3E56A

The 2.0 angstrom resolution crystal structure of npr1517, a putative heterocyst differentiation inhibitor from nostoc punctiforme
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
LEVGVYECEIHLKFRLIEEKSLLSDREQLLQVLLDALTEGSDDFLETLQASVKAQEVSEFKASPQMRRQLMRLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of Npun_R1517, a putative negative regulator of heterocyst differentiation from Nostoc punctiforme PCC 73102.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18068 Npun_R1517 Npun R1517
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.450 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3e56A00
3E56A
chains in the Genus database with same CATH superfamily
1Q1OA 4NJ7A 3RNEC 3ZQ4A 3QCAA 1M94A 2WXNA 2IO0B 5J18A 2N1VA 5IN7A 2MSED 2MBQA 4JLCA 3SD5A 4PS7A 2JZPA 1E8ZA 2LHDA 3AE1B 2CHWA 4Q2JA 3TMPB 2DAJA 1WR1A 2GBNA 5E6OA 3RYTA 4ITKA 1YJ1A 2J7QB 3X23A 2RDGA 2DAFA 3DBRI 3ZTDA 2ON8A 2NCNA 1E5WA 1KRHA 1QF6A 5J2RA 4XWWA 2KVZA 3BY4B 3VTVA 4DK5A 3AU5A 3DHGC 2KANA 3U30A 3IAM1 2AWTA 3ZDMC 3TEYA 4ZYSA 1TS2A 1FIQA 2WDQB 4A55A 4GDLB 4HRSA 2KJRA 3I9V1 4JL9A 4MACA 4OZCA 3HM6X 2J4XA 3QX1A 1TS5A 3R2IA 4FHKA 4I6NB 3VTUA 3NY5A 1OQYA 2NPTB 2J0JA 3R8BA 1OQRA 4DHJD 1IGCA 3DDCB 4ARIA 2HTME 1A70A 5BYRA 4RM8A 4US8A 4RM9A 1H4RA 3VDZA 2BKFA 4BKGA 4IM3A 2EELA 5EE1A 4KGRA 4AJYB 1T3QA 3AI5A 2HTHA 4AQ7A 3UQBA 3PLUA 1YJJA 3GS2A 5I4DA 1CMXB 3V05A 2KX3A 3Q3MC 2LUEA 2KZRA 2PPHA 1NI3A 1ZP0B 2CS4A 4K7UA 1CK1A 3PPAA 1QZEA 4KSKC 3U8ZA 1UGMA 3ZRCA 3GB1A 4HKQA 1L0YB 3NVWA 2CHXA 2KJHB 1F52A 3PZ7A 4HKZE 3M3JA 2DNFA 1WGDA 3IXSA 1QQRA 1XD3B 3ZRFA 4GU2A 4RF1A 4ICVA 4PYZA 1IP9A 4N58A 1BXTA 5LXHA 5MPOA 2QHOA 1FNWA 3VRAB 3CSFA 3OJ3A 3RZWC 5LXIB 1WR6E 5H8YE 1VDVA 1JWMD 2N9XA 4LJOB 2DYBA 5BYSA 4K81A 2W54A 4RGMA 3U7DA 2QC8A 3UINB 1E10A 3AE8B 2M0AA 1MPEA 2ASQA 1D5XC 4XE0A 1OGWA 2IBIB 1MVKA 4TKNA 1GAQB 2MQJA 1WM2A 4OHJA 4ANUA 1ZDVA 2JPHA 3BVGA 4BOSC 4RFBA 4GDKA 1LO5D 1NEKB 2RPVA 1RWSA 3PSEB 4CO7A 3TSSA 4S17A 3HVDA 1H8CA 4AUQC 4IG7B 2FNJB 3NS1A 2AL6A 1WSPA 4WURA 2LD9A 1ACCA 2K0PA 3BK1A 1N60A 3MC9A 4W9FA 3UQAA 1STEA 1OTRB 1UGJA 1YD8U 2KTRA 4RGTA 1E8YA 3QARA 2LGDA 2LRUA 4KKJA 2N7DA 2XBBC 4J3OD 1R4MI 2M1MA 3QIJA 5FR3A 3H6NA 3MTNB 2WXQA 1WJ6A 3KQ4A 3DWMA 5AZFA 2O2VA 3AXCA 1E8XA 1J7BA 2NTTA 3AEDB 1V9JA 3FAHA 1S3SG 3WCQA 4BAXA 1V97A 2KO3A 1GPXA 5E6NA 2NTSA 3TJPA 3ONSA 3H7PB 5EE0A 3RPFC 3H7PA 1SE3A 2VRRB 1PFDA 1I4QA 2WXFA 3EFCA 2CU3A 3IHPC 5C23A 3ZIMA 3UI3A 4HDQA 1E90A 2JX5A 3V62A 4E3CA 3EC8A 4J6IA 3GZNB 2JT4B 1WIAA 2BS4B 2G3QB 2M4NA 2WXRA 4KIKB 3SDLC 5H92C 4BZAA 1FRDA 5J17A 1WJNA 4PT5A 3QWZB 2K8BA 2DZKA 4IOIE 1BT0A 2IPKD 4HCNB 1XCQL 2KKCA 4XC2A 3ENEA 3CMMB 2ZNVC 1YN5A 4ZRQA 2QCZA 4YT0B 3TEZA 1FPYA 4H2AA 1C1YB 4ANWA 3T8MA 2W82A 2Z59B 2C7MB 4UDUC 1J7AA 1WX9A 4AOFA 2WXJA 3T3OA 2RSUA 3B08A 4IW0A 2WXKA 2V9HA 4P1BC 1XF5L 4BVUC 4HROA 2KQ4X 2LVPA 1JQ4A 1E7UA 3PRZA 4I6PA 1ZPSA 2PVOD 1ZXIA 3N1YC 4W9CA 3GOEA 2D2QA 3LDZE 3V6CB 3BINA 1N62A 4E74A 1FD6A 4TV3A 4LDTD 3AEEB 3B0AA 1IYFA 2KFJA 3AEBB 2KDIA 3RNBC 5TR5A 1J19A 3R2TA 4M00A 2AEHA 2UYZB 1WZ3A 2JVCA 2RDHA 3HVZA 4MH8A 3QAQA 2INPE 4M0WA 4W9KA 3PRMB 1TKEA 3A33B 1LM8B 4N6EB 4ZHOA 4W9DA 1T0QC 4PYUA 3VFKA 2HJ1A 1L6VA 3HM3A 1D6EC 1WM3A 1KLVA 1C4AA 1UH6A 3WALA 3KUDB 2PW9A 4KGSA 1MJDA 1J0GA 2FCMA 4MDKE 3L4PA 2KQSA 3P4PB 3U52E 1L4ZB 4S0RA 5G2NA 2MRPA 3VTWA 2KC2A 4HDOA 3QQ8B 2WDRB 2O6VA 1WXSA 5GMVA 3NZSA 3QHTA 2KMMA 2J0KA 1FXTB 1N5XA 3N9YC 1QOAA 2BVCA 2I38A 1FEHA 1WX7A 3Q3FA 1ET6A 2VH2A 4C80A 3K9OB 4DDGD 2N4FA 4FXCA 3FILA 3TEWA 2BB5A 3URYA 2KWCA 1QOGA 2LGXA 3BZDB 4TQ0A 2FUHB 1SB3C 4MGKE 4JX1C 5BO4B 2JYTA 3D32A 3EFUA 3W1YA 3WANA 4B9KA 1D5ZC 4DXFA 1C3TA 2B76B 2ZVNA 4A20A 1JW9D 1RFAA 5C2TB 4KV2A 4M8NA 1UZXB 3DPDA 1JROA 2KHWB 4IKGA 3AULA 3I57A 1ENFA 4C56C 4MGZE 2LGSA 4JIOU 2WXHA 3BVZA 2SEBD 3DBLB 4N59A 2BQQA 4K3BA 2LEKA 1GUAB 4KZCA 1PGXA 2MA9B 3A9JB 2R2QA 5IAAC 4ZOHC 4KDLB 2K9XA 4JPSA 3P42A 4G3XB 2AYOB 1XT9B 1PDXA 3PHWB 3TUOA 4G11A 1AARA 1TJEA 5D3DA 3ZXVA 4XDDA 1Q0WB 2WXPA 2LASA 4WJOA 3MP9A 3ZNID 1D3ZA 1B9RA 1KTKA 5IO9A 4NAWB 2L8JA 2CHZA 2HJ8A 4NAWA 1N5WA 4OZBA 3KYCD 1TGZB 3RD2A 2GBJA 5G5GA 1YN4A 4ZHPA 1I7HA 2D07B 4HWIB 4HPPA 3ML8A 1VJKA 2MBHA 2AL3A 5IKCM 3MHZA 2YLMA 3I3TB 2R61A 2CU1A 2LHEA 5GXGB 2K22A 2ONQA 4WH4A 3DWGC 1WF9A 3PTFC 2C7NB 1XQQA 1C76A 3BVMA 1GNUA 2C5LC 2BYFA 3W9CB 3W2DA 1V86A 3E56A 2FIFA 4C7ZA 1F0ZA 3KWVA 4D2KA 4WAAA 3GP7A 2DLBA 1TY2A 1UF0A 3IT4B 2NBUA 2UWQA 3BK2A 4MGIE 3HUIA 4LNOA 3LXFA 2LZ6A 1ISNA 2MJ3A 4RGNA 3KLSX 2JQRB 1XLNA 1F2RI 2K39A 1I4HA 3UGBB 2LWPA 1KLGD 3AH7A 2L00B 3ZJUA 4XX5A 1CQVA 4P7IA 3DBHB 3AE9B 1DOYA 4K7SA 2OHFA 3AE4B 1E9MA 4REZA 1I4PA 4WIPA 5IP4D 3RT3B 2KD0A 2N0SB 1ESFA 3BYYB 4OVUA 3WA0A 2DYOA 5KHOA 1YNTE 3EGRA 2L7RA 2VZKB 1NI2A 4IUMB 4GXBA 1NBFC 2GRIA 5LNK1 5E6PA 3GZNI 4LTUA 1R4NB 5HKHA 3VRBB 5HG2A 4W9JA 3LYYA 2N1WA 2LXCA 3CF6E 4G50A 1C4CA 2IDYA 4DHZE 1WZ0A 4FJVB 1LFDA 1VLBA 4JWUC 3QJZA 1E8WA 4R3DA 3RCZA 1TS3A 4EOYA 3VUYA 1IUEA 4M02A 3L10B 5JZEB 2C9WB 4HCPB 2NR2A 3A9KB 4II2B 3A9KA 3L54A 2L1AA 3Q3OC 2MBOA 4F1SA 1ZW7A 3Q8FA 2NS5A 2QJLA 3ZW3A 2JU6X 3KWLA 1Q10A 4JGHB 4AS1A 1SJHD 2BGFA 2ZPNA 4LNIA 4LJPB 3L0WB 3FKYA 4GDKB 3ZUNA 5AEKB 3PGEA 2M0XA 2PEAA 3NVZA 2QDFA 4WWOA 1YQBA 1WYWB 2C7HA 3B2FA 1TZOA 3Q6BA 2MJEA 4RGOS 2R2OA 1UD7A 2L83A 1AWDA 1DOXA 2LRWA 2N9LA 1XLOA 4HPLB 4TSSA 2H89B 1FRRA 3UF8A 2WX1A 2OOBB 3Q3JA 3SU8X 2KTRB 2KDFB 3Q8BA 1L0VB 3MC0B 2CJNA 2IYDB 2HD5B 3MFGA 4WWMA 2JRHA 4A90A 1P9DU 1JWUD 4ZRIA 2RDBC 3R66C 1Z5SB 2V1YA 2KX0A 4ZDVA 1WRIA 5CHFA 4IM0A 1V5OA 1WE6A 2VH1A 2O2VB 3N1ZC 1QKZA 1EF5A 3IG3A 1HA5A 2WXMA 5DPRA 2IO1B 5JHBA 2LMCA 3Q69A 4MH0E 3X0WA 3VR8B 2DHZA 1QT9A 4RMAA 5DPTA 1NDDA 5HHDG 1KF6B 1QOBA 2KVRA 2FAZA 3VUWA 3B2GA 2ZEQA 4W9LA 1P7EA 3CWIA 3C19A 3MJWA 4FULA 1WFYA 1L0XB 2Z8LA 4ZYNA 1GOZA 4MM3A 1I4XA 2D3AA 4NNJB 1VZ6A 3ZNZB 4B95A 1JALA 1P7FA 1HTQA 3PHXB 2YEPF 3H9DA 2J52A 4IC7B 1L5PA 4ZRJA 4MT5A 1FXIA 4MJSA 4EZKA 2DBYA 3NG0A 3SR6A 4EZJA 3NZUA 2IGDA 2DENB 2JWUA 4F7ZA 3CSTA 2AQ3B 3KYDD 1EF1A 2UU7A 3AB5A 4II3B 3PZ8A 2FIDA 4EUTA 3AE5B 4BOZB 2EMTA 4IWOA 4A9AA 1TZ1A 1EU4A 1K53A 2GOWA 4YSXB 2IO2B 2GB1A 1WH3A 4FA6A 3UIOB 1XO3A 3U4EG 5EDSA 5D7GA 3TCAA 2LVOA 3Q2AC 1LQBA 2ZW1A 3ZNGC 4AJWA 3O65B 4ANVA 1MG8A 1YX5B 1WWTA 1JWBD 3Q14C 4XGAB 2RMMA 4OZAA 1L6UA 3ZJVA 3VR9B 4AP4C 2BPSA 3DBLI 4YL8A 1BMLC 3W1SC 2OJWA 3TEXA 1UBQA 2Y5CA 1WJ4A 2V3SA 4G0NB 1TBEA 1JRUA 2PE9A 2KN5A 2L0FA 1UNSA 1KLUD 5BYQA 1PGAA 2JZZA 2GBMA 3AE3B 3ZO5B 2BBCA 4GOCA 3Q8EA 2EKIA 3V3XA 2JXXA 5JH5C 4EKUA 1K50A 2J53A 1WI0A 4ARCA 2D3CA 3LJ3A 2FCSA 2KWUB 1SIFA 4N9F4 2LUMA 1NYQA 3LB8C 1XLPA 1MHXA 1ET9A 2KTFA 1EU3A 3M63B 3H7SA 1Y8RC 2ZNVB 2GI9A 4M0WB 3KH0A 3ZYYX 4BKSA 1A5RA 3L16A 2ZZPB 4YWGG 2INDC 4YSZB 5LLIA 3HHMA 1C77A 2PKOA 3UIPB 4FJZA 4GN1A 2YVCA 1V2YA 2K8CA 3NVYA 4TMAB 3KUZA 2ZVOA 3J9CA 1V49A 3NJTA 2MEKA 1GG3A 3NVVA 1L2NA 3AEGB 1F9JA 5C1ZA 1R7SA 4WWNA 1FFVA 2ZCBA 3I5JC 4A6QA 4YTNB 1V81A 1V8CA 3NUHB 1KM7A 3GE8C 2KDBA 2KACA 2W55A 4DXAB 3W1SA 5D94A 2CR5A 1FO4A 2O6VB 3N32A 4IWPA 1FMAD 1N63A 1GC6A 1SBBB 1GC7A 3JVZX 2MWSB 1VD2A 3ZGZA 4DQOC 1SXTA 4RH6A 4BBNC 3PO0A 1JRPA 4A8XC 3ETRA 3FILB 1SE2A 2L32A 3DBHI 2Y5PA 1Z2MA 2FE8A 3PLVA 1SGHA 1UUPA 4P16A 3SEBA 1E0ZA 2J42A 3P1MA 2MCNB 3WAMA 2MLBA 1S1QB 3AN1A 4O1NA 4W9HA 3DVGX 4GB9A 2CJOA 1NENB 3N20C 2N9EB 2FCQA 2H88B 4KX6B 4ZRPA 2PLPA 2V0GA 3RFZB 2RPQA 4K1RB 4NZLB 3AEAB 3NRZA 1X1MA 5HFYA 3K9PB 3RMKC 2N7JA 1T0SC 1D5MC 3VQIA 3FC4A 2BW2A 1MI0A 3RI7C 1RM6C 4L2YA 1R4NI 1Q5WB 4FBJB 2HE7A 3M62B 2E6XA 3ZNHB 1FM0D 2OJRA 2RGFA 3ABVB 1P3QU 4WJPA 2WGSA 3KVFB 2L76A 5FR6A 4CQNA 1E7VA 3N30A 2W9NA 1T0RC 1C9FA 2XK5B 4ASWC 4KZ0A 4LCDE 2WXIA 3SFDB 2XK5A 2MP2B 1YIWA 3KW5B 1EWYC 4PK1A 3P4SB 3L08A 2MP2A 3ML9A 3O13A 3ZKJC 1FNUA 4US9A 1V6EA 2QMTA 4KDIC 1RAXA 1XEEA 1LXDA 1NVID 1SEBD 1MHHE 1ZXHA 2JXTA 4HEA1 5CHWA 1VRAB 1WGKA 1RFKA 2BYVE 2K5PA 1QILA 3IBEA 1VZ8A 2LFIA 2XEWA 3HIZA 1EWCA 4YXDB 2K6DB 2WQYB 1TYGB 3IFWB 4WWPA 1ROEA 4XDCA 2KMAA 1UWMA 3MJ5A 2GBKA 1WXMA 1WGHA 2WNMA 4CYEA 4C4VA 3JYUA 1MFWA 4EE2A 4PS3A 2K25A 3VH3B 4GSWA 3PZDA 2J0MA 4NQKE 1JCKB 1WMHB 3L13A 2WDTB 1IGDA 1WMHA 1PQSA 2NMQA 4RCOA 3BYTB 2SAKA 1J8CA 3BWUD 5E6JA 4EZLA 4JWSC 2LJIA 1UELA 3APCA 2BF8B 4KKIA 3Q8CA 2N7EA 4JE3B 2VZKD 1M4VA 3ALBA 2ZW0A 2DZIA 2IGGA 5CX3A 3T9LA 1HE8A 2QSDA 4URKA 1L4DB 1ZOYB 2BS2B 4ANXA 1I4RA 2ACZB 1XLQA 3DVGY 4IWQA 3A4SC 3B9JA 2YEPB 3PS6A 4X57B 3A4RA 3AU4A 4JQWC 1D4BA 4GDLA 3R7RA 4PS8A 1E7PB 1WXVA 3SFEB 2DX5B 2A5UA 4HLEA 4M8MA 3AM9A 3PV1A 4TUUA 4XZ4A 2NPTA 2MBEA 1T5XD 2DWQA 2ZPYA 1WJUA 3QK0A 1XXGA 3N1XC 2M19A 4USAA 3U2SC 1TS4A 3DBSA 4FADA 4IDIA 5D6JB 2IJ0A 2BT6A 4L23A 1KFYB 1MG4A 5IA7A 3A1QB 2C60A 1K8RB 2INCC 3A1QA 4B0EA 1VR9A 3C8YA 2WLBA 3TBLD 1FCLA 3DHHC 2E3TA 3NOBA 1L7YA 2FBWB 2KWDA 1UBIA 3ZLZA 3OLMD 1ZE3D 2V4LA 4NJ6A 1XCTL 2BB6A 5D2MB 4C00A 3TIXA 2WYQA 1SE4A 2JYEA 5D3IB 3EUB2 4DXGA 4KSLC 4DHJB 3RZFA 3H1UA 2WX0A 5KHQA 2BWFA 1RYJA 2DZJA 4HJGE 3VHTC 2KDMA 1F2RC 2LVQA 2WDVB 1F1HA 4EFOA 2G1EA 3V6EB 5DPWA 3VVWB 2MHJA 2D5GA 2BTEA 4AWJA 2WU5B 1T6BX 3P4QB 1DGJA 1P0RA 2IY0B 2D3GA 5TSSA 1TT5B 1V5TA 3S2AA 2G45B 1AW7A 2MH7A 2JSVX 3GE3C 4FJYA 4WQMA 3PVLA 2FCNA 2KDEB 4NJCA 1GJZA 4HK2A 2X8XX 1DYQA 3IVFA 2PJHA 1WGRA 3ZXRA 1SIJA 1PYWD 3TL5A 4BBNF 2WU2B 4YTPB 2KQ7A 3W5VB 2RD0A 5AUKA 2GLSA 4TQ1A 5JHAA 4GLSC 5AUIA 3R7QA 3SHQA 3DBRB 2BWES 3VXWA 3MHSD 1HQRD 2KJ6A 1K51A 1SF0A 2BYEA 4QAYA 4BKTA 3CIRB 4WJQA 1HZ5A 4DDID 2NBWB 2XN9C 1YX6B 3BIID 4WAFA 1N6ZA 2ZJDA 4XWTA 2IO3B 2N9KA 3ECIA 2JF5A 1V1PB 4MSMB 1TIFA 4B6WA 3V61A 1V1PA 2AX5A 1EUVB 3AE7B 2QILA 2WWZA 3B1LX 2I2YA 3RNFC 1G6JA 2WHIA 2JZ3B 3EHVA 4HXDA 1JWAD 2B3AA 1Y56A 2LXAA 2KXJA 2DYMA 3C0RB 5L95C 2L05A 2FUG1 1EM7A 5IOIA 3RUIB 3DCGA 3DVNU 3QC8B 1JMLA 1EO6A 4GMVA 1YMHE 1UWXA 1VZ7A 3AV8A 1OEYJ 2RR9A 2BYTA 2KLGA 4K7WA 2PMVA 2KLCA 1C79A 4MM3B 2LGIA 4ZRKA 4P6VF 4ACFA 1ZGUB 3ZJTA 5DCNA 1WYGA 2K8HA 2D11A 2KOXA 2NVUI 2G4DB 2L52A 5G55A 3OG5A 5FK9C 3ZTCA 1NYRA 1OEYA 1YN3A 2QEJC 4MJSB 5EE9A 3KUCB 3L17A 3WIMA 3APFA 3P63A 4I6LB 3RULA 3P2BA 1K52A 2WP9B 3NS8A 2MJDA 2ZCCA 1U4AA 1LGRA 4KIKA 2M56B 2D10A 4OW0A 2W3RA 1GB1A 4NY0A 3AMZA 3MC8A 4FHJA 4LLGM 2LI5A 1HEZE 3EECA 1TKYA 2KNBA 4FLHA 1KOTA 1TKGA 3DHIC 1AN8A 1VCBA 4BKSD 1KH0A 2TSSA 4DHZB 2QIEB 4LK0M 3EA6A 3I63C 2Y5BB 1OFFA 1C4PA 5T8IA 1J7CA 4NAMA 1WY8A 3AEFB 1JWSD 4K3CA 4EEWA 2I1KA 1IBXB 3WAOA 1IPGA 1GB4A 1IBXA 4P1CC 1FNVA 4W9EA 4RNAA 2DZMA 1KJTA 2K3UA 3Q8AA 2EMSA 2WS3B 3JW0X 1I35A 4LNNA 3AECB 5L83A 4HVBA 2AQ2B 1SE9A 2M8SA 2K1FA 1BUIC 5BMHA 1YOVB 3R3MA 1RRBA 2Z0EB 1WX8A 3T3NA 2O6VD 2I1JA 1YQ4B 3HK0A 2V3PA 4W9GA 1WE7A 3M95A 1ZDXA 5AZHA 4WJNA 2V3NA 2PE6B 2JY6A 3Q3NC 2L0TA 4OVVA 3NHEB 1WGGA 2Z0DB 2M17A 3OAWA 3HRDD 1R4MB 2G9HD 5HI1A 2MBBB 2KK8A 2WXGA 1SJED 1CZPA 2GBRA 4WQOB 1ZUD2 2OEDA 1FXAA 3RNGC 3WAPA 1OQQA 2PTLA 2IGHA 5C3JB 3ZDTA 3VAWA 2D3BA 3E9SA 4BFRA 1C78A 3AE6B 1TY0A 2WXLA 2X38A 3RNCC 2AQ1B 5BMIA 2K6QA 1WGYA 5EE3A 1WRDB 2BS3B 3H8HA 4A3OA 4DWFA 3NZ3A 2XNAC 2G4SA 4LDTB 3U7ZA 5G5HA 1T0YA 4RF0A 1E6EB 5BMGA 3JSVB 5JXVA 2EKEC 2JWZA 4F8CB 1F77A 2REXA 4XYCA 1V1OA 3DOWA 1HTOA 3JSVA 3V60A 1SSNA 2PVGC 2V4IB 4E71A 3OJ4B 2HDEA 3IT6B 2GMIC 4GIVA 1TTNA 2L3ZA 2KN4A 1HXYD 4MSQB 4YSYB 2IY1B 2N9PC 4IM2A 3N3KB 3DVNV 1I42A 1QLBB 1WXQA 2CKHB 4A3PA 2LGYA 4NPNA 1YJIA 2Y3AA 3OWEB 5FKAC 4NQLB 1P1AA 1N61A 1I4GA 4MEMA 3AE2B 4MGYE 1PGBA 2W3SA 4LNKA 4KGTA 4LNFA 3ZVVA 2A4ZA 3P4RB 4YTMB 4OVZA 4CHKA 2JRIB 3QA8A 2JUOA 4GGQA 2KFKB 2LJ5A 4W9IA 2KFKA 2KT7A 4HJKA 5CTRC 4C7YA 2NBVB 1DOIA 3PREA 1YQ3B 1FFUA 2KMCA 2ICIA 1ZKHA 4M01A 2Q5WD 1AYFA 1CJEA 1HZ6A 3PRPB 4ICUA 2MW5A 1QOFA 4FN2A 3VUXA 2KC1A 4HPMB 3W5UB 1RLFA 2MX2A 4KVGB 3A9JA 2IZVB 1FCCC 1V80A 2KYWA 2INNE 3APDA 3DQVA 2BKRB 2WXOA 4MELA 5AZGA 2KWVB 1WXAA 5CHVC 3IAS1 3VH4B 2PIAA 3RN9C 4C4VB 4DBGA 1B1ZA 1P98A 3PT2B 5DPSA 3RNAC 2KAJA 4L1BA 1PUTA 4B0MA
chains in the Genus database with same CATH topology
1RYJA 4HJGE 1JALA 3ZQ4A 1P7FA 2YEPF 2KDMA 3L4PA 2J52A 1F2RC 1L5PA 4MT5A 1FXIA 2WDVB 3P4PB 2WXNA 2DBYA 3U52E 2G1EA 3SR6A 1L4ZB 2D5GA 2JZPA 2BTEA 2LHDA 2IGDA 2WU5B 3AE1B 1T6BX 3P4QB 2JWUA 1DGJA 4Q2JA 2AQ3B 2WDRB 5TSSA 3AB5A 3PZ8A 4ITKA 3AE5B 2KMMA 2RDGA 1AW7A 2MH7A 2JSVX 4A9AA 1N5XA 1EU4A 3N9YC 1K53A 1QOAA 4WQMA 4NJCA 4YSXB 2GB1A 2ON8A 1DYQA 2I38A 1FEHA 1XO3A 3U4EG 1SIJA 1PYWD 1KRHA 5D7GA 2WU2B 4YTPB 1QF6A 3W5VB 1ET6A 4C80A 4XWWA 2ZW1A 4FXCA 5AUKA 3FILA 3TEWA 4TQ1A 2BB5A 3URYA 3IAM1 1QOGA 3BZDB 4GLSC 5AUIA 4TQ0A 1SB3C 3TEYA 1WWTA 1JWBD 4ZYSA 1TS2A 2RMMA 4OZAA 1L6UA 3ZJVA 1FIQA 4JX1C 2JYTA 2WDQB 3VR9B 1HQRD 4GDLB 4A55A 4HRSA 1K51A 1SF0A 3I9V1 4MACA 4OZCA 1BMLC 2J4XA 1D5ZC 1TS5A 3R2IA 3TEXA 3CIRB 4DXFA 2Y5CA 1HZ5A 2XN9C 2B76B 3BIID 1JW9D 1KLUD 1UNSA 4WAFA 5BYQA 5C2TB 1PGAA 4XWTA 3R8BA 3AE3B 1JROA 2BBCA 4IKGA 3Q8EA 1OQRA 4ARIA 1IGCA 2EKIA 3V3XA 2HTME 2N9KA 3I57A 1A70A 5BYRA 1ENFA 1V1PB 4US8A 1K50A 2J53A 4ARCA 4C56C 1V1PA 2AX5A 2EELA 3AE7B 2QILA 5EE1A 4KGRA 2WXHA 3BVZA 2LUMA 1T3QA 2SEBD 1NYQA 4AQ7A 2I2YA 3LB8C 4N59A 1XLPA 1MHXA 1ET9A 1YJJA 2LEKA 1EU3A 3GS2A 1JWAD 5I4DA 1PGXA 1Y56A 2DYMA 4ZOHC 3V05A 2GI9A 2K9XA 3ZYYX 2FUG1 4JPSA 1EM7A 3P42A 4YWGG 1JMLA 1YMHE 1NI3A 1ZP0B 4YSZB 1PDXA 1CK1A 3TUOA 1C77A 2PKOA 1UWXA 1VZ7A 3AV8A 3GB1A 1TJEA 5D3DA 4HKQA 4XDDA 2BYTA 1L0YB 2PMVA 3NVWA 2WXPA 3NVYA 3PZ7A 4TMAB 1C79A 4MM3B 2LGIA 3J9CA 4HKZE 4P6VF 3ZJTA 2MEKA 3MP9A 1WYGA 3IXSA 3NVVA 1B9RA 1QQRA 1KTKA 4NAWB 3AEGB 2L52A 4RF1A 5FK9C 1R7SA 1FFVA 1N5WA 4OZBA 1NYRA 4N58A 1YN3A 2QEJC 1BXTA 5G5GA 4A6QA 1YN4A 4YTNB 5EE9A 1I7HA 4ZHPA 1V8CA 3NUHB 3P63A 5MPOA 1FNWA 3VRAB 1VJKA 2KACA 2W55A 3MHZA 3W1SA 2R61A 2LHEA 5H8YE 1VDVA 5GXGB 1FO4A 2K22A 2ONQA 1JWMD 1K52A 4WH4A 1FMAD 2WP9B 3DWGC 5BYSA 1N63A 2W54A 4RGMA 2MJDA 1SBBB 1C76A 2M56B 3BVMA 3ZGZA 4OW0A 3W9CB 3W2DA 1E10A 2W3RA 3AE8B 1GB1A 4DQOC 3E56A 1SXTA 3AMZA 2M0AA 4RH6A 4LLGM 1MPEA 1D5XC 4XE0A 4C7ZA 1HEZE 3PO0A 1F0ZA 3KWVA 1TKYA 4D2KA 1MVKA 1JRPA 1TKGA 1AN8A 1GAQB 3ETRA 4A8XC 3GP7A 2DLBA 3FILB 1SE2A 1TY2A 1KH0A 2TSSA 3IT4B 2L32A 2QIEB 2Y5PA 3BK2A 4OHJA 2FE8A 4LK0M 3EA6A 1UUPA 1ZDVA 3HUIA 1OFFA 4P16A 1C4PA 3BVGA 3LXFA 5T8IA 1J7CA 2MJ3A 4RGNA 4NAMA 3SEBA 3KLSX 1E0ZA 2JQRB 2J42A 3P1MA 4RFBA 3AEFB 1XLNA 1JWSD 1F2RI 1LO5D 1NEKB 2RPVA 3AN1A 1RWSA 4O1NA 1IBXB 2CJOA 1NENB 3TSSA 1GB4A 3HVDA 1IBXA 1I4HA 2H88B 4KX6B 3NS1A 4ZRPA 2PLPA 2V0GA 3RFZB 1WSPA 4WURA 1KLGD 1FNVA 3AH7A 4RNAA 3ZJUA 1ACCA 2K0PA 2K3UA 1CQVA 3BK1A 3Q8AA 4NZLB 3AEAB 3NRZA 1N60A 2WS3B 3AE9B 1DOYA 1STEA 5HFYA 1UGJA 2N7JA 2OHFA 3AE4B 3AECB 1D5MC 4RGTA 3VQIA 3FC4A 1E9MA 2AQ2B 1I4PA 2BW2A 4REZA 1MI0A 4WIPA 1BUIC 5BMHA 1RM6C 4KKJA 2N0SB 4L2YA 1ESFA 4J3OD 3BYYB 5FR3A 3T3NA 2E6XA 2WXQA 1FM0D 2DYOA 3ABVB 1YNTE 1YQ4B 3DWMA 2V3PA 3EGRA 3KQ4A 2VZKB 1J7BA 2NTTA 3AEDB 1ZDXA 4CQNA 3FAHA 2V3NA 1C9FA 2GRIA 3WCQA 5LNK1 1V97A 2WXIA 3SFDB 1GPXA 1EWYC 4LTUA 2NTSA 3P4SB 3HRDD 3O13A 5HI1A 2G9HD 3VRBB 5HG2A 3LYYA 1FNUA 4US9A 2WXGA 5EE0A 1SJED 2QMTA 3RPFC 1SE3A 1CZPA 1XEEA 1C4CA 1NVID 1PFDA 1ZUD2 2IDYA 1SEBD 2OEDA 1FXAA 1MHHE 1I4QA 1ZXHA 1OQQA 2JXTA 4HEA1 2WXFA 2PTLA 2IGHA 2CU3A 1VRAB 5C3JB 1WGKA 1RFKA 2K5PA 1VLBA 1QILA 3UI3A 1VZ8A 2LFIA 1EWCA 3E9SA 4YXDB 2JX5A 4JWUC 2WQYB 1TYGB 1ROEA 4R3DA 1C78A 3AE6B 1TS3A 1TY0A 2WXLA 2X38A 2AQ1B 4XDCA 5BMIA 1UWMA 1IUEA 5EE3A 3MJ5A 2BS4B 2BS3B 3H8HA 2WNMA 3NZ3A 2WXRA 2XNAC 2L1AA 3U7ZA 4EE2A 5G5HA 5H92C 4RF0A 1E6EB 1FRDA 5BMGA 3Q8FA 4PT5A 2QJLA 5JXVA 1JCKB 4IOIE 1F77A 2IPKD 1V1OA 1XCQL 1IGDA 1SSNA 2PVGC 2V4IB 2NMQA 4RCOA 2HDEA 3BYTB 3IT6B 2SAKA 2JU6X 3BWUD 3KWLA 5E6JA 1Q10A 4JWSC 2LJIA 2KN4A 1YN5A 4AS1A 1SJHD 1HXYD 4KKIA 3Q8CA 4ZRQA 4YSYB 4YT0B 4JE3B 4GDKB 2VZKD 3TEZA 1QLBB 3NVZA 1M4VA 1WXQA 4H2AA 3B2FA 1TZOA 2MJEA 2ZW0A 4RGOS 1YJIA 2Y3AA 2IGGA 3OWEB 2QSDA 5FKAC 1N61A 1L4DB 2L83A 1AWDA 1ZOYB 2BS2B 1DOXA 1I4RA 1I4GA 2ACZB 3AE2B 2W82A 2N9LA 1PGBA 1XLOA 2W3SA 4KGTA 4TSSA 2H89B 1FRRA 1XLQA 4UDUC 1J7AA 3P4RB 4YTMB 2WXJA 3B9JA 3T3OA 2YEPB 1L0VB 3MC0B 3Q8BA 4OVZA 2CJNA 2WXKA 3MFGA 4WWMA 4A90A 1XF5L 4HROA 1D4BA 1JWUD 2KQ4X 1E7PB 1JQ4A 3SFEB 1ZPSA 2PVOD 1ZXIA 3AM9A 1WRIA 1T5XD 4C7YA 2DWQA 1N62A 1DOIA 1XXGA 1YQ3B 1FD6A 1FFUA 2M19A 4USAA 1QKZA 3U2SC 1TS4A 3AEEB 1HA5A 2ICIA 4IDIA 2Q5WD 2WXMA 1AYFA 2IJ0A 2LMCA 1CJEA 3Q69A 3AEBB 3VR8B 1HZ6A 2BT6A 4L23A 1KFYB 1QT9A 3R2TA 1QOFA 4B0EA 1VR9A 5HHDG 1KF6B 3C8YA 2WLBA 3W5UB 1FCLA 1QOBA 2RDHA 2E3TA 3HVZA 4MH8A 2FBWB 3B2GA 2KWDA 2INPE 1FCCC 4M0WA 1P7EA 2INNE 1ZE3D 1TKEA 4N6EB 4ZHOA 1XCTL 2BB6A 2WXOA 3CWIA 1L6VA 1D6EC 1SE4A 1L0XB 1C4AA 2Z8LA 1GOZA 1I4XA 2JYEA 3EUB2 3IAS1 5D3IB 2PW9A 2PIAA 4KGSA 4DXGA 1B1ZA 2KAJA 4L1BA 1PUTA 1VZ6A 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E56 A; 
#chains in the Genus database with same CATH topology
 1Q1O A;  4NJ7 A;  3RNE C;  3ZQ4 A;  3QCA A;  1M94 A;  2WXN A;  2IO0 B;  5J18 A;  2N1V A;  5IN7 A;  2MSE D;  2MBQ A;  4JLC A;  3SD5 A;  4PS7 A;  2JZP A;  1E8Z A;  2LHD A;  3AE1 B;  2CHW A;  4Q2J A;  3TMP B;  2DAJ A;  1WR1 A;  2GBN A;  5E6O A;  3RYT A;  4ITK A;  1YJ1 A;  2J7Q B;  3X23 A;  2RDG A;  2DAF A;  3DBR I;  3ZTD A;  2ON8 A;  2NCN A;  1E5W A;  1KRH A;  1QF6 A;  5J2R A;  4XWW A;  2KVZ A;  3BY4 B;  3VTV A;  4DK5 A;  3AU5 A;  3DHG C;  2KAN A;  3U30 A;  3IAM 1;  2AWT A;  3ZDM C;  3TEY A;  4ZYS A;  1TS2 A;  1FIQ A;  2WDQ B;  4A55 A;  4GDL B;  4HRS A;  2KJR A;  3I9V 1;  4JL9 A;  4MAC A;  4OZC A;  3HM6 X;  2J4X A;  3QX1 A;  1TS5 A;  3R2I A;  4FHK A;  4I6N B;  3VTU A;  3NY5 A;  1OQY A;  2NPT B;  2J0J A;  3R8B A;  1OQR A;  4DHJ D;  1IGC A;  3DDC B;  4ARI A;  2HTM E;  1A70 A;  5BYR A;  4RM8 A;  4US8 A;  4RM9 A;  1H4R A;  3VDZ A;  2BKF A;  4BKG A;  4IM3 A;  2EEL A;  5EE1 A;  4KGR A;  4AJY B;  1T3Q A;  3AI5 A;  2HTH A;  4AQ7 A;  3UQB A;  3PLU A;  1YJJ A;  3GS2 A;  5I4D A;  1CMX B;  3V05 A;  2KX3 A;  3Q3M C;  2LUE A;  2KZR A;  2PPH A;  1NI3 A;  1ZP0 B;  2CS4 A;  4K7U A;  1CK1 A;  3PPA A;  1QZE A;  4KSK C;  3U8Z A;  1UGM A;  3ZRC A;  3GB1 A;  4HKQ A;  1L0Y B;  3NVW A;  2CHX A;  2KJH B;  1F52 A;  3PZ7 A;  4HKZ E;  3M3J A;  2DNF A;  1WGD A;  3IXS A;  1QQR A;  1XD3 B;  3ZRF A;  4GU2 A;  4RF1 A;  4ICV A;  4PYZ A;  1IP9 A;  4N58 A;  1BXT A;  5LXH A;  5MPO A;  2QHO A;  1FNW A;  3VRA B;  3CSF A;  3OJ3 A;  3RZW C;  5LXI B;  1WR6 E;  5H8Y E;  1VDV A;  1JWM D;  2N9X A;  4LJO B;  2DYB A;  5BYS A;  4K81 A;  2W54 A;  4RGM A;  3U7D A;  2QC8 A;  3UIN B;  1E10 A;  3AE8 B;  2M0A A;  1MPE A;  2ASQ A;  1D5X C;  4XE0 A;  1OGW A;  2IBI B;  1MVK A;  4TKN A;  1GAQ B;  2MQJ A;  1WM2 A;  4OHJ A;  4ANU A;  1ZDV A;  2JPH A;  3BVG A;  4BOS C;  4RFB A;  4GDK A;  1LO5 D;  1NEK B;  2RPV A;  1RWS A;  3PSE B;  4CO7 A;  3TSS A;  4S17 A;  3HVD A;  1H8C A;  4AUQ C;  4IG7 B;  2FNJ B;  3NS1 A;  2AL6 A;  1WSP A;  4WUR A;  2LD9 A;  1ACC A;  2K0P A;  3BK1 A;  1N60 A;  3MC9 A;  4W9F A;  3UQA A;  1STE A;  1OTR B;  1UGJ A;  1YD8 U;  2KTR A;  4RGT A;  1E8Y A;  3QAR A;  2LGD A;  2LRU A;  4KKJ A;  2N7D A;  2XBB C;  4J3O D;  1R4M I;  2M1M A;  3QIJ A;  5FR3 A;  3H6N A;  3MTN B;  2WXQ A;  1WJ6 A;  3KQ4 A;  3DWM A;  5AZF A;  2O2V A;  3AXC A;  1E8X A;  1J7B A;  2NTT A;  3AED B;  1V9J A;  3FAH A;  1S3S G;  3WCQ A;  4BAX A;  1V97 A;  2KO3 A;  1GPX A;  5E6N A;  2NTS A;  3TJP A;  3ONS A;  3H7P B;  5EE0 A;  3RPF C;  3H7P A;  1SE3 A;  2VRR B;  1PFD A;  1I4Q A;  2WXF A;  3EFC A;  2CU3 A;  3IHP C;  5C23 A;  3ZIM A;  3UI3 A;  4HDQ A;  1E90 A;  2JX5 A;  3V62 A;  4E3C A;  3EC8 A;  4J6I A;  3GZN B;  2JT4 B;  1WIA A;  2BS4 B;  2G3Q B;  2M4N A;  2WXR A;  4KIK B;  3SDL C;  5H92 C;  4BZA A;  1FRD A;  5J17 A;  1WJN A;  4PT5 A;  3QWZ B;  2K8B A;  2DZK A;  4IOI E;  1BT0 A;  2IPK D;  4HCN B;  1XCQ L;  2KKC A;  4XC2 A;  3ENE A;  3CMM B;  2ZNV C;  1YN5 A;  4ZRQ A;  2QCZ A;  4YT0 B;  3TEZ A;  1FPY A;  4H2A A;  1C1Y B;  4ANW A;  3T8M A;  2W82 A;  2Z59 B;  2C7M B;  4UDU C;  1J7A A;  1WX9 A;  4AOF A;  2WXJ A;  3T3O A;  2RSU A;  3B08 A;  4IW0 A;  2WXK A;  2V9H A;  4P1B C;  1XF5 L;  4BVU C;  4HRO A;  2KQ4 X;  2LVP A;  1JQ4 A;  1E7U A;  3PRZ A;  4I6P A;  1ZPS A;  2PVO D;  1ZXI A;  3N1Y C;  4W9C A;  3GOE A;  2D2Q A;  3LDZ E;  3V6C B;  3BIN A;  1N62 A;  4E74 A;  1FD6 A;  4TV3 A;  4LDT D;  3AEE B;  3B0A A;  1IYF A;  2KFJ A;  3AEB B;  2KDI A;  3RNB C;  5TR5 A;  1J19 A;  3R2T A;  4M00 A;  2AEH A;  2UYZ B;  1WZ3 A;  2JVC A;  2RDH A;  3HVZ A;  4MH8 A;  3QAQ A;  2INP E;  4M0W A;  4W9K A;  3PRM B;  1TKE A;  3A33 B;  1LM8 B;  4N6E B;  4ZHO A;  4W9D A;  1T0Q C;  4PYU A;  3VFK A;  2HJ1 A;  1L6V A;  3HM3 A;  1D6E C;  1WM3 A;  1KLV A;  1C4A A;  1UH6 A;  3WAL A;  3KUD B;  2PW9 A;  4KGS A;  1MJD A;  1J0G A;  2FCM A;  4MDK E;  3L4P A;  2KQS A;  3P4P B;  3U52 E;  1L4Z B;  4S0R A;  5G2N A;  2MRP A;  3VTW A;  2KC2 A;  4HDO A;  3QQ8 B;  2WDR B;  2O6V A;  1WXS A;  5GMV A;  3NZS A;  3QHT A;  2KMM A;  2J0K A;  1FXT B;  1N5X A;  3N9Y C;  1QOA A;  2BVC A;  2I38 A;  1FEH A;  1WX7 A;  3Q3F A;  1ET6 A;  2VH2 A;  4C80 A;  3K9O B;  4DDG D;  2N4F A;  4FXC A;  3FIL A;  3TEW A;  2BB5 A;  3URY A;  2KWC A;  1QOG A;  2LGX A;  3BZD B;  4TQ0 A;  2FUH B;  1SB3 C;  4MGK E;  4JX1 C;  5BO4 B;  2JYT A;  3D32 A;  3EFU A;  3W1Y A;  3WAN A;  4B9K A;  1D5Z C;  4DXF A;  1C3T A;  2B76 B;  2ZVN A;  4A20 A;  1JW9 D;  1RFA A;  5C2T B;  4KV2 A;  4M8N A;  1UZX B;  3DPD A;  1JRO A;  2KHW B;  4IKG A;  3AUL A;  3I57 A;  1ENF A;  4C56 C;  4MGZ E;  2LGS A;  4JIO U;  2WXH A;  3BVZ A;  2SEB D;  3DBL B;  4N59 A;  2BQQ A;  4K3B A;  2LEK A;  1GUA B;  4KZC A;  1PGX A;  2MA9 B;  3A9J B;  2R2Q A;  5IAA C;  4ZOH C;  4KDL B;  2K9X A;  4JPS A;  3P42 A;  4G3X B;  2AYO B;  1XT9 B;  1PDX A;  3PHW B;  3TUO A;  4G11 A;  1AAR A;  1TJE A;  5D3D A;  3ZXV A;  4XDD A;  1Q0W B;  2WXP A;  2LAS A;  4WJO A;  3MP9 A;  3ZNI D;  1D3Z A;  1B9R A;  1KTK A;  5IO9 A;  4NAW B;  2L8J A;  2CHZ A;  2HJ8 A;  4NAW A;  1N5W A;  4OZB A;  3KYC D;  1TGZ B;  3RD2 A;  2GBJ A;  5G5G A;  1YN4 A;  4ZHP A;  1I7H A;  2D07 B;  4HWI B;  4HPP A;  3ML8 A;  1VJK A;  2MBH A;  2AL3 A;  5IKC M;  3MHZ A;  2YLM A;  3I3T B;  2R61 A;  2CU1 A;  2LHE A;  5GXG B;  2K22 A;  2ONQ A;  4WH4 A;  3DWG C;  1WF9 A;  3PTF C;  2C7N B;  1XQQ A;  1C76 A;  3BVM A;  1GNU A;  2C5L C;  2BYF A;  3W9C B;  3W2D A;  1V86 A;  3E56 A;  2FIF A;  4C7Z A;  1F0Z A;  3KWV A;  4D2K A;  4WAA A;  3GP7 A;  2DLB A;  1TY2 A;  1UF0 A;  3IT4 B;  2NBU A;  2UWQ A;  3BK2 A;  4MGI E;  3HUI A;  4LNO A;  3LXF A;  2LZ6 A;  1ISN A;  2MJ3 A;  4RGN A;  3KLS X;  2JQR B;  1XLN A;  1F2R I;  2K39 A;  1I4H A;  3UGB B;  2LWP A;  1KLG D;  3AH7 A;  2L00 B;  3ZJU A;  4XX5 A;  1CQV A;  4P7I A;  3DBH B;  3AE9 B;  1DOY A;  4K7S A;  2OHF A;  3AE4 B;  1E9M A;  4REZ A;  1I4P A;  4WIP A;  5IP4 D;  3RT3 B;  2KD0 A;  2N0S B;  1ESF A;  3BYY B;  4OVU A;  3WA0 A;  2DYO A;  5KHO A;  1YNT E;  3EGR A;  2L7R A;  2VZK B;  1NI2 A;  4IUM B;  4GXB A;  1NBF C;  2GRI A;  5LNK 1;  5E6P A;  3GZN I;  4LTU A;  1R4N B;  5HKH A;  3VRB B;  5HG2 A;  4W9J A;  3LYY A;  2N1W A;  2LXC A;  3CF6 E;  4G50 A;  1C4C A;  2IDY A;  4DHZ E;  1WZ0 A;  4FJV B;  1LFD A;  1VLB A;  4JWU C;  3QJZ A;  1E8W A;  4R3D A;  3RCZ A;  1TS3 A;  4EOY A;  3VUY A;  1IUE A;  4M02 A;  3L10 B;  5JZE B;  2C9W B;  4HCP B;  2NR2 A;  3A9K B;  4II2 B;  3A9K A;  3L54 A;  2L1A A;  3Q3O C;  2MBO A;  4F1S A;  1ZW7 A;  3Q8F A;  2NS5 A;  2QJL A;  3ZW3 A;  2JU6 X;  3KWL A;  1Q10 A;  4JGH B;  4AS1 A;  1SJH D;  2BGF A;  2ZPN A;  4LNI A;  4LJP B;  3L0W B;  3FKY A;  4GDK B;  3ZUN A;  5AEK B;  3PGE A;  2M0X A;  2PEA A;  3NVZ A;  2QDF A;  4WWO A;  1YQB A;  1WYW B;  2C7H A;  3B2F A;  1TZO A;  3Q6B A;  2MJE A;  4RGO S;  2R2O A;  1UD7 A;  2L83 A;  1AWD A;  1DOX A;  2LRW A;  2N9L A;  1XLO A;  4HPL B;  4TSS A;  2H89 B;  1FRR A;  3UF8 A;  2WX1 A;  2OOB B;  3Q3J A;  3SU8 X;  2KTR B;  2KDF B;  3Q8B A;  1L0V B;  3MC0 B;  2CJN A;  2IYD B;  2HD5 B;  3MFG A;  4WWM A;  2JRH A;  4A90 A;  1P9D U;  1JWU D;  4ZRI A;  2RDB C;  3R66 C;  1Z5S B;  2V1Y A;  2KX0 A;  4ZDV A;  1WRI A;  5CHF A;  4IM0 A;  1V5O A;  1WE6 A;  2VH1 A;  2O2V B;  3N1Z C;  1QKZ A;  1EF5 A;  3IG3 A;  1HA5 A;  2WXM A;  5DPR A;  2IO1 B;  5JHB A;  2LMC A;  3Q69 A;  4MH0 E;  3X0W A;  3VR8 B;  2DHZ A;  1QT9 A;  4RMA A;  5DPT A;  1NDD A;  5HHD G;  1KF6 B;  1QOB A;  2KVR A;  2FAZ A;  3VUW A;  3B2G A;  2ZEQ A;  4W9L A;  1P7E A;  3CWI A;  3C19 A;  3MJW A;  4FUL A;  1WFY A;  1L0X B;  2Z8L A;  4ZYN A;  1GOZ A;  4MM3 A;  1I4X A;  2D3A A;  4NNJ B;  1VZ6 A;  3ZNZ B;  4B95 A;  1JAL A;  1P7F A;  1HTQ A;  3PHX B;  2YEP F;  3H9D A;  2J52 A;  4IC7 B;  1L5P A;  4ZRJ A;  4MT5 A;  1FXI A;  4MJS A;  4EZK A;  2DBY A;  3NG0 A;  3SR6 A;  4EZJ A;  3NZU A;  2IGD A;  2DEN B;  2JWU A;  4F7Z A;  3CST A;  2AQ3 B;  3KYD D;  1EF1 A;  2UU7 A;  3AB5 A;  4II3 B;  3PZ8 A;  2FID A;  4EUT A;  3AE5 B;  4BOZ B;  2EMT A;  4IWO A;  4A9A A;  1TZ1 A;  1EU4 A;  1K53 A;  2GOW A;  4YSX B;  2IO2 B;  2GB1 A;  1WH3 A;  4FA6 A;  3UIO B;  1XO3 A;  3U4E G;  5EDS A;  5D7G A;  3TCA A;  2LVO A;  3Q2A C;  1LQB A;  2ZW1 A;  3ZNG C;  4AJW A;  3O65 B;  4ANV A;  1MG8 A;  1YX5 B;  1WWT A;  1JWB D;  3Q14 C;  4XGA B;  2RMM A;  4OZA A;  1L6U A;  3ZJV A;  3VR9 B;  4AP4 C;  2BPS A;  3DBL I;  4YL8 A;  1BML C;  3W1S C;  2OJW A;  3TEX A;  1UBQ A;  2Y5C A;  1WJ4 A;  2V3S A;  4G0N B;  1TBE A;  1JRU A;  2PE9 A;  2KN5 A;  2L0F A;  1UNS A;  1KLU D;  5BYQ A;  1PGA A;  2JZZ A;  2GBM A;  3AE3 B;  3ZO5 B;  2BBC A;  4GOC A;  3Q8E A;  2EKI A;  3V3X A;  2JXX A;  5JH5 C;  4EKU A;  1K50 A;  2J53 A;  1WI0 A;  4ARC A;  2D3C A;  3LJ3 A;  2FCS A;  2KWU B;  1SIF A;  4N9F 4;  2LUM A;  1NYQ A;  3LB8 C;  1XLP A;  1MHX A;  1ET9 A;  2KTF A;  1EU3 A;  3M63 B;  3H7S A;  1Y8R C;  2ZNV B;  2GI9 A;  4M0W B;  3KH0 A;  3ZYY X;  4BKS A;  1A5R A;  3L16 A;  2ZZP B;  4YWG G;  2IND C;  4YSZ B;  5LLI A;  3HHM A;  1C77 A;  2PKO A;  3UIP B;  4FJZ A;  4GN1 A;  2YVC A;  1V2Y A;  2K8C A;  3NVY A;  4TMA B;  3KUZ A;  2ZVO A;  3J9C A;  1V49 A;  3NJT A;  2MEK A;  1GG3 A;  3NVV A;  1L2N A;  3AEG B;  1F9J A;  5C1Z A;  1R7S A;  4WWN A;  1FFV A;  2ZCB A;  3I5J C;  4A6Q A;  4YTN B;  1V81 A;  1V8C A;  3NUH B;  1KM7 A;  3GE8 C;  2KDB A;  2KAC A;  2W55 A;  4DXA B;  3W1S A;  5D94 A;  2CR5 A;  1FO4 A;  2O6V B;  3N32 A;  4IWP A;  1FMA D;  1N63 A;  1GC6 A;  1SBB B;  1GC7 A;  3JVZ X;  2MWS B;  1VD2 A;  3ZGZ A;  4DQO C;  1SXT A;  4RH6 A;  4BBN C;  3PO0 A;  1JRP A;  4A8X C;  3ETR A;  3FIL B;  1SE2 A;  2L32 A;  3DBH I;  2Y5P A;  1Z2M A;  2FE8 A;  3PLV A;  1SGH A;  1UUP A;  4P16 A;  3SEB A;  1E0Z A;  2J42 A;  3P1M A;  2MCN B;  3WAM A;  2MLB A;  1S1Q B;  3AN1 A;  4O1N A;  4W9H A;  3DVG X;  4GB9 A;  2CJO A;  1NEN B;  3N20 C;  2N9E B;  2FCQ A;  2H88 B;  4KX6 B;  4ZRP A;  2PLP A;  2V0G A;  3RFZ B;  2RPQ A;  4K1R B;  4NZL B;  3AEA B;  3NRZ A;  1X1M A;  5HFY A;  3K9P B;  3RMK C;  2N7J A;  1T0S C;  1D5M C;  3VQI A;  3FC4 A;  2BW2 A;  1MI0 A;  3RI7 C;  1RM6 C;  4L2Y A;  1R4N I;  1Q5W B;  4FBJ B;  2HE7 A;  3M62 B;  2E6X A;  3ZNH B;  1FM0 D;  2OJR A;  2RGF A;  3ABV B;  1P3Q U;  4WJP A;  2WGS A;  3KVF B;  2L76 A;  5FR6 A;  4CQN A;  1E7V A;  3N30 A;  2W9N A;  1T0R C;  1C9F A;  2XK5 B;  4ASW C;  4KZ0 A;  4LCD E;  2WXI A;  3SFD B;  2XK5 A;  2MP2 B;  1YIW A;  3KW5 B;  1EWY C;  4PK1 A;  3P4S B;  3L08 A;  2MP2 A;  3ML9 A;  3O13 A;  3ZKJ C;  1FNU A;  4US9 A;  1V6E A;  2QMT A;  4KDI C;  1RAX A;  1XEE A;  1LXD A;  1NVI D;  1SEB D;  1MHH E;  1ZXH A;  2JXT A;  4HEA 1;  5CHW A;  1VRA B;  1WGK A;  1RFK A;  2BYV E;  2K5P A;  1QIL A;  3IBE A;  1VZ8 A;  2LFI A;  2XEW A;  3HIZ A;  1EWC A;  4YXD B;  2K6D B;  2WQY B;  1TYG B;  3IFW B;  4WWP A;  1ROE A;  4XDC A;  2KMA A;  1UWM A;  3MJ5 A;  2GBK A;  1WXM A;  1WGH A;  2WNM A;  4CYE A;  4C4V A;  3JYU A;  1MFW A;  4EE2 A;  4PS3 A;  2K25 A;  3VH3 B;  4GSW A;  3PZD A;  2J0M A;  4NQK E;  1JCK B;  1WMH B;  3L13 A;  2WDT B;  1IGD A;  1WMH A;  1PQS A;  2NMQ A;  4RCO A;  3BYT B;  2SAK A;  1J8C A;  3BWU D;  5E6J A;  4EZL A;  4JWS C;  2LJI A;  1UEL A;  3APC A;  2BF8 B;  4KKI A;  3Q8C A;  2N7E A;  4JE3 B;  2VZK D;  1M4V A;  3ALB A;  2ZW0 A;  2DZI A;  2IGG A;  5CX3 A;  3T9L A;  1HE8 A;  2QSD A;  4URK A;  1L4D B;  1ZOY B;  2BS2 B;  4ANX A;  1I4R A;  2ACZ B;  1XLQ A;  3DVG Y;  4IWQ A;  3A4S C;  3B9J A;  2YEP B;  3PS6 A;  4X57 B;  3A4R A;  3AU4 A;  4JQW C;  1D4B A;  4GDL A;  3R7R A;  4PS8 A;  1E7P B;  1WXV A;  3SFE B;  2DX5 B;  2A5U A;  4HLE A;  4M8M A;  3AM9 A;  3PV1 A;  4TUU A;  4XZ4 A;  2NPT A;  2MBE A;  1T5X D;  2DWQ A;  2ZPY A;  1WJU A;  3QK0 A;  1XXG A;  3N1X C;  2M19 A;  4USA A;  3U2S C;  1TS4 A;  3DBS A;  4FAD A;  4IDI A;  5D6J B;  2IJ0 A;  2BT6 A;  4L23 A;  1KFY B;  1MG4 A;  5IA7 A;  3A1Q B;  2C60 A;  1K8R B;  2INC C;  3A1Q A;  4B0E A;  1VR9 A;  3C8Y A;  2WLB A;  3TBL D;  1FCL A;  3DHH C;  2E3T A;  3NOB A;  1L7Y A;  2FBW B;  2KWD A;  1UBI A;  3ZLZ A;  3OLM D;  1ZE3 D;  2V4L A;  4NJ6 A;  1XCT L;  2BB6 A;  5D2M B;  4C00 A;  3TIX A;  2WYQ A;  1SE4 A;  2JYE A;  5D3I B;  3EUB 2;  4DXG A;  4KSL C;  4DHJ B;  3RZF A;  3H1U A;  2WX0 A;  5KHQ A;  2BWF A;  1RYJ A;  2DZJ A;  4HJG E;  3VHT C;  2KDM A;  1F2R C;  2LVQ A;  2WDV B;  1F1H A;  4EFO A;  2G1E A;  3V6E B;  5DPW A;  3VVW B;  2MHJ A;  2D5G A;  2BTE A;  4AWJ A;  2WU5 B;  1T6B X;  3P4Q B;  1DGJ A;  1P0R A;  2IY0 B;  2D3G A;  5TSS A;  1TT5 B;  1V5T A;  3S2A A;  2G45 B;  1AW7 A;  2MH7 A;  2JSV X;  3GE3 C;  4FJY A;  4WQM A;  3PVL A;  2FCN A;  2KDE B;  4NJC A;  1GJZ A;  4HK2 A;  2X8X X;  1DYQ A;  3IVF A;  2PJH A;  1WGR A;  3ZXR A;  1SIJ A;  1PYW D;  3TL5 A;  4BBN F;  2WU2 B;  4YTP B;  2KQ7 A;  3W5V B;  2RD0 A;  5AUK A;  2GLS A;  4TQ1 A;  5JHA A;  4GLS C;  5AUI A;  3R7Q A;  3SHQ A;  3DBR B;  2BWE S;  3VXW A;  3MHS D;  1HQR D;  2KJ6 A;  1K51 A;  1SF0 A;  2BYE A;  4QAY A;  4BKT A;  3CIR B;  4WJQ A;  1HZ5 A;  4DDI D;  2NBW B;  2XN9 C;  1YX6 B;  3BII D;  4WAF A;  1N6Z A;  2ZJD A;  4XWT A;  2IO3 B;  2N9K A;  3ECI A;  2JF5 A;  1V1P B;  4MSM B;  1TIF A;  4B6W A;  3V61 A;  1V1P A;  2AX5 A;  1EUV B;  3AE7 B;  2QIL A;  2WWZ A;  3B1L X;  2I2Y A;  3RNF C;  1G6J A;  2WHI A;  2JZ3 B;  3EHV A;  4HXD A;  1JWA D;  2B3A A;  1Y56 A;  2LXA A;  2KXJ A;  2DYM A;  3C0R B;  5L95 C;  2L05 A;  2FUG 1;  1EM7 A;  5IOI A;  3RUI B;  3DCG A;  3DVN U;  3QC8 B;  1JML A;  1EO6 A;  4GMV A;  1YMH E;  1UWX A;  1VZ7 A;  3AV8 A;  1OEY J;  2RR9 A;  2BYT A;  2KLG A;  4K7W A;  2PMV A;  2KLC A;  1C79 A;  4MM3 B;  2LGI A;  4ZRK A;  4P6V F;  4ACF A;  1ZGU B;  3ZJT A;  5DCN A;  1WYG A;  2K8H A;  2D11 A;  2KOX A;  2NVU I;  2G4D B;  2L52 A;  5G55 A;  3OG5 A;  5FK9 C;  3ZTC A;  1NYR A;  1OEY A;  1YN3 A;  2QEJ C;  4MJS B;  5EE9 A;  3KUC B;  3L17 A;  3WIM A;  3APF A;  3P63 A;  4I6L B;  3RUL A;  3P2B A;  1K52 A;  2WP9 B;  3NS8 A;  2MJD A;  2ZCC A;  1U4A A;  1LGR A;  4KIK A;  2M56 B;  2D10 A;  4OW0 A;  2W3R A;  1GB1 A;  4NY0 A;  3AMZ A;  3MC8 A;  4FHJ A;  4LLG M;  2LI5 A;  1HEZ E;  3EEC A;  1TKY A;  2KNB A;  4FLH A;  1KOT A;  1TKG A;  3DHI C;  1AN8 A;  1VCB A;  4BKS D;  1KH0 A;  2TSS A;  4DHZ B;  2QIE B;  4LK0 M;  3EA6 A;  3I63 C;  2Y5B B;  1OFF A;  1C4P A;  5T8I A;  1J7C A;  4NAM A;  1WY8 A;  3AEF B;  1JWS D;  4K3C A;  4EEW A;  2I1K A;  1IBX B;  3WAO A;  1IPG A;  1GB4 A;  1IBX A;  4P1C C;  1FNV A;  4W9E A;  4RNA A;  2DZM A;  1KJT A;  2K3U A;  3Q8A A;  2EMS A;  2WS3 B;  3JW0 X;  1I35 A;  4LNN A;  3AEC B;  5L83 A;  4HVB A;  2AQ2 B;  1SE9 A;  2M8S A;  2K1F A;  1BUI C;  5BMH A;  1YOV B;  3R3M A;  1RRB A;  2Z0E B;  1WX8 A;  3T3N A;  2O6V D;  2I1J A;  1YQ4 B;  3HK0 A;  2V3P A;  4W9G A;  1WE7 A;  3M95 A;  1ZDX A;  5AZH A;  4WJN A;  2V3N A;  2PE6 B;  2JY6 A;  3Q3N C;  2L0T A;  4OVV A;  3NHE B;  1WGG A;  2Z0D B;  2M17 A;  3OAW A;  3HRD D;  1R4M B;  2G9H D;  5HI1 A;  2MBB B;  2KK8 A;  2WXG A;  1SJE D;  1CZP A;  2GBR A;  4WQO B;  1ZUD 2;  2OED A;  1FXA A;  3RNG C;  3WAP A;  1OQQ A;  2PTL A;  2IGH A;  5C3J B;  3ZDT A;  3VAW A;  2D3B A;  3E9S A;  4BFR A;  1C78 A;  3AE6 B;  1TY0 A;  2WXL A;  2X38 A;  3RNC C;  2AQ1 B;  5BMI A;  2K6Q A;  1WGY A;  5EE3 A;  1WRD B;  2BS3 B;  3H8H A;  4A3O A;  4DWF A;  3NZ3 A;  2XNA C;  2G4S A;  4LDT B;  3U7Z A;  5G5H A;  1T0Y A;  4RF0 A;  1E6E B;  5BMG A;  3JSV B;  5JXV A;  2EKE C;  2JWZ A;  4F8C B;  1F77 A;  2REX A;  4XYC A;  1V1O A;  3DOW A;  1HTO A;  3JSV A;  3V60 A;  1SSN A;  2PVG C;  2V4I B;  4E71 A;  3OJ4 B;  2HDE A;  3IT6 B;  2GMI C;  4GIV A;  1TTN A;  2L3Z A;  2KN4 A;  1HXY D;  4MSQ B;  4YSY B;  2IY1 B;  2N9P C;  4IM2 A;  3N3K B;  3DVN V;  1I42 A;  1QLB B;  1WXQ A;  2CKH B;  4A3P A;  2LGY A;  4NPN A;  1YJI A;  2Y3A A;  3OWE B;  5FKA C;  4NQL B;  1P1A A;  1N61 A;  1I4G A;  4MEM A;  3AE2 B;  4MGY E;  1PGB A;  2W3S A;  4LNK A;  4KGT A;  4LNF A;  3ZVV A;  2A4Z A;  3P4R B;  4YTM B;  4OVZ A;  4CHK A;  2JRI B;  3QA8 A;  2JUO A;  4GGQ A;  2KFK B;  2LJ5 A;  4W9I A;  2KFK A;  2KT7 A;  4HJK A;  5CTR C;  4C7Y A;  2NBV B;  1DOI A;  3PRE A;  1YQ3 B;  1FFU A;  2KMC A;  2ICI A;  1ZKH A;  4M01 A;  2Q5W D;  1AYF A;  1CJE A;  1HZ6 A;  3PRP B;  4ICU A;  2MW5 A;  1QOF A;  4FN2 A;  3VUX A;  2KC1 A;  4HPM B;  3W5U B;  1RLF A;  2MX2 A;  4KVG B;  3A9J A;  2IZV B;  1FCC C;  1V80 A;  2KYW A;  2INN E;  3APD A;  3DQV A;  2BKR B;  2WXO A;  4MEL A;  5AZG A;  2KWV B;  1WXA A;  5CHV C;  3IAS 1;  3VH4 B;  2PIA A;  3RN9 C;  4C4V B;  4DBG A;  1B1Z A;  1P98 A;  3PT2 B;  5DPS A;  3RNA C;  2KAJ A;  4L1B A;  1PUT A;  4B0M A; 
#chains in the Genus database with same CATH homology
 1RYJ A;  4HJG E;  1JAL A;  3ZQ4 A;  1P7F A;  2YEP F;  2KDM A;  3L4P A;  2J52 A;  1F2R C;  1L5P A;  4MT5 A;  1FXI A;  2WDV B;  3P4P B;  2WXN A;  2DBY A;  3U52 E;  2G1E A;  3SR6 A;  1L4Z B;  2D5G A;  2JZP A;  2BTE A;  2LHD A;  2IGD A;  2WU5 B;  3AE1 B;  1T6B X;  3P4Q B;  2JWU A;  1DGJ A;  4Q2J A;  2AQ3 B;  2WDR B;  5TSS A;  3AB5 A;  3PZ8 A;  4ITK A;  3AE5 B;  2KMM A;  2RDG A;  1AW7 A;  2MH7 A;  2JSV X;  4A9A A;  1N5X A;  1EU4 A;  3N9Y C;  1K53 A;  1QOA A;  4WQM A;  4NJC A;  4YSX B;  2GB1 A;  2ON8 A;  1DYQ A;  2I38 A;  1FEH A;  1XO3 A;  3U4E G;  1SIJ A;  1PYW D;  1KRH A;  5D7G A;  2WU2 B;  4YTP B;  1QF6 A;  3W5V B;  1ET6 A;  4C80 A;  4XWW A;  2ZW1 A;  4FXC A;  5AUK A;  3FIL A;  3TEW A;  4TQ1 A;  2BB5 A;  3URY A;  3IAM 1;  1QOG A;  3BZD B;  4GLS C;  5AUI A;  4TQ0 A;  1SB3 C;  3TEY A;  1WWT A;  1JWB D;  4ZYS A;  1TS2 A;  2RMM A;  4OZA A;  1L6U A;  3ZJV A;  1FIQ A;  4JX1 C;  2JYT A;  2WDQ B;  3VR9 B;  1HQR D;  4GDL B;  4A55 A;  4HRS A;  1K51 A;  1SF0 A;  3I9V 1;  4MAC A;  4OZC A;  1BML C;  2J4X A;  1D5Z C;  1TS5 A;  3R2I A;  3TEX A;  3CIR B;  4DXF A;  2Y5C A;  1HZ5 A;  2XN9 C;  2B76 B;  3BII D;  1JW9 D;  1KLU D;  1UNS A;  4WAF A;  5BYQ A;  5C2T B;  1PGA A;  4XWT A;  3R8B A;  3AE3 B;  1JRO A;  2BBC A;  4IKG A;  3Q8E A;  1OQR A;  4ARI A;  1IGC A;  2EKI A;  3V3X A;  2HTM E;  2N9K A;  3I57 A;  1A70 A;  5BYR A;  1ENF A;  1V1P B;  4US8 A;  1K50 A;  2J53 A;  4ARC A;  4C56 C;  1V1P A;  2AX5 A;  2EEL A;  3AE7 B;  2QIL A;  5EE1 A;  4KGR A;  2WXH A;  3BVZ A;  2LUM A;  1T3Q A;  2SEB D;  1NYQ A;  4AQ7 A;  2I2Y A;  3LB8 C;  4N59 A;  1XLP A;  1MHX A;  1ET9 A;  1YJJ A;  2LEK A;  1EU3 A;  3GS2 A;  1JWA D;  5I4D A;  1PGX A;  1Y56 A;  2DYM A;  4ZOH C;  3V05 A;  2GI9 A;  2K9X A;  3ZYY X;  2FUG 1;  4JPS A;  1EM7 A;  3P42 A;  4YWG G;  1JML A;  1YMH E;  1NI3 A;  1ZP0 B;  4YSZ B;  1PDX A;  1CK1 A;  3TUO A;  1C77 A;  2PKO A;  1UWX A;  1VZ7 A;  3AV8 A;  3GB1 A;  1TJE A;  5D3D A;  4HKQ A;  4XDD A;  2BYT A;  1L0Y B;  2PMV A;  3NVW A;  2WXP A;  3NVY A;  3PZ7 A;  4TMA B;  1C79 A;  4MM3 B;  2LGI A;  3J9C A;  4HKZ E;  4P6V F;  3ZJT A;  2MEK A;  3MP9 A;  1WYG A;  3IXS A;  3NVV A;  1B9R A;  1QQR A;  1KTK A;  4NAW B;  3AEG B;  2L52 A;  4RF1 A;  5FK9 C;  1R7S A;  1FFV A;  1N5W A;  4OZB A;  1NYR A;  4N58 A;  1YN3 A;  2QEJ C;  1BXT A;  5G5G A;  4A6Q A;  1YN4 A;  4YTN B;  5EE9 A;  1I7H A;  4ZHP A;  1V8C A;  3NUH B;  3P63 A;  5MPO A;  1FNW A;  3VRA B;  1VJK A;  2KAC A;  2W55 A;  3MHZ A;  3W1S A;  2R61 A;  2LHE A;  5H8Y E;  1VDV A;  5GXG B;  1FO4 A;  2K22 A;  2ONQ A;  1JWM D;  1K52 A;  4WH4 A;  1FMA D;  2WP9 B;  3DWG C;  5BYS A;  1N63 A;  2W54 A;  4RGM A;  2MJD A;  1SBB B;  1C76 A;  2M56 B;  3BVM A;  3ZGZ A;  4OW0 A;  3W9C B;  3W2D A;  1E10 A;  2W3R A;  3AE8 B;  1GB1 A;  4DQO C;  3E56 A;  1SXT A;  3AMZ A;  2M0A A;  4RH6 A;  4LLG M;  1MPE A;  1D5X C;  4XE0 A;  4C7Z A;  1HEZ E;  3PO0 A;  1F0Z A;  3KWV A;  1TKY A;  4D2K A;  1MVK A;  1JRP A;  1TKG A;  1AN8 A;  1GAQ B;  3ETR A;  4A8X C;  3GP7 A;  2DLB A;  3FIL B;  1SE2 A;  1TY2 A;  1KH0 A;  2TSS A;  3IT4 B;  2L32 A;  2QIE B;  2Y5P A;  3BK2 A;  4OHJ A;  2FE8 A;  4LK0 M;  3EA6 A;  1UUP A;  1ZDV A;  3HUI A;  1OFF A;  4P16 A;  1C4P A;  3BVG A;  3LXF A;  5T8I A;  1J7C A;  2MJ3 A;  4RGN A;  4NAM A;  3SEB A;  3KLS X;  1E0Z A;  2JQR B;  2J42 A;  3P1M A;  4RFB A;  3AEF B;  1XLN A;  1JWS D;  1F2R I;  1LO5 D;  1NEK B;  2RPV A;  3AN1 A;  1RWS A;  4O1N A;  1IBX B;  2CJO A;  1NEN B;  3TSS A;  1GB4 A;  3HVD A;  1IBX A;  1I4H A;  2H88 B;  4KX6 B;  3NS1 A;  4ZRP A;  2PLP A;  2V0G A;  3RFZ B;  1WSP A;  4WUR A;  1KLG D;  1FNV A;  3AH7 A;  4RNA A;  3ZJU A;  1ACC A;  2K0P A;  2K3U A;  1CQV A;  3BK1 A;  3Q8A A;  4NZL B;  3AEA B;  3NRZ A;  1N60 A;  2WS3 B;  3AE9 B;  1DOY A;  1STE A;  5HFY A;  1UGJ A;  2N7J A;  2OHF A;  3AE4 B;  3AEC B;  1D5M C;  4RGT A;  3VQI A;  3FC4 A;  1E9M A;  2AQ2 B;  1I4P A;  2BW2 A;  4REZ A;  1MI0 A;  4WIP A;  1BUI C;  5BMH A;  1RM6 C;  4KKJ A;  2N0S B;  4L2Y A;  1ESF A;  4J3O D;  3BYY B;  5FR3 A;  3T3N A;  2E6X A;  2WXQ A;  1FM0 D;  2DYO A;  3ABV B;  1YNT E;  1YQ4 B;  3DWM A;  2V3P A;  3EGR A;  3KQ4 A;  2VZK B;  1J7B A;  2NTT A;  3AED B;  1ZDX A;  4CQN A;  3FAH A;  2V3N A;  1C9F A;  2GRI A;  3WCQ A;  5LNK 1;  1V97 A;  2WXI A;  3SFD B;  1GPX A;  1EWY C;  4LTU A;  2NTS A;  3P4S B;  3HRD D;  3O13 A;  5HI1 A;  2G9H D;  3VRB B;  5HG2 A;  3LYY A;  1FNU A;  4US9 A;  2WXG A;  5EE0 A;  1SJE D;  2QMT A;  3RPF C;  1SE3 A;  1CZP A;  1XEE A;  1C4C A;  1NVI D;  1PFD A;  1ZUD 2;  2IDY A;  1SEB D;  2OED A;  1FXA A;  1MHH E;  1I4Q A;  1ZXH A;  1OQQ A;  2JXT A;  4HEA 1;  2WXF A;  2PTL A;  2IGH A;  2CU3 A;  1VRA B;  5C3J B;  1WGK A;  1RFK A;  2K5P A;  1VLB A;  1QIL A;  3UI3 A;  1VZ8 A;  2LFI A;  1EWC A;  3E9S A;  4YXD B;  2JX5 A;  4JWU C;  2WQY B;  1TYG B;  1ROE A;  4R3D A;  1C78 A;  3AE6 B;  1TS3 A;  1TY0 A;  2WXL A;  2X38 A;  2AQ1 B;  4XDC A;  5BMI A;  1UWM A;  1IUE A;  5EE3 A;  3MJ5 A;  2BS4 B;  2BS3 B;  3H8H A;  2WNM A;  3NZ3 A;  2WXR A;  2XNA C;  2L1A A;  3U7Z A;  4EE2 A;  5G5H A;  5H92 C;  4RF0 A;  1E6E B;  1FRD A;  5BMG A;  3Q8F A;  4PT5 A;  2QJL A;  5JXV A;  1JCK B;  4IOI E;  1F77 A;  2IPK D;  1V1O A;  1XCQ L;  1IGD A;  1SSN A;  2PVG C;  2V4I B;  2NMQ A;  4RCO A;  2HDE A;  3BYT B;  3IT6 B;  2SAK A;  2JU6 X;  3BWU D;  3KWL A;  5E6J A;  1Q10 A;  4JWS C;  2LJI A;  2KN4 A;  1YN5 A;  4AS1 A;  1SJH D;  1HXY D;  4KKI A;  3Q8C A;  4ZRQ A;  4YSY B;  4YT0 B;  4JE3 B;  4GDK B;  2VZK D;  3TEZ A;  1QLB B;  3NVZ A;  1M4V A;  1WXQ A;  4H2A A;  3B2F A;  1TZO A;  2MJE A;  2ZW0 A;  4RGO S;  1YJI A;  2Y3A A;  2IGG A;  3OWE B;  2QSD A;  5FKA C;  1N61 A;  1L4D B;  2L83 A;  1AWD A;  1ZOY B;  2BS2 B;  1DOX A;  1I4R A;  1I4G A;  2ACZ B;  3AE2 B;  2W82 A;  2N9L A;  1PGB A;  1XLO A;  2W3S A;  4KGT A;  4TSS A;  2H89 B;  1FRR A;  1XLQ A;  4UDU C;  1J7A A;  3P4R B;  4YTM B;  2WXJ A;  3B9J A;  3T3O A;  2YEP B;  1L0V B;  3MC0 B;  3Q8B A;  4OVZ A;  2CJN A;  2WXK A;  3MFG A;  4WWM A;  4A90 A;  1XF5 L;  4HRO A;  1D4B A;  1JWU D;  2KQ4 X;  1E7P B;  1JQ4 A;  3SFE B;  1ZPS A;  2PVO D;  1ZXI A;  3AM9 A;  1WRI A;  1T5X D;  4C7Y A;  2DWQ A;  1N62 A;  1DOI A;  1XXG A;  1YQ3 B;  1FD6 A;  1FFU A;  2M19 A;  4USA A;  1QKZ A;  3U2S C;  1TS4 A;  3AEE B;  1HA5 A;  2ICI A;  4IDI A;  2Q5W D;  2WXM A;  1AYF A;  2IJ0 A;  2LMC A;  1CJE A;  3Q69 A;  3AEB B;  3VR8 B;  1HZ6 A;  2BT6 A;  4L23 A;  1KFY B;  1QT9 A;  3R2T A;  1QOF A;  4B0E A;  1VR9 A;  5HHD G;  1KF6 B;  3C8Y A;  2WLB A;  3W5U B;  1FCL A;  1QOB A;  2RDH A;  2E3T A;  3HVZ A;  4MH8 A;  2FBW B;  3B2G A;  2KWD A;  2INP E;  1FCC C;  4M0W A;  1P7E A;  2INN E;  1ZE3 D;  1TKE A;  4N6E B;  4ZHO A;  1XCT L;  2BB6 A;  2WXO A;  3CWI A;  1L6V A;  1D6E C;  1SE4 A;  1L0X B;  1C4A A;  2Z8L A;  1GOZ A;  1I4X A;  2JYE A;  3EUB 2;  3IAS 1;  5D3I B;  2PW9 A;  2PIA A;  4KGS A;  4DXG A;  1B1Z A;  2KAJ A;  4L1B A;  1PUT A;  1VZ6 A;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...