3E5SA

Crystal structure of staphylococcal nuclease variant delta+phs l103k at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e5sA00
5KIXA 3LX0A 3SK4A 2F0MA 5KRUA 2F0KA 5IODA 5M9OA 3ERQA 2PZWA 3H6MA 3OMGA 4PNYA 3TP6A 4PMBA 3SK8A 2RDFA 2F0NA 3C1FA 3E5SA 4KJOA 4K5XA 3NK9A 4EQNA 1NSNS 1NUCA 2PW7A 4NP5A 4KTAA 1SYGA 2EY5A 4IZ8A 4DU9A 3V2TA 1A3TA 2EYPA 4WORA 2F3VA 4ME5A 5EGTA 1AEXA 3T13A 5F2DA 1SNOA 4K5VA 4IALA 4NKLA 5ISRA 5CGKA 2EYJA 1SNCA 5C5MA 3TP8A 1F2ZA 1RKNA 2RKSA 3BDLA 1F2YA 3EROA 1EZ6A 3OWFA 4KY7A 3SXHA 1ENAA 1SYCA 3TP7A 4F7XA 1EY4A 5J22A 2F0VA 2KHSA 3DHQA 3NUCA 1STBA 2PZTA 2OEOA 5DAUA 5DEHA 5KGUA 4KV6A 4KY5A 2EYOA 5CV4A 3VA5A 4QMGA 2PQEA 2ENBA 1STGA 5CR3A 1STHA 3MXPA 5NUCA 5C3WA 4K6DA 4G57A 1EQVA 5I9PA 1STAA 4K14A 3R3OA 3SK6A 1TQOA 5IOCA 2EYLA 2EY1A 3S9WA 4N9PA 2NUCA 5J1ZA 3EVQA 2F0QA 1STNA 1TT2A 2PW5A 3EJIA 4RKBA 2EYHA 4KJNA 5EKLA 1SNDA 1A3VA 1KDCA 3BDCA 4KY6A 5HGTA 4H7BA 2M00A 4NDXA 4ZUIA 3QOJA 5C6AA 1STYA 3OSOA 1A2UA 2EY2A 4RKLA 1EY5A 4KHVA 3U9OA 3RUZA 2WACA 5EKKA 1EY9A 4I65A 3C1EA 1SNQA 3D4WA 5E1FA 1SYDA 3MVVA 5IGCA 1ENCA 3PMFA 1EY8A 3DMUA 1JOOA 4J1MA 1KABA 4MIUA 2F0EA 4WRDA 4B9WA 4DFAA 1U9RA 3NP8A 1II3A 2KQ3A 3TMEA 2QDBA 5HURA 4HMIA 5K5PA 4K8JA 3OMCA 4K8IA 2F0DA 4N9TA 4NMZA 4TRDA 1SYEA 1SNPA 2F0IA 3HZXA 3ITPA 1EYCA 5C4HA 3MHBA 5C3XA 2EY6A 5IGEA 1JOKA 4B9XA 1EYAA 3D6CA 5JAVA 3SR1A 5KYLA 3SK5A 4EQOA 1EY7A 4R8NA 4ODGA 4DF7A 5CV6A 2F0GA 2HQEA 4EQPA 1KDAA 4PMCA 4KD4A 1SYFA 5CV7A 2OF1A 2F3WA 5I6WA 1JOQA 4HTHA 3NQTA 2F0WA 2F0UA 1KDBA 5C5LA 3P75A 5C4ZA 2F0JA 4ZUJA 3QB3A 2SNMA 4DGZA 4F8MA 5I6YA 4LAAA 4K2KA 4QB4A 4ID6A 1EYDA 5CV9A 4HMJA 2RBMA 2EYMA 1TR5A 2O4XA 5E3FA 2LKVA 4QF4A 4K2LA 1EY6A 4KD3A 2F0TA 3NXWA 2F0OA 4K5WA 4J6HA 5KYIA 3MZ5A 2EYFA 4S3SA 5CV8A 1EY0A 2SNSA 5IGDA 2F0HA 3SHLA 3D4DA 5IGFA 3NHHA 5JOBA 2F0LA 1KAAA 1SNMA 1F2MA 5J39A 2PZUA 2OXPA 1SYBA 3TP5A 3MEHA 3D8GA 4IUNA 5CV5A 5CC4A 5IIFA 5I9OA 1JORA 3HEJA 3T16A 1EZ8A 4E6IA 2F0SA 4EVOA 5IGGA 2EXZA 1IHZA 3P1HA 2F0FA 2F0PA 5IGBA 2SOBA 2PYKA 5KEEA 4ZQ3A 3QOLA 4OL7A 4YIJA 1A3UA 1A2TA
chains in the Genus database with same CATH superfamily
1P8LA 2EQSA 2VY3A 4XDXA 2Z9HA 4IJLA 4R4CA 3TP6A 1FYCA 5GROA 3S1RH 2JA8G 4LF8Q 1D1IA 4YCUA 1VQEA 1SFOH 1VMCA 5C4JH 2PMZB 2JEAI 1BVSA 4JI8Q 2PMZE 3PV0A 5K36G 3S15B 1ONLA 1S5ED 2X69A 4JI6L 4R4TA 1PDQA 2E76C 4C2MB 1BCPF 1YHAA 4P74A 5NUCA 1TWHB 1M4VA 4AH6A 1STAA 4K14A 1VQHA 5J1ZA 4JI4Q 2JJQA 4AYBE 3EJIA 4L5TA 1I6HB 1SFOB 2L0CA 1HA6A 3AB9A 2NVQB 1T5XD 3X3NA 4R8IA 1CQFA 4DA2A 3Q22A 1VF7A 3E0EA 1CFMA 1HZ9A 2MQHA 3BZCA 4OO1H 1JWUD 3M9BA 3I56A 2VUMB 3T1HQ 2PI2E 1YI2A 3PO3H 4NMZA 4C2MH 1IYVA 1IKLA 2DY7A 2N49A 1LABA 4JBWA 1Y1VG 4L5RC 3D6CA 1KLUD 3WOEA 4FVMA 5KYLA 3S1QH 2JA6B 1CI3M 1S4ZA 2HDLA 3FKIG 3W2DA 2K01A 1DYQA 1LTSD 4DV5Q 4DV7L 3KFUA 4KMUC 4LAAA 3HGBA 4OELB 4EGVA 1L0XB 1QB5D 1HZCA 1VQNA 3C46A 3GP7A 4R4QA 1D5MC 1E0BA 1IBLQ 4P72A 4DAVA 1HHVA 3S2HH 4IFDG 1UUPA 1KAAA 1HH2P 4IO9A 1PRTD 1T9HA 1MJEA 2OTLA 4OGQC 1HFNA 4B08A 1XJVA 4DUYL 2I5LX 3PIPA 4Z9CB 3MFGA 3P1HA 3U4ZA 3URYA 1Y8PB 1N34L 3BVZA 4GOPA 1N36L 1FJGL 2YYZA 5C0XG 2YV5A 2EIFA 2K14A 1HNZQ 1GO3E 1NMGA 1V43A 3X3MA 2L5TA 1G6ZA 4PZ7A 2EY5A 1ENFA 3S2DB 4B3RQ 1PH4A 4NXML 1D5ZC 4A3DB 3S2HB 3MXGA 4P75A 4CJ2C 4OWWB 2EYJA 3FPPA 1IYUA 1QVGA 1FD7D 1BKBA 1H9SA 3J81i 1F9PA 1UEAB 5KGUA 1EOTA 2EYOA 1JMCA 3KJPA 2B39A 2WAQG 1X32A 5IYBG 1QVCA 4A93B 3VR4A 1NNXA 1HQRD 2KVMA 3C3LA 1I4RA 1TS3A 1XTDA 2Z4HA 5E4XA 1PZJD 3W5OA 5EKKA 2CH4W 4CDCC 3DMUA 1LTAD 4MIUA 2F0EA 4BXXH 1DOKA 2HIXA 2NVXH 1UE7A 1BBUA 3TBIB 1HA5A 4BY1H 4A3KG 3I73A 4DR1L 2A8VA 5M3FG 1XMQQ 3WOFA 2D9UA 4R4IA 2KBNA 4IURA 1VQJA 1SN8A 4MN3A 3I4OA 5I6WA 2F52A 4HTHA 2F0JA 2ZTCA 3CF5A 3I4NG 4X65L 1N32L 2QILA 2K03A 1BQQT 2DUDA 2Z6KA 4HJ9A 1H9RA 1EY6A 4K2LA 1ZYRD 4DK3C 3KLSA 1Q86C 3DEPA 4DV0Q 2B29A 4JOIC 1SNMA 5C4XH 1VQLA 4IUNA 2ZXPA 2UU9L 3M4YA 2CVRA 3K6OA 2B2TA 3BYTB 5LHY1 5IP9H 4IQZA 5EBDA 4DV1L 4OO1I 2NN6I 2RF4A 1WTRA 3R2TA 4BY7B 2SEBD 3F2CA 4C3JG 1I3QH 3I4MB 3JAMc 4GZYC 1TWFH 3MWYW 4FF1A 2E8GA 1X54A 2WINB 3H6MA 3WDNA 1MSGA 5GQOA 3CMEA 4UPAA 3ICEA 1YIJA 1HXYD 1TY2A 3NK9A 2KEEA 3E9HA 5G3LD 4ZKBB 1L1OB 1SYGA 4DR6L 2OQ0A 4DU9A 4G7OC 3V2TA 5JJKA 5G3LF 1GHJA 2L55A 3TN2A 4IPGA 3NTHA 2E75C 4IALA 2XGTA 4A3FG 3QJYA 3TZUA 1F2YA 4LFAL 3SXHA 1SR3A 1YNNC 2Z6BA 4C3JB 3HOWH 4X62L 1Y1VH 2IY5B 2PQEA 5FLXL 1I3QB 3SK6A 1SMYD 3I70A 4B3ML 4KY6A 3KF6A 3KJOA 5D3DA 5BR8L 4ZUIA 4ILWA 5A2QE 3AU7A 3PUXA 1EY5A 1VQ5A 5ELEA 1CT1D 4CDDC 4A3KH 3JC66 3ND9A 2EE1A 1B3AA 3MVVA 1TWHH 1CTMA 1Z9FA 2FINB 3W1GA 1L1OC 1U9RA 4DR4L 1ET6A 2CQAA 1BNZA 5HURA 4DV1Q 5K5PA 3FKIH 2IT1A 3CAMA 3ONAB 3HZXA 5C4HA 1BCPC 1Q1EA 1Y14B 1HNWL 2IWHA 3K57A 1A6XA 2CQOA 4A3BB 3HOVG 1DZ1A 2R7FA 1LTBD 4HSVA 1WTWA 3P75A 5FO9B 4GNXC 1C9OA 3VYSA 4A3KB 2HUGA 2SNMA 4K2KA 1LLRD 3UDGA 4NXMQ 1X56A 1YJNA 1GUSA 1RTNA 2E2IB 1JWMD 1ICWA 1K3BC 1ML0D 5IGDA 3D6WA 3FKIB 2E2DC 5JOBA 4IFDI 3KLSX 4X64Q 1C7YA 4LUOA 5IE8A 5E7NA 5CC4A 4A3GH 2LMCB 3J7AV 3HEJA 3IKJA 5BR8Q 3OW7A 2K5WA 4DR7Q 3CC2A 2X6LA 2K32A 1D1KA 4X66Q 1EYGA 2A74C 4HJ8A 1V1QA 3SK4A 4HCEA 3VR6A 2RVLA 4JOIA 3ERQA 1JR0D 1CA5A 2IJ0A 3Q8DA 4O1NA 1VQDA 4HIKA 2PW7A 2CKZB 2PQAA 2K5NA 4A3DG 5JJZA 4LF5L 1OTCA 2I5MX 5F2DA 1K83H 4C3HB 1EFWA 4XYOA 2BE5C 3EN2A 1NJIC 1XMQL 2NB0A 5AJ3Q 3K58A 1TWCH 1FNUA 3W3AA 4KV6A 2UUCQ 2AQ1B 5M9OA 5KNCA 4DV4Q 4GN3B 4L6TB 3HKZG 4K0KL 5ELOA 3TQYA 1C48A 5FLMH 1KTKA 2TSSA 2EYHA 5EKLA 3QIAA 3BDCA 5L37A 2BE5D 4POGA 1A2UA 2R7ZB 5JEAG 4JI2Q 1JQYD 1BUVT 2H5XA 1STEA 1SYDA 1E7ZA 1JJ2A 1K83B 1A15A 4C3HH 5M3MG 3ERSX 1B70B 4B9WA 1ZYRC 1VQ9A 3OOCA 1XNRL 4Y52H 4DAMA 4K8JA 1J9OA 4LFBL 4A3MG 1YNJD 5C3XA 1V8QA 1O7IA 3CMAA 4DR2L 3C2PA 2HQEA 2KCTA 2WKDA 3A8KE 4PMCA 1HZBA 2Q2IA 2RHSB 4IOCA 2F0UA 3S1NB 1HRJA 4BBRG 4ZK9B 2A6HD 4F8MA 1EIFA 3HOUB 3CC4A 1CM9A 4MTNA 1I4PA 3P20A 1VQKA 1TIID 1E24A 3D31A 4QY7A 3CCJA 5AJ3L 2JA9A 4BBSG 1B9NA 4A3CG 1K8AC 1RDPD 1CHPD 1PH3A 3SHLA 4OIKA 2Q8TA 4KHPL 2X6GA 3T4AC 1I4HA 1KLGD 2WB1G 4EQ5A 3GV6A 3MXNA 3HOXG 3DLLA 4GKKQ 3S16H 2B2UA 1HJPA 5I2XA 1VQ8A 2BH2A 3FP9A 4A3EH 4PNYA 2B2WC 2D0OA 4X3UA 3SK8A 1GJXA 1HNXL 3PCOB 4A76A 1OXXK 1HTPA 1NSNS 3ULLA 4KTAA 2KCMA 3TDQA 4IUVA 3MEFA 2YTXA 5IT9E 1DJRD 1SNCA 1HNWQ 5EQ0A 1AZQA 1AE3A 3DHQA 3NUCA 1X3FA 4QIWE 1E2VA 4FO2A 2DJGC 2PZTA 3TEHB 2JN4A 1I4XA 4DV5L 5I9PA 1TQOA 1IL8A 4A3LG 4CHTB 1M90C 5C3EG 1K8MA 4LF7L 3PUVA 1VQBA 1Q8KA 4DUZQ 2AWOA 2QCPX 4CGYB 2KA7A 4BBRH 5DM63 3GTMB 2VXWA 3RN2A 1Y1VB 4BS9A 5FJ8H 3ULJA 1R4QB 4X6AH 1WJJA 3NP8A 2YU9B 4HIDA 3I8ZA 2Q8RE 4GKKL 1TWGB 1E1TA 4CKEA 3T53B 4A3LH 1N34Q 1EYCA 3U9SA 4QL5A 1U4LA 1EIHA 3K0XA 4B9XA 3H3VC 1KNAA 2KCCA 5IYBH 2UXBQ 1KDAA 3L7ZC 2QDLA 5ELBA 2ICEC 3N52A 3LNNA 3T51B 1ASYA 1O7LA 1EWHA 1PFMA 3FHWA 1KDBA 3S1RB 4DV6L 3B6YA 5DNFA 4GKJL 5C4JB 4LK1C 5IT9L 3S15H 2RBMA 4L5QA 3TZDA 3GTKB 4HN7A 1B50A 4CBVA 5C44G 4A3BH 4F88A 4TVAB 2VQEQ 3R93A 1Q8IA 2F4IA 4JI7L 2DN8A 1Y1WG 2DY8A 3P7JA 1N9WA 5I9OA 3HRZC 4EVOA 1C4QA 2XWBB 3UDXA 2E74C 1EEFD 3G7LA 1AH9A 2A6EC 3KBGA 3PUYA 2RCNA 1WTHA 1I6HH 5KRUA 3OMGA 4A3GB 4JK1C 1N33L 2Y0SE 5JJLA 3C1FA 1TU2B 4LF6Q 1H9MA 2R93G 3AYHB 1QILA 3CCUA 3HOWG 5IWAL 3ND8A 1K8GA 3GTGB 4C3HG 1CHQD 1BBWA 1YZ6A 4CDFC 1JB7A 5C0XJ 5JJIA 2IW3A 4NKLA 4G7ZC 2BDNA 2AWNA 2K6AA 2A6ED 4JW0A 1B44D 2KHSA 1G51A 4GS3A 3CRKC 1YITA 1W3SA 1STGA 2Z0SA 1WCMB 1KRTA 4NW2A 1BXTA 4KKTA 4A3MH 3BVMA 3GTPH 1TT2A 2VL6A 1XNQL 4KJNA 2JE6I 2B2UC 1A3VA 5FO8B 3J81j 3A8IE 4NDXA 1I94Q 1WVLA 1IBML 4KHVA 3U9OA 1PRTB 3GTGH 1I4GA 3C1EA 1GUGA 5GAEC 4DR3L 3NE5B 1TKWB 1JOOA 4DNIA 3OTOQ 3Q0AA 3CCQA 4KKUA 5LMUQ 1HR0W 1WTOA 1QZGA 1SNPA 2Z6KC 1NTGA 3JAMi 1EIGA 1IW7C 1IL2A 2NVTH 5JPNC 3KDFA 2R93B 4R1JA 5IP7G 3MTSA 5C44H 2K5DA 1H9KA 1HNXQ 3R8BA 1DCZA 1RHPA 1RTOA 2BA0A 4DGZA 4DV6Q 3GDEA 2AUKA 3LGJA 2KECA 3K7UC 1IBKL 1AN8A 3HOZG 1U5KA 2A69D 3H91A 4AQYQ 2EYFA 2NZHA 5CV8A 1NE3A 1PHJA 1YNXA 1SE3A 4X3SA 3SGIA 5J39A 2A69C 5ELCA 3UDFA 4JV5Q 4RFBA 4YWLA 2V1CC 2WB1B 5FKAC 5EPLA 1YEZA 1DGSA 1GHKA 2C9OA 2ZXOA 5C44B 1I50B 3GTQB 3LX0A 4JBJA 3OTOL 1IW7D 2GN5A 3OIQA 3QR8A 1SRUA 1WTXA 4XTCS 4LUVA 5COYA 4IZ8A 2B8FA 2NZOA 2B2TC 5M5XB 4BY1B 2UUBQ 4RWSC 3M3YB 1NMFA 3CQZH 5ISRA 2ZJPA 1F2ZA 3H0GH 2QW7A 3TP7A 4A3EB 2JSOA 5CORA 4C56C 3IFDA 2QEXA 5DAUA 3I72A 3F8TA 1B53A 3K8AA 3S14B 3CPWA 2CW0C 2NUCA 2PW5A 1VQCA 5IT9c 2K05A 3KF6B 2JEBI 2I46A 4Y7NB 3CCMA 4JVZA 4N8X1 1BOSA 1TS5A 1ILPA 3S1MB 3CU7A 3M3YH 3CQZB 1B2TA 3H0GB 4H13C 2Q2UA 1FGUA 1VF5C 3H0GG 2NVTB 2RQXA 1JJGA 3KF8B 1HFGA 4TRDA 2F0IA 1GUTA 3H3VI 3S14H 4YCWA 3HOXB 4DV2Q 2R6GA 4G7HC 4FYDA 1B7YB 2KCNA 3I4MH 1RCVD 5JVH3 3HOZH 3JAME 3NQTA 2F0WA 3DM3A 2AQ2B 1HNZL 2UUBL 1H95A 4FNFA 1HUMA 1RJTA 4DN4M 2HT1A 5IYDG 3S1MH 4L63B 5FJ8G 5JEAJ 3AMUA 4C1NI 3HP3A 3FEWX 5ELDA 2R92B 3O13A 4A3EG 3HKSA 1GUOA 1J6QA 5M5WH 3HOYH 4APVA 1EY0A 2KHJA 3BG3A 5IGFA 5H1SE 4C3JH 3Q24A 1XMOQ 4JYAQ 1E22A 1KHIA 3RNUA 2IL8A 1F9SA 2DJFC 2F0PA 3CHBD 1B3QA 1XPUA 4U68A 1MIUA 5C4XG 4JI2L 3D0FA 2MGSA 2F3IA 1GOZA 1JCKB 1S3OA 2A68C 1VQGA 5IODA 4O42A 1Q3LA 1BCPD 4MZ9A 1NUCA 2PQAB 4DV3L 1G291 2F1MA 2JA5B 2R7ZG 3RN5A 1SNOA 3A8JE 1DM0B 3BDLA 3V05A 4F7XA 4A3GG 2BDOA 2ZTEA 4FP5D 2FJ2A 1SJHD 5D65A 1QUQB 1D6EC 1STHA 1DONA 1AP0A 3R3OA 1AZPA 2EYLA 3RLFA 4N9PA 2ZT9C 4RKBA 4DXGA 3L0OA 1PFBA 1K0RA 4M8AA 4DR5L 2UXDL 2CHBD 1HTLD 3E3XA 4XT1B 3TRZA 4UP7A 3T56B 2E2IH 3J7A5 5JVG3 3CRLC 3D4WA 5E1FA 1L2FA 3K7AB 3HKZB 3UI2A 1K9MC 4J1MA 4WRDA 2NVQH 3PO2B 5EPKA 2PNHA 3HS0C 1ESRA 1G8ZD 2B8GA 4GNXA 3U58A 3KOJA 5IP7H 2UU9Q 1QZHA 2F0DA 2IX3A 3DWAA 1SYEA 4AYBG 4WJWA 3S24A 5T1IA 2JP1A 1VQ7A 2XSCA 3SR1A 1PRTF 4FXKC 5A2QL 2NN6G 2A5HA 5I2YA 4DV3Q 4HIMA 1EWCA 3DWQA 3FRPB 5BN4A 4RGMA 1PFSA 3FVQA 1PH7A 3GTLB 2RDHA 3EQLC 4P71A 3K80C 4X3TA 2I07B 1SXTA 2QF7A 4OEMB 3VR2A 3HOUG 4PZ8A 4XXEA 4QQBX 3MZ5A 2SNSA 4LFAQ 2WKCA 1LTLA 2F0LA 3RD4A 1TWCB 1SMYC 3NWTA 2XTIA 2HHHL 2A19A 1OXUA 1KC8C 4WJ4A 5EPJA 5EJWA 2EZVA 2Y0SB 3PF4A 4CKCA 3QOLA 4YIJA 1A3UA 2HQLA 4DUZL 3GTLH 1K8OA 1PTOC 3A74A 3BZDB 4C1NK 1EQQA 4DV0L 2L1BA 2B63G 4KJOA 4LJZC 2AKWB 2CH4A 5LMNQ 4POFA 1PH1A 1X3GA 3HOVB 4DR7L 2QGQA 1PYBA 2KEDA 1PMRA 4JI4L 4GLXA 1CSQA 1I50H 1K28A 1TS4A 1FR3A 2AUJD 2RKSA 1ENAA 1EY4A 5TSSA 2F0VA 2G5DA 5J22A 1PH8A 2JA8B 4G4KA 1IKMA 2Z1CA 5FK9C 5CV4A 3SEBA 1RF2D 3KLRA 5JEAH 4LF8L 3M4OH 3BVGA 4K6DA 1EQVA 2EY1A 4JI8L 3EVQA 5C0XH 4DR6Q 1LM0A 2JYOA 4JCVE 2ALYB 2M00A 1HQMC 3QOJA 1HCZA 3OSOA 4JI7Q 1TS2A 4ZRZA 2B2VA 5AFWA 1QG7A 3PMFA 4BBSB 1LO5D 4X64L 2WAQB 3DUZA 4OWTB 4FF3A 2GVAA 1G2TA 4RAUC 3SDZA 5EBCA 4DKAC 1O80A 4RHRA 1JOKA 3J81E 3FPUB 4Q0FA 2UXCQ 3J81c 4KK7A 1ESFA 4FXGC 3NPPA 4DAPA 1CSPA 2IHFA 3GTOB 1P16A 4JI1L 1KL9A 2MO0A 2CCZA 2XNAC 4LFBQ 5LMNW 5ELFA 4LF4L 2JA7G 4HMJA 1TWAB 3I4MG 4BY7G 1PRTC 4DR2Q 5GAHC 1AFPA 4A3JB 1X3QA 5KYIA 2L12A 1N36Q 3PO2G 3I4NB 2EJFC 2LSSA 4LUZA 3NHHA 3F2BA 3BDOA 4YY3L 2PZUA 4R4OA 4XYQA 1WTQA 1E2ZA 1S5BD 3T16A 5IGGA 2HHHQ 3J80i 1Q1BA 4ULLA 1SROA 4DK1A 4A3JG 2F0MA 2KENA 4A3IH 3S17B 4LFCQ 2PO4A 3G6JB 3E5SA 1SLJA 3VYRA 2LY7A 4HJ7A 3TS0A 4B3TQ 2CWPA 4EQNA 1LT4D 1R4PB 4DUYQ 2C35B 2B3GA 4P2CB 2P5ZX 4HJAA 3GV3A 2NZ1D 2IHEA 2K28A 3CXCA 4QCLA 2IPKD 1E1OA 3PUZA 1BR9A 1Z6HA 1A8VA 1E3PA 3VA5A 4KN4C 3HKZE 1B4OA 2H1EA 3S9WA 4GLAC 3HOYG 1UWVA 4YWMA 2VQFQ 4B3RL 2F0QA 2FMCA 4A3IB 1A63A 2N3SA 1PH6A 2GVBA 4NB3A 3K5LA 3K5MA 1CZGA 1JE5A 2EY2A 1EQRA 2N78A 2DGYA 4HEDA 3J80L 4A93G 5GAGC 1DOMA 2ZM6L 4I65A 4QJFA 4YWKA 1ENCA 2MNAA 4JI0Q 4KHPQ 1EU3A 1X6OA 3TMEA 1OXTA 2ID0A 4HMIA 2K5HA 1H9JA 1PV4A 1NY4A 3U4VA 4H44C 3TSSA 3ITPA 1UE1A 1N32Q 3CCEA 4XIGS 4OONA 2K75A 3STBD 3K7AH 4BWGB 5CBEE 4RH6A 1U4RA 2FFKB 1W6JA 2LXJA 2N55A 3KDFB 1ET9A 3ULPA 3OWEB 3CPFA 4JI1Q 3PGZA 1CQVA 4RMFA 2PI2A 1CUKA 2CW0D 1WYDA 1VQAA 1NAPA 4LF4Q 2CWAA 2F0TA 2F0OA 3L2PA 2R61A 3GD7A 2VB2X 4IPCA 1M8AA 4MHEA 1LUZA 3K81C 2ASBA 3M4QA 4QUFA 3D8GA 5CV5A 1J5EQ 1FNVA 3NQIA 1WCMH 3E0JA 5IIFA 4RGNA 4E6IA 1EZ8A 2JA6G 4IFDJ 1IHZA 3TS2A 1RL2A 3GTPB 3AFQA 5ELNA 2Q2HA 3CCLA 2I0QA 3RLNA 2MHVA 2IX1A 3DEOA 1YJ9A 3A5UA 3GQBA 4JI0L 1MKHA 1LV9A 3BZKA 2QEJC 2B2YC 3VR5A 2WV6D 4X62Q 1KD1C 1MD2D 4CJ0B 2N8NA 1D7QA 3RLOA 5FLXE 2EYPA 2HIVA 4LF9Q 3H3VH 2D5DA 1CKNA 4A3IG 1F9RA 3OWFA 4V190 2OQKA 1X55A 1JJCB 5DEHA 4KN7C 4KY5A 1JC7A 1YBYA 2ENBA 5CR3A 5IWAQ 4A93H 1MJCA 2DNEA 3I55A 3NELA 2XRQD 1STNA 4RGOS 3MFYA 4IFDH 1PH9A 1V1OA 4OX9Q 1GXDC 4DAYA 2M9VA 1PYSB 2JA8H 2D0PA 2RCFA 2EOTA 1SNQA 1CK1A 1DXMA 1XMOL 1PTOF 3K59A 4N8FA 1KABA 3CCSA 1N8RC 1Z7TA 2NN6H 2B63B 4DFAA 2R7ZH 3AFPA 1WOCA 4H0LC 2QDBA 4CDEC 2NVYH 3M85A 2O5JC 1IZ6A 4K8IA 3KF8A 1XWEA 2OWOA 1PH5A 3J80E 4C3IG 1QWYA 2L9HA 3KYHC 4WJ3M 4DR3Q 5IYDH 2SDFA 2IX0A 4TQUS 4NXNL 5M3FB 2E5LQ 2OTJA 2MPMA 2O2LD 1CA6A 3OHXC 1D8LA 1ILQA 1R9TH 2O4XA 3PF5A 2KUMA 2B63H 1V1PB 4HSPA 4A3FB 2D2CC 2A6HC 4GN5A 4JG2A 5CBAE 5J3BA 4JI3Q 3EFXD 2PCFB 2VS1A 1JWSD 3NBIA 2F0SA 4F87A 1YJWA 4LF5Q 1AE2A 4A3JH 4JBMA 4L8JA 5IGBA 3F2UA 5KEEA 4BXXG 5HGQA 2UUAQ 4LW1A 1A2TA 4Y7NH 4HAEA 4KI0A 1GVPA 1F77A 1BBXC 3OYYA 3I3CA 1JE4A 1RIPA 1IBMQ 2A73B 1YNND 2R7DA 1R9TB 4PMBA 3CCRA 1W2BA 5C0XI 1O78A 3WWVA 2BA1A 4MNOA 1C8CA 1A3TA 1IXRA 1PTOD 2AMCB 4I7AA 5EGTA 5CMDA 1AEXA 3DM1A 2HDMA 1B8AA 3AQQA 3QG1A 4YHHQ 5M5YH 1WFQA 2FHTA 1PZKD 3A0JA 4J15A 3TP8A 2VW9A 3HOWB 4KY7A 3EROA 3RR5A 3T1YQ 3QO2A 5I4DA 3S17H 2E5LL 2JA7H 2E2HH 3NBHA 3PUWA 2KOLA 1QUQA 1U4MA 4QMGA 4RCOA 4G57A 4UP9A 4LF6L 1D2BA 1KDCA 1EL0A 3DXJC 3K0YA 3CC7A 2VB3X 3TREA 4PZ6A 2R92H 3CP0A 2EJGC 1EY9A 5M5WB 3L9AX 1SDFA 4WFN3 2JXMB 3ZJYC 2ZJQA 1DOLA 1CZWA 2KQ3A 1MSHA 4FF4A 2JA7B 4GNXB 1A62A 4X65Q 2UUAL 2E2HB 3NENA 3UDIA 4IOAA 4DV7Q 1GM5A 3MHBA 2ICIA 2EY6A 2KJXA 1OO9B 4DNTB 4ODGA 4DF7A 1MI2A 1IBLL 1PTOH 4OWXB 1G91A 1PXUA 1QVFA 4YHHL 1MBYA 3UE0A 1QCBD 2JA5H 5LMUL 2K52A 2EYMA 1TR5A 4DV2L 3EBEA 2JQOA 2LFNA 2AQ3B 4LWCA 1S40A 2H4OA 3D4DA 3GTKH 4Q5VA 1FJGQ 1U4PA 2TMPA 1G2SA 2OXPA 4HR7B 2RSNA 4TSSA 3PO3B 2K5VA 3OW2A 4QUCA 4OL7A 3IAYA 4M1UB 4HJ5A 1IBKQ 3S1QB 2F0KA 1BO0A 2JA6H 4JYAL 2WAQE 5DM73 2RDFA 1PYWD 2F0NA 4H02A 1LACA 3BS1A 5KNBA 2VZAA 1BDOA 4WORA 1S5CD 1RD9D 2F3VA 4L5SA 1EQTA 4GN4B 1VCIA 4LF7Q 1TY0A 2EPBA 3CW2C 2UXCL 1SYCA 1Q90A 1MGSA 5BN3A 2Q2TA 4OO1G 2Z4IA 3J7ZC 2OCEA 4LMQD 1LTID 3KBXA 1KAWA 4NXNQ 2L15A 2Y0SG 5IOCA 3F1ZA 1LYLA 4QIWB 2PPBC 1SNDA 1V9PA 1G6PA 2K50A 1LT3D 1STYA 1HZAA 3QWNA 1VQOA 4B3SQ 1PA6A 1UAPA 1SSOA 4BY1G 2KHIA 2B2YA 2EXDA 3RZOB 1Q7YC 3M7NA 2L4NA 3L3OC 1TVXA 3I2ZA 4ME3A 3I91A 3VYTA 3OIPA 2VUMG 1HUNA 1EWIA 4DR5Q 1UNSA 2D62A 3K5OA 1VQ4A 2XIWA 2K4KA 2UXDQ 5FLXc 3NWSA 4RG1A 2NTTA 1X9NA 1XXGA 5IGEA 2YTYA 5FOBB 3I7FA 1QJOA 4IUTA 2XRSD 1EY7A 3S1NH 2G9HD 4ABNA 5CV6A 2F0GA 1K0SA 2RSOA 4KD4A 1SYFA 2A68D 5JPMC 3HOUH 1FGBD 1O7ZA 3A7AB 1OXVA 2NVYB 4B3MQ 5LL6S 4AYBB 2NTSA 2M2LA 3HOVH 4ZYSA 2R92G 5I6YA 2GA4B 1EYDA 2EJMA 4R9WA 1Z47A 3H15A 4QF4A 3Q6SA 1KXLA 3CD6A 3R2IA 2Z8LA 2JK8A 2UXBL 1LTGD 1I6VC 4RHSA 4IUUA 3DWPA 3KUPA 3IRBA 3TP5A 2NVXB 3M4OB 1JORA 3S16B 4A4IA 1HPCA 1PFNA 3T1HL 3IL8A 3STBC 3A7LA 4GOPB 5DLQE 5IYCG 3I4LA 5KIXA 2K04A 3ZYYX 2WIIB 2QKIC 4K6LA 2ZM6Q 3W1BA 4TKOB 4RA8A 1Y69U 3EA6A 3GTQH 4KLKA 3NEMA 4BBSH 5HY6A 1XYIA 3A54A 1YHQA 1AW7A 2LS01 2OT2A 5M3MH 3T13A 1SAPA 4NPSA 1WTPA 1I94L 1HR0L 5CGKA 1FNWA 5C5MA 4JC0A 5EAYA 1EZ6A 1H9SB 5BN5A 4CKBA 1EEID 3CKIB 2OEOA 2C5CA 1KIXA 5C4XB 3G48A 3A55A 4BA1I 1K3RA 2F03A 3GTOH 3MXUA 5C3WA 3MC0B 4IJHA 4MTKA 4LNQA 2YTVA 4BBRB 4GOPC 3GTMH 1Q46A 1JT8A 2AHOB 1SEBD 1RODA 4DXFA 2XVSA 3H94A 1PZID 1EFID 1PVOA 1F9QA 1TWFB 3U50C 2O5IC 4B3SL 5IGCA 3G6EA 1TWGH 2K7VA 4OHJA 4XT3B 1J5EL 1LTTD 2XN9C 1VS0A 2L11A 1KNEA 1Q12A 2R3ZA 2RA4A 2ZTDA 1XNQQ 5CYUA 4ZLTF 3A5ZB 3PSIA 5FLMG 1B9MA 1LTRD 3HG9A 4P73A 2F4VQ 1EYAA 2XWJB 3SK5A 3VA7A 1SE8A 3OPOA 2UUCL 4DV4L 2EDGA 3NSWA 3NTIA 3D3RA 3HOXH 4A3BG 1JOQA 5C5LA 1XX8A 1JB3A 4BA2I 4PMWA 2DNCA 1CKMA 2NYZD 1HR0Q 4QB4A 3SE0A 5LMNL 1VQPA 3HOZB 4DK0A 4IN3A 4PG3A 4X3KA 1T5EA 2LKVA 1QNKA 1WTVA 1WD0A 1YVCA 5K36H 1VQIA 4S3SA 1NCVA 1PTOB 1XNRQ 4UHVA 4IPHA 1EIYB 5GADC 3Q23A 1SYBA 2JA5G 1O7YA 4ALPA 1VQMA 5KNDA 4I7ZC 1XTCD 2NBFA 2WB1E 4KHZA 1S72A 1EU4A 4OX9L 2CFMA 4ZQ3A 4XQNA 1GKHA 1SMXA 2EVBA 4AQYL 4IUQA 3VYUA 4YY3Q 3AEVA 5FO7B 2K5QA 1WD1A 1KRSA 2ES2A 4JV5L 1Y8OB 4NP5A 3K5NA 1L1OA 3V96A 1J8IA 4V0BA 3MAQA 4K0KQ 1S5DD 2A1AA 3UE1A 4K5VA 1UEBA 1CKNB 2FXQA 1NR4A 1L0WA 5C3EB 2WP8J 4LFCL 1WCMG 1NBWA 4A3MB 4FXDA 4JI5Q 3J7AF 1VQ6A 3KLWA 3MXPA 3LWEA 1TXYA 1X3PA 3VDYA 4AIMA 3BJUA 3MA2B 3PIO3 4U673 2BCOA 4FF2A 1DD2A 1GUWA 1ZXTA 5E4WC 1Y1WH 2VUMH 1QE6A 4HCSA 4J8QA 4DAYB 4ZAIA 3PQIA 1CKOA 4ZCKA 1M1KC 2K33A 1A0IA 4XQJA 2MO1A 3BU2A 4UAIA 1I4QA 3E6ZX 1EY8A 4JI3L 4PQXA 2ZXRA 5C3EH 1II3A 1QNUA 2MUYA 1FVIA 5T1GA 1ASZA 3OMCA 4N9TA 1VQFA 4HIOA 3PO2H 3RZOH 2VQEL 2R93H 5JAVA 1YNJC 4R8NA 2B2VC 4EQPA 3G4SA 1Y1WB 5CV7A 2OF1A 4A3CH 3LWUA 2Q8IB 1EUJA 5C4ZA 1QOHA 1OXSC 2WFWA 4ID6A 4IUPA 5D3IB 3M7GA 1C0AA 5E3FA 1V1PA 4OIJA 4KD3A 3T1YL 3NXWA 4IPDA 3JAML 1PH2A 4UP8A 4UDUC 2F0HA 2NWGA 3PO3G 2RHQB 1GD7A 3VR3A 4ZKCB 1F2MA 2J4XA 2PNRC 1X3EA 3MEHA 1VMPA 4YCVA 4DR4Q 2N88A 4O2DA 2EXZA 4A75A 3S2DH 2F0FA 2VQFL 2SOBA 1SJED 2PYKA 4A3DH 1NR2A 1SBBB 1IYJB 4UY8C 3RZDB 1LT5D 2PZWA 1XPRA 5M5XH 2MJ8A 1GUNA 2V4DA 4OXPA 4GKJQ 4PV1C 4K5XA 2LXKA 3HFZB 1U0LA 1Q82C 1KQSA 3RMHA 2MFIA 3GO5A 1UE5A 4ME5A 4KKSA 3J80c 1YHBA 2ATWA 4JI6Q 2BOSA 1Y8NB 1RKNA 2ZJRA 2F4VL 2E2JH 4RCNA 2FMMA 1BF4A 1JICA 4GLVB 3H09A 4C3IB 3NBHB 5LL6X 1F2LA 1STBA 5M3FH 4JI5L 3GTJH 5M3MB 1UE6A 3A56A 1ZEQX 3PIP3 3NTKA 2QA4A 1Q81C 4B3TL 4DNRB 3RZDH 2BH8A 3E9IA 5HGTA 3J81L 2K1BA 4H7BA 4X66L 1EOVA 5C6AA 4RKLA 1MHWC 1ZKOA 3D4RA 3RUZA 1WI5A 2WACA 1ICFB 1N33Q 4A3FH 4EX5A 4JPBW 3IFTA 2HD3A 1W6KA 5D14A 4FDBA 2E2JB 5A35A 4C3IH 1PLFA 1XPOA 4CJ1B 5IY0A 3GTJB 2VNUD 4EQOA 2MP1A 4DPGA 1X65A 2I5HA 2F3WA 5IP9G 1FL0A 2B2WA 2HCIA 4ZUJA 3QB3A 3CCVA 4JBKA 5IYCH 1SE4A 5CV9A 2HCCA 1BCPB 3HOYB 5M5YB 1S5FD 4LF9L 3F2DA 1E2WA 4K5WA 4J6HA 4DK6C 3J7YW 3M4PA 1I5FA 1L0YB 1TWAH 2RDGA 4BY7H 1LT6D 3I90A 3G71A 5EKIA 3FDTA 2G9DA 4RGTA 1SE2A 3I4NH 1B1ZA 2YU9H 1VDZA 4O0AA 3SVMA 4XQQA 3ER0A 1K73C 3MXNB 3PIOA 2J0TD 3EIVA 2J7ZA 3BYYB 3N6RA 3FMCA 1D5XC 3KK7A 4QGUA 4DR1Q
chains in the Genus database with same CATH topology
4XDXA 3TP6A 1FYCA 1D1IA 1VMCA 2PMZB 2JEAI 5K36G 3PV0A 3S15B 1ONLA 1S5ED 2X69A 1PDQA 2E76C 4C2MB 1BCPF 5NUCA 1TWHB 1M4VA 1STAA 4K14A 5J1ZA 3EJIA 1I6HB 1SFOB 2L0CA 1HA6A 3AB9A 2NVQB 1T5XD 3X3NA 4R8IA 1CQFA 4DA2A 3Q22A 1VF7A 1CFMA 4OO1H 1JWUD 2VUMB 4NMZA 1IYVA 1IKLA 2DY7A 1LABA 4JBWA 3D6CA 1KLUD 3WOEA 4FVMA 5KYLA 2JA6B 1CI3M 1S4ZA 2HDLA 3W2DA 2K01A 1DYQA 1LTSD 4KMUC 4LAAA 3HGBA 4EGVA 1L0XB 1QB5D 3C46A 3GP7A 1D5MC 1E0BA 4DAVA 1HHVA 4IFDG 1UUPA 1KAAA 1PRTD 4OGQC 1HFNA 4B08A 4Z9CB 3MFGA 3P1HA 3URYA 1Y8PB 3BVZA 2YYZA 5C0XG 1V43A 3X3MA 2L5TA 1G6ZA 2EY5A 1ENFA 3S2DB 1D5ZC 4A3DB 3S2HB 3MXGA 4CJ2C 2EYJA 3FPPA 1IYUA 1FD7D 1H9SA 1F9PA 1UEAB 5KGUA 1EOTA 2EYOA 2B39A 1X32A 4A93B 3VR4A 2KVMA 1HQRD 3C3LA 1I4RA 1TS3A 2Z4HA 5E4XA 1PZJD 5EKKA 3DMUA 1LTAD 4MIUA 2F0EA 1DOKA 3TBIB 1HA5A 3I73A 3WOFA 2D9UA 4IURA 4MN3A 5I6WA 4HTHA 2F0JA 2QILA 2K03A 1BQQT 1H9RA 1EY6A 4K2LA 1ZYRD 3KLSA 3DEPA 1SNMA 4IUNA 2ZXPA 3M4YA 2CVRA 3K6OA 2B2TA 3BYTB 5LHY1 4IQZA 5EBDA 4OO1I 2NN6I 1WTRA 4BY7B 3R2TA 2SEBD 4C3JG 3I4MB 4GZYC 3MWYW 4FF1A 2WINB 3H6MA 3WDNA 1MSGA 1HXYD 1TY2A 3NK9A 2KEEA 5G3LD 4ZKBB 1SYGA 4G7OC 4DU9A 3V2TA 5G3LF 1GHJA 2L55A 3TN2A 3NTHA 2E75C 4IALA 3QJYA 3TZUA 1F2YA 3SXHA 1YNNC 4C3JB 2PQEA 5FLXL 1I3QB 3SK6A 1SMYD 3I70A 4KY6A 5D3DA 4ZUIA 4ILWA 5A2QE 3AU7A 3PUXA 1EY5A 5ELEA 1CT1D 3ND9A 2EE1A 1B3AA 3MVVA 2FINB 1CTMA 1U9RA 1ET6A 2CQAA 1BNZA 5HURA 5K5PA 2IT1A 3ONAB 3HZXA 5C4HA 1BCPC 1Q1EA 2IWHA 3K57A 1A6XA 4A3BB 1DZ1A 1LTBD 4HSVA 1WTWA 3P75A 5FO9B 3VYSA 4A3KB 2HUGA 2SNMA 4K2KA 1LLRD 1GUSA 1RTNA 2E2IB 1JWMD 1ICWA 1ML0D 5IGDA 3D6WA 3FKIB 2E2DC 5JOBA 4IFDI 3KLSX 5CC4A 2LMCB 3J7AV 3HEJA 3IKJA 3OW7A 2K5WA 2X6LA 2K32A 1D1KA 2A74C 3SK4A 3VR6A 4HCEA 2RVLA 3ERQA 1JR0D 1CA5A 2IJ0A 4O1NA 2PW7A 5JJZA 5F2DA 4C3HB 4XYOA 2BE5C 2NB0A 3K58A 1FNUA 3W3AA 4KV6A 2AQ1B 5M9OA 5KNCA 4L6TB 1C48A 1KTKA 2TSSA 2EYHA 5EKLA 3QIAA 3BDCA 2BE5D 1A2UA 2R7ZB 5JEAG 1JQYD 1BUVT 1STEA 1SYDA 1K83B 1A15A 4B9WA 1ZYRC 3OOCA 4K8JA 1J9OA 1YNJD 5C3XA 1V8QA 3C2PA 2HQEA 2WKDA 3A8KE 4PMCA 2F0UA 3S1NB 1HRJA 4ZK9B 2A6HD 4F8MA 3HOUB 1CM9A 1I4PA 3P20A 1TIID 3D31A 1B9NA 1RDPD 1CHPD 3SHLA 4OIKA 2Q8TA 2X6GA 3T4AC 1I4HA 1KLGD 3GV6A 3MXNA 2B2UA 5I2XA 4PNYA 2B2WC 4X3UA 3SK8A 1GJXA 1OXXK 1HTPA 1NSNS 4KTAA 3TDQA 4IUVA 5IT9E 1DJRD 1SNCA 5EQ0A 1AZQA 3DHQA 3NUCA 1E2VA 4FO2A 2PZTA 1I4XA 5I9PA 1TQOA 1IL8A 4CHTB 1K8MA 3PUVA 2AWOA 2QCPX 4CGYB 2KA7A 5DM63 3GTMB 2VXWA 1Y1VB 4BS9A 1R4QB 3NP8A 2YU9B 3I8ZA 2Q8RE 1TWGB 4CKEA 3T53B 1EYCA 3U9SA 1U4LA 1EIHA 4B9XA 3H3VC 1KNAA 2KCCA 1KDAA 3L7ZC 5ELBA 2ICEC 3N52A 3LNNA 3T51B 1O7LA 1EWHA 1PFMA 1KDBA 3S1RB 5DNFA 5C4JB 4LK1C 5IT9L 2RBMA 3TZDA 3GTKB 4HN7A 1B50A 4CBVA 4F88A 3R93A 1Q8IA 2F4IA 2DN8A 2DY8A 3P7JA 5I9OA 3HRZC 4EVOA 1C4QA 2XWBB 2E74C 1EEFD 3G7LA 2A6EC 3KBGA 3PUYA 5KRUA 3OMGA 4A3GB 4JK1C 3C1FA 1TU2B 1H9MA 1QILA 3ND8A 3GTGB 4C3HG 1CHQD 5C0XJ 2IW3A 4NKLA 4G7ZC 2BDNA 2AWNA 2K6AA 2A6ED 1B44D 2KHSA 3CRKC 1STGA 1WCMB 4NW2A 1BXTA 4KKTA 3BVMA 1TT2A 4KJNA 2JE6I 2B2UC 1A3VA 5FO8B 3A8IE 4NDXA 1WVLA 4KHVA 3U9OA 1PRTB 1I4GA 3C1EA 1GUGA 3NE5B 1TKWB 1JOOA 3Q0AA 4KKUA 1WTOA 1SNPA 1EIGA 1IW7C 5JPNC 2R93B 3MTSA 2K5DA 1H9KA 3R8BA 1DCZA 1RHPA 1RTOA 2BA0A 4DGZA 2AUKA 2KECA 1AN8A 2A69D 3H91A 2EYFA 5CV8A 1SE3A 4X3SA 5J39A 2A69C 5ELCA 4RFBA 2WB1B 5FKAC 5EPLA 1GHKA 2C9OA 2ZXOA 5C44B 1I50B 3GTQB 3LX0A 1IW7D 3OIQA 1WTXA 4XTCS 5COYA 4IZ8A 2B8FA 2B2TC 5M5XB 4BY1B 4RWSC 3M3YB 5ISRA 1F2ZA 3TP7A 4A3EB 2JSOA 5CORA 4C56C 3IFDA 5DAUA 3I72A 1B53A 3S14B 2CW0C 2NUCA 2PW5A 2K05A 2JEBI 4Y7NB 2I46A 1BOSA 1TS5A 1ILPA 3S1MB 3CU7A 3CQZB 1B2TA 3H0GB 4H13C 1VF5C 2NVTB 2RQXA 1HFGA 4TRDA 2F0IA 1GUTA 3HOXB 2R6GA 4G7HC 4FYDA 2KCNA 1RCVD 5JVH3 3JAME 3NQTA 2F0WA 2AQ2B 4FNFA 1HUMA 1RJTA 4DN4M 4L63B 5JEAJ 3AMUA 4C1NI 3HP3A 3FEWX 5ELDA 2R92B 3O13A 1GUOA 1EY0A 3BG3A 5IGFA 3Q24A 2IL8A 1F9SA 2F0PA 3CHBD 4U68A 2MGSA 1GOZA 1JCKB 2A68C 5IODA 4O42A 1Q3LA 1BCPD 1NUCA 1G291 2F1MA 2JA5B 1SNOA 3A8JE 1DM0B 3BDLA 3V05A 4F7XA 2BDOA 4FP5D 2FJ2A 1SJHD 5D65A 1D6EC 1STHA 1DONA 1AP0A 3R3OA 1AZPA 2EYLA 3RLFA 4N9PA 2ZT9C 4RKBA 4DXGA 1PFBA 4M8AA 2CHBD 1HTLD 4XT1B 3T56B 5JVG3 3CRLC 3D4WA 5E1FA 3K7AB 3HKZB 3UI2A 4J1MA 4WRDA 3PO2B 5EPKA 3HS0C 1ESRA 1G8ZD 2B8GA 2F0DA 2IX3A 3DWAA 1SYEA 4WJWA 5T1IA 2JP1A 2XSCA 3SR1A 1PRTF 4FXKC 5A2QL 2NN6G 2A5HA 5I2YA 1EWCA 3DWQA 3FRPB 5BN4A 4RGMA 3FVQA 3GTLB 2RDHA 3EQLC 4X3TA 2I07B 1SXTA 2QF7A 3VR2A 4XXEA 3MZ5A 2SNSA 2WKCA 2F0LA 3RD4A 1TWCB 1SMYC 3NWTA 1OXUA 5EPJA 5EJWA 2EZVA 2Y0SB 4CKCA 3QOLA 4YIJA 1A3UA 1K8OA 1PTOC 3BZDB 4C1NK 2L1BA 4KJOA 4LJZC 3HOVB 2KEDA 1PMRA 1TS4A 1FR3A 2AUJD 2RKSA 1ENAA 1EY4A 5TSSA 2F0VA 5J22A 2JA8B 4G4KA 1IKMA 2Z1CA 5FK9C 5CV4A 3SEBA 1RF2D 3KLRA 5JEAH 3BVGA 4K6DA 1EQVA 2EY1A 3EVQA 5C0XH 2JYOA 2M00A 1HQMC 3QOJA 1HCZA 3OSOA 1TS2A 4ZRZA 2B2VA 5AFWA 1QG7A 3PMFA 4BBSB 1LO5D 2WAQB 3DUZA 4FF3A 1G2TA 4RAUC 3SDZA 5EBCA 1O80A 4RHRA 1JOKA 3J81E 3FPUB 4Q0FA 4KK7A 1ESFA 4FXGC 3NPPA 4DAPA 3GTOB 2XNAC 5ELFA 4HMJA 1TWAB 1PRTC 1AFPA 4A3JB 1X3QA 5KYIA 2L12A 3I4NB 2EJFC 3NHHA 3BDOA 2PZUA 4XYQA 1WTQA 1E2ZA 1S5BD 3T16A 5IGGA 1Q1BA 4ULLA 4DK1A 2F0MA 3S17B 2PO4A 3G6JB 3E5SA 3VYRA 2LY7A 4EQNA 1LT4D 1R4PB 4P2CB 3GV3A 2NZ1D 2K28A 4QCLA 2IPKD 3PUZA 1BR9A 1Z6HA 3VA5A 4KN4C 1B4OA 2H1EA 3S9WA 2F0QA 2FMCA 4A3IB 3K5LA 3K5MA 1CZGA 2EY2A 4HEDA 3J80L 1DOMA 4I65A 1ENCA 1EU3A 3TMEA 1OXTA 2ID0A 4HMIA 1H9JA 4H44C 3TSSA 3ITPA 4XIGS 4BWGB 5CBEE 4RH6A 1U4RA 2FFKB 1W6JA 2N55A 1ET9A 3OWEB 1CQVA 2CW0D 1NAPA 2F0TA 2F0OA 2R61A 3GD7A 2VB2X 1M8AA 4MHEA 4QUFA 3D8GA 5CV5A 1FNVA 3NQIA 5IIFA 3E0JA 4RGNA 4E6IA 1EZ8A 4IFDJ 1IHZA 3GTPB 2MHVA 2IX1A 3DEOA 3GQBA 1LV9A 2QEJC 2B2YC 3VR5A 2WV6D 1MD2D 4CJ0B 5FLXE 2EYPA 2D5DA 1F9RA 3OWFA 4V190 5DEHA 4KN7C 4KY5A 1JC7A 2ENBA 5CR3A 2DNEA 2XRQD 1STNA 4RGOS 3MFYA 4IFDH 1V1OA 1GXDC 4DAYA 2M9VA 2EOTA 1SNQA 1CK1A 1DXMA 1PTOF 3K59A 1KABA 1Z7TA 2NN6H 2B63B 4DFAA 4H0LC 2QDBA 3M85A 2O5JC 4K8IA 3KF8A 1XWEA 3J80E 4C3IG 1QWYA 2L9HA 2SDFA 2IX0A 4TQUS 5M3FB 2MPMA 2O2LD 1CA6A 3OHXC 1ILQA 2O4XA 2KUMA 1V1PB 4HSPA 4A3FB 2D2CC 2A6HC 5CBAE 3EFXD 2PCFB 1JWSD 3NBIA 2F0SA 4F87A 4L8JA 5IGBA 3F2UA 5KEEA 1A2TA 4HAEA 4KI0A 1F77A 1BBXC 3I3CA 1JE4A 2A73B 1YNND 1R9TB 4PMBA 5C0XI 1O78A 2BA1A 1C8CA 1A3TA 1PTOD 5EGTA 5CMDA 1AEXA 3DM1A 2HDMA 3QG1A 2FHTA 1PZKD 3TP8A 3HOWB 4KY7A 3EROA 3QO2A 5I4DA 3NBHA 3PUWA 2KOLA 1U4MA 4QMGA 4RCOA 4G57A 1D2BA 1KDCA 1EL0A 3DXJC 3K0YA 2VB3X 2EJGC 1EY9A 5M5WB 3L9AX 1SDFA 4WFN3 2JXMB 1DOLA 1CZWA 2KQ3A 1MSHA 4FF4A 2JA7B 2E2HB 3MHBA 2ICIA 2EY6A 2KJXA 1OO9B 4DNTB 4ODGA 4DF7A 1MI2A 1PTOH 1G91A 1PXUA 1MBYA 1QCBD 2EYMA 1TR5A 2LFNA 2AQ3B 2H4OA 3D4DA 4Q5VA 1U4PA 2TMPA 1G2SA 2OXPA 4HR7B 2RSNA 4TSSA 3PO3B 4QUCA 4OL7A 3IAYA 4M1UB 3S1QB 2F0KA 1BO0A 5DM73 2RDFA 1PYWD 2F0NA 1LACA 3BS1A 5KNBA 1BDOA 4WORA 1S5CD 1RD9D 2F3VA 1EQTA 1VCIA 1TY0A 2EPBA 1SYCA 1Q90A 1MGSA 5BN3A 4OO1G 2Z4IA 4LMQD 1LTID 3KBXA 5IOCA 4QIWB 2PPBC 1SNDA 1LT3D 1STYA 3QWNA 1UAPA 1SSOA 2B2YA 3RZOB 3M7NA 2L4NA 3L3OC 1TVXA 3VYTA 3I91A 3OIPA 1HUNA 1UNSA 2D62A 3K5OA 2XIWA 3NWSA 2NTTA 1XXGA 5IGEA 5FOBB 1QJOA 4IUTA 2XRSD 1EY7A 2G9HD 4ABNA 5CV6A 2F0GA 2RSOA 4KD4A 1SYFA 2A68D 5JPMC 1FGBD 1O7ZA 3A7AB 1OXVA 2NVYB 5LL6S 4AYBB 2NTSA 2M2LA 4ZYSA 5I6YA 2GA4B 1EYDA 2EJMA 4R9WA 1Z47A 4QF4A 3Q6SA 3R2IA 2Z8LA 1LTGD 1I6VC 4RHSA 4IUUA 3DWPA 3KUPA 3TP5A 2NVXB 3M4OB 1JORA 3S16B 1HPCA 1PFNA 3IL8A 3A7LA 3I4LA 5KIXA 2K04A 3ZYYX 2WIIB 2QKIC 4K6LA 4TKOB 4RA8A 1Y69U 3EA6A 1XYIA 3A54A 1AW7A 2LS01 2OT2A 3T13A 1SAPA 1WTPA 5CGKA 1FNWA 5C5MA 1EZ6A 1H9SB 5BN5A 4CKBA 1EEID 3CKIB 2OEOA 2C5CA 5C4XB 3A55A 4BA1I 2F03A 3MXUA 5C3WA 3MC0B 4BBRB 1SEBD 1RODA 4DXFA 2XVSA 3H94A 1PZID 1EFID 1TWFB 1F9QA 2O5IC 5IGCA 2K7VA 4OHJA 4XT3B 1LTTD 2XN9C 2L11A 1KNEA 1Q12A 2R3ZA 2RA4A 5CYUA 4ZLTF 1B9MA 1LTRD 3HG9A 1EYAA 2XWJB 3SK5A 3VA7A 3OPOA 2EDGA 3NSWA 3NTIA 3D3RA 1JOQA 5C5LA 1XX8A 1JB3A 4BA2I 4PMWA 2DNCA 3HOZB 2NYZD 4QB4A 3SE0A 4DK0A 4IN3A 4X3KA 1T5EA 2LKVA 1QNKA 1WTVA 1WD0A 5K36H 4S3SA 1NCVA 1PTOB 3Q23A 1SYBA 1O7YA 5KNDA 1XTCD 2NBFA 4I7ZC 4KHZA 1EU4A 4ZQ3A 4XQNA 2EVBA 4IUQA 3VYUA 5FO7B 2K5QA 1WD1A 1Y8OB 4NP5A 3K5NA 3V96A 1J8IA 4V0BA 3MAQA 1S5DD 4K5VA 1NR4A 5C3EB 2WP8J 4FXDA 4A3MB 3J7AF 3MXPA 3LWEA 1X3PA 3MA2B 3PIO3 4FF2A 4U673 2BCOA 1DD2A 1GUWA 1ZXTA 5E4WC 1QE6A 4HCSA 4J8QA 4ZAIA 2K33A 4XQJA 4UAIA 1I4QA 3E6ZX 1EY8A 4PQXA 2ZXRA 1II3A 1QNUA 2MUYA 5T1GA 3OMCA 4N9TA 5JAVA 1YNJC 4R8NA 2B2VC 4EQPA 1Y1WB 5CV7A 2OF1A 3LWUA 2Q8IB 5C4ZA 1QOHA 1OXSC 4ID6A 4IUPA 5D3IB 3M7GA 5E3FA 1V1PA 4OIJA 4KD3A 3NXWA 3JAML 4UDUC 2F0HA 2NWGA 3VR3A 4ZKCB 1F2MA 2J4XA 2PNRC 3MEHA 1VMPA 2N88A 2EXZA 2F0FA 2SOBA 1SJED 2PYKA 1NR2A 1SBBB 3RZDB 1LT5D 2PZWA 2MJ8A 1GUNA 2V4DA 4PV1C 4K5XA 3RMHA 3GO5A 4KKSA 4ME5A 2BOSA 1Y8NB 1RKNA 4RCNA 2FMMA 1BF4A 1JICA 3H09A 4C3IB 5LL6X 1F2LA 1STBA 5M3MB 3A56A 1ZEQX 3PIP3 3NTKA 4DNRB 5HGTA 3J81L 2K1BA 4H7BA 5C6AA 4RKLA 1ZKOA 3D4RA 3RUZA 2WACA 3IFTA 1W6KA 5D14A 2E2JB 5A35A 1PLFA 4CJ1B 3GTJB 2VNUD 4EQOA 2MP1A 2F3WA 2B2WA 2HCIA 4ZUJA 3QB3A 1SE4A 5CV9A 2HCCA 1BCPB 3HOYB 5M5YB 1S5FD 1E2WA 4K5WA 4J6HA 3J7YW 1L0YB 2RDGA 1LT6D 3I90A 5EKIA 3FDTA 2G9DA 4RGTA 1SE2A 1B1ZA 1VDZA 3SVMA 4XQQA 2J0TD 2J7ZA 3BYYB 3N6RA 3FMCA 1D5XC 3KK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIX A;  3LX0 A;  3SK4 A;  2F0M A;  5KRU A;  2F0K A;  5IOD A;  5M9O A;  3ERQ A;  2PZW A;  3H6M A;  3OMG A;  4PNY A;  3TP6 A;  4PMB A;  3SK8 A;  2RDF A;  2F0N A;  3C1F A;  3E5S A;  4KJO A;  4K5X A;  3NK9 A;  4EQN A;  1NSN S;  1NUC A;  2PW7 A;  4NP5 A;  4KTA A;  1SYG A;  2EY5 A;  4IZ8 A;  4DU9 A;  3V2T A;  1A3T A;  2EYP A;  4WOR A;  2F3V A;  4ME5 A;  5EGT A;  1AEX A;  3T13 A;  5F2D A;  1SNO A;  4K5V A;  4IAL A;  4NKL A;  5ISR A;  5CGK A;  2EYJ A;  1SNC A;  5C5M A;  3TP8 A;  1F2Z A;  1RKN A;  2RKS A;  3BDL A;  1F2Y A;  3ERO A;  1EZ6 A;  3OWF A;  4KY7 A;  3SXH A;  1ENA A;  1SYC A;  3TP7 A;  4F7X A;  1EY4 A;  5J22 A;  2F0V A;  2KHS A;  3DHQ A;  3NUC A;  1STB A;  2PZT A;  2OEO A;  5DAU A;  5DEH A;  5KGU A;  4KV6 A;  4KY5 A;  2EYO A;  5CV4 A;  3VA5 A;  4QMG A;  2PQE A;  2ENB A;  1STG A;  5CR3 A;  1STH A;  3MXP A;  5NUC A;  5C3W A;  4K6D A;  4G57 A;  1EQV A;  5I9P A;  1STA A;  4K14 A;  3R3O A;  3SK6 A;  1TQO A;  5IOC A;  2EYL A;  2EY1 A;  3S9W A;  4N9P A;  2NUC A;  5J1Z A;  3EVQ A;  2F0Q A;  1STN A;  1TT2 A;  2PW5 A;  3EJI A;  4RKB A;  2EYH A;  4KJN A;  5EKL A;  1SND A;  1A3V A;  1KDC A;  3BDC A;  4KY6 A;  5HGT A;  4H7B A;  2M00 A;  4NDX A;  4ZUI A;  3QOJ A;  5C6A A;  1STY A;  3OSO A;  1A2U A;  2EY2 A;  4RKL A;  1EY5 A;  4KHV A;  3U9O A;  3RUZ A;  2WAC A;  5EKK A;  1EY9 A;  4I65 A;  3C1E A;  1SNQ A;  3D4W A;  5E1F A;  1SYD A;  3MVV A;  5IGC A;  1ENC A;  3PMF A;  1EY8 A;  3DMU A;  1JOO A;  4J1M A;  1KAB A;  4MIU A;  2F0E A;  4WRD A;  4B9W A;  4DFA A;  1U9R A;  3NP8 A;  1II3 A;  2KQ3 A;  3TME A;  2QDB A;  5HUR A;  4HMI A;  5K5P A;  4K8J A;  3OMC A;  4K8I A;  2F0D A;  4N9T A;  4NMZ A;  4TRD A;  1SYE A;  1SNP A;  2F0I A;  3HZX A;  3ITP A;  1EYC A;  5C4H A;  3MHB A;  5C3X A;  2EY6 A;  5IGE A;  1JOK A;  4B9X A;  1EYA A;  3D6C A;  5JAV A;  3SR1 A;  5KYL A;  3SK5 A;  4EQO A;  1EY7 A;  4R8N A;  4ODG A;  4DF7 A;  5CV6 A;  2F0G A;  2HQE A;  4EQP A;  1KDA A;  4PMC A;  4KD4 A;  1SYF A;  5CV7 A;  2OF1 A;  2F3W A;  5I6W A;  1JOQ A;  4HTH A;  3NQT A;  2F0W A;  2F0U A;  1KDB A;  5C5L A;  3P75 A;  5C4Z A;  2F0J A;  4ZUJ A;  3QB3 A;  2SNM A;  4DGZ A;  4F8M A;  5I6Y A;  4LAA A;  4K2K A;  4QB4 A;  4ID6 A;  1EYD A;  5CV9 A;  4HMJ A;  2RBM A;  2EYM A;  1TR5 A;  2O4X A;  5E3F A;  2LKV A;  4QF4 A;  4K2L A;  1EY6 A;  4KD3 A;  2F0T A;  3NXW A;  2F0O A;  4K5W A;  4J6H A;  5KYI A;  3MZ5 A;  2EYF A;  4S3S A;  5CV8 A;  1EY0 A;  2SNS A;  5IGD A;  2F0H A;  3SHL A;  3D4D A;  5IGF A;  3NHH A;  5JOB A;  2F0L A;  1KAA A;  1SNM A;  1F2M A;  5J39 A;  2PZU A;  2OXP A;  1SYB A;  3TP5 A;  3MEH A;  3D8G A;  4IUN A;  5CV5 A;  5CC4 A;  5IIF A;  5I9O A;  1JOR A;  3HEJ A;  3T16 A;  1EZ8 A;  4E6I A;  2F0S A;  4EVO A;  5IGG A;  2EXZ A;  1IHZ A;  3P1H A;  2F0F A;  2F0P A;  5IGB A;  2SOB A;  2PYK A;  5KEE A;  4ZQ3 A;  3QOL A;  4OL7 A;  4YIJ A;  1A3U A;  1A2T A; 
#chains in the Genus database with same CATH topology
 1P8L A;  2EQS A;  2VY3 A;  4XDX A;  2Z9H A;  4IJL A;  4R4C A;  3TP6 A;  1FYC A;  5GRO A;  3S1R H;  2JA8 G;  4LF8 Q;  1D1I A;  4YCU A;  1VQE A;  1SFO H;  1VMC A;  5C4J H;  2PMZ B;  2JEA I;  1BVS A;  4JI8 Q;  2PMZ E;  3PV0 A;  5K36 G;  3S15 B;  1ONL A;  1S5E D;  2X69 A;  4JI6 L;  4R4T A;  1PDQ A;  2E76 C;  4C2M B;  1BCP F;  1YHA A;  4P74 A;  5NUC A;  1TWH B;  1M4V A;  4AH6 A;  1STA A;  4K14 A;  1VQH A;  5J1Z A;  4JI4 Q;  2JJQ A;  4AYB E;  3EJI A;  4L5T A;  1I6H B;  1SFO B;  2L0C A;  1HA6 A;  3AB9 A;  2NVQ B;  1T5X D;  3X3N A;  4R8I A;  1CQF A;  4DA2 A;  3Q22 A;  1VF7 A;  3E0E A;  1CFM A;  1HZ9 A;  2MQH A;  3BZC A;  4OO1 H;  1JWU D;  3M9B A;  3I56 A;  2VUM B;  3T1H Q;  2PI2 E;  1YI2 A;  3PO3 H;  4NMZ A;  4C2M H;  1IYV A;  1IKL A;  2DY7 A;  2N49 A;  1LAB A;  4JBW A;  1Y1V G;  4L5R C;  3D6C A;  1KLU D;  3WOE A;  4FVM A;  5KYL A;  3S1Q H;  2JA6 B;  1CI3 M;  1S4Z A;  2HDL A;  3FKI G;  3W2D A;  2K01 A;  1DYQ A;  1LTS D;  4DV5 Q;  4DV7 L;  3KFU A;  4KMU C;  4LAA A;  3HGB A;  4OEL B;  4EGV A;  1L0X B;  1QB5 D;  1HZC A;  1VQN A;  3C46 A;  3GP7 A;  4R4Q A;  1D5M C;  1E0B A;  1IBL Q;  4P72 A;  4DAV A;  1HHV A;  3S2H H;  4IFD G;  1UUP A;  1KAA A;  1HH2 P;  4IO9 A;  1PRT D;  1T9H A;  1MJE A;  2OTL A;  4OGQ C;  1HFN A;  4B08 A;  1XJV A;  4DUY L;  2I5L X;  3PIP A;  4Z9C B;  3MFG A;  3P1H A;  3U4Z A;  3URY A;  1Y8P B;  1N34 L;  3BVZ A;  4GOP A;  1N36 L;  1FJG L;  2YYZ A;  5C0X G;  2YV5 A;  2EIF A;  2K14 A;  1HNZ Q;  1GO3 E;  1NMG A;  1V43 A;  3X3M A;  2L5T A;  1G6Z A;  4PZ7 A;  2EY5 A;  1ENF A;  3S2D B;  4B3R Q;  1PH4 A;  4NXM L;  1D5Z C;  4A3D B;  3S2H B;  3MXG A;  4P75 A;  4CJ2 C;  4OWW B;  2EYJ A;  3FPP A;  1IYU A;  1QVG A;  1FD7 D;  1BKB A;  1H9S A;  3J81 i;  1F9P A;  1UEA B;  5KGU A;  1EOT A;  2EYO A;  1JMC A;  3KJP A;  2B39 A;  2WAQ G;  1X32 A;  5IYB G;  1QVC A;  4A93 B;  3VR4 A;  1NNX A;  1HQR D;  2KVM A;  3C3L A;  1I4R A;  1TS3 A;  1XTD A;  2Z4H A;  5E4X A;  1PZJ D;  3W5O A;  5EKK A;  2CH4 W;  4CDC C;  3DMU A;  1LTA D;  4MIU A;  2F0E A;  4BXX H;  1DOK A;  2HIX A;  2NVX H;  1UE7 A;  1BBU A;  3TBI B;  1HA5 A;  4BY1 H;  4A3K G;  3I73 A;  4DR1 L;  2A8V A;  5M3F G;  1XMQ Q;  3WOF A;  2D9U A;  4R4I A;  2KBN A;  4IUR A;  1VQJ A;  1SN8 A;  4MN3 A;  3I4O A;  5I6W A;  2F52 A;  4HTH A;  2F0J A;  2ZTC A;  3CF5 A;  3I4N G;  4X65 L;  1N32 L;  2QIL A;  2K03 A;  1BQQ T;  2DUD A;  2Z6K A;  4HJ9 A;  1H9R A;  1EY6 A;  4K2L A;  1ZYR D;  4DK3 C;  3KLS A;  1Q86 C;  3DEP A;  4DV0 Q;  2B29 A;  4JOI C;  1SNM A;  5C4X H;  1VQL A;  4IUN A;  2ZXP A;  2UU9 L;  3M4Y A;  2CVR A;  3K6O A;  2B2T A;  3BYT B;  5LHY 1;  5IP9 H;  4IQZ A;  5EBD A;  4DV1 L;  4OO1 I;  2NN6 I;  2RF4 A;  1WTR A;  3R2T A;  4BY7 B;  2SEB D;  3F2C A;  4C3J G;  1I3Q H;  3I4M B;  3JAM c;  4GZY C;  1TWF H;  3MWY W;  4FF1 A;  2E8G A;  1X54 A;  2WIN B;  3H6M A;  3WDN A;  1MSG A;  5GQO A;  3CME A;  4UPA A;  3ICE A;  1YIJ A;  1HXY D;  1TY2 A;  3NK9 A;  2KEE A;  3E9H A;  5G3L D;  4ZKB B;  1L1O B;  1SYG A;  4DR6 L;  2OQ0 A;  4DU9 A;  4G7O C;  3V2T A;  5JJK A;  5G3L F;  1GHJ A;  2L55 A;  3TN2 A;  4IPG A;  3NTH A;  2E75 C;  4IAL A;  2XGT A;  4A3F G;  3QJY A;  3TZU A;  1F2Y A;  4LFA L;  3SXH A;  1SR3 A;  1YNN C;  2Z6B A;  4C3J B;  3HOW H;  4X62 L;  1Y1V H;  2IY5 B;  2PQE A;  5FLX L;  1I3Q B;  3SK6 A;  1SMY D;  3I70 A;  4B3M L;  4KY6 A;  3KF6 A;  3KJO A;  5D3D A;  5BR8 L;  4ZUI A;  4ILW A;  5A2Q E;  3AU7 A;  3PUX A;  1EY5 A;  1VQ5 A;  5ELE A;  1CT1 D;  4CDD C;  4A3K H;  3JC6 6;  3ND9 A;  2EE1 A;  1B3A A;  3MVV A;  1TWH H;  1CTM A;  1Z9F A;  2FIN B;  3W1G A;  1L1O C;  1U9R A;  4DR4 L;  1ET6 A;  2CQA A;  1BNZ A;  5HUR A;  4DV1 Q;  5K5P A;  3FKI H;  2IT1 A;  3CAM A;  3ONA B;  3HZX A;  5C4H A;  1BCP C;  1Q1E A;  1Y14 B;  1HNW L;  2IWH A;  3K57 A;  1A6X A;  2CQO A;  4A3B B;  3HOV G;  1DZ1 A;  2R7F A;  1LTB D;  4HSV A;  1WTW A;  3P75 A;  5FO9 B;  4GNX C;  1C9O A;  3VYS A;  4A3K B;  2HUG A;  2SNM A;  4K2K A;  1LLR D;  3UDG A;  4NXM Q;  1X56 A;  1YJN A;  1GUS A;  1RTN A;  2E2I B;  1JWM D;  1ICW A;  1K3B C;  1ML0 D;  5IGD A;  3D6W A;  3FKI B;  2E2D C;  5JOB A;  4IFD I;  3KLS X;  4X64 Q;  1C7Y A;  4LUO A;  5IE8 A;  5E7N A;  5CC4 A;  4A3G H;  2LMC B;  3J7A V;  3HEJ A;  3IKJ A;  5BR8 Q;  3OW7 A;  2K5W A;  4DR7 Q;  3CC2 A;  2X6L A;  2K32 A;  1D1K A;  4X66 Q;  1EYG A;  2A74 C;  4HJ8 A;  1V1Q A;  3SK4 A;  4HCE A;  3VR6 A;  2RVL A;  4JOI A;  3ERQ A;  1JR0 D;  1CA5 A;  2IJ0 A;  3Q8D A;  4O1N A;  1VQD A;  4HIK A;  2PW7 A;  2CKZ B;  2PQA A;  2K5N A;  4A3D G;  5JJZ A;  4LF5 L;  1OTC A;  2I5M X;  5F2D A;  1K83 H;  4C3H B;  1EFW A;  4XYO A;  2BE5 C;  3EN2 A;  1NJI C;  1XMQ L;  2NB0 A;  5AJ3 Q;  3K58 A;  1TWC H;  1FNU A;  3W3A A;  4KV6 A;  2UUC Q;  2AQ1 B;  5M9O A;  5KNC A;  4DV4 Q;  4GN3 B;  4L6T B;  3HKZ G;  4K0K L;  5ELO A;  3TQY A;  1C48 A;  5FLM H;  1KTK A;  2TSS A;  2EYH A;  5EKL A;  3QIA A;  3BDC A;  5L37 A;  2BE5 D;  4POG A;  1A2U A;  2R7Z B;  5JEA G;  4JI2 Q;  1JQY D;  1BUV T;  2H5X A;  1STE A;  1SYD A;  1E7Z A;  1JJ2 A;  1K83 B;  1A15 A;  4C3H H;  5M3M G;  3ERS X;  1B70 B;  4B9W A;  1ZYR C;  1VQ9 A;  3OOC A;  1XNR L;  4Y52 H;  4DAM A;  4K8J A;  1J9O A;  4LFB L;  4A3M G;  1YNJ D;  5C3X A;  1V8Q A;  1O7I A;  3CMA A;  4DR2 L;  3C2P A;  2HQE A;  2KCT A;  2WKD A;  3A8K E;  4PMC A;  1HZB A;  2Q2I A;  2RHS B;  4IOC A;  2F0U A;  3S1N B;  1HRJ A;  4BBR G;  4ZK9 B;  2A6H D;  4F8M A;  1EIF A;  3HOU B;  3CC4 A;  1CM9 A;  4MTN A;  1I4P A;  3P20 A;  1VQK A;  1TII D;  1E24 A;  3D31 A;  4QY7 A;  3CCJ A;  5AJ3 L;  2JA9 A;  4BBS G;  1B9N A;  4A3C G;  1K8A C;  1RDP D;  1CHP D;  1PH3 A;  3SHL A;  4OIK A;  2Q8T A;  4KHP L;  2X6G A;  3T4A C;  1I4H A;  1KLG D;  2WB1 G;  4EQ5 A;  3GV6 A;  3MXN A;  3HOX G;  3DLL A;  4GKK Q;  3S16 H;  2B2U A;  1HJP A;  5I2X A;  1VQ8 A;  2BH2 A;  3FP9 A;  4A3E H;  4PNY A;  2B2W C;  2D0O A;  4X3U A;  3SK8 A;  1GJX A;  1HNX L;  3PCO B;  4A76 A;  1OXX K;  1HTP A;  1NSN S;  3ULL A;  4KTA A;  2KCM A;  3TDQ A;  4IUV A;  3MEF A;  2YTX A;  5IT9 E;  1DJR D;  1SNC A;  1HNW Q;  5EQ0 A;  1AZQ A;  1AE3 A;  3DHQ A;  3NUC A;  1X3F A;  4QIW E;  1E2V A;  4FO2 A;  2DJG C;  2PZT A;  3TEH B;  2JN4 A;  1I4X A;  4DV5 L;  5I9P A;  1TQO A;  1IL8 A;  4A3L G;  4CHT B;  1M90 C;  5C3E G;  1K8M A;  4LF7 L;  3PUV A;  1VQB A;  1Q8K A;  4DUZ Q;  2AWO A;  2QCP X;  4CGY B;  2KA7 A;  4BBR H;  5DM6 3;  3GTM B;  2VXW A;  3RN2 A;  1Y1V B;  4BS9 A;  5FJ8 H;  3ULJ A;  1R4Q B;  4X6A H;  1WJJ A;  3NP8 A;  2YU9 B;  4HID A;  3I8Z A;  2Q8R E;  4GKK L;  1TWG B;  1E1T A;  4CKE A;  3T53 B;  4A3L H;  1N34 Q;  1EYC A;  3U9S A;  4QL5 A;  1U4L A;  1EIH A;  3K0X A;  4B9X A;  3H3V C;  1KNA A;  2KCC A;  5IYB H;  2UXB Q;  1KDA A;  3L7Z C;  2QDL A;  5ELB A;  2ICE C;  3N52 A;  3LNN A;  3T51 B;  1ASY A;  1O7L A;  1EWH A;  1PFM A;  3FHW A;  1KDB A;  3S1R B;  4DV6 L;  3B6Y A;  5DNF A;  4GKJ L;  5C4J B;  4LK1 C;  5IT9 L;  3S15 H;  2RBM A;  4L5Q A;  3TZD A;  3GTK B;  4HN7 A;  1B50 A;  4CBV A;  5C44 G;  4A3B H;  4F88 A;  4TVA B;  2VQE Q;  3R93 A;  1Q8I A;  2F4I A;  4JI7 L;  2DN8 A;  1Y1W G;  2DY8 A;  3P7J A;  1N9W A;  5I9O A;  3HRZ C;  4EVO A;  1C4Q A;  2XWB B;  3UDX A;  2E74 C;  1EEF D;  3G7L A;  1AH9 A;  2A6E C;  3KBG A;  3PUY A;  2RCN A;  1WTH A;  1I6H H;  5KRU A;  3OMG A;  4A3G B;  4JK1 C;  1N33 L;  2Y0S E;  5JJL A;  3C1F A;  1TU2 B;  4LF6 Q;  1H9M A;  2R93 G;  3AYH B;  1QIL A;  3CCU A;  3HOW G;  5IWA L;  3ND8 A;  1K8G A;  3GTG B;  4C3H G;  1CHQ D;  1BBW A;  1YZ6 A;  4CDF C;  1JB7 A;  5C0X J;  5JJI A;  2IW3 A;  4NKL A;  4G7Z C;  2BDN A;  2AWN A;  2K6A A;  2A6E D;  4JW0 A;  1B44 D;  2KHS A;  1G51 A;  4GS3 A;  3CRK C;  1YIT A;  1W3S A;  1STG A;  2Z0S A;  1WCM B;  1KRT A;  4NW2 A;  1BXT A;  4KKT A;  4A3M H;  3BVM A;  3GTP H;  1TT2 A;  2VL6 A;  1XNQ L;  4KJN A;  2JE6 I;  2B2U C;  1A3V A;  5FO8 B;  3J81 j;  3A8I E;  4NDX A;  1I94 Q;  1WVL A;  1IBM L;  4KHV A;  3U9O A;  1PRT B;  3GTG H;  1I4G A;  3C1E A;  1GUG A;  5GAE C;  4DR3 L;  3NE5 B;  1TKW B;  1JOO A;  4DNI A;  3OTO Q;  3Q0A A;  3CCQ A;  4KKU A;  5LMU Q;  1HR0 W;  1WTO A;  1QZG A;  1SNP A;  2Z6K C;  1NTG A;  3JAM i;  1EIG A;  1IW7 C;  1IL2 A;  2NVT H;  5JPN C;  3KDF A;  2R93 B;  4R1J A;  5IP7 G;  3MTS A;  5C44 H;  2K5D A;  1H9K A;  1HNX Q;  3R8B A;  1DCZ A;  1RHP A;  1RTO A;  2BA0 A;  4DGZ A;  4DV6 Q;  3GDE A;  2AUK A;  3LGJ A;  2KEC A;  3K7U C;  1IBK L;  1AN8 A;  3HOZ G;  1U5K A;  2A69 D;  3H91 A;  4AQY Q;  2EYF A;  2NZH A;  5CV8 A;  1NE3 A;  1PHJ A;  1YNX A;  1SE3 A;  4X3S A;  3SGI A;  5J39 A;  2A69 C;  5ELC A;  3UDF A;  4JV5 Q;  4RFB A;  4YWL A;  2V1C C;  2WB1 B;  5FKA C;  5EPL A;  1YEZ A;  1DGS A;  1GHK A;  2C9O A;  2ZXO A;  5C44 B;  1I50 B;  3GTQ B;  3LX0 A;  4JBJ A;  3OTO L;  1IW7 D;  2GN5 A;  3OIQ A;  3QR8 A;  1SRU A;  1WTX A;  4XTC S;  4LUV A;  5COY A;  4IZ8 A;  2B8F A;  2NZO A;  2B2T C;  5M5X B;  4BY1 B;  2UUB Q;  4RWS C;  3M3Y B;  1NMF A;  3CQZ H;  5ISR A;  2ZJP A;  1F2Z A;  3H0G H;  2QW7 A;  3TP7 A;  4A3E B;  2JSO A;  5COR A;  4C56 C;  3IFD A;  2QEX A;  5DAU A;  3I72 A;  3F8T A;  1B53 A;  3K8A A;  3S14 B;  3CPW A;  2CW0 C;  2NUC A;  2PW5 A;  1VQC A;  5IT9 c;  2K05 A;  3KF6 B;  2JEB I;  2I46 A;  4Y7N B;  3CCM A;  4JVZ A;  4N8X 1;  1BOS A;  1TS5 A;  1ILP A;  3S1M B;  3CU7 A;  3M3Y H;  3CQZ B;  1B2T A;  3H0G B;  4H13 C;  2Q2U A;  1FGU A;  1VF5 C;  3H0G G;  2NVT B;  2RQX A;  1JJG A;  3KF8 B;  1HFG A;  4TRD A;  2F0I A;  1GUT A;  3H3V I;  3S14 H;  4YCW A;  3HOX B;  4DV2 Q;  2R6G A;  4G7H C;  4FYD A;  1B7Y B;  2KCN A;  3I4M H;  1RCV D;  5JVH 3;  3HOZ H;  3JAM E;  3NQT A;  2F0W A;  3DM3 A;  2AQ2 B;  1HNZ L;  2UUB L;  1H95 A;  4FNF A;  1HUM A;  1RJT A;  4DN4 M;  2HT1 A;  5IYD G;  3S1M H;  4L63 B;  5FJ8 G;  5JEA J;  3AMU A;  4C1N I;  3HP3 A;  3FEW X;  5ELD A;  2R92 B;  3O13 A;  4A3E G;  3HKS A;  1GUO A;  1J6Q A;  5M5W H;  3HOY H;  4APV A;  1EY0 A;  2KHJ A;  3BG3 A;  5IGF A;  5H1S E;  4C3J H;  3Q24 A;  1XMO Q;  4JYA Q;  1E22 A;  1KHI A;  3RNU A;  2IL8 A;  1F9S A;  2DJF C;  2F0P A;  3CHB D;  1B3Q A;  1XPU A;  4U68 A;  1MIU A;  5C4X G;  4JI2 L;  3D0F A;  2MGS A;  2F3I A;  1GOZ A;  1JCK B;  1S3O A;  2A68 C;  1VQG A;  5IOD A;  4O42 A;  1Q3L A;  1BCP D;  4MZ9 A;  1NUC A;  2PQA B;  4DV3 L;  1G29 1;  2F1M A;  2JA5 B;  2R7Z G;  3RN5 A;  1SNO A;  3A8J E;  1DM0 B;  3BDL A;  3V05 A;  4F7X A;  4A3G G;  2BDO A;  2ZTE A;  4FP5 D;  2FJ2 A;  1SJH D;  5D65 A;  1QUQ B;  1D6E C;  1STH A;  1DON A;  1AP0 A;  3R3O A;  1AZP A;  2EYL A;  3RLF A;  4N9P A;  2ZT9 C;  4RKB A;  4DXG A;  3L0O A;  1PFB A;  1K0R A;  4M8A A;  4DR5 L;  2UXD L;  2CHB D;  1HTL D;  3E3X A;  4XT1 B;  3TRZ A;  4UP7 A;  3T56 B;  2E2I H;  3J7A 5;  5JVG 3;  3CRL C;  3D4W A;  5E1F A;  1L2F A;  3K7A B;  3HKZ B;  3UI2 A;  1K9M C;  4J1M A;  4WRD A;  2NVQ H;  3PO2 B;  5EPK A;  2PNH A;  3HS0 C;  1ESR A;  1G8Z D;  2B8G A;  4GNX A;  3U58 A;  3KOJ A;  5IP7 H;  2UU9 Q;  1QZH A;  2F0D A;  2IX3 A;  3DWA A;  1SYE A;  4AYB G;  4WJW A;  3S24 A;  5T1I A;  2JP1 A;  1VQ7 A;  2XSC A;  3SR1 A;  1PRT F;  4FXK C;  5A2Q L;  2NN6 G;  2A5H A;  5I2Y A;  4DV3 Q;  4HIM A;  1EWC A;  3DWQ A;  3FRP B;  5BN4 A;  4RGM A;  1PFS A;  3FVQ A;  1PH7 A;  3GTL B;  2RDH A;  3EQL C;  4P71 A;  3K80 C;  4X3T A;  2I07 B;  1SXT A;  2QF7 A;  4OEM B;  3VR2 A;  3HOU G;  4PZ8 A;  4XXE A;  4QQB X;  3MZ5 A;  2SNS A;  4LFA Q;  2WKC A;  1LTL A;  2F0L A;  3RD4 A;  1TWC B;  1SMY C;  3NWT A;  2XTI A;  2HHH L;  2A19 A;  1OXU A;  1KC8 C;  4WJ4 A;  5EPJ A;  5EJW A;  2EZV A;  2Y0S B;  3PF4 A;  4CKC A;  3QOL A;  4YIJ A;  1A3U A;  2HQL A;  4DUZ L;  3GTL H;  1K8O A;  1PTO C;  3A74 A;  3BZD B;  4C1N K;  1EQQ A;  4DV0 L;  2L1B A;  2B63 G;  4KJO A;  4LJZ C;  2AKW B;  2CH4 A;  5LMN Q;  4POF A;  1PH1 A;  1X3G A;  3HOV B;  4DR7 L;  2QGQ A;  1PYB A;  2KED A;  1PMR A;  4JI4 L;  4GLX A;  1CSQ A;  1I50 H;  1K28 A;  1TS4 A;  1FR3 A;  2AUJ D;  2RKS A;  1ENA A;  1EY4 A;  5TSS A;  2F0V A;  2G5D A;  5J22 A;  1PH8 A;  2JA8 B;  4G4K A;  1IKM A;  2Z1C A;  5FK9 C;  5CV4 A;  3SEB A;  1RF2 D;  3KLR A;  5JEA H;  4LF8 L;  3M4O H;  3BVG A;  4K6D A;  1EQV A;  2EY1 A;  4JI8 L;  3EVQ A;  5C0X H;  4DR6 Q;  1LM0 A;  2JYO A;  4JCV E;  2ALY B;  2M00 A;  1HQM C;  3QOJ A;  1HCZ A;  3OSO A;  4JI7 Q;  1TS2 A;  4ZRZ A;  2B2V A;  5AFW A;  1QG7 A;  3PMF A;  4BBS B;  1LO5 D;  4X64 L;  2WAQ B;  3DUZ A;  4OWT B;  4FF3 A;  2GVA A;  1G2T A;  4RAU C;  3SDZ A;  5EBC A;  4DKA C;  1O80 A;  4RHR A;  1JOK A;  3J81 E;  3FPU B;  4Q0F A;  2UXC Q;  3J81 c;  4KK7 A;  1ESF A;  4FXG C;  3NPP A;  4DAP A;  1CSP A;  2IHF A;  3GTO B;  1P16 A;  4JI1 L;  1KL9 A;  2MO0 A;  2CCZ A;  2XNA C;  4LFB Q;  5LMN W;  5ELF A;  4LF4 L;  2JA7 G;  4HMJ A;  1TWA B;  3I4M G;  4BY7 G;  1PRT C;  4DR2 Q;  5GAH C;  1AFP A;  4A3J B;  1X3Q A;  5KYI A;  2L12 A;  1N36 Q;  3PO2 G;  3I4N B;  2EJF C;  2LSS A;  4LUZ A;  3NHH A;  3F2B A;  3BDO A;  4YY3 L;  2PZU A;  4R4O A;  4XYQ A;  1WTQ A;  1E2Z A;  1S5B D;  3T16 A;  5IGG A;  2HHH Q;  3J80 i;  1Q1B A;  4ULL A;  1SRO A;  4DK1 A;  4A3J G;  2F0M A;  2KEN A;  4A3I H;  3S17 B;  4LFC Q;  2PO4 A;  3G6J B;  3E5S A;  1SLJ A;  3VYR A;  2LY7 A;  4HJ7 A;  3TS0 A;  4B3T Q;  2CWP A;  4EQN A;  1LT4 D;  1R4P B;  4DUY Q;  2C35 B;  2B3G A;  4P2C B;  2P5Z X;  4HJA A;  3GV3 A;  2NZ1 D;  2IHE A;  2K28 A;  3CXC A;  4QCL A;  2IPK D;  1E1O A;  3PUZ A;  1BR9 A;  1Z6H A;  1A8V A;  1E3P A;  3VA5 A;  4KN4 C;  3HKZ E;  1B4O A;  2H1E A;  3S9W A;  4GLA C;  3HOY G;  1UWV A;  4YWM A;  2VQF Q;  4B3R L;  2F0Q A;  2FMC A;  4A3I B;  1A63 A;  2N3S A;  1PH6 A;  2GVB A;  4NB3 A;  3K5L A;  3K5M A;  1CZG A;  1JE5 A;  2EY2 A;  1EQR A;  2N78 A;  2DGY A;  4HED A;  3J80 L;  4A93 G;  5GAG C;  1DOM A;  2ZM6 L;  4I65 A;  4QJF A;  4YWK A;  1ENC A;  2MNA A;  4JI0 Q;  4KHP Q;  1EU3 A;  1X6O A;  3TME A;  1OXT A;  2ID0 A;  4HMI A;  2K5H A;  1H9J A;  1PV4 A;  1NY4 A;  3U4V A;  4H44 C;  3TSS A;  3ITP A;  1UE1 A;  1N32 Q;  3CCE A;  4XIG S;  4OON A;  2K75 A;  3STB D;  3K7A H;  4BWG B;  5CBE E;  4RH6 A;  1U4R A;  2FFK B;  1W6J A;  2LXJ A;  2N55 A;  3KDF B;  1ET9 A;  3ULP A;  3OWE B;  3CPF A;  4JI1 Q;  3PGZ A;  1CQV A;  4RMF A;  2PI2 A;  1CUK A;  2CW0 D;  1WYD A;  1VQA A;  1NAP A;  4LF4 Q;  2CWA A;  2F0T A;  2F0O A;  3L2P A;  2R61 A;  3GD7 A;  2VB2 X;  4IPC A;  1M8A A;  4MHE A;  1LUZ A;  3K81 C;  2ASB A;  3M4Q A;  4QUF A;  3D8G A;  5CV5 A;  1J5E Q;  1FNV A;  3NQI A;  1WCM H;  3E0J A;  5IIF A;  4RGN A;  4E6I A;  1EZ8 A;  2JA6 G;  4IFD J;  1IHZ A;  3TS2 A;  1RL2 A;  3GTP B;  3AFQ A;  5ELN A;  2Q2H A;  3CCL A;  2I0Q A;  3RLN A;  2MHV A;  2IX1 A;  3DEO A;  1YJ9 A;  3A5U A;  3GQB A;  4JI0 L;  1MKH A;  1LV9 A;  3BZK A;  2QEJ C;  2B2Y C;  3VR5 A;  2WV6 D;  4X62 Q;  1KD1 C;  1MD2 D;  4CJ0 B;  2N8N A;  1D7Q A;  3RLO A;  5FLX E;  2EYP A;  2HIV A;  4LF9 Q;  3H3V H;  2D5D A;  1CKN A;  4A3I G;  1F9R A;  3OWF A;  4V19 0;  2OQK A;  1X55 A;  1JJC B;  5DEH A;  4KN7 C;  4KY5 A;  1JC7 A;  1YBY A;  2ENB A;  5CR3 A;  5IWA Q;  4A93 H;  1MJC A;  2DNE A;  3I55 A;  3NEL A;  2XRQ D;  1STN A;  4RGO S;  3MFY A;  4IFD H;  1PH9 A;  1V1O A;  4OX9 Q;  1GXD C;  4DAY A;  2M9V A;  1PYS B;  2JA8 H;  2D0P A;  2RCF A;  2EOT A;  1SNQ A;  1CK1 A;  1DXM A;  1XMO L;  1PTO F;  3K59 A;  4N8F A;  1KAB A;  3CCS A;  1N8R C;  1Z7T A;  2NN6 H;  2B63 B;  4DFA A;  2R7Z H;  3AFP A;  1WOC A;  4H0L C;  2QDB A;  4CDE C;  2NVY H;  3M85 A;  2O5J C;  1IZ6 A;  4K8I A;  3KF8 A;  1XWE A;  2OWO A;  1PH5 A;  3J80 E;  4C3I G;  1QWY A;  2L9H A;  3KYH C;  4WJ3 M;  4DR3 Q;  5IYD H;  2SDF A;  2IX0 A;  4TQU S;  4NXN L;  5M3F B;  2E5L Q;  2OTJ A;  2MPM A;  2O2L D;  1CA6 A;  3OHX C;  1D8L A;  1ILQ A;  1R9T H;  2O4X A;  3PF5 A;  2KUM A;  2B63 H;  1V1P B;  4HSP A;  4A3F B;  2D2C C;  2A6H C;  4GN5 A;  4JG2 A;  5CBA E;  5J3B A;  4JI3 Q;  3EFX D;  2PCF B;  2VS1 A;  1JWS D;  3NBI A;  2F0S A;  4F87 A;  1YJW A;  4LF5 Q;  1AE2 A;  4A3J H;  4JBM A;  4L8J A;  5IGB A;  3F2U A;  5KEE A;  4BXX G;  5HGQ A;  2UUA Q;  4LW1 A;  1A2T A;  4Y7N H;  4HAE A;  4KI0 A;  1GVP A;  1F77 A;  1BBX C;  3OYY A;  3I3C A;  1JE4 A;  1RIP A;  1IBM Q;  2A73 B;  1YNN D;  2R7D A;  1R9T B;  4PMB A;  3CCR A;  1W2B A;  5C0X I;  1O78 A;  3WWV A;  2BA1 A;  4MNO A;  1C8C A;  1A3T A;  1IXR A;  1PTO D;  2AMC B;  4I7A A;  5EGT A;  5CMD A;  1AEX A;  3DM1 A;  2HDM A;  1B8A A;  3AQQ A;  3QG1 A;  4YHH Q;  5M5Y H;  1WFQ A;  2FHT A;  1PZK D;  3A0J A;  4J15 A;  3TP8 A;  2VW9 A;  3HOW B;  4KY7 A;  3ERO A;  3RR5 A;  3T1Y Q;  3QO2 A;  5I4D A;  3S17 H;  2E5L L;  2JA7 H;  2E2H H;  3NBH A;  3PUW A;  2KOL A;  1QUQ A;  1U4M A;  4QMG A;  4RCO A;  4G57 A;  4UP9 A;  4LF6 L;  1D2B A;  1KDC A;  1EL0 A;  3DXJ C;  3K0Y A;  3CC7 A;  2VB3 X;  3TRE A;  4PZ6 A;  2R92 H;  3CP0 A;  2EJG C;  1EY9 A;  5M5W B;  3L9A X;  1SDF A;  4WFN 3;  2JXM B;  3ZJY C;  2ZJQ A;  1DOL A;  1CZW A;  2KQ3 A;  1MSH A;  4FF4 A;  2JA7 B;  4GNX B;  1A62 A;  4X65 Q;  2UUA L;  2E2H B;  3NEN A;  3UDI A;  4IOA A;  4DV7 Q;  1GM5 A;  3MHB A;  2ICI A;  2EY6 A;  2KJX A;  1OO9 B;  4DNT B;  4ODG A;  4DF7 A;  1MI2 A;  1IBL L;  1PTO H;  4OWX B;  1G91 A;  1PXU A;  1QVF A;  4YHH L;  1MBY A;  3UE0 A;  1QCB D;  2JA5 H;  5LMU L;  2K52 A;  2EYM A;  1TR5 A;  4DV2 L;  3EBE A;  2JQO A;  2LFN A;  2AQ3 B;  4LWC A;  1S40 A;  2H4O A;  3D4D A;  3GTK H;  4Q5V A;  1FJG Q;  1U4P A;  2TMP A;  1G2S A;  2OXP A;  4HR7 B;  2RSN A;  4TSS A;  3PO3 B;  2K5V A;  3OW2 A;  4QUC A;  4OL7 A;  3IAY A;  4M1U B;  4HJ5 A;  1IBK Q;  3S1Q B;  2F0K A;  1BO0 A;  2JA6 H;  4JYA L;  2WAQ E;  5DM7 3;  2RDF A;  1PYW D;  2F0N A;  4H02 A;  1LAC A;  3BS1 A;  5KNB A;  2VZA A;  1BDO A;  4WOR A;  1S5C D;  1RD9 D;  2F3V A;  4L5S A;  1EQT A;  4GN4 B;  1VCI A;  4LF7 Q;  1TY0 A;  2EPB A;  3CW2 C;  2UXC L;  1SYC A;  1Q90 A;  1MGS A;  5BN3 A;  2Q2T A;  4OO1 G;  2Z4I A;  3J7Z C;  2OCE A;  4LMQ D;  1LTI D;  3KBX A;  1KAW A;  4NXN Q;  2L15 A;  2Y0S G;  5IOC A;  3F1Z A;  1LYL A;  4QIW B;  2PPB C;  1SND A;  1V9P A;  1G6P A;  2K50 A;  1LT3 D;  1STY A;  1HZA A;  3QWN A;  1VQO A;  4B3S Q;  1PA6 A;  1UAP A;  1SSO A;  4BY1 G;  2KHI A;  2B2Y A;  2EXD A;  3RZO B;  1Q7Y C;  3M7N A;  2L4N A;  3L3O C;  1TVX A;  3I2Z A;  4ME3 A;  3I91 A;  3VYT A;  3OIP A;  2VUM G;  1HUN A;  1EWI A;  4DR5 Q;  1UNS A;  2D62 A;  3K5O A;  1VQ4 A;  2XIW A;  2K4K A;  2UXD Q;  5FLX c;  3NWS A;  4RG1 A;  2NTT A;  1X9N A;  1XXG A;  5IGE A;  2YTY A;  5FOB B;  3I7F A;  1QJO A;  4IUT A;  2XRS D;  1EY7 A;  3S1N H;  2G9H D;  4ABN A;  5CV6 A;  2F0G A;  1K0S A;  2RSO A;  4KD4 A;  1SYF A;  2A68 D;  5JPM C;  3HOU H;  1FGB D;  1O7Z A;  3A7A B;  1OXV A;  2NVY B;  4B3M Q;  5LL6 S;  4AYB B;  2NTS A;  2M2L A;  3HOV H;  4ZYS A;  2R92 G;  5I6Y A;  2GA4 B;  1EYD A;  2EJM A;  4R9W A;  1Z47 A;  3H15 A;  4QF4 A;  3Q6S A;  1KXL A;  3CD6 A;  3R2I A;  2Z8L A;  2JK8 A;  2UXB L;  1LTG D;  1I6V C;  4RHS A;  4IUU A;  3DWP A;  3KUP A;  3IRB A;  3TP5 A;  2NVX B;  3M4O B;  1JOR A;  3S16 B;  4A4I A;  1HPC A;  1PFN A;  3T1H L;  3IL8 A;  3STB C;  3A7L A;  4GOP B;  5DLQ E;  5IYC G;  3I4L A;  5KIX A;  2K04 A;  3ZYY X;  2WII B;  2QKI C;  4K6L A;  2ZM6 Q;  3W1B A;  4TKO B;  4RA8 A;  1Y69 U;  3EA6 A;  3GTQ H;  4KLK A;  3NEM A;  4BBS H;  5HY6 A;  1XYI A;  3A54 A;  1YHQ A;  1AW7 A;  2LS0 1;  2OT2 A;  5M3M H;  3T13 A;  1SAP A;  4NPS A;  1WTP A;  1I94 L;  1HR0 L;  5CGK A;  1FNW A;  5C5M A;  4JC0 A;  5EAY A;  1EZ6 A;  1H9S B;  5BN5 A;  4CKB A;  1EEI D;  3CKI B;  2OEO A;  2C5C A;  1KIX A;  5C4X B;  3G48 A;  3A55 A;  4BA1 I;  1K3R A;  2F03 A;  3GTO H;  3MXU A;  5C3W A;  3MC0 B;  4IJH A;  4MTK A;  4LNQ A;  2YTV A;  4BBR B;  4GOP C;  3GTM H;  1Q46 A;  1JT8 A;  2AHO B;  1SEB D;  1ROD A;  4DXF A;  2XVS A;  3H94 A;  1PZI D;  1EFI D;  1PVO A;  1F9Q A;  1TWF B;  3U50 C;  2O5I C;  4B3S L;  5IGC A;  3G6E A;  1TWG H;  2K7V A;  4OHJ A;  4XT3 B;  1J5E L;  1LTT D;  2XN9 C;  1VS0 A;  2L11 A;  1KNE A;  1Q12 A;  2R3Z A;  2RA4 A;  2ZTD A;  1XNQ Q;  5CYU A;  4ZLT F;  3A5Z B;  3PSI A;  5FLM G;  1B9M A;  1LTR D;  3HG9 A;  4P73 A;  2F4V Q;  1EYA A;  2XWJ B;  3SK5 A;  3VA7 A;  1SE8 A;  3OPO A;  2UUC L;  4DV4 L;  2EDG A;  3NSW A;  3NTI A;  3D3R A;  3HOX H;  4A3B G;  1JOQ A;  5C5L A;  1XX8 A;  1JB3 A;  4BA2 I;  4PMW A;  2DNC A;  1CKM A;  2NYZ D;  1HR0 Q;  4QB4 A;  3SE0 A;  5LMN L;  1VQP A;  3HOZ B;  4DK0 A;  4IN3 A;  4PG3 A;  4X3K A;  1T5E A;  2LKV A;  1QNK A;  1WTV A;  1WD0 A;  1YVC A;  5K36 H;  1VQI A;  4S3S A;  1NCV A;  1PTO B;  1XNR Q;  4UHV A;  4IPH A;  1EIY B;  5GAD C;  3Q23 A;  1SYB A;  2JA5 G;  1O7Y A;  4ALP A;  1VQM A;  5KND A;  4I7Z C;  1XTC D;  2NBF A;  2WB1 E;  4KHZ A;  1S72 A;  1EU4 A;  4OX9 L;  2CFM A;  4ZQ3 A;  4XQN A;  1GKH A;  1SMX A;  2EVB A;  4AQY L;  4IUQ A;  3VYU A;  4YY3 Q;  3AEV A;  5FO7 B;  2K5Q A;  1WD1 A;  1KRS A;  2ES2 A;  4JV5 L;  1Y8O B;  4NP5 A;  3K5N A;  1L1O A;  3V96 A;  1J8I A;  4V0B A;  3MAQ A;  4K0K Q;  1S5D D;  2A1A A;  3UE1 A;  4K5V A;  1UEB A;  1CKN B;  2FXQ A;  1NR4 A;  1L0W A;  5C3E B;  2WP8 J;  4LFC L;  1WCM G;  1NBW A;  4A3M B;  4FXD A;  4JI5 Q;  3J7A F;  1VQ6 A;  3KLW A;  3MXP A;  3LWE A;  1TXY A;  1X3P A;  3VDY A;  4AIM A;  3BJU A;  3MA2 B;  3PIO 3;  4U67 3;  2BCO A;  4FF2 A;  1DD2 A;  1GUW A;  1ZXT A;  5E4W C;  1Y1W H;  2VUM H;  1QE6 A;  4HCS A;  4J8Q A;  4DAY B;  4ZAI A;  3PQI A;  1CKO A;  4ZCK A;  1M1K C;  2K33 A;  1A0I A;  4XQJ A;  2MO1 A;  3BU2 A;  4UAI A;  1I4Q A;  3E6Z X;  1EY8 A;  4JI3 L;  4PQX A;  2ZXR A;  5C3E H;  1II3 A;  1QNU A;  2MUY A;  1FVI A;  5T1G A;  1ASZ A;  3OMC A;  4N9T A;  1VQF A;  4HIO A;  3PO2 H;  3RZO H;  2VQE L;  2R93 H;  5JAV A;  1YNJ C;  4R8N A;  2B2V C;  4EQP A;  3G4S A;  1Y1W B;  5CV7 A;  2OF1 A;  4A3C H;  3LWU A;  2Q8I B;  1EUJ A;  5C4Z A;  1QOH A;  1OXS C;  2WFW A;  4ID6 A;  4IUP A;  5D3I B;  3M7G A;  1C0A A;  5E3F A;  1V1P A;  4OIJ A;  4KD3 A;  3T1Y L;  3NXW A;  4IPD A;  3JAM L;  1PH2 A;  4UP8 A;  4UDU C;  2F0H A;  2NWG A;  3PO3 G;  2RHQ B;  1GD7 A;  3VR3 A;  4ZKC B;  1F2M A;  2J4X A;  2PNR C;  1X3E A;  3MEH A;  1VMP A;  4YCV A;  4DR4 Q;  2N88 A;  4O2D A;  2EXZ A;  4A75 A;  3S2D H;  2F0F A;  2VQF L;  2SOB A;  1SJE D;  2PYK A;  4A3D H;  1NR2 A;  1SBB B;  1IYJ B;  4UY8 C;  3RZD B;  1LT5 D;  2PZW A;  1XPR A;  5M5X H;  2MJ8 A;  1GUN A;  2V4D A;  4OXP A;  4GKJ Q;  4PV1 C;  4K5X A;  2LXK A;  3HFZ B;  1U0L A;  1Q82 C;  1KQS A;  3RMH A;  2MFI A;  3GO5 A;  1UE5 A;  4ME5 A;  4KKS A;  3J80 c;  1YHB A;  2ATW A;  4JI6 Q;  2BOS A;  1Y8N B;  1RKN A;  2ZJR A;  2F4V L;  2E2J H;  4RCN A;  2FMM A;  1BF4 A;  1JIC A;  4GLV B;  3H09 A;  4C3I B;  3NBH B;  5LL6 X;  1F2L A;  1STB A;  5M3F H;  4JI5 L;  3GTJ H;  5M3M B;  1UE6 A;  3A56 A;  1ZEQ X;  3PIP 3;  3NTK A;  2QA4 A;  1Q81 C;  4B3T L;  4DNR B;  3RZD H;  2BH8 A;  3E9I A;  5HGT A;  3J81 L;  2K1B A;  4H7B A;  4X66 L;  1EOV A;  5C6A A;  4RKL A;  1MHW C;  1ZKO A;  3D4R A;  3RUZ A;  1WI5 A;  2WAC A;  1ICF B;  1N33 Q;  4A3F H;  4EX5 A;  4JPB W;  3IFT A;  2HD3 A;  1W6K A;  5D14 A;  4FDB A;  2E2J B;  5A35 A;  4C3I H;  1PLF A;  1XPO A;  4CJ1 B;  5IY0 A;  3GTJ B;  2VNU D;  4EQO A;  2MP1 A;  4DPG A;  1X65 A;  2I5H A;  2F3W A;  5IP9 G;  1FL0 A;  2B2W A;  2HCI A;  4ZUJ A;  3QB3 A;  3CCV A;  4JBK A;  5IYC H;  1SE4 A;  5CV9 A;  2HCC A;  1BCP B;  3HOY B;  5M5Y B;  1S5F D;  4LF9 L;  3F2D A;  1E2W A;  4K5W A;  4J6H A;  4DK6 C;  3J7Y W;  3M4P A;  1I5F A;  1L0Y B;  1TWA H;  2RDG A;  4BY7 H;  1LT6 D;  3I90 A;  3G71 A;  5EKI A;  3FDT A;  2G9D A;  4RGT A;  1SE2 A;  3I4N H;  1B1Z A;  2YU9 H;  1VDZ A;  4O0A A;  3SVM A;  4XQQ A;  3ER0 A;  1K73 C;  3MXN B;  3PIO A;  2J0T D;  3EIV A;  2J7Z A;  3BYY B;  3N6R A;  3FMC A;  1D5X C;  3KK7 A;  4QGU A;  4DR1 Q; 
#chains in the Genus database with same CATH homology
 4XDX A;  3TP6 A;  1FYC A;  1D1I A;  1VMC A;  2PMZ B;  2JEA I;  5K36 G;  3PV0 A;  3S15 B;  1ONL A;  1S5E D;  2X69 A;  1PDQ A;  2E76 C;  4C2M B;  1BCP F;  5NUC A;  1TWH B;  1M4V A;  1STA A;  4K14 A;  5J1Z A;  3EJI A;  1I6H B;  1SFO B;  2L0C A;  1HA6 A;  3AB9 A;  2NVQ B;  1T5X D;  3X3N A;  4R8I A;  1CQF A;  4DA2 A;  3Q22 A;  1VF7 A;  1CFM A;  4OO1 H;  1JWU D;  2VUM B;  4NMZ A;  1IYV A;  1IKL A;  2DY7 A;  1LAB A;  4JBW A;  3D6C A;  1KLU D;  3WOE A;  4FVM A;  5KYL A;  2JA6 B;  1CI3 M;  1S4Z A;  2HDL A;  3W2D A;  2K01 A;  1DYQ A;  1LTS D;  4KMU C;  4LAA A;  3HGB A;  4EGV A;  1L0X B;  1QB5 D;  3C46 A;  3GP7 A;  1D5M C;  1E0B A;  4DAV A;  1HHV A;  4IFD G;  1UUP A;  1KAA A;  1PRT D;  4OGQ C;  1HFN A;  4B08 A;  4Z9C B;  3MFG A;  3P1H A;  3URY A;  1Y8P B;  3BVZ A;  2YYZ A;  5C0X G;  1V43 A;  3X3M A;  2L5T A;  1G6Z A;  2EY5 A;  1ENF A;  3S2D B;  1D5Z C;  4A3D B;  3S2H B;  3MXG A;  4CJ2 C;  2EYJ A;  3FPP A;  1IYU A;  1FD7 D;  1H9S A;  1F9P A;  1UEA B;  5KGU A;  1EOT A;  2EYO A;  2B39 A;  1X32 A;  4A93 B;  3VR4 A;  2KVM A;  1HQR D;  3C3L A;  1I4R A;  1TS3 A;  2Z4H A;  5E4X A;  1PZJ D;  5EKK A;  3DMU A;  1LTA D;  4MIU A;  2F0E A;  1DOK A;  3TBI B;  1HA5 A;  3I73 A;  3WOF A;  2D9U A;  4IUR A;  4MN3 A;  5I6W A;  4HTH A;  2F0J A;  2QIL A;  2K03 A;  1BQQ T;  1H9R A;  1EY6 A;  4K2L A;  1ZYR D;  3KLS A;  3DEP A;  1SNM A;  4IUN A;  2ZXP A;  3M4Y A;  2CVR A;  3K6O A;  2B2T A;  3BYT B;  5LHY 1;  4IQZ A;  5EBD A;  4OO1 I;  2NN6 I;  1WTR A;  4BY7 B;  3R2T A;  2SEB D;  4C3J G;  3I4M B;  4GZY C;  3MWY W;  4FF1 A;  2WIN B;  3H6M A;  3WDN A;  1MSG A;  1HXY D;  1TY2 A;  3NK9 A;  2KEE A;  5G3L D;  4ZKB B;  1SYG A;  4G7O C;  4DU9 A;  3V2T A;  5G3L F;  1GHJ A;  2L55 A;  3TN2 A;  3NTH A;  2E75 C;  4IAL A;  3QJY A;  3TZU A;  1F2Y A;  3SXH A;  1YNN C;  4C3J B;  2PQE A;  5FLX L;  1I3Q B;  3SK6 A;  1SMY D;  3I70 A;  4KY6 A;  5D3D A;  4ZUI A;  4ILW A;  5A2Q E;  3AU7 A;  3PUX A;  1EY5 A;  5ELE A;  1CT1 D;  3ND9 A;  2EE1 A;  1B3A A;  3MVV A;  2FIN B;  1CTM A;  1U9R A;  1ET6 A;  2CQA A;  1BNZ A;  5HUR A;  5K5P A;  2IT1 A;  3ONA B;  3HZX A;  5C4H A;  1BCP C;  1Q1E A;  2IWH A;  3K57 A;  1A6X A;  4A3B B;  1DZ1 A;  1LTB D;  4HSV A;  1WTW A;  3P75 A;  5FO9 B;  3VYS A;  4A3K B;  2HUG A;  2SNM A;  4K2K A;  1LLR D;  1GUS A;  1RTN A;  2E2I B;  1JWM D;  1ICW A;  1ML0 D;  5IGD A;  3D6W A;  3FKI B;  2E2D C;  5JOB A;  4IFD I;  3KLS X;  5CC4 A;  2LMC B;  3J7A V;  3HEJ A;  3IKJ A;  3OW7 A;  2K5W A;  2X6L A;  2K32 A;  1D1K A;  2A74 C;  3SK4 A;  3VR6 A;  4HCE A;  2RVL A;  3ERQ A;  1JR0 D;  1CA5 A;  2IJ0 A;  4O1N A;  2PW7 A;  5JJZ A;  5F2D A;  4C3H B;  4XYO A;  2BE5 C;  2NB0 A;  3K58 A;  1FNU A;  3W3A A;  4KV6 A;  2AQ1 B;  5M9O A;  5KNC A;  4L6T B;  1C48 A;  1KTK A;  2TSS A;  2EYH A;  5EKL A;  3QIA A;  3BDC A;  2BE5 D;  1A2U A;  2R7Z B;  5JEA G;  1JQY D;  1BUV T;  1STE A;  1SYD A;  1K83 B;  1A15 A;  4B9W A;  1ZYR C;  3OOC A;  4K8J A;  1J9O A;  1YNJ D;  5C3X A;  1V8Q A;  3C2P A;  2HQE A;  2WKD A;  3A8K E;  4PMC A;  2F0U A;  3S1N B;  1HRJ A;  4ZK9 B;  2A6H D;  4F8M A;  3HOU B;  1CM9 A;  1I4P A;  3P20 A;  1TII D;  3D31 A;  1B9N A;  1RDP D;  1CHP D;  3SHL A;  4OIK A;  2Q8T A;  2X6G A;  3T4A C;  1I4H A;  1KLG D;  3GV6 A;  3MXN A;  2B2U A;  5I2X A;  4PNY A;  2B2W C;  4X3U A;  3SK8 A;  1GJX A;  1OXX K;  1HTP A;  1NSN S;  4KTA A;  3TDQ A;  4IUV A;  5IT9 E;  1DJR D;  1SNC A;  5EQ0 A;  1AZQ A;  3DHQ A;  3NUC A;  1E2V A;  4FO2 A;  2PZT A;  1I4X A;  5I9P A;  1TQO A;  1IL8 A;  4CHT B;  1K8M A;  3PUV A;  2AWO A;  2QCP X;  4CGY B;  2KA7 A;  5DM6 3;  3GTM B;  2VXW A;  1Y1V B;  4BS9 A;  1R4Q B;  3NP8 A;  2YU9 B;  3I8Z A;  2Q8R E;  1TWG B;  4CKE A;  3T53 B;  1EYC A;  3U9S A;  1U4L A;  1EIH A;  4B9X A;  3H3V C;  1KNA A;  2KCC A;  1KDA A;  3L7Z C;  5ELB A;  2ICE C;  3N52 A;  3LNN A;  3T51 B;  1O7L A;  1EWH A;  1PFM A;  1KDB A;  3S1R B;  5DNF A;  5C4J B;  4LK1 C;  5IT9 L;  2RBM A;  3TZD A;  3GTK B;  4HN7 A;  1B50 A;  4CBV A;  4F88 A;  3R93 A;  1Q8I A;  2F4I A;  2DN8 A;  2DY8 A;  3P7J A;  5I9O A;  3HRZ C;  4EVO A;  1C4Q A;  2XWB B;  2E74 C;  1EEF D;  3G7L A;  2A6E C;  3KBG A;  3PUY A;  5KRU A;  3OMG A;  4A3G B;  4JK1 C;  3C1F A;  1TU2 B;  1H9M A;  1QIL A;  3ND8 A;  3GTG B;  4C3H G;  1CHQ D;  5C0X J;  2IW3 A;  4NKL A;  4G7Z C;  2BDN A;  2AWN A;  2K6A A;  2A6E D;  1B44 D;  2KHS A;  3CRK C;  1STG A;  1WCM B;  4NW2 A;  1BXT A;  4KKT A;  3BVM A;  1TT2 A;  4KJN A;  2JE6 I;  2B2U C;  1A3V A;  5FO8 B;  3A8I E;  4NDX A;  1WVL A;  4KHV A;  3U9O A;  1PRT B;  1I4G A;  3C1E A;  1GUG A;  3NE5 B;  1TKW B;  1JOO A;  3Q0A A;  4KKU A;  1WTO A;  1SNP A;  1EIG A;  1IW7 C;  5JPN C;  2R93 B;  3MTS A;  2K5D A;  1H9K A;  3R8B A;  1DCZ A;  1RHP A;  1RTO A;  2BA0 A;  4DGZ A;  2AUK A;  2KEC A;  1AN8 A;  2A69 D;  3H91 A;  2EYF A;  5CV8 A;  1SE3 A;  4X3S A;  5J39 A;  2A69 C;  5ELC A;  4RFB A;  2WB1 B;  5FKA C;  5EPL A;  1GHK A;  2C9O A;  2ZXO A;  5C44 B;  1I50 B;  3GTQ B;  3LX0 A;  1IW7 D;  3OIQ A;  1WTX A;  4XTC S;  5COY A;  4IZ8 A;  2B8F A;  2B2T C;  5M5X B;  4BY1 B;  4RWS C;  3M3Y B;  5ISR A;  1F2Z A;  3TP7 A;  4A3E B;  2JSO A;  5COR A;  4C56 C;  3IFD A;  5DAU A;  3I72 A;  1B53 A;  3S14 B;  2CW0 C;  2NUC A;  2PW5 A;  2K05 A;  2JEB I;  4Y7N B;  2I46 A;  1BOS A;  1TS5 A;  1ILP A;  3S1M B;  3CU7 A;  3CQZ B;  1B2T A;  3H0G B;  4H13 C;  1VF5 C;  2NVT B;  2RQX A;  1HFG A;  4TRD A;  2F0I A;  1GUT A;  3HOX B;  2R6G A;  4G7H C;  4FYD A;  2KCN A;  1RCV D;  5JVH 3;  3JAM E;  3NQT A;  2F0W A;  2AQ2 B;  4FNF A;  1HUM A;  1RJT A;  4DN4 M;  4L63 B;  5JEA J;  3AMU A;  4C1N I;  3HP3 A;  3FEW X;  5ELD A;  2R92 B;  3O13 A;  1GUO A;  1EY0 A;  3BG3 A;  5IGF A;  3Q24 A;  2IL8 A;  1F9S A;  2F0P A;  3CHB D;  4U68 A;  2MGS A;  1GOZ A;  1JCK B;  2A68 C;  5IOD A;  4O42 A;  1Q3L A;  1BCP D;  1NUC A;  1G29 1;  2F1M A;  2JA5 B;  1SNO A;  3A8J E;  1DM0 B;  3BDL A;  3V05 A;  4F7X A;  2BDO A;  4FP5 D;  2FJ2 A;  1SJH D;  5D65 A;  1D6E C;  1STH A;  1DON A;  1AP0 A;  3R3O A;  1AZP A;  2EYL A;  3RLF A;  4N9P A;  2ZT9 C;  4RKB A;  4DXG A;  1PFB A;  4M8A A;  2CHB D;  1HTL D;  4XT1 B;  3T56 B;  5JVG 3;  3CRL C;  3D4W A;  5E1F A;  3K7A B;  3HKZ B;  3UI2 A;  4J1M A;  4WRD A;  3PO2 B;  5EPK A;  3HS0 C;  1ESR A;  1G8Z D;  2B8G A;  2F0D A;  2IX3 A;  3DWA A;  1SYE A;  4WJW A;  5T1I A;  2JP1 A;  2XSC A;  3SR1 A;  1PRT F;  4FXK C;  5A2Q L;  2NN6 G;  2A5H A;  5I2Y A;  1EWC A;  3DWQ A;  3FRP B;  5BN4 A;  4RGM A;  3FVQ A;  3GTL B;  2RDH A;  3EQL C;  4X3T A;  2I07 B;  1SXT A;  2QF7 A;  3VR2 A;  4XXE A;  3MZ5 A;  2SNS A;  2WKC A;  2F0L A;  3RD4 A;  1TWC B;  1SMY C;  3NWT A;  1OXU A;  5EPJ A;  5EJW A;  2EZV A;  2Y0S B;  4CKC A;  3QOL A;  4YIJ A;  1A3U A;  1K8O A;  1PTO C;  3BZD B;  4C1N K;  2L1B A;  4KJO A;  4LJZ C;  3HOV B;  2KED A;  1PMR A;  1TS4 A;  1FR3 A;  2AUJ D;  2RKS A;  1ENA A;  1EY4 A;  5TSS A;  2F0V A;  5J22 A;  2JA8 B;  4G4K A;  1IKM A;  2Z1C A;  5FK9 C;  5CV4 A;  3SEB A;  1RF2 D;  3KLR A;  5JEA H;  3BVG A;  4K6D A;  1EQV A;  2EY1 A;  3EVQ A;  5C0X H;  2JYO A;  2M00 A;  1HQM C;  3QOJ A;  1HCZ A;  3OSO A;  1TS2 A;  4ZRZ A;  2B2V A;  5AFW A;  1QG7 A;  3PMF A;  4BBS B;  1LO5 D;  2WAQ B;  3DUZ A;  4FF3 A;  1G2T A;  4RAU C;  3SDZ A;  5EBC A;  1O80 A;  4RHR A;  1JOK A;  3J81 E;  3FPU B;  4Q0F A;  4KK7 A;  1ESF A;  4FXG C;  3NPP A;  4DAP A;  3GTO B;  2XNA C;  5ELF A;  4HMJ A;  1TWA B;  1PRT C;  1AFP A;  4A3J B;  1X3Q A;  5KYI A;  2L12 A;  3I4N B;  2EJF C;  3NHH A;  3BDO A;  2PZU A;  4XYQ A;  1WTQ A;  1E2Z A;  1S5B D;  3T16 A;  5IGG A;  1Q1B A;  4ULL A;  4DK1 A;  2F0M A;  3S17 B;  2PO4 A;  3G6J B;  3E5S A;  3VYR A;  2LY7 A;  4EQN A;  1LT4 D;  1R4P B;  4P2C B;  3GV3 A;  2NZ1 D;  2K28 A;  4QCL A;  2IPK D;  3PUZ A;  1BR9 A;  1Z6H A;  3VA5 A;  4KN4 C;  1B4O A;  2H1E A;  3S9W A;  2F0Q A;  2FMC A;  4A3I B;  3K5L A;  3K5M A;  1CZG A;  2EY2 A;  4HED A;  3J80 L;  1DOM A;  4I65 A;  1ENC A;  1EU3 A;  3TME A;  1OXT A;  2ID0 A;  4HMI A;  1H9J A;  4H44 C;  3TSS A;  3ITP A;  4XIG S;  4BWG B;  5CBE E;  4RH6 A;  1U4R A;  2FFK B;  1W6J A;  2N55 A;  1ET9 A;  3OWE B;  1CQV A;  2CW0 D;  1NAP A;  2F0T A;  2F0O A;  2R61 A;  3GD7 A;  2VB2 X;  1M8A A;  4MHE A;  4QUF A;  3D8G A;  5CV5 A;  1FNV A;  3NQI A;  5IIF A;  3E0J A;  4RGN A;  4E6I A;  1EZ8 A;  4IFD J;  1IHZ A;  3GTP B;  2MHV A;  2IX1 A;  3DEO A;  3GQB A;  1LV9 A;  2QEJ C;  2B2Y C;  3VR5 A;  2WV6 D;  1MD2 D;  4CJ0 B;  5FLX E;  2EYP A;  2D5D A;  1F9R A;  3OWF A;  4V19 0;  5DEH A;  4KN7 C;  4KY5 A;  1JC7 A;  2ENB A;  5CR3 A;  2DNE A;  2XRQ D;  1STN A;  4RGO S;  3MFY A;  4IFD H;  1V1O A;  1GXD C;  4DAY A;  2M9V A;  2EOT A;  1SNQ A;  1CK1 A;  1DXM A;  1PTO F;  3K59 A;  1KAB A;  1Z7T A;  2NN6 H;  2B63 B;  4DFA A;  4H0L C;  2QDB A;  3M85 A;  2O5J C;  4K8I A;  3KF8 A;  1XWE A;  3J80 E;  4C3I G;  1QWY A;  2L9H A;  2SDF A;  2IX0 A;  4TQU S;  5M3F B;  2MPM A;  2O2L D;  1CA6 A;  3OHX C;  1ILQ A;  2O4X A;  2KUM A;  1V1P B;  4HSP A;  4A3F B;  2D2C C;  2A6H C;  5CBA E;  3EFX D;  2PCF B;  1JWS D;  3NBI A;  2F0S A;  4F87 A;  4L8J A;  5IGB A;  3F2U A;  5KEE A;  1A2T A;  4HAE A;  4KI0 A;  1F77 A;  1BBX C;  3I3C A;  1JE4 A;  2A73 B;  1YNN D;  1R9T B;  4PMB A;  5C0X I;  1O78 A;  2BA1 A;  1C8C A;  1A3T A;  1PTO D;  5EGT A;  5CMD A;  1AEX A;  3DM1 A;  2HDM A;  3QG1 A;  2FHT A;  1PZK D;  3TP8 A;  3HOW B;  4KY7 A;  3ERO A;  3QO2 A;  5I4D A;  3NBH A;  3PUW A;  2KOL A;  1U4M A;  4QMG A;  4RCO A;  4G57 A;  1D2B A;  1KDC A;  1EL0 A;  3DXJ C;  3K0Y A;  2VB3 X;  2EJG C;  1EY9 A;  5M5W B;  3L9A X;  1SDF A;  4WFN 3;  2JXM B;  1DOL A;  1CZW A;  2KQ3 A;  1MSH A;  4FF4 A;  2JA7 B;  2E2H B;  3MHB A;  2ICI A;  2EY6 A;  2KJX A;  1OO9 B;  4DNT B;  4ODG A;  4DF7 A;  1MI2 A;  1PTO H;  1G91 A;  1PXU A;  1MBY A;  1QCB D;  2EYM A;  1TR5 A;  2LFN A;  2AQ3 B;  2H4O A;  3D4D A;  4Q5V A;  1U4P A;  2TMP A;  1G2S A;  2OXP A;  4HR7 B;  2RSN A;  4TSS A;  3PO3 B;  4QUC A;  4OL7 A;  3IAY A;  4M1U B;  3S1Q B;  2F0K A;  1BO0 A;  5DM7 3;  2RDF A;  1PYW D;  2F0N A;  1LAC A;  3BS1 A;  5KNB A;  1BDO A;  4WOR A;  1S5C D;  1RD9 D;  2F3V A;  1EQT A;  1VCI A;  1TY0 A;  2EPB A;  1SYC A;  1Q90 A;  1MGS A;  5BN3 A;  4OO1 G;  2Z4I A;  4LMQ D;  1LTI D;  3KBX A;  5IOC A;  4QIW B;  2PPB C;  1SND A;  1LT3 D;  1STY A;  3QWN A;  1UAP A;  1SSO A;  2B2Y A;  3RZO B;  3M7N A;  2L4N A;  3L3O C;  1TVX A;  3VYT A;  3I91 A;  3OIP A;  1HUN A;  1UNS A;  2D62 A;  3K5O A;  2XIW A;  3NWS A;  2NTT A;  1XXG A;  5IGE A;  5FOB B;  1QJO A;  4IUT A;  2XRS D;  1EY7 A;  2G9H D;  4ABN A;  5CV6 A;  2F0G A;  2RSO A;  4KD4 A;  1SYF A;  2A68 D;  5JPM C;  1FGB D;  1O7Z A;  3A7A B;  1OXV A;  2NVY B;  5LL6 S;  4AYB B;  2NTS A;  2M2L A;  4ZYS A;  5I6Y A;  2GA4 B;  1EYD A;  2EJM A;  4R9W A;  1Z47 A;  4QF4 A;  3Q6S A;  3R2I A;  2Z8L A;  1LTG D;  1I6V C;  4RHS A;  4IUU A;  3DWP A;  3KUP A;  3TP5 A;  2NVX B;  3M4O B;  1JOR A;  3S16 B;  1HPC A;  1PFN A;  3IL8 A;  3A7L A;  3I4L A;  5KIX A;  2K04 A;  3ZYY X;  2WII B;  2QKI C;  4K6L A;  4TKO B;  4RA8 A;  1Y69 U;  3EA6 A;  1XYI A;  3A54 A;  1AW7 A;  2LS0 1;  2OT2 A;  3T13 A;  1SAP A;  1WTP A;  5CGK A;  1FNW A;  5C5M A;  1EZ6 A;  1H9S B;  5BN5 A;  4CKB A;  1EEI D;  3CKI B;  2OEO A;  2C5C A;  5C4X B;  3A55 A;  4BA1 I;  2F03 A;  3MXU A;  5C3W A;  3MC0 B;  4BBR B;  1SEB D;  1ROD A;  4DXF A;  2XVS A;  3H94 A;  1PZI D;  1EFI D;  1TWF B;  1F9Q A;  2O5I C;  5IGC A;  2K7V A;  4OHJ A;  4XT3 B;  1LTT D;  2XN9 C;  2L11 A;  1KNE A;  1Q12 A;  2R3Z A;  2RA4 A;  5CYU A;  4ZLT F;  1B9M A;  1LTR D;  3HG9 A;  1EYA A;  2XWJ B;  3SK5 A;  3VA7 A;  3OPO A;  2EDG A;  3NSW A;  3NTI A;  3D3R A;  1JOQ A;  5C5L A;  1XX8 A;  1JB3 A;  4BA2 I;  4PMW A;  2DNC A;  3HOZ B;  2NYZ D;  4QB4 A;  3SE0 A;  4DK0 A;  4IN3 A;  4X3K A;  1T5E A;  2LKV A;  1QNK A;  1WTV A;  1WD0 A;  5K36 H;  4S3S A;  1NCV A;  1PTO B;  3Q23 A;  1SYB A;  1O7Y A;  5KND A;  1XTC D;  2NBF A;  4I7Z C;  4KHZ A;  1EU4 A;  4ZQ3 A;  4XQN A;  2EVB A;  4IUQ A;  3VYU A;  5FO7 B;  2K5Q A;  1WD1 A;  1Y8O B;  4NP5 A;  3K5N A;  3V96 A;  1J8I A;  4V0B A;  3MAQ A;  1S5D D;  4K5V A;  1NR4 A;  5C3E B;  2WP8 J;  4FXD A;  4A3M B;  3J7A F;  3MXP A;  3LWE A;  1X3P A;  3MA2 B;  3PIO 3;  4FF2 A;  4U67 3;  2BCO A;  1DD2 A;  1GUW A;  1ZXT A;  5E4W C;  1QE6 A;  4HCS A;  4J8Q A;  4ZAI A;  2K33 A;  4XQJ A;  4UAI A;  1I4Q A;  3E6Z X;  1EY8 A;  4PQX A;  2ZXR A;  1II3 A;  1QNU A;  2MUY A;  5T1G A;  3OMC A;  4N9T A;  5JAV A;  1YNJ C;  4R8N A;  2B2V C;  4EQP A;  1Y1W B;  5CV7 A;  2OF1 A;  3LWU A;  2Q8I B;  5C4Z A;  1QOH A;  1OXS C;  4ID6 A;  4IUP A;  5D3I B;  3M7G A;  5E3F A;  1V1P A;  4OIJ A;  4KD3 A;  3NXW A;  3JAM L;  4UDU C;  2F0H A;  2NWG A;  3VR3 A;  4ZKC B;  1F2M A;  2J4X A;  2PNR C;  3MEH A;  1VMP A;  2N88 A;  2EXZ A;  2F0F A;  2SOB A;  1SJE D;  2PYK A;  1NR2 A;  1SBB B;  3RZD B;  1LT5 D;  2PZW A;  2MJ8 A;  1GUN A;  2V4D A;  4PV1 C;  4K5X A;  3RMH A;  3GO5 A;  4KKS A;  4ME5 A;  2BOS A;  1Y8N B;  1RKN A;  4RCN A;  2FMM A;  1BF4 A;  1JIC A;  3H09 A;  4C3I B;  5LL6 X;  1F2L A;  1STB A;  5M3M B;  3A56 A;  1ZEQ X;  3PIP 3;  3NTK A;  4DNR B;  5HGT A;  3J81 L;  2K1B A;  4H7B A;  5C6A A;  4RKL A;  1ZKO A;  3D4R A;  3RUZ A;  2WAC A;  3IFT A;  1W6K A;  5D14 A;  2E2J B;  5A35 A;  1PLF A;  4CJ1 B;  3GTJ B;  2VNU D;  4EQO A;  2MP1 A;  2F3W A;  2B2W A;  2HCI A;  4ZUJ A;  3QB3 A;  1SE4 A;  5CV9 A;  2HCC A;  1BCP B;  3HOY B;  5M5Y B;  1S5F D;  1E2W A;  4K5W A;  4J6H A;  3J7Y W;  1L0Y B;  2RDG A;  1LT6 D;  3I90 A;  5EKI A;  3FDT A;  2G9D A;  4RGT A;  1SE2 A;  1B1Z A;  1VDZ A;  3SVM A;  4XQQ A;  2J0T D;  2J7Z A;  3BYY B;  3N6R A;  3FMC A;  1D5X C;  3KK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...