXHA 4OZCA 4DDID 4XDDA 2VH1A 1N5XA 1PFDA 3DHGC 1T6BX 3RT3B 4K7UA 2L3ZA 2E3TA 3N1XC 2KLCA 1TTNA 1EUVB 1L7YA 2MP2A 1WM3A 2MW5A 3Q8BA 2KLGA 1YQBA 4KGTA 3SEBA 3ENEA 3VUYA 1D5XC 1RLFA 2GLSA 2NR2A 2KFKB 2RR9A 3IXSA 2O6VA 1XEEA 2DZMA 2KKCA 3TCAA 2BS2B 4OW0A 2CU3A 2PTLA 2WWZA 2JRHA 1JRUA 4AP4C 1YX5B 2L52A 1WXQA 2QHOA 3VR8B 1RFKA 4FN2A 1JRPA 1PQSA 1P98A 1U4AA 1C9FA 1KH0A 2DZJA 2G1EA 1FM0D 5BMHA 2JUOA 1WWTA 1UNSA 3RNGC 3CIRB 1HE8A 3N1YC 4MELA 3AEEB 3J9CA 2ZPNA 1ZP0B 3JW0X 2MQJA 1V2YA 2AL3A 2D3GA 3I3TB 2FCQA 3U4EG 2YEPF 3PZ8A 4P1CC 1EU4A 2GRIA 2JF5A 4ASWC 2VZKD 1IUEA 1I4HA 4LTUA 1I4PA 3N20C 2WLBA 1L5PA 4USAA 1ZXIA 1WZ3A 1TS2A 1NI3A 4KDIC 1R4NI 1FIQA 4EZJA 3QIJA 4FXCA 4HK2A 1E7UA 4E74A 1K50A 2JWUA 3AULA 2KJHB 3L4PA 2L0FA 5CHWA 4G0NB 1RM6C 2KFJA 3B0AA 5TR5A 3P2BA 3TEYA 3UIOB 2L05A 5BYRA 3AE8B 1RYJA 1V1PB 2WU2B 1YJJA 2LVPA 2FUG1 1J19A 4XDCA 1V8CA 1VZ8A 1YN4A 3TSSA 1WXAA 4KIKB 2LMCA 1D5MC 1QOBA 4LCDE 3RUIB 4HJKA 2IO3B 1WF9A 1OFFA 2IZVB 2ZW0A 1K8RB 4KGSA 3TIXA 2MSED 1QQRA 4RFBA 3Q3MC 3H9DA 1X1MA 1S3SG 2WX1A 2JX5A 1MFWA 1H8CA 4DBGA 2FCNA 2M1MA 4KV2A 4EZKA 2KVZA 4YL8A 2W82A 4M01A 1TZ1A 1TJEA 2EMSA 1FO4A 2YEPB 4EFOA 2H89B 3BINA 3VXWA 1LO5D 4JE3B 3W5UB 2ZEQA 3KLSX 1D5ZC 2WNMA 1JALA 2M19A 3SDLC 2G3QB 2Y3AA 1F2RI 2KAJA 4IOIE 2GBNA 3A4RA 2LGIA 4WJOA 1AW7A 3W2DA 1E8YA 2MJDA 1WH3A 2WHIA 3ZDTA 2INDC 4ARIA 4HXDA 3AN1A 1WXVA 2WXRA 2GBRA 1S1QB 2KTFA 3MP9A 2Z0DB 4S17A 3RMKC 1JWSD 1SJED 3IT6B 4ICUA 2GBMA 4KKJA 3KYDD 1J7AA 2UYZB 4NY0A 5D3IB 3DDCB 2L8JA 1JWMD 3L08A 2UU7A 4ACFA 1E6EB 1OQRA 3U8ZA 3SR6A 5C23A 4M0WB 2X8XX 1C4AA 1PGAA 3DBHB 1XLOA 1Y56A 1YIWA 4RNAA 4YXDB 4PS3A 4QAYA 1UUPA 3BIID 1HTOA 5L83A 3LJ3A 2WDRB 4IWPA 1QOGA 2XK5B 3EA6A 4W9DA 2LHEA 3U7DA 2W55A 4ZDVA 1EWYC 1UGJA 2PVOD 5I4DA 3GE8C 2KD0A 3T3NA 4NAWB 4GXBA 2HTHA 3ZO5B 1ZE3D 3C19A 4XC2A 3ECIA 5DPRA 1GOZA 4MGZE 1TKYA 2GBKA 1K53A 2BKFA 4LDTD 4KSLC 4M8NA 1N5WA 4A8XC 5H8YE 1WYWB 2MBBB 3APFA 3NVYA 1L2NA 1VDVA 1XT9B 2AWTA 4A9AA 4OVVA 2L1AA 3U30A 5E6PA 4MSMB 3V61A 1XLNA 2OHFA 2BTEA 2Z59B 1LFDA 1XXGA 1PDXA 1F0ZA 1V5TA 3A9KB 4A6QA 4MGIE 2HD5B 3PTFC 1FEHA 2N1WA 4IUMB 2KZRA 3EFCA 2HDEA 3LYYA 3HRDD 5BYSA 3AE7B 4ZRKA 2KNBA 3O13A 3WAMA 2QSDA 3IBEA 1WIAA 3R7QA 1CJEA 4B0EA 4G11A 5L95C 1WZ0A 2I38A 4IWOA 2M0AA 3V62A 2EMTA 2NTTA 1F1HA 3VR9B 4HWIB 2HE7A 1Y8RC 1AWDA 1FXTB 2R61A 3ONSA 4IWQA 1I35A 3ML8A 3VDZA 3JSVB 4M8MA 5EDSA 1TS5A 4ANUA 3PO0A 4TUUA 3VRBB 4WWNA 4W9CA 3A9JA 2KTRB 2RSUA 5EE1A 5G55A 1KOTA 1FXAA 3GZNB 1CMXB 2INPE 2I1KA 4FBJB 4ZYSA 2OJWA 2RGFA 4GIVA 3IG3A 1WGHA 1UF0A 2CKHB 3SFEB 4KZCA 1EM7A 3H7SA 2DENB 1B1ZA 4B0MA 3FILB 3SU8X 2DHZA 2IY1B 3S2AA 3RFZB 2LUMA 4DXAB 2EKIA 2AX5A 1QZEA 3AE2B 2LEKA 5LLIA 1TY2A 1MG8A 3APCA 2IO0B 3RYTA 4ZHOA 1P7FA 1FD6A 1T3QA 4NJ6A 5JHAA 4C56C 3MC9A 1E90A 3P42A 1KF6B 2Z0EB 1UGMA 4L2YA 2L83A 1Q0WB 2XK5A 1TS4A 3PLVA 2IGDA 4ZRPA 4EEWA 3A33B 2KDEB 4F8CB 2WXOA 3P63A 4CYEA 1E7PB 2BB6A 2GI9A 1BT0A 3WALA 1DOYA 3R66C 1STEA 3KH0A 1WMHA 3NS1A 3X23A 4NAWA 1F52A 2JYEA 2L7RA 5AZHA 4C7ZA 2BPSA 2JPHA 4BKGA 4PS7A 1RAXA 3BK2A 3CSTA 1WGYA 2SAKA 3QHTA 2W3RA 2IDYA 2NCNA 4RM9A 5JXVA 1GAQB 3HUIA 4K3BA 5BMIA 5G2NA 2MBEA 3TEWA 3NOBA 1T0SC 1A70A 3AEFB 3PS6A 1FNUA 1FCCC 1FXIA 2BBCA 2LJ5A 4BKSA 1FFUA 1E0ZA 3AEBB 2LI5A 4MEMA 2J4XA 3DWMA 4KKIA 3PGEA 2FUHB 1I4GA 1V6EA 3DBHI 4HCPB 2IJ0A 2Y5BB 3M63B 3X0WA 2WXIA 1XCQL 2WXMA 4M02A 1SEBD 2KX3A 4II2B 3AI5A 3PRPB 3L17A 4B6WA 3QARA 3Q69A 3H7PA 3UF8A 1Z5SB 1IBXB 3IFWB 4MH0E 5FKAC 3LXFA 2KC1A 1SIJA 4C4VA 2PVGC 1UD7A 1IPGA 1KTKA 2V0GA 1Q1OA 4K81A 3NVZA 1RRBA 2LGXA 2DYBA 3Q8CA 1A5RA 1NVID 2BWFA 1WJNA 1Z2MA 3CSFA 3DVGX 3IHPC 3L10B 1VR9A 4LLGM 2WXNA 4REZA 2ONQA 2V1YA 4FJYA 2MRPA 4LJOB 3TMPB 2G4DB 2JQRB 3O65B 3VTUA 3K9OB 4P16A 3D32A 1MG4A 3FILA 2IY0B 4ANVA 3ZKJC 1AARA 2O2VA 3RZWC 4YSZB 1L0XB 3ETRA 2A5UA 3B2FA 1YQ3B 1ZDXA 3PZDA 3T3OA 2RPVA 4HCNB 3BYTB 2HJ8A 4A20A 4MM3B 4TQ1A 4NZLB 3BVZA 3EECA 3I9V1 3WANA 1VZ6A 2FCSA 4MSQB 2D3BA 1RWSA 2IGGA 1GPXA 1R4MB 3MTNB 4G3XB 3SHQA 1WJUA 3GZNI 3QAQA 1BMLC 1TBEA 2LGDA 5FK9C 1DYQA 2VH2A 1QKZA 3UINB 2D07B 3L0WB 3N3KB 2GBJA 4AJWA 3WAOA 4FADA 2YLMA 4AJYB 3P4RB 4LNIA 5D6JB 3ZYYX 4LNFA 2FNJB 2LVOA 1ZOYB 3T8MA 4BOZB 3QC8B 3VTWA 5J18A 1J8CA 1E8XA 5LXIB 2MBHA 5JZEB 3R3MA 4GDLA 2LUEA 4W9JA 3CWIA 2N4FA 3EUB2 1SF0A 2CHXA 2CS4A 3PT2B 3ZDMC 1QLBB 4N59A 2KJRA 3FC4A 4CHKA 5LNK1 3VTVA 3AECB 2DZIA 3A1QB 2JY6A 2NBUA 2NMQA 2WP9B 3U2SC 2C9WB 3MJWA 4HEA1 4BFRA 3JYUA 2FIDA 1L6VA 1MI0A 1SXTA 4FJZA 4IKGA 3UGBB 2K8CA 5C2TB 4RF0A 4JGHB 2IPKD 3AE1B 1WR6E 2GB1A 2K25A 3I57A 2DNFA 2D3CA 2KX0A 2DWQA 3L54A 3QCAA 1L4ZB 5IP4D 3MHSD 4ANXA 3W5VB 2KMAA 3AM9A 4K7SA 1NI2A 3ZRCA 2QILA 3VUWA 3OG5A 1VLBA 2MLBA 4II3B 1KLGD 4BZAA 5AUIA 1FCLA 3Q8AA 2WXJA 2LD9A 1XD3B 4EKUA 4DDGD 1ET6A 4MM3A 1WRIA 4US9A 2V9HA 1I42A 2N7JA 3GB1A 2KDIA 2V3PA 4MDKE 2CU1A 3BWUD 1ZDVA 2KFKA 2YVCA 3VAWA 1V80A 1FRDA 2INCC 3U52E 2W3SA 2K3UA 3MC0B 3JVZX 2KVRA 2CHZA 4KDLB 1SE3A 2ZZPB 4E3CA 2FCMA 2L76A 3B9JA 5GMVA 2QIEB 1TIFA 4GMVA 5G5GA 4DXFA 4TQ0A 2PE9A 1ET9A 1SE4A 2GOWA 2O6VD 1NYRA 2I1JA 3QJZA 3AE9B 1UZXB 3N1ZC 1OTRB 2M17A 5DPTA 3NY5A 4S0RA 2WU5B 2QDFA 3RNCC 4A55A 4EUTA 5DCNA 1WXMA 1HTQA 2QMTA 1XF5L 3RPFC 2L32A 2K6QA 4P1BC 3Q6BA 3PVLA 1OGWA 2WXHA 2K39A 3RNBC 2N9PC 2J0JA 3KWLA 2LGYA 1R4MI 3HK0A 1NEKB 1T0QC 1TGZB 2BKRB 3AE4B 2J53A 2NVUI 5D94A 2L0TA 3H6NA 3Q2AC 1G6JA 3AE6B 3AE3B 3WIMA 3ALBA 1XLPA 2REXA 2BYVE 2J7QB 1V1PA 2N7EA 1L6UA 4K1RB 3Q3OC 1ROEA 1YN3A 3A1QA 2VZKB 3TEXA 2N7DA 4H2AA 3UQBA 1ACCA 2LHDA 2QEJC 2V3SA 3R2TA 3WA0A 2WXQA 4KIKA 2JWZA 2KDMA 2PIAA 4ZOHC 2LXAA 2MJ3A 1K51A 4IM2A 2AQ2B 1E9MA 4US8A 3BY4B 4XYCA 3M62B 2ZJDA 2B76B 3OJ4B 3V6EB 1E8WA 2BYFA 3Q8EA 3Q14C 1KFYB 1PGBA 4XX5A 3N9YC 4WIPA 2K8BA 5FR6A 1L0YB 4JQWC 3E56A 2DLBA 5KHQA 1LGRA 3W1SC 4IDIA 2QC8A 3M3JA 3RNFC 2B3AA 3AEGB 3PRMB 1JROA 1N62A 1FNVA 4KGRA 1AN8A 5IKCM 1ZUD2 2WX0A 1ISNA 1JWAD 1MVKA 2RDHA 3DHHC 1C4CA 4TMAB 2ZCBA 2M4NA 4IG7B 1XCTL 5D2MB 1D3ZA 4RMAA 4PT5A 2N0SB 2ZVOA 2BYTA 2MHJA 2GMIC 1MHXA 4MJSB 1NBFC 1E5WA 3L16A 5JHBA 4A3PA 2IYDB 4DQOC 2BQQA 2KN4A 3IT4B 1JQ4A 4DK5A 1L4DB 2KDBA 3Q3FA 2KWCA 4ZYNA 4TV3A 4RM8A 5J2RA 2CHWA 3R2IA 1TY0A 3OAWA 2MBQA 5KHOA 1F77A 2CJNA 3M95A 4W9HA 1UWXA 5AUKA 3VFKA 1L0VB 1C4PA 1PGXA 3KWVA 5TSSA 4M0WA 1TZOA 4KVGB 4IM0A 1M94A 1YNTE 2RD0A 3GE3C 4JPSA 1GB4A 3KUDB 2E6XA 3ZNID 4XZ4A 2BB5A 1R7SA 3C8YA 5EE3A 2J0KA 2K1FA 4C7YA 3ZIMA 3ZGZA 3BYYB 2KHWB 3R8BA 4ZRJA 2IGHA 3NZUA 3OLMD 4WWMA 4EE2A 1HQRD 4AUQC 1C79A 2BWES 2KK8A 5BMGA 1D4BA 2AQ3B 2JZ3B 4NJ7A 3ZLZA 2O6VB 2IBIB 4JWUC 3B08A 2KOXA 1ZXHA 2ZPYA 2JXXA 2G9HD 2IO2B 4FHKA 4K3CA 3UI3A 2KQSA 1WX8A 3WCQA 2OEDA 5HKHA 5IN7A 3IAM1 4MGYE 3P1MA 2JZZA 1GC6A 2BW2A 4L23A 4O1NA 2Q5WD 3AU5A 4RCOA 4X57B 4YTNB 2Y5PA 4HKQA 2NS5A 1ZW7A 1IYFA 1E7VA 4JLCA 4BKTA 2ZCCA 4OHJA 4Q2JA 2LJIA 3EC8A 2WQYB 3A9KA 3MJ5A 4WURA 5CTRC 3KQ4A 3ZVVA 1F2RC 5D3DA 1QOAA 4GN1A 3OJ3A 1V49A 2BF8B 1LM8B 4LDTB 3CF6E 4TSSA 1GC7A 2ZW1A 1UH6A 3V6CB 3ABVB 3DCGA 1GNUA 4AS1A 2JSVX 4YWGG 1ZPSA 4OZBA 4OVZA 1DOIA 3H8HA 3V60A 4N6EB 2NBVB 1E8ZA 2PPHA 4HKZE 1LXDA 1XQQA 2MX2A 4BVUC 2QCZA 3JSVA 2XBBC 3R7RA 3FKYA 4RGMA 3ZUNA 3QK0A 1HXYD 2PEAA 2R2QA 3KVFB 1WX7A 2KTRA 5HHDG 3C0RB 3MHZA 2CR5A 3P4PB 2WXPA 3TJPA 1TT5B 2G4SA 1GG3A 1YJIA 4WJNA 4G50A 2K22A 4MACA 1N63A 1UBIA 2JYTA 3W9CB 2L00B 1I4RA 1P1AA 3QQ8B 1YQ4B 3LB8C 1VZ7A 1EU3A 2EKEC 5E6OA 3VVWB 4F1SA 4B9KA 4WQOB 1SGHA 1N61A 1OQQA 2C7NB 1QF6A 1IGDA 3PSEB 3URYA 3ZNGC 2I2YA 3EFUA 1WYGA 2JZPA 3OWEB 1WE7A 3RZFA 4ANWA 4L1BA 3AB5A 3AV8A 1SB3C 3DVGY 3QX1A 1XO3A 3BK1A 2M0XA 4RF1A 2K5PA 3RNAC 4AQ7A 4OVUA 4HVBA 4YT0B 1EF5A 1P3QU 1HZ6A 3QWZB 3I63C 2MH7A 3EGRA 4B95A 1RFAA 2DAFA 2KWUB 5HFYA 1P0RA 5IA7A 1YD8U 2UWQA 4M00A 1MPEA 1YN5A 2WXKA 3V3XA 3ZXVA 3NVWA 2K0PA 1WI0A 3N32A 1J7BA 2INNE 1WGDA 2KWDA 1IGCA 1VD2A 2DYMA 5E6JA 3N30A 1I4XA 4W9GA 5C1ZA 4FJVB 2CJOA 4J3OD 2MEKA 2WXGA 4GSWA 2RDGA 4MH8A 1WGRA 3NRZA 3Q3JA 3DVNU 2D10A 3VHTC 2PJHA 1E10A 1ESFA 1VJKA 3DPDA 3PPAA 3NUHB 3APDA 5G5HA 3NVVA 2C5LC 1TKEA 1IBXA 3IAS1 1FRRA 4BKSD 5MPOA 3TEZA 4PYUA 5IAAC 4WJPA 2WXLA 5FR3A 3PREA 1P9DU 1T0YA 2KMMA 1SJHD 4W9FA 1YOVB 4HPLB 3DBRB 4DHJD 3DWGC 3RULA 4PK1A 1EWCA 2KACA 1CK1A 1P7EA 1GUAB 3PZ7A 4FLHA 5CX3A 3DBLB 1UELA 4DXGA 4XE0A 3NS8A 1C76A 2RDBC 2WS3B 4EZLA 1YX6B 1WM2A 2H88B 5C3JB 2W9NA 3ZXRA 4ARCA 1SIFA 4PYZA 3DHIC 3AEAB 2Z8LA 2QJLA 4JX1C 4TKNA 2LASA 1OEYJ 2HTME 4JIOU 2C60A 3AU4A 2MJEA 4DHZE 4HPPA 2XNAC 4EOYA 1TYGB 1V81A 3AEDB 3PHWB 4IC7B 4W9LA 1ZGUB 3VUXA 3MFGA 2JRIB 5CHFA 4HRSA 2KQ7A 4GDKB 1V9JA 2KXJA 4I6PA 3B1LX 2WDVB 2PE6B 3RD2A 2WDTB 4HDQA 2V4LA 5D7GA 4FHJA 1ENFA 1WRDB 1KLVA 5BO4B 4A90A 2LFIA 3ZJTA 5BYQA 5J17A 4MT5A 2BS4B 2FIFA 1VRAB 3TBLD 4P7IA 1OQYA 3DQVA 1KLUD 1MJDA 1LQBA 2OOBB 1UWMA 1WE6A 1OEYA 3A9JB 3W1YA 2J42A 2DZKA 4RGTA 3TL5A 3EHVA 3B2GA
chains in the Genus database with same CATH topology
1N62A 2RMMA 2WXIA 1FNVA 1XCQL 2WXMA 1SEBD 2G1EA 4KGRA 1FM0D 2X38A 5BMHA 1WWTA 1AN8A 1UNSA 1ZUD2 3CIRB 3Q69A 1IBXB 1JWAD 3AEEB 1MVKA 2RDHA 3J9CA 5FKAC 1C4CA 1ZP0B 3LXFA 1JMLA 1SIJA 1C77A 4TMAB 1XCTL 3U4EG 2YEPF 3PZ8A 2K9XA 1I7HA 4PT5A 1V1OA 1EU4A 2N0SB 2N9KA 2GRIA 1WSPA 2J52A 2PVGC 2VZKD 2BYTA 1IUEA 1JWUD 4UDUC 3HVZA 3GS2A 1MHXA 1I4HA 4LTUA 1I4PA 1D6EC 1KTKA 2V0GA 2WLBA 2XN9C 4HROA 1L5PA 1V97A 4USAA 2V4IB 3NVZA 1ZXIA 2JU6X 1B9RA 2JXTA 1QOFA 4DQOC 1N60A 1TKGA 1TS2A 2KN4A 3IT4B 2AQ1B 1NI3A 1JQ4A 4ZRQA 1FIQA 1L4DB 3Q8CA 4FXCA 1NVID 1PYWD 1JCKB 1K50A 2JWUA 3R2IA 3L4PA 1DOXA 2ACZB 1TY0A 2EELA 1VR9A 4LLGM 2WXNA 1F77A 4REZA 4CQNA 2CJNA 2ONQA 4WAFA 1WGKA 1RM6C 1UWXA 5AUKA 4N58A 1L0VB 1C4PA 1PGXA 1HEZE 3KWVA 3TEYA 5TSSA 5BYRA 4M0WA 2JQRB 1TZOA 3AE8B 1RYJA 1V1PB 4P16A 3FILA 2WU2B 1YJJA 1I4QA 1YNTE 4JPSA 1GB4A 2FUG1 4XDCA 1V8CA 1VZ8A 1YN4A 3TSSA 1GB1A 2E6XA 3TUOA 2BB5A 1R7SA 3C8YA 4YSZB 1L0XB 5EE3A 1QILA 3ETRA 4C80A 2LMCA 4C7YA 3B2FA 1YQ3B 1ZDXA 3ZGZA 3T3OA 1D5MC 1QOBA 1CQVA 1DGJA 3BYYB 2RPVA 3R8BA 2IGHA 4WWMA 4EE2A 1HQRD 3BYTB 4HJGE 4MM3B 1OFFA 1C79A 2ZW0A 4KGSA 4TQ1A 1SBBB 4NZLB 3BVZA 1D4BA 5BMGA 3I9V1 1VZ6A 1QQRA 4RFBA 2AQ3B 4KX6B 4JWUC 1RWSA 1ZXHA 3V05A 3AH7A 2IGGA 2G9HD 1MHHE 2JX5A 3UI3A 1GPXA 3WCQA 2NTSA 2OEDA 5H92C 1K52A 3IAM1 3P1MA 2W82A 4YSYB 4XWWA 1T5XD 4R3DA 2BW2A 1TJEA 4L23A 3ZJVA 4O1NA 1Q10A 2Q5WD 4RCOA 4YTNB 1FO4A 2YEPB 2H89B 2Y5PA 4HKQA 1BMLC 1LO5D 5FK9C 1DYQA 4LK0M 1FMAD 1QKZA 4OHJA 4JE3B 4Q2JA 4YSXB 2LJIA 3W5UB 3KLSX 1D5ZC 3ZQ4A 5GXGB 2FBWB 2WNMA 1JALA 2M19A 2WQYB 3MJ5A 2PW9A 2Y3AA 4IOIE 1F2RI 2KAJA 4WURA 3KQ4A 1F2RC 5D3DA 3P4RB 2LGIA 4RGOS 1QOAA 3ZYYX 1AW7A 3W2DA 3P4QB 2MJDA 2DBYA 4ARIA 1ZOYB 5EE9A 3AN1A 2ZW1A 4TSSA 3ABVB 1BUIC 2WXRA 1YMHE 4AS1A 2JSVX 4YWGG 1ZPSA 4OZBA 4OVZA 1DOIA 2SEBD 2D5GA 3MP9A 3H8HA 5T8IA 1JWSD 1SJED 3IT6B 4N6EB 4HKZE 2N9LA 4RH6A 3Q8FA 1AYFA 4KKJA 4NJCA 1J7AA 4RGMA 5D3IB 3NZ3A 1JWMD 3AMZA 1HXYD 3CWIA 4JWSC 1E6EB 1OQRA 3SR6A 1J7CA 3EUB2 5EE0A 1SF0A 5HHDG 3MHZA 1C4AA 1PGAA 1XLOA 1Y56A 2ICIA 2W54A 3P4PB 4RGNA 2WXPA 3AE5B 4RNAA 4YXDB 1XLQA 1UUPA 4D2KA 3BIID 1QLBB 4N59A 4WH4A 2WDRB 1QOGA 4ITKA 1FNWA 1YJIA 5HI1A 3EA6A 3FC4A 1M4VA 5LNK1 2LHEA 3AECB 2K22A 4MACA 1N63A 2W55A 2JYTA 3W9CB 1JWBD 1EWYC 1UGJA 1I4RA 2NMQA 2WP9B 1BXTA 3U2SC 2PVOD 1YQ4B 4HEA1 5I4DA 3LB8C 4YTMB 1VZ7A 1EU3A 1L6VA 1MI0A 3T3NA 1CZPA 3BVGA 1SXTA 2WXFA 4NAWB 4IKGA 1N61A 3FAHA 1ZE3D 1OQQA 5C2TB 1QF6A 4RF0A 1IGDA 1GOZA 2IPKD 3AE1B 3URYA 1TKYA 2GB1A 3P4SB 2I2YA 1K53A 1KH0A 2DYOA 3U7ZA 3I57A 1WYGA 3VRAB 2DWQA 2JZPA 3OWEB 1L4ZB 2M56B 1N5WA 4A8XC 2PMVA 5HG2A 3W5VB 2V3NA 4L1BA 5H8YE 1TS3A 3AM9A 3AB5A 3AV8A 1SB3C 3NVYA 1PUTA 1VDVA 3VQIA 2QILA 1XO3A 4A9AA 3BK1A 1VLBA 4RF1A 2BT6A 2K5PA 4AQ7A 2L1AA 1XLNA 2OHFA 2BTEA 1NENB 1XXGA 1KLGD 5AUIA 1PDXA 1FCLA 1NYQA 1F0ZA 3Q8AA 2WXJA 4YT0B 4A6QA 1HZ6A 1FEHA 1ET6A 2MH7A 2TSSA 2KQ4X 3EGRA 5HFYA 1WRIA 4US9A 4ZHPA 2N7JA 3GB1A 2HDEA 3LYYA 3SFDB 3HRDD 4OZAA 1SE2A 2V3PA 1MPEA 1YN5A 2WXKA 3V3XA 3AE7B 5BYSA 3NVWA 3O13A 2K0PA 3BWUD 2QSDA 1J7BA 1JW9D 1CJEA 4B0EA 2INNE 2KWDA 2I38A 1IGCA 1ZDVA 2DYMA 2M0AA 5E6JA 1I4XA 2PKOA 2NTTA 3VR9B 1FRDA 3U52E 1AWDA 2W3SA 2R61A 2K3UA 3MC0B 2CJOA 4GDLB 4J3OD 3ZJUA 1SE3A 2MEKA 2WXGA 4XWTA 2BS3B 2FE8A 2RDGA 2PLPA 4MH8A 1TS5A 3NRZA 3PO0A 3B9JA 2QIEB 3VRBB 5G5GA 4DXFA 4TQ0A 5EE1A 3GP7A 1ET9A 1SE4A 1E10A 1FXAA 1ESFA 1VJKA 2INPE 3NUHB 4ZYSA 5G5HA 1NYRA 3NVVA 4P6VF 1C78A 3AE9B 3SFEB 4YTPB 1EM7A 1TKEA 1IBXA 3IAS1 1B1ZA 4B0MA 1FRRA 5MPOA 3FILB 2ON8A 3TEZA 4NAMA 2WU5B 1KRHA 2WXLA 5FR3A 3RFZB 2LUMA 2KMMA 1SJHD 3HVDA 2EKIA 1HA5A 2AX5A 4A55A 3AE2B 2LEKA 1QT9A 3BZDB 2QMTA 1XF5L 3RPFC 2L32A 3DWGC 1EWCA 2WXHA 2KACA 1CK1A 1TY2A 1P7EA 3PZ7A 3W1SA 4GLSC 3KWLA 3BVMA 4DXGA 4ZHOA 1P7FA 3E9SA 1FD6A 1T3QA 4XE0A 2Y5CA 1C76A 1FFVA 1NEKB 4C56C 2WS3B 3P42A 3AE4B 1KF6B 2H88B 2J53A 4WQMA 5C3JB 1HZ5A 4ARCA 1SSNA 4L2YA 3AEAB 2Z8LA 2QJLA 4JX1C 3AE6B 2L83A 3AE3B 1TS4A 2WDQB 1XLPA 2HTME 2IGDA 4ZRPA 1V1PA 4OZCA 2MJEA 4XDDA 1L6UA 1N5XA 2WXOA 2XNAC 1ROEA 1TYGB 1PFDA 1YN3A 3P63A 3AEDB 2VZKB 1E7PB 1T6BX 2BB6A 2GI9A 3TEXA 1DOYA 4H2AA 1ACCA 1STEA 2LHDA 2QEJC 3R2TA 2E3TA 2WXQA 3MFGA 3NS1A 2KDMA 2PIAA 4ZOHC 4HRSA 2JYEA 4GDKB 2MJ3A 4C7ZA 2WDVB 3Q8BA 1K51A 2AQ2B 4KGTA 3BK2A 1E9MA 3SEBA 4US8A 2SAKA 5D7GA 2W3RA 2IDYA 2B76B 5JXVA 1D5XC 3Q8EA 3IXSA 1GAQB 1KFYB 3HUIA 5BMIA 1XEEA 1ENFA 1PGBA 2BS2B 4OW0A 2CU3A 2PTLA 3N9YC 4WIPA 4A90A 2LFIA 3TEWA 3ZJTA 5BYQA 4MT5A 1A70A 3AEFB 1FNUA 1L0YB 2BS4B 1VRAB 1FCCC 1FXIA 2BBCA 3E56A 1FFUA 1E0ZA 3AEBB 2DLBA 2L52A 2J4XA 3DWMA 4KKIA 1WXQA 3VR8B 1KLUD 1RFKA 4IDIA 1UWMA 1JRPA 1I4GA 2J42A 3AEGB 4RGTA 1JROA 3B2GA 1C9FA 2IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E56 A; 
#chains in the Genus database with same CATH topology
 2RMM A;  2D3A A;  2X38 A;  4A3O A;  3VH4 B;  3ZNZ B;  2HJ1 A;  3H1U A;  3ZNH B;  3NHE B;  1JML A;  1C77 A;  2KN5 A;  3HM6 X;  2K9X A;  1I7H A;  3L13 A;  1V1O A;  2N9K A;  2J52 A;  1WSP A;  4NNJ B;  4NQK E;  1JWU D;  4UDU C;  2WYQ A;  3HVZ A;  3GS2 A;  1D6E C;  1C1Y B;  2NPT B;  4KZ0 A;  2XN9 C;  4HRO A;  1V97 A;  1B9R A;  2V4I B;  2JU6 X;  3NJT A;  4W9K A;  2JXT A;  4DWF A;  5IO9 A;  1QOF A;  1N60 A;  1TKG A;  2AQ1 B;  4ZRQ A;  3CMM B;  1PYW D;  2DX5 B;  4MGK E;  1JCK B;  1WFY A;  4E71 A;  1DOX A;  2ACZ B;  2EEL A;  3UQA A;  2LRW A;  1ZKH A;  4CQN A;  4WAF A;  1WGK A;  4N58 A;  3DOW A;  1HEZ E;  4WWP A;  2K6D B;  4PS8 A;  5CHV C;  2M8S A;  2D2Q A;  4W9E A;  1KJT A;  3DVN V;  1EF1 A;  1I4Q A;  1N6Z A;  1GB1 A;  3I5J C;  3TUO A;  3GOE A;  2LRU A;  1WMH B;  1QIL A;  4C80 A;  4URK A;  2JVC A;  2KT7 A;  4CO7 A;  1CQV A;  1WJ6 A;  1DGJ A;  1H4R A;  2RPQ A;  2MBO A;  4BBN F;  4HJG E;  1V5O A;  1SBB B;  4FUL A;  1T0R C;  2ZNV C;  4KX6 B;  2C7M B;  3DBS A;  3UIP B;  3V05 A;  1FPY A;  3AH7 A;  5IOI A;  1MHH E;  2LZ6 A;  2NTS A;  2DAJ A;  5H92 C;  4BAX A;  1K52 A;  4YSY B;  4XWW A;  1T5X D;  4R3D A;  2LWP A;  3ZJV A;  2AYO B;  1Q10 A;  4LNO A;  4DHJ B;  4JL9 A;  2LVQ A;  2J0M A;  4LK0 M;  1FMA D;  2KWV B;  4YSX B;  4HDO A;  4GDK A;  3ZQ4 A;  2KJ6 A;  5GXG B;  2FBW B;  2LXC A;  2PW9 A;  3H7P B;  3ZTD A;  4BBN C;  3LDZ E;  4C4V B;  4RGO S;  2ZNV B;  3P4Q B;  2DBY A;  5EE9 A;  3DBR I;  1BUI C;  1YMH E;  2SEB D;  1Q5W B;  4IM3 A;  2D5G A;  1F9J A;  5AZF A;  4WAA A;  4AOF A;  1V86 A;  5T8I A;  4NPN A;  2FAZ A;  4BOS C;  3DBL I;  2MWS B;  2N9L A;  4RH6 A;  3Q8F A;  4W9I A;  1AYF A;  1NDD A;  2VRR B;  3KUZ A;  2BVC A;  4NJC A;  4GGQ A;  2N9X A;  1IP9 A;  3NZ3 A;  3QA8 A;  3AMZ A;  2OJR A;  2K8H A;  4HPM B;  4JWS C;  2KDF B;  1J7C A;  5EE0 A;  4AWJ A;  2WGS A;  2ICI A;  2G45 B;  2W54 A;  3T9L A;  4RGN A;  3AE5 B;  1XLQ A;  4D2K A;  2AEH A;  2NBW B;  4WH4 A;  4LJP B;  2O2V B;  3HIZ A;  4ITK A;  1FNW A;  2A4Z A;  5HI1 A;  1M4V A;  2NPT A;  1JWB D;  1BXT A;  5AZG A;  4YTM B;  1WJ4 A;  3KYC D;  3PV1 A;  1CZP A;  5JH5 C;  2KC2 A;  3BVG A;  2WXF A;  2MP2 B;  4DHZ B;  3FAH A;  3PHX B;  4XGA B;  3KUC B;  1WX9 A;  4NQL B;  3NZS A;  3P4S B;  5AEK B;  1R4N B;  2DYO A;  3U7Z A;  3VRA B;  2M56 B;  1WGG A;  2PMV A;  5HG2 A;  2V3N A;  1TS3 A;  4WJQ A;  1PUT A;  4LNK A;  3VQI A;  5DPS A;  3RI7 C;  3HM3 A;  2BT6 A;  1KM7 A;  2XEW A;  1NEN B;  4I6L B;  3Q3N C;  1NYQ A;  2TSS A;  2AL6 A;  2KQ4 X;  4GB9 A;  3A4S C;  4ZHP A;  2MCN B;  3PLU A;  3SFD B;  2R2O A;  4OZA A;  1SE2 A;  4I6N B;  4LNN A;  4ICV A;  5E6N A;  4J6I A;  1JW9 D;  3K9P B;  2BGF A;  3NG0 A;  2BYE A;  2KYW A;  4K7W A;  3ZRF A;  2PKO A;  4WWO A;  2JT4 B;  3SD5 A;  4C00 A;  1GJZ A;  3WAP A;  4GDL B;  3ZJU A;  4ZRI A;  4XWT A;  4F7Z A;  1C3T A;  2BS3 B;  2FE8 A;  2PLP A;  3RCZ A;  4KSK C;  4FA6 A;  2N9E B;  1EO6 A;  1SE9 A;  1UBQ A;  3GP7 A;  3RN9 C;  2IO1 B;  3VH3 B;  4P6V F;  1C78 A;  4YTP B;  2ASQ A;  1VCB A;  1WY8 A;  2MA9 B;  2ON8 A;  3MC8 A;  4NAM A;  1WXS A;  2C7H A;  1KRH A;  3HVD A;  3AXC A;  1WR1 A;  1HA5 A;  2LGS A;  4GU2 A;  2KO3 A;  1QT9 A;  3BZD B;  3RNE C;  1YJ1 A;  4GOC A;  2D11 A;  4MJS A;  4HLE A;  3HHM A;  1J0G A;  3W1S A;  4GLS C;  3ZTC A;  5DPW A;  3BVM A;  3E9S A;  3ZW3 A;  2Y5C A;  3IVF A;  1FFV A;  3PRZ A;  3KW5 B;  2KMC A;  4WQM A;  1HZ5 A;  3ML9 A;  1SSN A;  2N1V A;  2KAN A;  4N9F 4;  2WDQ B;  4IW0 A;  2ZVN A;  5LXH A;  4OZC A;  4DDI D;  4XDD A;  2VH1 A;  1N5X A;  1PFD A;  3DHG C;  1T6B X;  3RT3 B;  4K7U A;  2L3Z A;  2E3T A;  3N1X C;  2KLC A;  1TTN A;  1EUV B;  1L7Y A;  2MP2 A;  1WM3 A;  2MW5 A;  3Q8B A;  2KLG A;  1YQB A;  4KGT A;  3SEB A;  3ENE A;  3VUY A;  1D5X C;  1RLF A;  2GLS A;  2NR2 A;  2KFK B;  2RR9 A;  3IXS A;  2O6V A;  1XEE A;  2DZM A;  2KKC A;  3TCA A;  2BS2 B;  4OW0 A;  2CU3 A;  2PTL A;  2WWZ A;  2JRH A;  1JRU A;  4AP4 C;  1YX5 B;  2L52 A;  1WXQ A;  2QHO A;  3VR8 B;  1RFK A;  4FN2 A;  1JRP A;  1PQS A;  1P98 A;  1U4A A;  1C9F A;  1KH0 A;  2DZJ A;  2G1E A;  1FM0 D;  5BMH A;  2JUO A;  1WWT A;  1UNS A;  3RNG C;  3CIR B;  1HE8 A;  3N1Y C;  4MEL A;  3AEE B;  3J9C A;  2ZPN A;  1ZP0 B;  3JW0 X;  2MQJ A;  1V2Y A;  2AL3 A;  2D3G A;  3I3T B;  2FCQ A;  3U4E G;  2YEP F;  3PZ8 A;  4P1C C;  1EU4 A;  2GRI A;  2JF5 A;  4ASW C;  2VZK D;  1IUE A;  1I4H A;  4LTU A;  1I4P A;  3N20 C;  2WLB A;  1L5P A;  4USA A;  1ZXI A;  1WZ3 A;  1TS2 A;  1NI3 A;  4KDI C;  1R4N I;  1FIQ A;  4EZJ A;  3QIJ A;  4FXC A;  4HK2 A;  1E7U A;  4E74 A;  1K50 A;  2JWU A;  3AUL A;  2KJH B;  3L4P A;  2L0F A;  5CHW A;  4G0N B;  1RM6 C;  2KFJ A;  3B0A A;  5TR5 A;  3P2B A;  3TEY A;  3UIO B;  2L05 A;  5BYR A;  3AE8 B;  1RYJ A;  1V1P B;  2WU2 B;  1YJJ A;  2LVP A;  2FUG 1;  1J19 A;  4XDC A;  1V8C A;  1VZ8 A;  1YN4 A;  3TSS A;  1WXA A;  4KIK B;  2LMC A;  1D5M C;  1QOB A;  4LCD E;  3RUI B;  4HJK A;  2IO3 B;  1WF9 A;  1OFF A;  2IZV B;  2ZW0 A;  1K8R B;  4KGS A;  3TIX A;  2MSE D;  1QQR A;  4RFB A;  3Q3M C;  3H9D A;  1X1M A;  1S3S G;  2WX1 A;  2JX5 A;  1MFW A;  1H8C A;  4DBG A;  2FCN A;  2M1M A;  4KV2 A;  4EZK A;  2KVZ A;  4YL8 A;  2W82 A;  4M01 A;  1TZ1 A;  1TJE A;  2EMS A;  1FO4 A;  2YEP B;  4EFO A;  2H89 B;  3BIN A;  3VXW A;  1LO5 D;  4JE3 B;  3W5U B;  2ZEQ A;  3KLS X;  1D5Z C;  2WNM A;  1JAL A;  2M19 A;  3SDL C;  2G3Q B;  2Y3A A;  1F2R I;  2KAJ A;  4IOI E;  2GBN A;  3A4R A;  2LGI A;  4WJO A;  1AW7 A;  3W2D A;  1E8Y A;  2MJD A;  1WH3 A;  2WHI A;  3ZDT A;  2IND C;  4ARI A;  4HXD A;  3AN1 A;  1WXV A;  2WXR A;  2GBR A;  1S1Q B;  2KTF A;  3MP9 A;  2Z0D B;  4S17 A;  3RMK C;  1JWS D;  1SJE D;  3IT6 B;  4ICU A;  2GBM A;  4KKJ A;  3KYD D;  1J7A A;  2UYZ B;  4NY0 A;  5D3I B;  3DDC B;  2L8J A;  1JWM D;  3L08 A;  2UU7 A;  4ACF A;  1E6E B;  1OQR A;  3U8Z A;  3SR6 A;  5C23 A;  4M0W B;  2X8X X;  1C4A A;  1PGA A;  3DBH B;  1XLO A;  1Y56 A;  1YIW A;  4RNA A;  4YXD B;  4PS3 A;  4QAY A;  1UUP A;  3BII D;  1HTO A;  5L83 A;  3LJ3 A;  2WDR B;  4IWP A;  1QOG A;  2XK5 B;  3EA6 A;  4W9D A;  2LHE A;  3U7D A;  2W55 A;  4ZDV A;  1EWY C;  1UGJ A;  2PVO D;  5I4D A;  3GE8 C;  2KD0 A;  3T3N A;  4NAW B;  4GXB A;  2HTH A;  3ZO5 B;  1ZE3 D;  3C19 A;  4XC2 A;  3ECI A;  5DPR A;  1GOZ A;  4MGZ E;  1TKY A;  2GBK A;  1K53 A;  2BKF A;  4LDT D;  4KSL C;  4M8N A;  1N5W A;  4A8X C;  5H8Y E;  1WYW B;  2MBB B;  3APF A;  3NVY A;  1L2N A;  1VDV A;  1XT9 B;  2AWT A;  4A9A A;  4OVV A;  2L1A A;  3U30 A;  5E6P A;  4MSM B;  3V61 A;  1XLN A;  2OHF A;  2BTE A;  2Z59 B;  1LFD A;  1XXG A;  1PDX A;  1F0Z A;  1V5T A;  3A9K B;  4A6Q A;  4MGI E;  2HD5 B;  3PTF C;  1FEH A;  2N1W A;  4IUM B;  2KZR A;  3EFC A;  2HDE A;  3LYY A;  3HRD D;  5BYS A;  3AE7 B;  4ZRK A;  2KNB A;  3O13 A;  3WAM A;  2QSD A;  3IBE A;  1WIA A;  3R7Q A;  1CJE A;  4B0E A;  4G11 A;  5L95 C;  1WZ0 A;  2I38 A;  4IWO A;  2M0A A;  3V62 A;  2EMT A;  2NTT A;  1F1H A;  3VR9 B;  4HWI B;  2HE7 A;  1Y8R C;  1AWD A;  1FXT B;  2R61 A;  3ONS A;  4IWQ A;  1I35 A;  3ML8 A;  3VDZ A;  3JSV B;  4M8M A;  5EDS A;  1TS5 A;  4ANU A;  3PO0 A;  4TUU A;  3VRB B;  4WWN A;  4W9C A;  3A9J A;  2KTR B;  2RSU A;  5EE1 A;  5G55 A;  1KOT A;  1FXA A;  3GZN B;  1CMX B;  2INP E;  2I1K A;  4FBJ B;  4ZYS A;  2OJW A;  2RGF A;  4GIV A;  3IG3 A;  1WGH A;  1UF0 A;  2CKH B;  3SFE B;  4KZC A;  1EM7 A;  3H7S A;  2DEN B;  1B1Z A;  4B0M A;  3FIL B;  3SU8 X;  2DHZ A;  2IY1 B;  3S2A A;  3RFZ B;  2LUM A;  4DXA B;  2EKI A;  2AX5 A;  1QZE A;  3AE2 B;  2LEK A;  5LLI A;  1TY2 A;  1MG8 A;  3APC A;  2IO0 B;  3RYT A;  4ZHO A;  1P7F A;  1FD6 A;  1T3Q A;  4NJ6 A;  5JHA A;  4C56 C;  3MC9 A;  1E90 A;  3P42 A;  1KF6 B;  2Z0E B;  1UGM A;  4L2Y A;  2L83 A;  1Q0W B;  2XK5 A;  1TS4 A;  3PLV A;  2IGD A;  4ZRP A;  4EEW A;  3A33 B;  2KDE B;  4F8C B;  2WXO A;  3P63 A;  4CYE A;  1E7P B;  2BB6 A;  2GI9 A;  1BT0 A;  3WAL A;  1DOY A;  3R66 C;  1STE A;  3KH0 A;  1WMH A;  3NS1 A;  3X23 A;  4NAW A;  1F52 A;  2JYE A;  2L7R A;  5AZH A;  4C7Z A;  2BPS A;  2JPH A;  4BKG A;  4PS7 A;  1RAX A;  3BK2 A;  3CST A;  1WGY A;  2SAK A;  3QHT A;  2W3R A;  2IDY A;  2NCN A;  4RM9 A;  5JXV A;  1GAQ B;  3HUI A;  4K3B A;  5BMI A;  5G2N A;  2MBE A;  3TEW A;  3NOB A;  1T0S C;  1A70 A;  3AEF B;  3PS6 A;  1FNU A;  1FCC C;  1FXI A;  2BBC A;  2LJ5 A;  4BKS A;  1FFU A;  1E0Z A;  3AEB B;  2LI5 A;  4MEM A;  2J4X A;  3DWM A;  4KKI A;  3PGE A;  2FUH B;  1I4G A;  1V6E A;  3DBH I;  4HCP B;  2IJ0 A;  2Y5B B;  3M63 B;  3X0W A;  2WXI A;  1XCQ L;  2WXM A;  4M02 A;  1SEB D;  2KX3 A;  4II2 B;  3AI5 A;  3PRP B;  3L17 A;  4B6W A;  3QAR A;  3Q69 A;  3H7P A;  3UF8 A;  1Z5S B;  1IBX B;  3IFW B;  4MH0 E;  5FKA C;  3LXF A;  2KC1 A;  1SIJ A;  4C4V A;  2PVG C;  1UD7 A;  1IPG A;  1KTK A;  2V0G A;  1Q1O A;  4K81 A;  3NVZ A;  1RRB A;  2LGX A;  2DYB A;  3Q8C A;  1A5R A;  1NVI D;  2BWF A;  1WJN A;  1Z2M A;  3CSF A;  3DVG X;  3IHP C;  3L10 B;  1VR9 A;  4LLG M;  2WXN A;  4REZ A;  2ONQ A;  2V1Y A;  4FJY A;  2MRP A;  4LJO B;  3TMP B;  2G4D B;  2JQR B;  3O65 B;  3VTU A;  3K9O B;  4P16 A;  3D32 A;  1MG4 A;  3FIL A;  2IY0 B;  4ANV A;  3ZKJ C;  1AAR A;  2O2V A;  3RZW C;  4YSZ B;  1L0X B;  3ETR A;  2A5U A;  3B2F A;  1YQ3 B;  1ZDX A;  3PZD A;  3T3O A;  2RPV A;  4HCN B;  3BYT B;  2HJ8 A;  4A20 A;  4MM3 B;  4TQ1 A;  4NZL B;  3BVZ A;  3EEC A;  3I9V 1;  3WAN A;  1VZ6 A;  2FCS A;  4MSQ B;  2D3B A;  1RWS A;  2IGG A;  1GPX A;  1R4M B;  3MTN B;  4G3X B;  3SHQ A;  1WJU A;  3GZN I;  3QAQ A;  1BML C;  1TBE A;  2LGD A;  5FK9 C;  1DYQ A;  2VH2 A;  1QKZ A;  3UIN B;  2D07 B;  3L0W B;  3N3K B;  2GBJ A;  4AJW A;  3WAO A;  4FAD A;  2YLM A;  4AJY B;  3P4R B;  4LNI A;  5D6J B;  3ZYY X;  4LNF A;  2FNJ B;  2LVO A;  1ZOY B;  3T8M A;  4BOZ B;  3QC8 B;  3VTW A;  5J18 A;  1J8C A;  1E8X A;  5LXI B;  2MBH A;  5JZE B;  3R3M A;  4GDL A;  2LUE A;  4W9J A;  3CWI A;  2N4F A;  3EUB 2;  1SF0 A;  2CHX A;  2CS4 A;  3PT2 B;  3ZDM C;  1QLB B;  4N59 A;  2KJR A;  3FC4 A;  4CHK A;  5LNK 1;  3VTV A;  3AEC B;  2DZI A;  3A1Q B;  2JY6 A;  2NBU A;  2NMQ A;  2WP9 B;  3U2S C;  2C9W B;  3MJW A;  4HEA 1;  4BFR A;  3JYU A;  2FID A;  1L6V A;  1MI0 A;  1SXT A;  4FJZ A;  4IKG A;  3UGB B;  2K8C A;  5C2T B;  4RF0 A;  4JGH B;  2IPK D;  3AE1 B;  1WR6 E;  2GB1 A;  2K25 A;  3I57 A;  2DNF A;  2D3C A;  2KX0 A;  2DWQ A;  3L54 A;  3QCA A;  1L4Z B;  5IP4 D;  3MHS D;  4ANX A;  3W5V B;  2KMA A;  3AM9 A;  4K7S A;  1NI2 A;  3ZRC A;  2QIL A;  3VUW A;  3OG5 A;  1VLB A;  2MLB A;  4II3 B;  1KLG D;  4BZA A;  5AUI A;  1FCL A;  3Q8A A;  2WXJ A;  2LD9 A;  1XD3 B;  4EKU A;  4DDG D;  1ET6 A;  4MM3 A;  1WRI A;  4US9 A;  2V9H A;  1I42 A;  2N7J A;  3GB1 A;  2KDI A;  2V3P A;  4MDK E;  2CU1 A;  3BWU D;  1ZDV A;  2KFK A;  2YVC A;  3VAW A;  1V80 A;  1FRD A;  2INC C;  3U52 E;  2W3S A;  2K3U A;  3MC0 B;  3JVZ X;  2KVR A;  2CHZ A;  4KDL B;  1SE3 A;  2ZZP B;  4E3C A;  2FCM A;  2L76 A;  3B9J A;  5GMV A;  2QIE B;  1TIF A;  4GMV A;  5G5G A;  4DXF A;  4TQ0 A;  2PE9 A;  1ET9 A;  1SE4 A;  2GOW A;  2O6V D;  1NYR A;  2I1J A;  3QJZ A;  3AE9 B;  1UZX B;  3N1Z C;  1OTR B;  2M17 A;  5DPT A;  3NY5 A;  4S0R A;  2WU5 B;  2QDF A;  3RNC C;  4A55 A;  4EUT A;  5DCN A;  1WXM A;  1HTQ A;  2QMT A;  1XF5 L;  3RPF C;  2L32 A;  2K6Q A;  4P1B C;  3Q6B A;  3PVL A;  1OGW A;  2WXH A;  2K39 A;  3RNB C;  2N9P C;  2J0J A;  3KWL A;  2LGY A;  1R4M I;  3HK0 A;  1NEK B;  1T0Q C;  1TGZ B;  2BKR B;  3AE4 B;  2J53 A;  2NVU I;  5D94 A;  2L0T A;  3H6N A;  3Q2A C;  1G6J A;  3AE6 B;  3AE3 B;  3WIM A;  3ALB A;  1XLP A;  2REX A;  2BYV E;  2J7Q B;  1V1P A;  2N7E A;  1L6U A;  4K1R B;  3Q3O C;  1ROE A;  1YN3 A;  3A1Q A;  2VZK B;  3TEX A;  2N7D A;  4H2A A;  3UQB A;  1ACC A;  2LHD A;  2QEJ C;  2V3S A;  3R2T A;  3WA0 A;  2WXQ A;  4KIK A;  2JWZ A;  2KDM A;  2PIA A;  4ZOH C;  2LXA A;  2MJ3 A;  1K51 A;  4IM2 A;  2AQ2 B;  1E9M A;  4US8 A;  3BY4 B;  4XYC A;  3M62 B;  2ZJD A;  2B76 B;  3OJ4 B;  3V6E B;  1E8W A;  2BYF A;  3Q8E A;  3Q14 C;  1KFY B;  1PGB A;  4XX5 A;  3N9Y C;  4WIP A;  2K8B A;  5FR6 A;  1L0Y B;  4JQW C;  3E56 A;  2DLB A;  5KHQ A;  1LGR A;  3W1S C;  4IDI A;  2QC8 A;  3M3J A;  3RNF C;  2B3A A;  3AEG B;  3PRM B;  1JRO A;  1N62 A;  1FNV A;  4KGR A;  1AN8 A;  5IKC M;  1ZUD 2;  2WX0 A;  1ISN A;  1JWA D;  1MVK A;  2RDH A;  3DHH C;  1C4C A;  4TMA B;  2ZCB A;  2M4N A;  4IG7 B;  1XCT L;  5D2M B;  1D3Z A;  4RMA A;  4PT5 A;  2N0S B;  2ZVO A;  2BYT A;  2MHJ A;  2GMI C;  1MHX A;  4MJS B;  1NBF C;  1E5W A;  3L16 A;  5JHB A;  4A3P A;  2IYD B;  4DQO C;  2BQQ A;  2KN4 A;  3IT4 B;  1JQ4 A;  4DK5 A;  1L4D B;  2KDB A;  3Q3F A;  2KWC A;  4ZYN A;  4TV3 A;  4RM8 A;  5J2R A;  2CHW A;  3R2I A;  1TY0 A;  3OAW A;  2MBQ A;  5KHO A;  1F77 A;  2CJN A;  3M95 A;  4W9H A;  1UWX A;  5AUK A;  3VFK A;  1L0V B;  1C4P A;  1PGX A;  3KWV A;  5TSS A;  4M0W A;  1TZO A;  4KVG B;  4IM0 A;  1M94 A;  1YNT E;  2RD0 A;  3GE3 C;  4JPS A;  1GB4 A;  3KUD B;  2E6X A;  3ZNI D;  4XZ4 A;  2BB5 A;  1R7S A;  3C8Y A;  5EE3 A;  2J0K A;  2K1F A;  4C7Y A;  3ZIM A;  3ZGZ A;  3BYY B;  2KHW B;  3R8B A;  4ZRJ A;  2IGH A;  3NZU A;  3OLM D;  4WWM A;  4EE2 A;  1HQR D;  4AUQ C;  1C79 A;  2BWE S;  2KK8 A;  5BMG A;  1D4B A;  2AQ3 B;  2JZ3 B;  4NJ7 A;  3ZLZ A;  2O6V B;  2IBI B;  4JWU C;  3B08 A;  2KOX A;  1ZXH A;  2ZPY A;  2JXX A;  2G9H D;  2IO2 B;  4FHK A;  4K3C A;  3UI3 A;  2KQS A;  1WX8 A;  3WCQ A;  2OED A;  5HKH A;  5IN7 A;  3IAM 1;  4MGY E;  3P1M A;  2JZZ A;  1GC6 A;  2BW2 A;  4L23 A;  4O1N A;  2Q5W D;  3AU5 A;  4RCO A;  4X57 B;  4YTN B;  2Y5P A;  4HKQ A;  2NS5 A;  1ZW7 A;  1IYF A;  1E7V A;  4JLC A;  4BKT A;  2ZCC A;  4OHJ A;  4Q2J A;  2LJI A;  3EC8 A;  2WQY B;  3A9K A;  3MJ5 A;  4WUR A;  5CTR C;  3KQ4 A;  3ZVV A;  1F2R C;  5D3D A;  1QOA A;  4GN1 A;  3OJ3 A;  1V49 A;  2BF8 B;  1LM8 B;  4LDT B;  3CF6 E;  4TSS A;  1GC7 A;  2ZW1 A;  1UH6 A;  3V6C B;  3ABV B;  3DCG A;  1GNU A;  4AS1 A;  2JSV X;  4YWG G;  1ZPS A;  4OZB A;  4OVZ A;  1DOI A;  3H8H A;  3V60 A;  4N6E B;  2NBV B;  1E8Z A;  2PPH A;  4HKZ E;  1LXD A;  1XQQ A;  2MX2 A;  4BVU C;  2QCZ A;  3JSV A;  2XBB C;  3R7R A;  3FKY A;  4RGM A;  3ZUN A;  3QK0 A;  1HXY D;  2PEA A;  2R2Q A;  3KVF B;  1WX7 A;  2KTR A;  5HHD G;  3C0R B;  3MHZ A;  2CR5 A;  3P4P B;  2WXP A;  3TJP A;  1TT5 B;  2G4S A;  1GG3 A;  1YJI A;  4WJN A;  4G50 A;  2K22 A;  4MAC A;  1N63 A;  1UBI A;  2JYT A;  3W9C B;  2L00 B;  1I4R A;  1P1A A;  3QQ8 B;  1YQ4 B;  3LB8 C;  1VZ7 A;  1EU3 A;  2EKE C;  5E6O A;  3VVW B;  4F1S A;  4B9K A;  4WQO B;  1SGH A;  1N61 A;  1OQQ A;  2C7N B;  1QF6 A;  1IGD A;  3PSE B;  3URY A;  3ZNG C;  2I2Y A;  3EFU A;  1WYG A;  2JZP A;  3OWE B;  1WE7 A;  3RZF A;  4ANW A;  4L1B A;  3AB5 A;  3AV8 A;  1SB3 C;  3DVG Y;  3QX1 A;  1XO3 A;  3BK1 A;  2M0X A;  4RF1 A;  2K5P A;  3RNA C;  4AQ7 A;  4OVU A;  4HVB A;  4YT0 B;  1EF5 A;  1P3Q U;  1HZ6 A;  3QWZ B;  3I63 C;  2MH7 A;  3EGR A;  4B95 A;  1RFA A;  2DAF A;  2KWU B;  5HFY A;  1P0R A;  5IA7 A;  1YD8 U;  2UWQ A;  4M00 A;  1MPE A;  1YN5 A;  2WXK A;  3V3X A;  3ZXV A;  3NVW A;  2K0P A;  1WI0 A;  3N32 A;  1J7B A;  2INN E;  1WGD A;  2KWD A;  1IGC A;  1VD2 A;  2DYM A;  5E6J A;  3N30 A;  1I4X A;  4W9G A;  5C1Z A;  4FJV B;  2CJO A;  4J3O D;  2MEK A;  2WXG A;  4GSW A;  2RDG A;  4MH8 A;  1WGR A;  3NRZ A;  3Q3J A;  3DVN U;  2D10 A;  3VHT C;  2PJH A;  1E10 A;  1ESF A;  1VJK A;  3DPD A;  3PPA A;  3NUH B;  3APD A;  5G5H A;  3NVV A;  2C5L C;  1TKE A;  1IBX A;  3IAS 1;  1FRR A;  4BKS D;  5MPO A;  3TEZ A;  4PYU A;  5IAA C;  4WJP A;  2WXL A;  5FR3 A;  3PRE A;  1P9D U;  1T0Y A;  2KMM A;  1SJH D;  4W9F A;  1YOV B;  4HPL B;  3DBR B;  4DHJ D;  3DWG C;  3RUL A;  4PK1 A;  1EWC A;  2KAC A;  1CK1 A;  1P7E A;  1GUA B;  3PZ7 A;  4FLH A;  5CX3 A;  3DBL B;  1UEL A;  4DXG A;  4XE0 A;  3NS8 A;  1C76 A;  2RDB C;  2WS3 B;  4EZL A;  1YX6 B;  1WM2 A;  2H88 B;  5C3J B;  2W9N A;  3ZXR A;  4ARC A;  1SIF A;  4PYZ A;  3DHI C;  3AEA B;  2Z8L A;  2QJL A;  4JX1 C;  4TKN A;  2LAS A;  1OEY J;  2HTM E;  4JIO U;  2C60 A;  3AU4 A;  2MJE A;  4DHZ E;  4HPP A;  2XNA C;  4EOY A;  1TYG B;  1V81 A;  3AED B;  3PHW B;  4IC7 B;  4W9L A;  1ZGU B;  3VUX A;  3MFG A;  2JRI B;  5CHF A;  4HRS A;  2KQ7 A;  4GDK B;  1V9J A;  2KXJ A;  4I6P A;  3B1L X;  2WDV B;  2PE6 B;  3RD2 A;  2WDT B;  4HDQ A;  2V4L A;  5D7G A;  4FHJ A;  1ENF A;  1WRD B;  1KLV A;  5BO4 B;  4A90 A;  2LFI A;  3ZJT A;  5BYQ A;  5J17 A;  4MT5 A;  2BS4 B;  2FIF A;  1VRA B;  3TBL D;  4P7I A;  1OQY A;  3DQV A;  1KLU D;  1MJD A;  1LQB A;  2OOB B;  1UWM A;  1WE6 A;  1OEY A;  3A9J B;  3W1Y A;  2J42 A;  2DZK A;  4RGT A;  3TL5 A;  3EHV A;  3B2G A; 
#chains in the Genus database with same CATH homology
 1N62 A;  2RMM A;  2WXI A;  1FNV A;  1XCQ L;  2WXM A;  1SEB D;  2G1E A;  4KGR A;  1FM0 D;  2X38 A;  5BMH A;  1WWT A;  1AN8 A;  1UNS A;  1ZUD 2;  3CIR B;  3Q69 A;  1IBX B;  1JWA D;  3AEE B;  1MVK A;  2RDH A;  3J9C A;  5FKA C;  1C4C A;  1ZP0 B;  3LXF A;  1JML A;  1SIJ A;  1C77 A;  4TMA B;  1XCT L;  3U4E G;  2YEP F;  3PZ8 A;  2K9X A;  1I7H A;  4PT5 A;  1V1O A;  1EU4 A;  2N0S B;  2N9K A;  2GRI A;  1WSP A;  2J52 A;  2PVG C;  2VZK D;  2BYT A;  1IUE A;  1JWU D;  4UDU C;  3HVZ A;  3GS2 A;  1MHX A;  1I4H A;  4LTU A;  1I4P A;  1D6E C;  1KTK A;  2V0G A;  2WLB A;  2XN9 C;  4HRO A;  1L5P A;  1V97 A;  4USA A;  2V4I B;  3NVZ A;  1ZXI A;  2JU6 X;  1B9R A;  2JXT A;  1QOF A;  4DQO C;  1N60 A;  1TKG A;  1TS2 A;  2KN4 A;  3IT4 B;  2AQ1 B;  1NI3 A;  1JQ4 A;  4ZRQ A;  1FIQ A;  1L4D B;  3Q8C A;  4FXC A;  1NVI D;  1PYW D;  1JCK B;  1K50 A;  2JWU A;  3R2I A;  3L4P A;  1DOX A;  2ACZ B;  1TY0 A;  2EEL A;  1VR9 A;  4LLG M;  2WXN A;  1F77 A;  4REZ A;  4CQN A;  2CJN A;  2ONQ A;  4WAF A;  1WGK A;  1RM6 C;  1UWX A;  5AUK A;  4N58 A;  1L0V B;  1C4P A;  1PGX A;  1HEZ E;  3KWV A;  3TEY A;  5TSS A;  5BYR A;  4M0W A;  2JQR B;  1TZO A;  3AE8 B;  1RYJ A;  1V1P B;  4P16 A;  3FIL A;  2WU2 B;  1YJJ A;  1I4Q A;  1YNT E;  4JPS A;  1GB4 A;  2FUG 1;  4XDC A;  1V8C A;  1VZ8 A;  1YN4 A;  3TSS A;  1GB1 A;  2E6X A;  3TUO A;  2BB5 A;  1R7S A;  3C8Y A;  4YSZ B;  1L0X B;  5EE3 A;  1QIL A;  3ETR A;  4C80 A;  2LMC A;  4C7Y A;  3B2F A;  1YQ3 B;  1ZDX A;  3ZGZ A;  3T3O A;  1D5M C;  1QOB A;  1CQV A;  1DGJ A;  3BYY B;  2RPV A;  3R8B A;  2IGH A;  4WWM A;  4EE2 A;  1HQR D;  3BYT B;  4HJG E;  4MM3 B;  1OFF A;  1C79 A;  2ZW0 A;  4KGS A;  4TQ1 A;  1SBB B;  4NZL B;  3BVZ A;  1D4B A;  5BMG A;  3I9V 1;  1VZ6 A;  1QQR A;  4RFB A;  2AQ3 B;  4KX6 B;  4JWU C;  1RWS A;  1ZXH A;  3V05 A;  3AH7 A;  2IGG A;  2G9H D;  1MHH E;  2JX5 A;  3UI3 A;  1GPX A;  3WCQ A;  2NTS A;  2OED A;  5H92 C;  1K52 A;  3IAM 1;  3P1M A;  2W82 A;  4YSY B;  4XWW A;  1T5X D;  4R3D A;  2BW2 A;  1TJE A;  4L23 A;  3ZJV A;  4O1N A;  1Q10 A;  2Q5W D;  4RCO A;  4YTN B;  1FO4 A;  2YEP B;  2H89 B;  2Y5P A;  4HKQ A;  1BML C;  1LO5 D;  5FK9 C;  1DYQ A;  4LK0 M;  1FMA D;  1QKZ A;  4OHJ A;  4JE3 B;  4Q2J A;  4YSX B;  2LJI A;  3W5U B;  3KLS X;  1D5Z C;  3ZQ4 A;  5GXG B;  2FBW B;  2WNM A;  1JAL A;  2M19 A;  2WQY B;  3MJ5 A;  2PW9 A;  2Y3A A;  4IOI E;  1F2R I;  2KAJ A;  4WUR A;  3KQ4 A;  1F2R C;  5D3D A;  3P4R B;  2LGI A;  4RGO S;  1QOA A;  3ZYY X;  1AW7 A;  3W2D A;  3P4Q B;  2MJD A;  2DBY A;  4ARI A;  1ZOY B;  5EE9 A;  3AN1 A;  2ZW1 A;  4TSS A;  3ABV B;  1BUI C;  2WXR A;  1YMH E;  4AS1 A;  2JSV X;  4YWG G;  1ZPS A;  4OZB A;  4OVZ A;  1DOI A;  2SEB D;  2D5G A;  3MP9 A;  3H8H A;  5T8I A;  1JWS D;  1SJE D;  3IT6 B;  4N6E B;  4HKZ E;  2N9L A;  4RH6 A;  3Q8F A;  1AYF A;  4KKJ A;  4NJC A;  1J7A A;  4RGM A;  5D3I B;  3NZ3 A;  1JWM D;  3AMZ A;  1HXY D;  3CWI A;  4JWS C;  1E6E B;  1OQR A;  3SR6 A;  1J7C A;  3EUB 2;  5EE0 A;  1SF0 A;  5HHD G;  3MHZ A;  1C4A A;  1PGA A;  1XLO A;  1Y56 A;  2ICI A;  2W54 A;  3P4P B;  4RGN A;  2WXP A;  3AE5 B;  4RNA A;  4YXD B;  1XLQ A;  1UUP A;  4D2K A;  3BII D;  1QLB B;  4N59 A;  4WH4 A;  2WDR B;  1QOG A;  4ITK A;  1FNW A;  1YJI A;  5HI1 A;  3EA6 A;  3FC4 A;  1M4V A;  5LNK 1;  2LHE A;  3AEC B;  2K22 A;  4MAC A;  1N63 A;  2W55 A;  2JYT A;  3W9C B;  1JWB D;  1EWY C;  1UGJ A;  1I4R A;  2NMQ A;  2WP9 B;  1BXT A;  3U2S C;  2PVO D;  1YQ4 B;  4HEA 1;  5I4D A;  3LB8 C;  4YTM B;  1VZ7 A;  1EU3 A;  1L6V A;  1MI0 A;  3T3N A;  1CZP A;  3BVG A;  1SXT A;  2WXF A;  4NAW B;  4IKG A;  1N61 A;  3FAH A;  1ZE3 D;  1OQQ A;  5C2T B;  1QF6 A;  4RF0 A;  1IGD A;  1GOZ A;  2IPK D;  3AE1 B;  3URY A;  1TKY A;  2GB1 A;  3P4S B;  2I2Y A;  1K53 A;  1KH0 A;  2DYO A;  3U7Z A;  3I57 A;  1WYG A;  3VRA B;  2DWQ A;  2JZP A;  3OWE B;  1L4Z B;  2M56 B;  1N5W A;  4A8X C;  2PMV A;  5HG2 A;  3W5V B;  2V3N A;  4L1B A;  5H8Y E;  1TS3 A;  3AM9 A;  3AB5 A;  3AV8 A;  1SB3 C;  3NVY A;  1PUT A;  1VDV A;  3VQI A;  2QIL A;  1XO3 A;  4A9A A;  3BK1 A;  1VLB A;  4RF1 A;  2BT6 A;  2K5P A;  4AQ7 A;  2L1A A;  1XLN A;  2OHF A;  2BTE A;  1NEN B;  1XXG A;  1KLG D;  5AUI A;  1PDX A;  1FCL A;  1NYQ A;  1F0Z A;  3Q8A A;  2WXJ A;  4YT0 B;  4A6Q A;  1HZ6 A;  1FEH A;  1ET6 A;  2MH7 A;  2TSS A;  2KQ4 X;  3EGR A;  5HFY A;  1WRI A;  4US9 A;  4ZHP A;  2N7J A;  3GB1 A;  2HDE A;  3LYY A;  3SFD B;  3HRD D;  4OZA A;  1SE2 A;  2V3P A;  1MPE A;  1YN5 A;  2WXK A;  3V3X A;  3AE7 B;  5BYS A;  3NVW A;  3O13 A;  2K0P A;  3BWU D;  2QSD A;  1J7B A;  1JW9 D;  1CJE A;  4B0E A;  2INN E;  2KWD A;  2I38 A;  1IGC A;  1ZDV A;  2DYM A;  2M0A A;  5E6J A;  1I4X A;  2PKO A;  2NTT A;  3VR9 B;  1FRD A;  3U52 E;  1AWD A;  2W3S A;  2R61 A;  2K3U A;  3MC0 B;  2CJO A;  4GDL B;  4J3O D;  3ZJU A;  1SE3 A;  2MEK A;  2WXG A;  4XWT A;  2BS3 B;  2FE8 A;  2RDG A;  2PLP A;  4MH8 A;  1TS5 A;  3NRZ A;  3PO0 A;  3B9J A;  2QIE B;  3VRB B;  5G5G A;  4DXF A;  4TQ0 A;  5EE1 A;  3GP7 A;  1ET9 A;  1SE4 A;  1E10 A;  1FXA A;  1ESF A;  1VJK A;  2INP E;  3NUH B;  4ZYS A;  5G5H A;  1NYR A;  3NVV A;  4P6V F;  1C78 A;  3AE9 B;  3SFE B;  4YTP B;  1EM7 A;  1TKE A;  1IBX A;  3IAS 1;  1B1Z A;  4B0M A;  1FRR A;  5MPO A;  3FIL B;  2ON8 A;  3TEZ A;  4NAM A;  2WU5 B;  1KRH A;  2WXL A;  5FR3 A;  3RFZ B;  2LUM A;  2KMM A;  1SJH D;  3HVD A;  2EKI A;  1HA5 A;  2AX5 A;  4A55 A;  3AE2 B;  2LEK A;  1QT9 A;  3BZD B;  2QMT A;  1XF5 L;  3RPF C;  2L32 A;  3DWG C;  1EWC A;  2WXH A;  2KAC A;  1CK1 A;  1TY2 A;  1P7E A;  3PZ7 A;  3W1S A;  4GLS C;  3KWL A;  3BVM A;  4DXG A;  4ZHO A;  1P7F A;  3E9S A;  1FD6 A;  1T3Q A;  4XE0 A;  2Y5C A;  1C76 A;  1FFV A;  1NEK B;  4C56 C;  2WS3 B;  3P42 A;  3AE4 B;  1KF6 B;  2H88 B;  2J53 A;  4WQM A;  5C3J B;  1HZ5 A;  4ARC A;  1SSN A;  4L2Y A;  3AEA B;  2Z8L A;  2QJL A;  4JX1 C;  3AE6 B;  2L83 A;  3AE3 B;  1TS4 A;  2WDQ B;  1XLP A;  2HTM E;  2IGD A;  4ZRP A;  1V1P A;  4OZC A;  2MJE A;  4XDD A;  1L6U A;  1N5X A;  2WXO A;  2XNA C;  1ROE A;  1TYG B;  1PFD A;  1YN3 A;  3P63 A;  3AED B;  2VZK B;  1E7P B;  1T6B X;  2BB6 A;  2GI9 A;  3TEX A;  1DOY A;  4H2A A;  1ACC A;  1STE A;  2LHD A;  2QEJ C;  3R2T A;  2E3T A;  2WXQ A;  3MFG A;  3NS1 A;  2KDM A;  2PIA A;  4ZOH C;  4HRS A;  2JYE A;  4GDK B;  2MJ3 A;  4C7Z A;  2WDV B;  3Q8B A;  1K51 A;  2AQ2 B;  4KGT A;  3BK2 A;  1E9M A;  3SEB A;  4US8 A;  2SAK A;  5D7G A;  2W3R A;  2IDY A;  2B76 B;  5JXV A;  1D5X C;  3Q8E A;  3IXS A;  1GAQ B;  1KFY B;  3HUI A;  5BMI A;  1XEE A;  1ENF A;  1PGB A;  2BS2 B;  4OW0 A;  2CU3 A;  2PTL A;  3N9Y C;  4WIP A;  4A90 A;  2LFI A;  3TEW A;  3ZJT A;  5BYQ A;  4MT5 A;  1A70 A;  3AEF B;  1FNU A;  1L0Y B;  2BS4 B;  1VRA B;  1FCC C;  1FXI A;  2BBC A;  3E56 A;  1FFU A;  1E0Z A;  3AEB B;  2DLB A;  2L52 A;  2J4X A;  3DWM A;  4KKI A;  1WXQ A;  3VR8 B;  1KLU D;  1RFK A;  4IDI A;  1UWM A;  1JRP A;  1I4G A;  2J42 A;  3AEG B;  4RGT A;  1JRO A;  3B2G A;  1C9F A;  2IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...