3E5SA

Crystal structure of staphylococcal nuclease variant delta+phs l103k at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e5sA00
1F2ZA 3EJIA 5CV7A 1EYAA 3BDCA 1STGA 1IHZA 5JAVA 4K5VA 5C4HA 1EY8A 4RKBA 5IGEA 3ITPA 2PZTA 5E1FA 4QF4A 5C3WA 4EQPA 1JOQA 4QMGA 1A2UA 5DEHA 3HEJA 3SK4A 3SK8A 2F0MA 1A3UA 3QOLA 4KY5A 1SYCA 1TR5A 2EYLA 2OF1A 3DHQA 4HTHA 3R3OA 3SK5A 5CV4A 4DF7A 4K2KA 4DFAA 4DU9A 1EY7A 5C5MA 2KQ3A 4QB4A 3OSOA 3D8GA 2M00A 3NP8A 3C1EA 4KY6A 4E6IA 4KHVA 3TP7A 4N9PA 4NKLA 2F0VA 2EY5A 5HURA 2EYMA 1A3VA 1STYA 1STAA 2PZWA 4J6HA 3OMGA 3OMCA 5DAUA 4B9WA 4F7XA 4ODGA 3T16A 4EVOA 2PQEA 2OEOA 5IGGA 2HQEA 5C5LA 4J1MA 2F0KA 4LAAA 3HZXA 5KIXA 1EYCA 2EY2A 4KJNA 3P75A 4K14A 3VA5A 2LKVA 2EYFA 2F0UA 2F0HA 3BDLA 4NMZA 3TP5A 2F0QA 4DGZA 5KYLA 2PW7A 4OL7A 3EROA 1KABA 1SYDA 3MZ5A 4K5XA 5IGBA 5IGCA 5IGFA 2EYPA 2EY1A 4YIJA 3D4DA 3P1HA 4K6DA 5EKKA 5KEEA 4KD4A 5CV9A 5M9OA 3D4WA 5C6AA 1SNQA 4IALA 3NK9A 3MEHA 1STNA 4HMIA 4IUNA 4WRDA 4KY7A 1ENCA 1EY0A 4KD3A 2EY6A 1STHA 2EYOA 2F0IA 1AEXA 1EY4A 1SNMA 4ID6A 3EVQA 3TP8A 1SNPA 4ZQ3A 1EQVA 1EZ6A 4ZUJA 2QDBA 1EY9A 5KGUA 5CC4A 5EKLA 3T13A 1EY6A 1EYDA 2SNMA 1F2YA 4WORA 5NUCA 5KRUA 5I6WA 2NUCA 1NSNS 1F2MA 4MIUA 2F0NA 3DMUA 4B9XA 2WACA 4KTAA 5IGDA 5CV5A 1JORA 4K5WA 2F0PA 4RKLA 1KAAA 1RKNA 1SNOA 1STBA 2PYKA 3D6CA 1A3TA 2EYJA 3MHBA 4K2LA 4PNYA 5I9OA 4ME5A 5EGTA 3SXHA 4KJOA 5C4ZA 5E3FA 2KHSA 5KYIA 2F0FA 2PZUA 5CGKA 1SNDA 2EXZA 1KDBA 4ZUIA 3TMEA 3QB3A 2RDFA 1II3A 2EYHA 2F0EA 2F0OA 4TRDA 3PMFA 4PMCA 5ISRA 5IODA 4HMJA 3SR1A 3OWFA 3H6MA 1TQOA 5CV8A 4KV6A 1ENAA 3TP6A 5I6YA 2RBMA 5J39A 3NQTA 4I65A 2F0LA 5J1ZA 2O4XA 2F0GA 3S9WA 5J22A 3NHHA 1KDCA 4G57A 5I9PA 3V2TA 2PW5A 3C1FA 3ERQA 1SYGA 3E5SA 4F8MA 5JOBA 5IOCA 1SYFA 1A2TA 2F0WA 4K8JA 4PMBA 1SYBA 2F0DA 2SNSA 3QOJA 3NXWA 4H7BA 2F3WA 3MVVA 4S3SA 3NUCA 2ENBA 3LX0A 5CR3A 3MXPA 1EY5A 4N9TA 1JOKA 4K8IA 4NDXA 3SHLA 5HGTA 2RKSA 4EQNA 1SYEA 1TT2A 2F0SA 4R8NA 2OXPA 2F0TA 2F3VA 1NUCA 4EQOA 2F0JA 1U9RA 4IZ8A 5C3XA 5K5PA 5CV6A 1KDAA 4NP5A 1SNCA 5IIFA 3RUZA 5F2DA 3U9OA 1JOOA 2SOBA 3SK6A 1EZ8A
chains in the Genus database with same CATH superfamily
4MHEA 5ELFA 1O7IA 2LS01 2KOLA 1WTHA 5BN4A 2ZXPA 5JPNC 2X6LA 4A3FB 1IYVA 5C3EH 1D6EC 4NB3A 4DR3L 2JA8G 1C9OA 1K83B 5M3MG 5DLQE 1Z6HA 4DV7Q 3HOZG 2RQXA 1M90C 1AFPA 3MAQA 2UXBQ 1EIFA 1LT4D 3D8GA 2M00A 1BBXC 1FJGQ 4N8X1 1BCPD 2CW0C 5GROA 4B3SL 4O2DA 2PZWA 4XYQA 3OMGA 1HNXL 3S17B 3A5UA 3JAMi 4YY3Q 3NBHA 2M9VA 4DV4L 1A6XA 3J80i 2O5JC 3CF5A 4K5XA 1QZGA 5KIXA 5JEAJ 4YIJA 1I6HH 4KD4A 4JG2A 2D0PA 4DV7L 1EIHA 4KY7A 1KLUD 2CFMA 3CQZH 4OWTB 4EQ5A 2UXBL 2I07B 4PQXA 4RA8A 3CU7A 3OPOA 3SVMA 3KFUA 4K6LA 1FJGL 4AQYQ 2R7DA 3RLFA 1FNVA 2IJ0A 1IL8A 3IL8A 5DM73 4IPDA 3T4AC 2NUCA 1T5XD 1G91A 1CTMA 4DAMA 4YY3L 1XMQQ 2K7VA 2PI2E 1SNOA 4KLKA 4PNYA 5EAYA 1HH2P 4ME5A 5EGTA 2Q2IA 2RHQB 4A93H 3MWYW 2VQEL 3K57A 4TRDA 2F3IA 2XGTA 1C48A 3FRPB 3KF6A 1CHPD 3CCQA 1CQVA 1GOZA 1DCZA 1T9HA 3BG3A 4A3LG 1JMCA 2DGYA 5G3LF 1E7ZA 3G7LA 4AQYL 2Z4HA 1O80A 1HUNA 1SDFA 3FKIB 4C3IG 3AFQA 4X64L 2K52A 2ASBA 4POFA 1EIGA 2RVLA 4S3SA 2Q2UA 1Y8NB 4LF4Q 3DWQA 4H13C 2K5DA 1YZ6A 5AJ3Q 3DUZA 3S14H 4A3KG 1ET6A 4X65Q 1ONLA 2YTXA 2Q8TA 1C4QA 3NEMA 1TWFB 4UAIA 1FD7D 1PZID 4EQPA 3D6WA 2BA0A 1A2UA 1ESRA 1CK1A 4A3FG 4OGQC 3RNUA 3LWEA 5TSSA 1K0RA 1KNAA 4DU9A 3SK5A 4OO1I 2KQ3A 1BBUA 3U58A 3NSWA 4HIDA 4LF4L 3C1EA 1NAPA 4B08A 3K58A 4IOAA 2JA7B 1A3VA 3STBC 5AJ3L 2HHHQ 1PH5A 2PQEA 4X65L 5IGGA 1AE2A 1PFNA 1FGUA 1EYCA 2G5DA 2A73B 3VA5A 3CKIB 2A69C 2NN6H 3TP5A 4A3JB 2UUAQ 1YJ9A 5C0XH 1D2BA 4IOCA 2I0QA 2B2WA 2I46A 1JJCB 1EY0A 4I7ZC 4L5QA 2E2IB 3WWVA 2ZXRA 3LGJA 5EBDA 1TY0A 1I3QH 2X6GA 1VQPA 5LMNW 3KDFA 2HHHL 2L55A 1IBKQ 4G4KA 3K7UC 4OXPA 1VQGA 3PO2G 3MHBA 1A3TA 1SMYC 3Q24A 1HR0Q 3SXHA 4I7AA 3A7LA 5CGKA 1RTNA 5M5WB 1KDBA 2RDFA 1BNZA 4R4TA 4APVA 3ICEA 4NXMQ 1D8LA 1PTOC 2L0CA 4JI8L 1PH8A 1ENAA 3NQTA 4I65A 5IYBH 4XXEA 2XTIA 2NZHA 1HZ9A 1ZEQX 3NTIA 2WIIB 3QOJA 1W6JA 1CI3M 5CORA 1OXVA 4JBKA 1EU4A 2AKWB 2OT2A 2Z6KA 4EQNA 3K59A 3ZJYC 4R8NA 1HR0L 1VQBA 3ULLA 5T1IA 2NTSA 1WCMH 2JN4A 2BE5D 4NXML 3CC4A 1I4RA 4UP9A 2YU9H 2PZTA 5E1FA 3WDNA 4U68A 2DNCA 1JICA 1B9MA 2R7ZB 1PRTD 2I5HA 2IX0A 4X66Q 4N8FA 1YEZA 3OSOA 3IKJA 2Q2TA 1NR4A 4HJAA 3MXUA 2N3SA 5HURA 1MJEA 1STAA 2DN8A 2L4NA 4EVOA 1S5FD 3GTLH 1IW7C 5BN3A 3AEVA 1G8ZD 4YWLA 2A6ED 1O7ZA 3MC0B 3D4DA 3NE5B 3PF4A 2IT1A 3A8JE 2HIVA 3S2DH 3M9BA 4BBSB 4X66L 4JI5Q 1LLRD 3DM3A 1ENCA 4MTKA 4R4QA 4CJ1B 3I4NH 4A3BB 1WTOA 5GADC 1AEXA 1IKMA 2QDBA 1ML0D 5M5YB 2LXKA 2XWBB 5FO9B 3KF6B 4R4IA 4TKOB 5ELBA 3HS0C 3X3NA 2WACA 5CV5A 1RDPD 2WFWA 2Z9HA 4NXNQ 1VQ4A 4JOIA 1A0IA 5C4ZA 2H1EA 4GLXA 1LABA 2LMCB 2E2HH 4H02A 4ZUIA 3R93A 3PO3H 1SE4A 1DM0B 2F0EA 1VQ9A 1SBBB 3EBEA 4JI5L 1EU3A 2B2TC 2VQFL 3SR1A 1KLGD 5JJLA 1Z7TA 3KYHC 2IL8A 3FDTA 3S9WA 5J22A 1JWSD 1HZBA 3C1FA 1MKHA 2GVAA 1KD1C 4JC0A 5C4XH 4DNIA 1ZXTA 1QNKA 1LTGD 1SROA 4NXNL 1WTPA 1OXSC 5HGTA 1HTPA 3M3YH 4ZCKA 2B3GA 4C1NI 1VCIA 1XTCD 4LUZA 3K7AB 4NP5A 3U4ZA 2K04A 1UE1A 1HTLD 2IWHA 3TS0A 2N88A 4GN4B 3BDCA 3F1ZA 1M1KC 3J81E 1MBYA 3BZCA 1UE5A 4AYBB 2VNUD 1V1PB 1A3UA 2KHJA 2MFIA 2MP1A 1EOVA 2UU9Q 5CBAE 3S16B 1BCPF 2PMZB 1SR3A 3N52A 1PH9A 2IHEA 2JA5B 1LM0A 2K03A 2L15A 2EYMA 5KNBA 1STYA 2MHVA 3OW7A 2CW0D 2UUCQ 1N34Q 4JV5Q 4XTCS 1HZAA 1K3RA 3KDFB 3NENA 5EJWA 3E0JA 2PW7A 1VQIA 3BVGA 5GAHC 1SSOA 2I5MX 1G6PA 1EEFD 3A74A 2UU9L 1YI2A 3J7AF 3CCSA 3VR4A 4G7ZC 4A3BG 1O78A 4KK7A 1V8QA 5COYA 1EY6A 1FYCA 1HFGA 2EOTA 1SAPA 3OIQA 2K6AA 1NSNS 1VQLA 2UUCL 1N34L 1Y1WH 1Q46A 4JV5L 2ZJRA 1PFMA 4K2LA 2EE1A 3HP3A 5I9OA 1GUSA 2XWJB 2J4XA 2C35B 1PH2A 1EIYB 3TMEA 4A3IG 2R93H 2G9HD 5KNDA 1E1OA 1F9RA 1PH3A 4LJZC 4RCOA 1TWHB 2KEDA 2E2DC 4FXKC 3GTMH 4JVZA 1B8AA 3BJUA 2YTVA 1OXXK 5IE8A 4RGMA 2B2YA 4XYOA 3QIAA 4YCWA 3SGIA 3VR6A 1RIPA 4ABNA 3ERQA 3QG1A 4P71A 3L0OA 1GHJA 5C4JH 4KHPQ 4IJLA 2PCFB 1GXDC 1EY5A 2KENA 3TN2A 1PYSB 2F0SA 3KUPA 3CHBD 3KJPA 1MHWC 4BXXG 3OTOQ 2H5XA 1Q1BA 1XNRQ 4IPGA 4JI4Q 1BUVT 3NQIA 3U9OA 2EVBA 1PH6A 3FP9A 1IHZA 1PZJD 4AYBE 2B63H 1YNNC 3TRZA 4L6TB 3CXCA 4LFCQ 5LMNQ 1VF5C 3SK4A 3SK8A 4AYBG 4HN7A 4Y7NH 1YJNA 1TS5A 3GTPB 1CFMA 2A68C 2MGSA 1VQ8A 1G51A 2PMZE 3RLNA 3R3OA 1JR0D 4KHPL 2RDGA 5C5MA 4FF2A 1O7YA 1S5DD 1WTWA 2JA5G 1MSGA 4DK1A 1X65A 2DUDA 4N9PA 3IFDA 4J6HA 3OTOL 4A3GG 4IURA 1N8RC 1XNRL 4JI4L 3STBD 5D65A 3S15H 3CCMA 5FO8B 5E7NA 1Q81C 3HOXH 2JA8B 3S1NH 2UXDQ 2NVYH 3G6EA 1U4LA 1R9TB 4NMZA 4C3JH 2MJ8A 4GOPA 5M3MB 3GD7A 3I2ZA 3HOZB 5LMNL 2A69D 2RA4A 3GTJH 3TS2A 2HCCA 1G2SA 3PIO3 2A19A 3E0EA 2KCTA 4OO1H 4GN5A 4QJFA 5C44H 1G291 2EYOA 1SNPA 1GM5A 1S4ZA 1EFID 4HCSA 2L11A 5EKLA 3F2DA 1X32A 3PIP3 4JI2Q 1F2MA 4K0KL 2F0NA 1E24A 1CSQA 2NVQH 1JORA 3K0XA 4OIJA 2UXDL 3D3RA 1H95A 3Q6SA 1L1OC 2ZM6L 4OIKA 5KYIA 2F0FA 1SMYD 1SNDA 4CHTB 2LY7A 2BDOA 1OO9B 1YNJC 1UEBA 1PA6A 3H91A 3SEBA 2NVTB 5CV8A 5IY0A 3NTKA 3S2HB 4UP7A 3TP6A 3T56B 3CCLA 1IL2A 5J39A 2FXQA 1PTOD 4C2MH 1D1IA 2F1MA 4V0BA 2UXCQ 2K32A 3CC2A 3ULPA 3G71A 4P74A 3VDYA 2Y0SG 4JI2L 2CQOA 4LUVA 2R92G 3RZOB 3QJYA 1MIUA 3NUCA 1OXTA 3R8BA 1C7YA 1RD9D 3CP0A 1DOLA 1KXLA 4HR7B 3I4OA 1NMFA 3VYRA 1LO5D 2ID0A 1F2ZA 5FOBB 4DV5Q 5EKIA 1SFOB 1GUTA 2UXCL 5M3FH 5JEAH 2ATWA 1W3SA 4FF4A 3M7NA 1TR5A 2EYLA 4MTNA 4UHVA 4L5SA 1B3QA 3AU7A 5EPJA 1WD1A 4JCVE 2QGQA 1K8MA 2ALYB 3N6RA 5JVG3 2CWPA 4QB4A 4CDFC 2N55A 4FXGC 3L2PA 4X3KA 4A3KB 3M85A 4IN3A 1PLFA 4B9WA 1ZKOA 4A3EB 3AYHB 2KCCA 3G6JB 4ODGA 4OEMB 1H9JA 2HDLA 4C3HH 2NBFA 1JWMD 1S72A 4LUOA 4DV1L 4DV4Q 4OONA 1IW7D 3URYA 4YHHQ 5C3EG 4IUPA 4DV5L 1KABA 1HRJA 1KNEA 1QVFA 1SJED 2MPMA 5KEEA 1BOSA 1HZCA 5CV9A 1TS2A 4OELB 4A3MH 4BY7H 4TVAB 1U4PA 3I73A 2B8FA 2XSCA 1EQVA 4PMWA 4JI0Q 4CGYB 3J81c 4IUQA 3H94A 1XWEA 2VUMB 4IFDG 1G2TA 3KF8B 4MIUA 5FLXE 1PH7A 2AWNA 1DGSA 1STBA 1Q90A 3T51B 3UDIA 4YHHL 3HOUH 1K73C 1DJRD 2VQEQ 1HJPA 4O42A 4WFN3 4X62Q 1GUWA 2H4OA 2XRQD 3P20A 1PH4A 2XVSA 2OQ0A 3J7AV 2K33A 4OX9Q 2L1BA 1PMRA 1X3FA 2XRSD 4JI0L 2XN9C 1WTXA 3T1YQ 3X3MA 4X64Q 5FLMH 3PO2B 1SYFA 5D3IB 4AIMA 3K0YA 4FP5D 4FNFA 3MVVA 2JA6H 2K5NA 4K8IA 1IZ6A 5M5XB 1WTVA 4A93G 1U9RA 4IZ8A 4X62L 4LMQD 1D5XC 1LTID 1HQMC 4GS3A 3ER0A 1HQRD 4OX9L 1EZ8A 5DM63 1EYAA 1Y14B 1CA6A 2FHTA 4RKBA 1NE3A 1HA6A 2HQLA 3T1YL 2E2JB 3K5MA 4ZRZA 2D9UA 2FFKB 1D7QA 4GOPB 3CCJA 1S40A 4K2KA 1BXTA 3S1RH 3U50C 1JWUD 1KIXA 1SJHD 5BR8Q 4NKLA 3O13A 4MNOA 1WTQA 4HIMA 2RCNA 4GZYC 3RN5A 2A74C 3JC66 4IFDJ 4A3EG 5C5LA 2YU9B 4JBJA 4C3IH 2HT1A 1JE4A 4KJNA 2JJQA 2RCFA 4DAYA 3I70A 3L3OC 4OL7A 3EROA 2K5WA 2D62A 1SYDA 2MNAA 1FR3A 2QCPX 4C56C 3HOWH 4WJ3M 3GTKH 3H0GB 1YITA 4A3CH 2CCZA 1UE7A 5BR8L 5GAGC 3TP8A 1B3AA 3MXNA 3PUZA 3GTLB 1NCVA 1VS0A 2EJFC 1V1PA 2VUMG 3TREA 4A3FH 5IYDH 1ET9A 4IO9A 2PNRC 1K83H 1UNSA 1E2ZA 1A8VA 1VQJA 2F0PA 2NN6G 3TZUA 2AMCB 5C0XG 2BCOA 3M4OB 1JT8A 4RHRA 4POGA 4HAEA 1I4GA 1PHJA 3HOVB 4JI8Q 4PV1C 1QUQA 4KN7C 3S17H 2NVXB 1AW7A 3AQQA 2RBMA 1ASYA 1TWGB 5J1ZA 1LTTD 3H3VI 1HFNA 1O7LA 1EOTA 1VQMA 3J7ZC 4PMBA 5JJZA 1V1OA 2Z4IA 2EPBA 4PZ7A 4NDXA 1JOKA 2KEEA 3JAML 1EEID 2F0TA 3OOCA 4EQOA 1AZQA 1LYLA 1SNCA 3J80L 1YJWA 2F4VQ 2N8NA 3AB9A 5CV7A 4CDCC 1D1KA 3BYTB 4Z9CB 1N9WA 1XMOQ 2FMCA 1YNND 4A75A 4DV6Q 1TY2A 4KY5A 1KQSA 5C4XB 3LNNA 3D4RA 1TIID 2A68D 3FEWX 4JI1Q 1QILA 4DKAC 1A15A 1V1QA 5I2XA 4YWKA 2K5QA 2AQ2B 2AHOB 2EY5A 4B3TQ 1HHVA 4A4IA 2BDNA 1IBMQ 1LT6D 1WCMG 1WOCA 1K28A 5IP7H 1T5EA 4LFAQ 2F4VL 5LL6S 3FKIH 2EYFA 1P16A 2JSOA 4BY1B 1QB5D 4XT1B 1XMOL 2BH8A 2PNHA 5ELCA 4DV6L 1GKHA 1ENFA 5M9OA 4DXGA 1OTCA 4TQUS 1J8IA 1I50B 3H0GG 4JI1L 3P7JA 1YBYA 1G6ZA 1LUZA 2B2VA 1GUNA 1Q1EA 1PH1A 4FYDA 3I90A 1PTOB 3PUVA 4B3TL 1B2TA 2K5VA 1TWFH 2YV5A 5I6WA 1IBML 4XT3B 1TWCB 1Y1VB 5FLXL 4LFAL 2LFNA 1K9MC 3W3AA 2KHIA 1MGSA 1Q8IA 1B53A 1RL2A 4KHZA 2NTTA 5E3FA 1CM9A 2EXZA 3D31A 3PGZA 2VQFQ 4RMFA 1R4QB 3I4NG 1PTOF 3HKZB 2JA7H 1M4VA 3M4YA 1TQOA 1YNJD 3HOVG 1VMPA 3CD6A 1HXYD 2F0LA 3NHHA 1KDCA 5EPKA 1EFWA 3GTGB 2N78A 3E5SA 2HCIA 4A3JH 3I4MB 2RDHA 1TU2B 2ENBA 4TSSA 4A3IB 2ZTCA 3E3XA 5D14A 4QIWB 4X6AH 4P72A 2E2IH 2ZJQA 4DV3Q 3EQLC 4DK6C 4PG3A 4ZAIA 1I6VC 5A35A 3SK6A 3NBIA 2B39A 3DM1A 3V05A 2A5HA 5IGEA 4HJ7A 3FHWA 4NW2A 3KLSX 5HGQA 2EQSA 1DXMA 2F0MA 2E8GA 4DAYB 5C4XG 1W6KA 4JBWA 5EBCA 1Q82C 2JE6I 1TKWB 4HTHA 3PUWA 3BZDB 2Z1CA 3U9SA 1QVCA 5IWAL 1VQNA 2QW7A 4DV0Q 4DUYL 1BCPB 4QGUA 4BBRB 2QKIC 1TS3A 1E2WA 4DV3L 1H9MA 2DJFC 1PV4A 3CMAA 4HEDA 4FDBA 4CJ0B 2ZT9C 3HZXA 3MXNB 2EY2A 3P75A 4K14A 2F0UA 4LWCA 1WJJA 1TWAB 2JXMB 2KCMA 3HGBA 4LK1C 4BA2I 1QWYA 2D2CC 4BY1G 2OTLA 1CA5A 1SN8A 4LF9L 4RCNA 3OWEB 2CQAA 1KRSA 4CBVA 3L7ZC 3EIVA 4FXDA 2QF7A 1SLJA 1E2VA 3GTQB 1H9KA 1SNMA 4GNXA 4DV0L 4A3GB 4ZQ3A 1EZ6A 2RHSB 5KGUA 5CC4A 2EJMA 1QUQB 1UEAB 3H3VC 1F2YA 3K5OA 2B2UC 1CKNA 1UWVA 2WAQG 3S1NB 1E1TA 4DR1L 4K5WA 2R7ZH 3UE1A 4RKLA 1Y1VG 3DWAA 3MFGA 1L1OA 1GO3E 4KJOA 4F88A 1B7YB 2Z6KC 1CUKA 2SEBD 3HKZE 5BN5A 2C5CA 3RZDB 1Q8KA 5C44B 1FGBD 3PMFA 4J15A 3T1HQ 5JVH3 5JPMC 2HIXA 5D3DA 3HKZG 4KN4C 4ULLA 3W1GA 4A3DB 3D0FA 3QWNA 4GLAC 1JB7A 4V190 2F0GA 3ULJA 4G57A 2A8VA 1SYGA 1B9NA 2MQHA 3CCVA 4R4CA 2QA4A 2V1CC 1Y1WG 2F0WA 3I4MG 4R4OA 2Q2HA 4R9WA 1GD7A 3HOYB 4BBSH 4QIWE 1SYEA 1R4PB 1XPOA 1RCVD 4KKTA 1NR2A 4A3BH 2R93G 3ND8A 3FPPA 1JCKB 3CPFA 4FF1A 1KHIA 3NWSA 5F2DA 3A5ZB 5M5YH 2DY7A 3IRBA 1JOOA 3KF8A 3T1HL 3S1MH 4DV2Q 1JE5A 4K5VA 1EY8A 3MXGA 3ITPA 1HNZQ 3HEJA 2Y0SB 2R92B 3MEFA 2PQAA 1FL0A 2E76C 4LW1A 3DEOA 3J81i 4HIOA 4HJ9A 1L2FA 2SDFA 1Q7YC 5IP9H 3S1QB 4GKJQ 4P75A 3WOFA 4QY7A 3OMCA 1XNQQ 4JYAQ 4BBRG 1VQOA 1GUGA 2OTJA 2CVRA 1LTBD 1HUMA 4PZ6A 1X3PA 4M1UB 2B63G 1IYUA 3NTHA 4DV2L 4UY8C 1E22A 3F2UA 1HNZL 2JEAI 1Q12A 3MZ5A 4JOIC 3IAYA 2N49A 1F9PA 3E6ZX 3OYYA 3C46A 4IALA 4HMIA 3GTOB 2A6HC 1F2LA 3K7AH 3V96A 4EGVA 4GKJL 2TMPA 3U4VA 1EYDA 4K0KQ 1XNQL 2EZVA 4JYAL 5K36G 2MO1A 5IYCH 4CKBA 5C3EB 1VQ7A 1LT5D 1HNWL 3VYTA 1J9OA 3I56A 3QR8A 1NY4A 2ZM6Q 3K80C 3S16H 3W1BA 1N33Q 2JA5H 1LTAD 2EYHA 1WD0A 1VQDA 5ISRA 4OO1G 5C44G 2Q8IB 2AUKA 1S5BD 3IFTA 4L8JA 4A3DG 3BZKA 1EL0A 2OCEA 4M8AA 1GUOA 2AWOA 2WB1B 3H09A 5FJ8H 3AMUA 1YHAA 1VQHA 4XDXA 3ZYYX 1I6HB 3HOYG 1A63A 1KC8C 3RD4A 1N33L 3CQZB 2HD3A 5K5PA 1LTRD 2QILA 2EXDA 2JA9A 4XQJA 3KBXA 3PF5A 2WKCA 1LACA 4XIGS 2HQEA 2L12A 4DR7Q 1L0YB 3DXJC 1BKBA 5C4HA 1F9QA 2Y0SE 2VS1A 4GN3B 5IT9L 3H3VH 2IHFA 5DEHA 2O5IC 1SXTA 1F77A 3E9IA 4RWSC 5KNCA 1PRTB 2CH4W 3DHQA 3A54A 2K4KA 3JAME 4DR4L 1EY7A 1VMCA 4A93B 1HPCA 3TEHB 3TQYA 3PUXA 3L9AX 3TP7A 1B4OA 1U0LA 2F0VA 3J80E 1TWHH 1VF7A 3T16A 2ZTEA 4GNXB 1X6OA 4LAAA 4DV1Q 4DXFA 3I72A 1PRTF 4DR7L 5FKAC 1BF4A 4CDDC 2CWAA 4DGZA 3BU2A 1CKNB 1XTDA 2IX1A 5IGFA 2EYPA 5ELDA 1VQAA 4CKCA 2DY8A 2B29A 1K0SA 5C6AA 3S1RB 1L1OB 3MEHA 3HKSA 5E4WC 4KD3A 1YHBA 5CMDA 4H44C 2F0IA 3A0JA 1L0XB 3S14B 1STEA 2IW3A 3RN2A 3GO5A 1EY9A 5ELNA 3T13A 1DYQA 5NUCA 4CKEA 5KRUA 4F87A 5L37A 1Q86C 4C3HG 4HJ8A 5IGDA 2KCNA 3GTPH 1IYJB 3CRLC 2OQKA 2GA4B 4JBMA 3KOJA 2MO0A 1I4QA 2KHSA 4JK1C 3QB3A 1YHQA 3M4PA 4A3MG 1EWHA 3VR2A 4BY7G 4GLVB 4DR6Q 1B1ZA 1WI5A 1LTSD 3GDEA 3QO2A 4JI6L 5I9PA 5H1SE 2DJGC 2JA8H 4DNTB 1R9TH 2WB1E 2R6GA 5M3MH 2CHBD 2VW9A 3EFXD 2HDMA 3HOZH 1FNUA 3J7YW 4QUCA 2XNAC 2WB1G 1HA5A 3HOUG 2QEXA 1J6QA 3UI2A 2PQAB 4B3RQ 1TS4A 2B8GA 4DNRB 1EQQA 3I91A 2R61A 3CW2C 2J7ZA 3Q23A 4IFDH 4LFBQ 1I3QB 4DR6L 3MFYA 3UDXA 3Q0AA 3HRZC 1YVCA 4X3SA 5C3WA 3BS1A 1I4XA 4IQZA 5FLMG 3QOLA 4GOPC 2KBNA 1EUJA 3FMCA 4G7HC 4JW0A 5CV4A 1X9NA 2JA6G 1XPUA 2AQ1B 2NZ1D 1PZKD 3T53B 4KY6A 1AN8A 4E6IA 4B3RL 1BR9A 4HSPA 2NVTH 1Z9FA 3SE0A 5E4XA 3S2HH 1ZYRC 4RH6A 1EWIA 2XIWA 4LFBL 3VA7A 2F0HA 2F0QA 5J3BA 5JJIA 2K5HA 3RZOH 3RR5A 3H15A 2EY1A 3I3CA 3P1HA 1CQFA 2PPBC 4QCLA 3I55A 3D4WA 1BDOA 1EQTA 3CCUA 3ONAB 4A3LH 1X54A 1WCMB 2V4DA 4HJ5A 3CAMA 4YCUA 2SNMA 3M7GA 3I4LA 2JYOA 3DMUA 4XQQA 4KTAA 1SFOH 1NNXA 3PCOB 1AZPA 1KAAA 3MA2B 4U673 3D6CA 1XMQL 4QUFA 1V9PA 1QCBD 2JK8A 3HOWG 4QQBX 4A3CG 2WINB 4A3KH 4LF5Q 5LMUQ 1CKMA 2K14A 3C2PA 1DONA 4A3EH 1XX8A 3W2DA 1B44D 3RMHA 3AFPA 5JOBA 5IYDG 1WFQA 5HY6A 3TDQA 2SNSA 1D5MC 3NXWA 4HSVA 2F3WA 3J7A5 3S2DB 4N9TA 3SHLA 2RKSA 4IUVA 1IKLA 4ZLTF 1JC7A 4ILWA 2F0JA 3I4NB 2B2TA 2JP1A 5T1GA 1VDZA 3KLRA 5CBEE 5IIFA 2P5ZX 5DNFA 1I94Q 4LF5L 5LMUL 2VUMH 3VR5A 4O0AA 5GQOA 4QMGA 4IJHA 3OW2A 2C9OA 4NPSA 4DAPA 1X3EA 2OF1A 2J0TD 4JI3Q 4DPGA 2KECA 2E75C 2E2HB 4DAVA 3PO3B 2FJ2A 4KHVA 3ERSX 1XPRA 2QEJC 1QJOA 5DAUA 3PV0A 2O2LD 2E5LQ 4F7XA 4UDUC 4ME3A 4IPHA 1H9SA 1CZWA 1VQFA 3RLOA 1I94L 3PO2H 1IXRA 3BDLA 5IYBG 5KYLA 1U4RA 3FVQA 1EYGA 3LWUA 5FK9C 2UUAL 1MJCA 3VYUA 2AQ3B 5JJKA 3A56A 4L5TA 5M5XH 3M3YB 4JI3L 1D5ZC 2EJGC 1KRTA 2A6HD 4RHSA 3DWPA 2KA7A 1ICWA 2B2UA 1J5EQ 4RGNA 1C0AA 2E5LL 3KLWA 1GHKA 2KJXA 5IP7G 1KL9A 1ILQA 1IBKL 1AP0A 3FKIG 2E2JH 3BVMA 1N36Q 4MN3A 3JAMc 2JEBI 2EYJA 2KVMA 1PDQA 5C0XJ 2NYZD 3F8TA 3HG9A 4RG1A 3J80c 1BO0A 2F0OA 3E9HA 3K6OA 5IODA 3B6YA 2K05A 4EX5A 2WAQB 5A2QE 2PW5A 2YTYA 5EQ0A 4X3UA 1J5EL 4F8MA 2YYZA 4BA1I 4K8JA 3NBHB 1SYBA 1ASZA 1PVOA 1PYBA 3PQIA 2L9HA 1CHQD 1N36L 4Q5VA 3MXPA 3H0GH 1LT3D 1P8LA 1QNUA 1VQ5A 1K8AC 3K5NA 4IFDI 4DK3C 2JA7G 1GVPA 3KLSA 1WTRA 2FINB 4L63B 1OXUA 4ZKCB 4QF4A 1JOQA 2BOSA 1ICFB 4RGOS 2I5LX 4BS9A 1Y1WB 4A3JG 1SYCA 2F03A 3S24A 2R3ZA 4ZYSA 3M4OH 2D0OA 4DFAA 5IWAQ 4XQNA 1BCPC 1CKOA 4CJ2C 4DUYQ 2R93B 1GJXA 3KJOA 1V43A 3K5LA 3NP8A 2VB2X 3HOVH 3CC7A 3PO3G 3J81j 2EDGA 2NVXH 1WVLA 3S1MB 1L0WA 3TZDA 2R7FA 3GTMB 1TWGH 2X69A 5FLXc 2KUMA 4AH6A 2BA1A 2F0KA 5IT9E 1VQEA 1SRUA 2F52A 3UDFA 2PO4A 1DD2A 3W5OA 4LF9Q 1Z47A 5C4JB 5LHY1 1JJGA 1PYWD 3EA6A 4IUUA 1SNQA 2VL6A 3NK9A 5M5WH 1STNA 4IUNA 4WJWA 2GVBA 4WRDA 2B2WC 2GN5A 2CH4A 3A55A 2K01A 1VQKA 4HIKA 4LF8Q 4ZUJA 1PFSA 3Q22A 4WORA 2B63B 4DR1Q 5ELOA 4DN4M 2NWGA 3NPPA 4B9XA 2VB3X 3BYYB 4KKUA 1BVSA 3KK7A 2PYKA 1F9SA 3EN2A 4Y7NB 1RTOA 4BWGB 2ZJPA 3WOEA 1RHPA 2HUGA 4KMUC 1HCZA 3K8AA 4ZK9B 1Y8OB 2G9DA 3I8ZA 3OWFA 2WV6D 3H6MA 1NBWA 2WAQE 2IX3A 4RFBA 1QG7A 5I2YA 4LF8L 3UDGA 1K8OA 3S15B 3V2TA 2F4IA 4C1NK 3CCEA 3HOXB 3DLLA 2NVYB 5G3LD 5IOCA 2NZOA 2PI2A 4PZ8A 4C3JB 4BY1H 1SE2A 3R2IA 4H0LC 2R7ZG 1N32Q 5CR3A 3GTJB 4KKSA 1I50H 1TT2A 4JI7Q 2F3VA 1NUCA 1WYDA 3VR3A 1LTLA 5CV6A 1KDAA 4R8IA 1PXUA 1PTOH 3EJIA 5JAVA 2ZTDA 2NN6I 4KI0A 1TWCH 2IPKD 1Y1VH 5ELEA 4P73A 1H9SB 2NVQB 3I7FA 1B70B 1LV9A 5C0XI 3F2CA 1NTGA 4YWMA 1S3OA 2K75A 4DF7A 1N32L 2Q8RE 2ICEC 1XXGA 4BBSG 2UUBQ 4IUTA 3BVZA 4LNQA 4JI7L 2B2VC 3MTSA 1KAWA 3UE0A 1X3GA 4DR2Q 2OEOA 1A62A 3G48A 4J1MA 1ZYRD 4C2MB 2OWOA 3GTGH 4RGTA 2LKVA 2DNEA 3M4QA 1W2BA 3I4MH 3VYSA 2TSSA 5IGBA 4R1JA 1ESFA 2JQOA 2Z6BA 1X3QA 1S5CD 4A3IH 1YNXA 5LL6X 1NMGA 1E3PA 1FNWA 1SE8A 4UPAA 1CT1D 4CDEC 2MUYA 1ILPA 1E0BA 1Q3LA 1Y69U 1TXYA 2UUBL 5IP9G 4ID6A 1JB3A 4JPBW 1QVGA 2VY3A 3F2BA 5I4DA 4OWXB 5FO7B 5CYUA 1DOMA 4DR2L 4MZ9A 1HNWQ 4WJ4A 2VZAA 5M3FB 4B3MQ 4DK0A 3GQBA 2A1AA 3A7AB 4OHJA 1C8CA 3CCRA 4BXXH 1II3A 1XYIA 1MSHA 4PMCA 1X56A 4G7OC 2D5DA 1K3BC 4Q0FA 4HMJA 4BBRH 4KV6A 1VQCA 2ZXOA 2O4XA 4C3HB 1CZGA 1UE6A 3Q8DA 1TWAH 5A2QL 3PIOA 1A2TA 1I5FA 1AE3A 5AFWA 5IYCG 3HOXG 4ALPA 1EWCA 2F0DA 1RODA 3A8IE 4C3JG 4LF6Q 4H7BA 1CSPA 4DR5Q 4IPCA 3LX0A 4B3ML 4P2CB 1BBWA 4A76A 4L5RC 4A3MB 4BY7B 3GTQH 1MI2A 5C3XA 2BE5C 3PIPA 3ND9A 4QL5A 4A3GH 4YCVA 3GP7A 5GAEC 2SOBA 2Z8LA 5K36H 1STGA 1S5ED 2L5TA 1I4HA 3C3LA 2RSOA 3K81C 1PRTC 1HR0W 2LXJA 4LFCL 1FVIA 3GV6A 2K50A 4X3TA 5FJ8G 3HOUB 4DR4Q 1UUPA 3OHXC 1TVXA 1SEBD 3R2TA 4LF6L 4DR5L 3RZDH 1U4MA 1KTKA 4UP8A 2FMMA 2AUJD 3DEPA 1JJ2A 4DUZQ 3CRKC 2M2LA 4GNXC 4FVMA 2K28A 1UAPA 4A3DH 1M8AA 4O1NA 2Z0SA 2ICIA 1EQRA 2A6EC 4J8QA 4DA2A 2RF4A 4GKKQ 3KBGA 3GV3A 3NWTA 1IBLQ 3CPWA 5IGCA 4FO2A 4HCEA 1VQ6A 5EKKA 4K6DA 1DZ1A 2JA6B 3HOYH 3TSSA 1B50A 1QZHA 3HFZB 3TBIB 1RF2D 1Y8PB 2EY6A 1STHA 2EIFA 2E74C 1EY4A 4LF7Q 3EVQA 4DUZL 1PFBA 1U5KA 3CMEA 4OWWB 4ZKBB 2WP8J 3A8KE 3PUYA 1DOKA 1MD2D 2R92H 1H9RA 3BDOA 4FF3A 1RKNA 3NELA 2ES2A 5M3FG 5JEAG 4GKKL 1X55A 2RSNA 1IBLL 2PZUA 1XJVA 2CKZB 2LSSA 3S1QH 4Y52H 2QDLA 1I4PA 2K1BA 5IT9c 4LF7L 1AH9A 5I6YA 4JI6Q 5EPLA 2BH2A 1SMXA 1BQQT 4DR3Q 1YIJA 4C3IB 1RJTA 3J81L 2B2YC 2VXWA 1QOHA 2IY5B 1QE6A 3OIPA 1NJIC 3G4SA 3HOWB 3GTKB 3GTOH 2OXPA 1JQYD 4B3SQ 3PSIA 2NB0A 4RAUC 1HNXQ 3FPUB 1K8GA 2WKDA 3RUZA 1SE3A 3SDZA
chains in the Genus database with same CATH topology
4MHEA 5ELFA 2LS01 2KOLA 5BN4A 2ZXPA 5JPNC 2X6LA 4A3FB 1IYVA 1D6EC 1K83B 1Z6HA 2RQXA 1AFPA 3MAQA 1LT4D 3D8GA 2M00A 1BBXC 1BCPD 2CW0C 2PZWA 4XYQA 3OMGA 3S17B 3NBHA 2M9VA 1A6XA 2O5JC 4K5XA 5KIXA 5JEAJ 4YIJA 4KD4A 1EIHA 4KY7A 1KLUD 2I07B 4PQXA 4RA8A 3CU7A 3OPOA 3SVMA 4K6LA 3RLFA 1FNVA 2IJ0A 1IL8A 3IL8A 5DM73 3T4AC 2NUCA 1T5XD 1G91A 1CTMA 2K7VA 1SNOA 4PNYA 4ME5A 5EGTA 3MWYW 3K57A 4TRDA 1C48A 3FRPB 1CHPD 1CQVA 1GOZA 1DCZA 3BG3A 5G3LF 3G7LA 2Z4HA 1O80A 1HUNA 1SDFA 3FKIB 4C3IG 1EIGA 2RVLA 4S3SA 1Y8NB 3DWQA 4H13C 2K5DA 3DUZA 1ET6A 1ONLA 2Q8TA 1C4QA 1TWFB 4UAIA 1FD7D 1PZID 4EQPA 3D6WA 2BA0A 1A2UA 1ESRA 1CK1A 4OGQC 3LWEA 5TSSA 1KNAA 4DU9A 3SK5A 4OO1I 2KQ3A 3NSWA 3C1EA 1NAPA 4B08A 3K58A 2JA7B 1A3VA 2PQEA 5IGGA 1PFNA 1EYCA 2A73B 3VA5A 3CKIB 2A69C 2NN6H 3TP5A 4A3JB 5C0XH 1D2BA 2B2WA 2I46A 1EY0A 4I7ZC 2E2IB 2ZXRA 5EBDA 1TY0A 2X6GA 2L55A 4G4KA 3MHBA 1A3TA 1SMYC 3Q24A 3SXHA 3A7LA 5CGKA 1RTNA 5M5WB 1KDBA 2RDFA 1BNZA 1PTOC 2L0CA 1ENAA 3NQTA 4I65A 4XXEA 1ZEQX 3NTIA 2WIIB 3QOJA 1W6JA 1CI3M 5CORA 1OXVA 1EU4A 2OT2A 4EQNA 3K59A 4R8NA 5T1IA 2NTSA 2BE5D 1I4RA 2PZTA 5E1FA 3WDNA 4U68A 2DNCA 1JICA 1B9MA 2R7ZB 1PRTD 2IX0A 3OSOA 3IKJA 1NR4A 3MXUA 5HURA 1STAA 2DN8A 2L4NA 4EVOA 1S5FD 1IW7C 5BN3A 1G8ZD 2A6ED 1O7ZA 3MC0B 3D4DA 3NE5B 2IT1A 3A8JE 4BBSB 1LLRD 1ENCA 4CJ1B 4A3BB 1WTOA 1AEXA 1IKMA 2QDBA 1ML0D 5M5YB 2XWBB 5FO9B 4TKOB 5ELBA 3HS0C 3X3NA 2WACA 5CV5A 1RDPD 5C4ZA 2H1EA 1LABA 2LMCB 4ZUIA 3R93A 1SE4A 1DM0B 2F0EA 1SBBB 1EU3A 2B2TC 3SR1A 1KLGD 1Z7TA 2IL8A 3FDTA 3S9WA 5J22A 1JWSD 3C1FA 1ZXTA 1QNKA 1LTGD 1WTPA 1OXSC 5HGTA 1HTPA 4C1NI 1VCIA 1XTCD 3K7AB 4NP5A 2K04A 2IWHA 1HTLD 2N88A 3BDCA 3J81E 1MBYA 4AYBB 2VNUD 1V1PB 1A3UA 2MP1A 5CBAE 3S16B 1BCPF 2PMZB 3N52A 2JA5B 2K03A 2EYMA 5KNBA 1STYA 2MHVA 3OW7A 2CW0D 4XTCS 5EJWA 3E0JA 2PW7A 3BVGA 1SSOA 1EEFD 3J7AF 3VR4A 4G7ZC 1O78A 4KK7A 1V8QA 5COYA 1EY6A 1FYCA 1HFGA 2EOTA 1SAPA 3OIQA 2K6AA 1NSNS 1PFMA 4K2LA 2EE1A 3HP3A 5I9OA 1GUSA 2XWJB 2J4XA 3TMEA 2G9HD 5KNDA 1F9RA 4LJZC 4RCOA 1TWHB 2KEDA 2E2DC 4FXKC 1OXXK 4RGMA 2B2YA 4XYOA 3QIAA 3VR6A 4ABNA 3ERQA 3QG1A 1GHJA 2PCFB 1GXDC 1EY5A 3TN2A 2F0SA 3KUPA 3CHBD 1Q1BA 1BUVT 3NQIA 3U9OA 2EVBA 1IHZA 1PZJD 1YNNC 4L6TB 1VF5C 3SK4A 3SK8A 4HN7A 3GTPB 1TS5A 1CFMA 2A68C 2MGSA 3R3OA 1JR0D 2RDGA 5C5MA 4FF2A 1O7YA 1S5DD 1WTWA 1MSGA 4DK1A 4N9PA 3IFDA 4J6HA 4IURA 5D65A 5FO8B 2JA8B 1U4LA 1R9TB 4NMZA 2MJ8A 5M3MB 3GD7A 3HOZB 2A69D 2RA4A 2HCCA 1G2SA 3PIO3 4OO1H 1G291 2EYOA 1SNPA 1S4ZA 1EFID 4HCSA 2L11A 5EKLA 1X32A 3PIP3 1F2MA 2F0NA 1JORA 4OIJA 3D3RA 3Q6SA 4OIKA 5KYIA 2F0FA 1SMYD 1SNDA 4CHTB 2LY7A 2BDOA 1OO9B 1YNJC 3H91A 3SEBA 2NVTB 5CV8A 3NTKA 3S2HB 3TP6A 3T56B 5J39A 1PTOD 1D1IA 2F1MA 4V0BA 2K32A 3RZOB 3QJYA 3NUCA 1OXTA 3R8BA 1RD9D 1DOLA 4HR7B 3VYRA 1LO5D 2ID0A 1F2ZA 5FOBB 5EKIA 1SFOB 1GUTA 5JEAH 4FF4A 3M7NA 1TR5A 2EYLA 3AU7A 5EPJA 1WD1A 3N6RA 1K8MA 5JVG3 4QB4A 2N55A 4FXGC 4X3KA 4A3KB 3M85A 4IN3A 1PLFA 4B9WA 1ZKOA 4A3EB 2KCCA 3G6JB 4ODGA 1H9JA 2HDLA 2NBFA 1JWMD 1IW7D 3URYA 4IUPA 1KABA 1HRJA 1KNEA 1SJED 2MPMA 5KEEA 1BOSA 5CV9A 1TS2A 1U4PA 3I73A 2B8FA 2XSCA 1EQVA 4PMWA 4CGYB 4IUQA 3H94A 1XWEA 2VUMB 4IFDG 1G2TA 4MIUA 5FLXE 2AWNA 1STBA 1Q90A 3T51B 1DJRD 4O42A 4WFN3 1GUWA 2H4OA 2XRQD 3P20A 2XVSA 3J7AV 2K33A 2L1BA 1PMRA 2XRSD 2XN9C 1WTXA 3X3MA 3PO2B 1SYFA 5D3IB 3K0YA 4FP5D 4FNFA 3MVVA 4K8IA 5M5XB 1WTVA 1U9RA 4IZ8A 4LMQD 1D5XC 1LTID 1HQMC 1HQRD 1EZ8A 5DM63 1EYAA 1CA6A 2FHTA 4RKBA 1HA6A 2E2JB 3K5MA 4ZRZA 2D9UA 2FFKB 4K2KA 1BXTA 1JWUD 1SJHD 4NKLA 3O13A 1WTQA 4GZYC 2A74C 4IFDJ 5C5LA 2YU9B 1JE4A 4KJNA 4DAYA 3I70A 3L3OC 4OL7A 3EROA 2K5WA 2D62A 1SYDA 1FR3A 2QCPX 4C56C 3H0GB 3TP8A 1B3AA 3MXNA 3PUZA 3GTLB 1NCVA 2EJFC 1V1PA 1ET9A 2PNRC 1UNSA 1E2ZA 2F0PA 2NN6G 3TZUA 5C0XG 2BCOA 3M4OB 4RHRA 4HAEA 1I4GA 3HOVB 4PV1C 4KN7C 2NVXB 1AW7A 2RBMA 1TWGB 5J1ZA 1LTTD 1HFNA 1O7LA 1EOTA 4PMBA 5JJZA 1V1OA 2Z4IA 2EPBA 4NDXA 1JOKA 2KEEA 3JAML 1EEID 2F0TA 3OOCA 4EQOA 1AZQA 1SNCA 3J80L 3AB9A 5CV7A 1D1KA 3BYTB 4Z9CB 2FMCA 1YNND 1TY2A 4KY5A 5C4XB 3LNNA 3D4RA 1TIID 2A68D 3FEWX 1QILA 1A15A 5I2XA 2K5QA 2AQ2B 2EY5A 1HHVA 2BDNA 1LT6D 1T5EA 5LL6S 2EYFA 2JSOA 4BY1B 1QB5D 4XT1B 5ELCA 1ENFA 5M9OA 4DXGA 4TQUS 1J8IA 1I50B 3P7JA 1G6ZA 2B2VA 1GUNA 1Q1EA 4FYDA 3I90A 1PTOB 3PUVA 1B2TA 5I6WA 4XT3B 1TWCB 1Y1VB 5FLXL 2LFNA 3W3AA 1MGSA 1Q8IA 1B53A 4KHZA 2NTTA 5E3FA 1CM9A 2EXZA 3D31A 1R4QB 1PTOF 3HKZB 1M4VA 3M4YA 1TQOA 1YNJD 1VMPA 1HXYD 2F0LA 3NHHA 1KDCA 5EPKA 3GTGB 3E5SA 2HCIA 3I4MB 2RDHA 1TU2B 2ENBA 4TSSA 4A3IB 5D14A 4QIWB 3EQLC 4ZAIA 5A35A 1I6VC 3SK6A 3NBIA 2B39A 3DM1A 3V05A 2A5HA 5IGEA 4NW2A 3KLSX 1DXMA 2F0MA 1W6KA 4JBWA 5EBCA 2JE6I 1TKWB 4HTHA 3PUWA 3BZDB 2Z1CA 3U9SA 1BCPB 4BBRB 2QKIC 1TS3A 1E2WA 1H9MA 4HEDA 4CJ0B 2ZT9C 3HZXA 2EY2A 3P75A 4K14A 2F0UA 4LK1C 3HGBA 1TWAB 2JXMB 4BA2I 1QWYA 2D2CC 1CA5A 4RCNA 3OWEB 2CQAA 4CBVA 3L7ZC 4FXDA 2QF7A 1E2VA 3GTQB 1H9KA 1SNMA 4A3GB 4ZQ3A 1EZ6A 5KGUA 5CC4A 2EJMA 1UEAB 3H3VC 1F2YA 3K5OA 2B2UC 3S1NB 4K5WA 4RKLA 3MFGA 3DWAA 4KJOA 4F88A 2SEBD 5BN5A 2C5CA 3RZDB 5C44B 1FGBD 3PMFA 5JVH3 5JPMC 5D3DA 4KN4C 4ULLA 4A3DB 3QWNA 4V190 2F0GA 4G57A 1SYGA 1B9NA 2F0WA 4R9WA 3HOYB 1SYEA 1R4PB 1RCVD 4KKTA 1NR2A 3ND8A 3FPPA 1JCKB 4FF1A 3NWSA 5F2DA 2DY7A 3KF8A 1JOOA 4K5VA 1EY8A 3MXGA 3ITPA 3HEJA 2Y0SB 2R92B 2E76C 3DEOA 2SDFA 3S1QB 3WOFA 3OMCA 1GUGA 2CVRA 1LTBD 1HUMA 1X3PA 4M1UB 1IYUA 3NTHA 3F2UA 2JEAI 1Q12A 3MZ5A 3IAYA 1F9PA 3E6ZX 3C46A 4IALA 4HMIA 3GTOB 2A6HC 1F2LA 3V96A 4EGVA 2TMPA 1EYDA 2EZVA 5K36G 4CKBA 5C3EB 1LT5D 3VYTA 1J9OA 1LTAD 2EYHA 1WD0A 5ISRA 4OO1G 2Q8IB 2AUKA 1S5BD 3IFTA 4L8JA 1EL0A 4M8AA 1GUOA 2AWOA 2WB1B 3H09A 3AMUA 4XDXA 3ZYYX 1I6HB 3RD4A 3CQZB 5K5PA 1LTRD 2QILA 4XQJA 3KBXA 2WKCA 1LACA 4XIGS 2HQEA 2L12A 1L0YB 3DXJC 5C4HA 1F9QA 5IT9L 2O5IC 5DEHA 1SXTA 1F77A 4RWSC 5KNCA 1PRTB 3DHQA 3A54A 3JAME 1EY7A 1VMCA 4A93B 1HPCA 3PUXA 3L9AX 3TP7A 1B4OA 2F0VA 3J80E 1VF7A 3T16A 4LAAA 4DXFA 3I72A 1PRTF 5FKAC 1BF4A 4DGZA 2IX1A 5IGFA 2EYPA 5ELDA 4CKCA 2DY8A 5C6AA 3S1RB 3MEHA 5E4WC 4KD3A 5CMDA 4H44C 2F0IA 1L0XB 3S14B 1STEA 2IW3A 3GO5A 1EY9A 3T13A 1DYQA 5NUCA 4CKEA 5KRUA 4F87A 4C3HG 5IGDA 2KCNA 3CRLC 2GA4B 1I4QA 2KHSA 4JK1C 3QB3A 1EWHA 3VR2A 1B1ZA 1LTSD 3QO2A 5I9PA 4DNTB 2R6GA 2CHBD 3EFXD 2HDMA 1FNUA 3J7YW 4QUCA 2XNAC 1HA5A 3UI2A 1TS4A 2B8GA 4DNRB 3I91A 2R61A 2J7ZA 3Q23A 4IFDH 1I3QB 3MFYA 3Q0AA 3HRZC 4X3SA 5C3WA 3BS1A 1I4XA 4IQZA 3QOLA 3FMCA 4G7HC 5CV4A 2AQ1B 2NZ1D 1PZKD 3T53B 4KY6A 1AN8A 4E6IA 1BR9A 4HSPA 3SE0A 5E4XA 1ZYRC 4RH6A 2XIWA 3VA7A 2F0HA 2F0QA 2EY1A 3I3CA 3P1HA 1CQFA 2PPBC 4QCLA 3D4WA 1BDOA 1EQTA 3ONAB 1WCMB 2V4DA 2SNMA 3M7GA 3I4LA 2JYOA 3DMUA 4XQQA 4KTAA 1AZPA 1KAAA 3MA2B 4U673 3D6CA 4QUFA 1QCBD 2WINB 3C2PA 1DONA 1XX8A 3W2DA 1B44D 3RMHA 5JOBA 3TDQA 2SNSA 1D5MC 3NXWA 4HSVA 2F3WA 3S2DB 4N9TA 3SHLA 2RKSA 4IUVA 1IKLA 4ZLTF 1JC7A 4ILWA 2F0JA 3I4NB 2B2TA 2JP1A 5T1GA 1VDZA 3KLRA 5CBEE 5IIFA 5DNFA 3VR5A 4QMGA 2C9OA 4DAPA 2OF1A 2J0TD 2KECA 2E75C 2E2HB 4DAVA 3PO3B 2FJ2A 4KHVA 2QEJC 1QJOA 5DAUA 3PV0A 2O2LD 4F7XA 4UDUC 1H9SA 1CZWA 3BDLA 5KYLA 1U4RA 3FVQA 3LWUA 5FK9C 3VYUA 2AQ3B 3A56A 3M3YB 1D5ZC 2EJGC 2A6HD 4RHSA 3DWPA 2KA7A 1ICWA 2B2UA 4RGNA 1GHKA 2KJXA 1ILQA 1AP0A 3BVMA 4MN3A 2JEBI 2EYJA 2KVMA 1PDQA 5C0XJ 2NYZD 3HG9A 1BO0A 2F0OA 3K6OA 5IODA 2K05A 2WAQB 5A2QE 2PW5A 5EQ0A 4X3UA 4F8MA 2YYZA 4BA1I 4K8JA 1SYBA 2L9HA 1CHQD 4Q5VA 3MXPA 1LT3D 1QNUA 3K5NA 4IFDI 3KLSA 1WTRA 2FINB 4L63B 1OXUA 4ZKCB 4QF4A 1JOQA 2BOSA 4RGOS 4BS9A 1Y1WB 1SYCA 2F03A 2R3ZA 4ZYSA 4DFAA 4XQNA 1BCPC 4CJ2C 2R93B 1GJXA 3K5LA 1V43A 3NP8A 2VB2X 2EDGA 1WVLA 3S1MB 3TZDA 3GTMB 2X69A 2KUMA 2BA1A 2F0KA 5IT9E 2PO4A 1DD2A 1Z47A 5C4JB 5LHY1 1PYWD 3EA6A 4IUUA 1SNQA 3NK9A 1STNA 4IUNA 4WJWA 4WRDA 2B2WC 3A55A 2K01A 4ZUJA 3Q22A 4WORA 2B63B 4DN4M 2NWGA 3NPPA 4B9XA 2VB3X 3BYYB 4KKUA 3KK7A 2PYKA 1F9SA 4Y7NB 1RTOA 4BWGB 3WOEA 1RHPA 2HUGA 4KMUC 1HCZA 4ZK9B 1Y8OB 2G9DA 3I8ZA 3OWFA 2WV6D 3H6MA 2IX3A 4RFBA 1QG7A 5I2YA 1K8OA 3S15B 3V2TA 2F4IA 4C1NK 3HOXB 2NVYB 5G3LD 5IOCA 4C3JB 1SE2A 3R2IA 4H0LC 5CR3A 3GTJB 4KKSA 1TT2A 2F3VA 1NUCA 3VR3A 5CV6A 1KDAA 4R8IA 1PXUA 1PTOH 3EJIA 5JAVA 2NN6I 4KI0A 2IPKD 5ELEA 1H9SB 2NVQB 1LV9A 5C0XI 4DF7A 2Q8RE 2ICEC 1XXGA 4IUTA 3BVZA 2B2VC 3MTSA 2OEOA 4J1MA 1ZYRD 4C2MB 4RGTA 2LKVA 2DNEA 3VYSA 2TSSA 5IGBA 1ESFA 1X3QA 1S5CD 5LL6X 1FNWA 1CT1D 2MUYA 1ILPA 1E0BA 1Q3LA 1Y69U 4ID6A 1JB3A 5I4DA 5FO7B 5CYUA 1DOMA 5M3FB 4DK0A 3GQBA 3A7AB 4OHJA 1C8CA 1II3A 1XYIA 1MSHA 4PMCA 4G7OC 2D5DA 4Q0FA 4HMJA 4KV6A 2ZXOA 2O4XA 4C3HB 1CZGA 5A2QL 1A2TA 5AFWA 1EWCA 4C3JG 1RODA 2F0DA 3A8IE 4H7BA 3LX0A 4P2CB 4A3MB 4BY7B 1MI2A 5C3XA 2BE5C 3ND9A 3GP7A 2SOBA 2Z8LA 5K36H 1STGA 1S5ED 2L5TA 1I4HA 3C3LA 2RSOA 1PRTC 3GV6A 4X3TA 3HOUB 1UUPA 3OHXC 1TVXA 1SEBD 3R2TA 1U4MA 1KTKA 2FMMA 2AUJD 3DEPA 3CRKC 2M2LA 4FVMA 2K28A 1UAPA 1M8AA 4O1NA 2ICIA 2A6EC 4J8QA 4DA2A 3KBGA 3GV3A 3NWTA 5IGCA 4FO2A 4HCEA 1DZ1A 5EKKA 4K6DA 2JA6B 3TSSA 1B50A 3TBIB 1RF2D 1Y8PB 2EY6A 1STHA 2E74C 1EY4A 3EVQA 1PFBA 4ZKBB 2WP8J 3A8KE 3PUYA 1DOKA 1MD2D 1H9RA 3BDOA 4FF3A 1RKNA 5JEAG 2RSNA 2PZUA 1I4PA 2K1BA 5I6YA 5EPLA 1BQQT 4C3IB 1RJTA 3J81L 2B2YC 2VXWA 1QOHA 1QE6A 3OIPA 3HOWB 3GTKB 2OXPA 1JQYD 2NB0A 4RAUC 3FPUB 2WKDA 3RUZA 1SE3A 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Z A;  3EJI A;  5CV7 A;  1EYA A;  3BDC A;  1STG A;  1IHZ A;  5JAV A;  4K5V A;  5C4H A;  1EY8 A;  4RKB A;  5IGE A;  3ITP A;  2PZT A;  5E1F A;  4QF4 A;  5C3W A;  4EQP A;  1JOQ A;  4QMG A;  1A2U A;  5DEH A;  3HEJ A;  3SK4 A;  3SK8 A;  2F0M A;  1A3U A;  3QOL A;  4KY5 A;  1SYC A;  1TR5 A;  2EYL A;  2OF1 A;  3DHQ A;  4HTH A;  3R3O A;  3SK5 A;  5CV4 A;  4DF7 A;  4K2K A;  4DFA A;  4DU9 A;  1EY7 A;  5C5M A;  2KQ3 A;  4QB4 A;  3OSO A;  3D8G A;  2M00 A;  3NP8 A;  3C1E A;  4KY6 A;  4E6I A;  4KHV A;  3TP7 A;  4N9P A;  4NKL A;  2F0V A;  2EY5 A;  5HUR A;  2EYM A;  1A3V A;  1STY A;  1STA A;  2PZW A;  4J6H A;  3OMG A;  3OMC A;  5DAU A;  4B9W A;  4F7X A;  4ODG A;  3T16 A;  4EVO A;  2PQE A;  2OEO A;  5IGG A;  2HQE A;  5C5L A;  4J1M A;  2F0K A;  4LAA A;  3HZX A;  5KIX A;  1EYC A;  2EY2 A;  4KJN A;  3P75 A;  4K14 A;  3VA5 A;  2LKV A;  2EYF A;  2F0U A;  2F0H A;  3BDL A;  4NMZ A;  3TP5 A;  2F0Q A;  4DGZ A;  5KYL A;  2PW7 A;  4OL7 A;  3ERO A;  1KAB A;  1SYD A;  3MZ5 A;  4K5X A;  5IGB A;  5IGC A;  5IGF A;  2EYP A;  2EY1 A;  4YIJ A;  3D4D A;  3P1H A;  4K6D A;  5EKK A;  5KEE A;  4KD4 A;  5CV9 A;  5M9O A;  3D4W A;  5C6A A;  1SNQ A;  4IAL A;  3NK9 A;  3MEH A;  1STN A;  4HMI A;  4IUN A;  4WRD A;  4KY7 A;  1ENC A;  1EY0 A;  4KD3 A;  2EY6 A;  1STH A;  2EYO A;  2F0I A;  1AEX A;  1EY4 A;  1SNM A;  4ID6 A;  3EVQ A;  3TP8 A;  1SNP A;  4ZQ3 A;  1EQV A;  1EZ6 A;  4ZUJ A;  2QDB A;  1EY9 A;  5KGU A;  5CC4 A;  5EKL A;  3T13 A;  1EY6 A;  1EYD A;  2SNM A;  1F2Y A;  4WOR A;  5NUC A;  5KRU A;  5I6W A;  2NUC A;  1NSN S;  1F2M A;  4MIU A;  2F0N A;  3DMU A;  4B9X A;  2WAC A;  4KTA A;  5IGD A;  5CV5 A;  1JOR A;  4K5W A;  2F0P A;  4RKL A;  1KAA A;  1RKN A;  1SNO A;  1STB A;  2PYK A;  3D6C A;  1A3T A;  2EYJ A;  3MHB A;  4K2L A;  4PNY A;  5I9O A;  4ME5 A;  5EGT A;  3SXH A;  4KJO A;  5C4Z A;  5E3F A;  2KHS A;  5KYI A;  2F0F A;  2PZU A;  5CGK A;  1SND A;  2EXZ A;  1KDB A;  4ZUI A;  3TME A;  3QB3 A;  2RDF A;  1II3 A;  2EYH A;  2F0E A;  2F0O A;  4TRD A;  3PMF A;  4PMC A;  5ISR A;  5IOD A;  4HMJ A;  3SR1 A;  3OWF A;  3H6M A;  1TQO A;  5CV8 A;  4KV6 A;  1ENA A;  3TP6 A;  5I6Y A;  2RBM A;  5J39 A;  3NQT A;  4I65 A;  2F0L A;  5J1Z A;  2O4X A;  2F0G A;  3S9W A;  5J22 A;  3NHH A;  1KDC A;  4G57 A;  5I9P A;  3V2T A;  2PW5 A;  3C1F A;  3ERQ A;  1SYG A;  3E5S A;  4F8M A;  5JOB A;  5IOC A;  1SYF A;  1A2T A;  2F0W A;  4K8J A;  4PMB A;  1SYB A;  2F0D A;  2SNS A;  3QOJ A;  3NXW A;  4H7B A;  2F3W A;  3MVV A;  4S3S A;  3NUC A;  2ENB A;  3LX0 A;  5CR3 A;  3MXP A;  1EY5 A;  4N9T A;  1JOK A;  4K8I A;  4NDX A;  3SHL A;  5HGT A;  2RKS A;  4EQN A;  1SYE A;  1TT2 A;  2F0S A;  4R8N A;  2OXP A;  2F0T A;  2F3V A;  1NUC A;  4EQO A;  2F0J A;  1U9R A;  4IZ8 A;  5C3X A;  5K5P A;  5CV6 A;  1KDA A;  4NP5 A;  1SNC A;  5IIF A;  3RUZ A;  5F2D A;  3U9O A;  1JOO A;  2SOB A;  3SK6 A;  1EZ8 A; 
#chains in the Genus database with same CATH topology
 4MHE A;  5ELF A;  1O7I A;  2LS0 1;  2KOL A;  1WTH A;  5BN4 A;  2ZXP A;  5JPN C;  2X6L A;  4A3F B;  1IYV A;  5C3E H;  1D6E C;  4NB3 A;  4DR3 L;  2JA8 G;  1C9O A;  1K83 B;  5M3M G;  5DLQ E;  1Z6H A;  4DV7 Q;  3HOZ G;  2RQX A;  1M90 C;  1AFP A;  3MAQ A;  2UXB Q;  1EIF A;  1LT4 D;  3D8G A;  2M00 A;  1BBX C;  1FJG Q;  4N8X 1;  1BCP D;  2CW0 C;  5GRO A;  4B3S L;  4O2D A;  2PZW A;  4XYQ A;  3OMG A;  1HNX L;  3S17 B;  3A5U A;  3JAM i;  4YY3 Q;  3NBH A;  2M9V A;  4DV4 L;  1A6X A;  3J80 i;  2O5J C;  3CF5 A;  4K5X A;  1QZG A;  5KIX A;  5JEA J;  4YIJ A;  1I6H H;  4KD4 A;  4JG2 A;  2D0P A;  4DV7 L;  1EIH A;  4KY7 A;  1KLU D;  2CFM A;  3CQZ H;  4OWT B;  4EQ5 A;  2UXB L;  2I07 B;  4PQX A;  4RA8 A;  3CU7 A;  3OPO A;  3SVM A;  3KFU A;  4K6L A;  1FJG L;  4AQY Q;  2R7D A;  3RLF A;  1FNV A;  2IJ0 A;  1IL8 A;  3IL8 A;  5DM7 3;  4IPD A;  3T4A C;  2NUC A;  1T5X D;  1G91 A;  1CTM A;  4DAM A;  4YY3 L;  1XMQ Q;  2K7V A;  2PI2 E;  1SNO A;  4KLK A;  4PNY A;  5EAY A;  1HH2 P;  4ME5 A;  5EGT A;  2Q2I A;  2RHQ B;  4A93 H;  3MWY W;  2VQE L;  3K57 A;  4TRD A;  2F3I A;  2XGT A;  1C48 A;  3FRP B;  3KF6 A;  1CHP D;  3CCQ A;  1CQV A;  1GOZ A;  1DCZ A;  1T9H A;  3BG3 A;  4A3L G;  1JMC A;  2DGY A;  5G3L F;  1E7Z A;  3G7L A;  4AQY L;  2Z4H A;  1O80 A;  1HUN A;  1SDF A;  3FKI B;  4C3I G;  3AFQ A;  4X64 L;  2K52 A;  2ASB A;  4POF A;  1EIG A;  2RVL A;  4S3S A;  2Q2U A;  1Y8N B;  4LF4 Q;  3DWQ A;  4H13 C;  2K5D A;  1YZ6 A;  5AJ3 Q;  3DUZ A;  3S14 H;  4A3K G;  1ET6 A;  4X65 Q;  1ONL A;  2YTX A;  2Q8T A;  1C4Q A;  3NEM A;  1TWF B;  4UAI A;  1FD7 D;  1PZI D;  4EQP A;  3D6W A;  2BA0 A;  1A2U A;  1ESR A;  1CK1 A;  4A3F G;  4OGQ C;  3RNU A;  3LWE A;  5TSS A;  1K0R A;  1KNA A;  4DU9 A;  3SK5 A;  4OO1 I;  2KQ3 A;  1BBU A;  3U58 A;  3NSW A;  4HID A;  4LF4 L;  3C1E A;  1NAP A;  4B08 A;  3K58 A;  4IOA A;  2JA7 B;  1A3V A;  3STB C;  5AJ3 L;  2HHH Q;  1PH5 A;  2PQE A;  4X65 L;  5IGG A;  1AE2 A;  1PFN A;  1FGU A;  1EYC A;  2G5D A;  2A73 B;  3VA5 A;  3CKI B;  2A69 C;  2NN6 H;  3TP5 A;  4A3J B;  2UUA Q;  1YJ9 A;  5C0X H;  1D2B A;  4IOC A;  2I0Q A;  2B2W A;  2I46 A;  1JJC B;  1EY0 A;  4I7Z C;  4L5Q A;  2E2I B;  3WWV A;  2ZXR A;  3LGJ A;  5EBD A;  1TY0 A;  1I3Q H;  2X6G A;  1VQP A;  5LMN W;  3KDF A;  2HHH L;  2L55 A;  1IBK Q;  4G4K A;  3K7U C;  4OXP A;  1VQG A;  3PO2 G;  3MHB A;  1A3T A;  1SMY C;  3Q24 A;  1HR0 Q;  3SXH A;  4I7A A;  3A7L A;  5CGK A;  1RTN A;  5M5W B;  1KDB A;  2RDF A;  1BNZ A;  4R4T A;  4APV A;  3ICE A;  4NXM Q;  1D8L A;  1PTO C;  2L0C A;  4JI8 L;  1PH8 A;  1ENA A;  3NQT A;  4I65 A;  5IYB H;  4XXE A;  2XTI A;  2NZH A;  1HZ9 A;  1ZEQ X;  3NTI A;  2WII B;  3QOJ A;  1W6J A;  1CI3 M;  5COR A;  1OXV A;  4JBK A;  1EU4 A;  2AKW B;  2OT2 A;  2Z6K A;  4EQN A;  3K59 A;  3ZJY C;  4R8N A;  1HR0 L;  1VQB A;  3ULL A;  5T1I A;  2NTS A;  1WCM H;  2JN4 A;  2BE5 D;  4NXM L;  3CC4 A;  1I4R A;  4UP9 A;  2YU9 H;  2PZT A;  5E1F A;  3WDN A;  4U68 A;  2DNC A;  1JIC A;  1B9M A;  2R7Z B;  1PRT D;  2I5H A;  2IX0 A;  4X66 Q;  4N8F A;  1YEZ A;  3OSO A;  3IKJ A;  2Q2T A;  1NR4 A;  4HJA A;  3MXU A;  2N3S A;  5HUR A;  1MJE A;  1STA A;  2DN8 A;  2L4N A;  4EVO A;  1S5F D;  3GTL H;  1IW7 C;  5BN3 A;  3AEV A;  1G8Z D;  4YWL A;  2A6E D;  1O7Z A;  3MC0 B;  3D4D A;  3NE5 B;  3PF4 A;  2IT1 A;  3A8J E;  2HIV A;  3S2D H;  3M9B A;  4BBS B;  4X66 L;  4JI5 Q;  1LLR D;  3DM3 A;  1ENC A;  4MTK A;  4R4Q A;  4CJ1 B;  3I4N H;  4A3B B;  1WTO A;  5GAD C;  1AEX A;  1IKM A;  2QDB A;  1ML0 D;  5M5Y B;  2LXK A;  2XWB B;  5FO9 B;  3KF6 B;  4R4I A;  4TKO B;  5ELB A;  3HS0 C;  3X3N A;  2WAC A;  5CV5 A;  1RDP D;  2WFW A;  2Z9H A;  4NXN Q;  1VQ4 A;  4JOI A;  1A0I A;  5C4Z A;  2H1E A;  4GLX A;  1LAB A;  2LMC B;  2E2H H;  4H02 A;  4ZUI A;  3R93 A;  3PO3 H;  1SE4 A;  1DM0 B;  2F0E A;  1VQ9 A;  1SBB B;  3EBE A;  4JI5 L;  1EU3 A;  2B2T C;  2VQF L;  3SR1 A;  1KLG D;  5JJL A;  1Z7T A;  3KYH C;  2IL8 A;  3FDT A;  3S9W A;  5J22 A;  1JWS D;  1HZB A;  3C1F A;  1MKH A;  2GVA A;  1KD1 C;  4JC0 A;  5C4X H;  4DNI A;  1ZXT A;  1QNK A;  1LTG D;  1SRO A;  4NXN L;  1WTP A;  1OXS C;  5HGT A;  1HTP A;  3M3Y H;  4ZCK A;  2B3G A;  4C1N I;  1VCI A;  1XTC D;  4LUZ A;  3K7A B;  4NP5 A;  3U4Z A;  2K04 A;  1UE1 A;  1HTL D;  2IWH A;  3TS0 A;  2N88 A;  4GN4 B;  3BDC A;  3F1Z A;  1M1K C;  3J81 E;  1MBY A;  3BZC A;  1UE5 A;  4AYB B;  2VNU D;  1V1P B;  1A3U A;  2KHJ A;  2MFI A;  2MP1 A;  1EOV A;  2UU9 Q;  5CBA E;  3S16 B;  1BCP F;  2PMZ B;  1SR3 A;  3N52 A;  1PH9 A;  2IHE A;  2JA5 B;  1LM0 A;  2K03 A;  2L15 A;  2EYM A;  5KNB A;  1STY A;  2MHV A;  3OW7 A;  2CW0 D;  2UUC Q;  1N34 Q;  4JV5 Q;  4XTC S;  1HZA A;  1K3R A;  3KDF B;  3NEN A;  5EJW A;  3E0J A;  2PW7 A;  1VQI A;  3BVG A;  5GAH C;  1SSO A;  2I5M X;  1G6P A;  1EEF D;  3A74 A;  2UU9 L;  1YI2 A;  3J7A F;  3CCS A;  3VR4 A;  4G7Z C;  4A3B G;  1O78 A;  4KK7 A;  1V8Q A;  5COY A;  1EY6 A;  1FYC A;  1HFG A;  2EOT A;  1SAP A;  3OIQ A;  2K6A A;  1NSN S;  1VQL A;  2UUC L;  1N34 L;  1Y1W H;  1Q46 A;  4JV5 L;  2ZJR A;  1PFM A;  4K2L A;  2EE1 A;  3HP3 A;  5I9O A;  1GUS A;  2XWJ B;  2J4X A;  2C35 B;  1PH2 A;  1EIY B;  3TME A;  4A3I G;  2R93 H;  2G9H D;  5KND A;  1E1O A;  1F9R A;  1PH3 A;  4LJZ C;  4RCO A;  1TWH B;  2KED A;  2E2D C;  4FXK C;  3GTM H;  4JVZ A;  1B8A A;  3BJU A;  2YTV A;  1OXX K;  5IE8 A;  4RGM A;  2B2Y A;  4XYO A;  3QIA A;  4YCW A;  3SGI A;  3VR6 A;  1RIP A;  4ABN A;  3ERQ A;  3QG1 A;  4P71 A;  3L0O A;  1GHJ A;  5C4J H;  4KHP Q;  4IJL A;  2PCF B;  1GXD C;  1EY5 A;  2KEN A;  3TN2 A;  1PYS B;  2F0S A;  3KUP A;  3CHB D;  3KJP A;  1MHW C;  4BXX G;  3OTO Q;  2H5X A;  1Q1B A;  1XNR Q;  4IPG A;  4JI4 Q;  1BUV T;  3NQI A;  3U9O A;  2EVB A;  1PH6 A;  3FP9 A;  1IHZ A;  1PZJ D;  4AYB E;  2B63 H;  1YNN C;  3TRZ A;  4L6T B;  3CXC A;  4LFC Q;  5LMN Q;  1VF5 C;  3SK4 A;  3SK8 A;  4AYB G;  4HN7 A;  4Y7N H;  1YJN A;  1TS5 A;  3GTP B;  1CFM A;  2A68 C;  2MGS A;  1VQ8 A;  1G51 A;  2PMZ E;  3RLN A;  3R3O A;  1JR0 D;  4KHP L;  2RDG A;  5C5M A;  4FF2 A;  1O7Y A;  1S5D D;  1WTW A;  2JA5 G;  1MSG A;  4DK1 A;  1X65 A;  2DUD A;  4N9P A;  3IFD A;  4J6H A;  3OTO L;  4A3G G;  4IUR A;  1N8R C;  1XNR L;  4JI4 L;  3STB D;  5D65 A;  3S15 H;  3CCM A;  5FO8 B;  5E7N A;  1Q81 C;  3HOX H;  2JA8 B;  3S1N H;  2UXD Q;  2NVY H;  3G6E A;  1U4L A;  1R9T B;  4NMZ A;  4C3J H;  2MJ8 A;  4GOP A;  5M3M B;  3GD7 A;  3I2Z A;  3HOZ B;  5LMN L;  2A69 D;  2RA4 A;  3GTJ H;  3TS2 A;  2HCC A;  1G2S A;  3PIO 3;  2A19 A;  3E0E A;  2KCT A;  4OO1 H;  4GN5 A;  4QJF A;  5C44 H;  1G29 1;  2EYO A;  1SNP A;  1GM5 A;  1S4Z A;  1EFI D;  4HCS A;  2L11 A;  5EKL A;  3F2D A;  1X32 A;  3PIP 3;  4JI2 Q;  1F2M A;  4K0K L;  2F0N A;  1E24 A;  1CSQ A;  2NVQ H;  1JOR A;  3K0X A;  4OIJ A;  2UXD L;  3D3R A;  1H95 A;  3Q6S A;  1L1O C;  2ZM6 L;  4OIK A;  5KYI A;  2F0F A;  1SMY D;  1SND A;  4CHT B;  2LY7 A;  2BDO A;  1OO9 B;  1YNJ C;  1UEB A;  1PA6 A;  3H91 A;  3SEB A;  2NVT B;  5CV8 A;  5IY0 A;  3NTK A;  3S2H B;  4UP7 A;  3TP6 A;  3T56 B;  3CCL A;  1IL2 A;  5J39 A;  2FXQ A;  1PTO D;  4C2M H;  1D1I A;  2F1M A;  4V0B A;  2UXC Q;  2K32 A;  3CC2 A;  3ULP A;  3G71 A;  4P74 A;  3VDY A;  2Y0S G;  4JI2 L;  2CQO A;  4LUV A;  2R92 G;  3RZO B;  3QJY A;  1MIU A;  3NUC A;  1OXT A;  3R8B A;  1C7Y A;  1RD9 D;  3CP0 A;  1DOL A;  1KXL A;  4HR7 B;  3I4O A;  1NMF A;  3VYR A;  1LO5 D;  2ID0 A;  1F2Z A;  5FOB B;  4DV5 Q;  5EKI A;  1SFO B;  1GUT A;  2UXC L;  5M3F H;  5JEA H;  2ATW A;  1W3S A;  4FF4 A;  3M7N A;  1TR5 A;  2EYL A;  4MTN A;  4UHV A;  4L5S A;  1B3Q A;  3AU7 A;  5EPJ A;  1WD1 A;  4JCV E;  2QGQ A;  1K8M A;  2ALY B;  3N6R A;  5JVG 3;  2CWP A;  4QB4 A;  4CDF C;  2N55 A;  4FXG C;  3L2P A;  4X3K A;  4A3K B;  3M85 A;  4IN3 A;  1PLF A;  4B9W A;  1ZKO A;  4A3E B;  3AYH B;  2KCC A;  3G6J B;  4ODG A;  4OEM B;  1H9J A;  2HDL A;  4C3H H;  2NBF A;  1JWM D;  1S72 A;  4LUO A;  4DV1 L;  4DV4 Q;  4OON A;  1IW7 D;  3URY A;  4YHH Q;  5C3E G;  4IUP A;  4DV5 L;  1KAB A;  1HRJ A;  1KNE A;  1QVF A;  1SJE D;  2MPM A;  5KEE A;  1BOS A;  1HZC A;  5CV9 A;  1TS2 A;  4OEL B;  4A3M H;  4BY7 H;  4TVA B;  1U4P A;  3I73 A;  2B8F A;  2XSC A;  1EQV A;  4PMW A;  4JI0 Q;  4CGY B;  3J81 c;  4IUQ A;  3H94 A;  1XWE A;  2VUM B;  4IFD G;  1G2T A;  3KF8 B;  4MIU A;  5FLX E;  1PH7 A;  2AWN A;  1DGS A;  1STB A;  1Q90 A;  3T51 B;  3UDI A;  4YHH L;  3HOU H;  1K73 C;  1DJR D;  2VQE Q;  1HJP A;  4O42 A;  4WFN 3;  4X62 Q;  1GUW A;  2H4O A;  2XRQ D;  3P20 A;  1PH4 A;  2XVS A;  2OQ0 A;  3J7A V;  2K33 A;  4OX9 Q;  2L1B A;  1PMR A;  1X3F A;  2XRS D;  4JI0 L;  2XN9 C;  1WTX A;  3T1Y Q;  3X3M A;  4X64 Q;  5FLM H;  3PO2 B;  1SYF A;  5D3I B;  4AIM A;  3K0Y A;  4FP5 D;  4FNF A;  3MVV A;  2JA6 H;  2K5N A;  4K8I A;  1IZ6 A;  5M5X B;  1WTV A;  4A93 G;  1U9R A;  4IZ8 A;  4X62 L;  4LMQ D;  1D5X C;  1LTI D;  1HQM C;  4GS3 A;  3ER0 A;  1HQR D;  4OX9 L;  1EZ8 A;  5DM6 3;  1EYA A;  1Y14 B;  1CA6 A;  2FHT A;  4RKB A;  1NE3 A;  1HA6 A;  2HQL A;  3T1Y L;  2E2J B;  3K5M A;  4ZRZ A;  2D9U A;  2FFK B;  1D7Q A;  4GOP B;  3CCJ A;  1S40 A;  4K2K A;  1BXT A;  3S1R H;  3U50 C;  1JWU D;  1KIX A;  1SJH D;  5BR8 Q;  4NKL A;  3O13 A;  4MNO A;  1WTQ A;  4HIM A;  2RCN A;  4GZY C;  3RN5 A;  2A74 C;  3JC6 6;  4IFD J;  4A3E G;  5C5L A;  2YU9 B;  4JBJ A;  4C3I H;  2HT1 A;  1JE4 A;  4KJN A;  2JJQ A;  2RCF A;  4DAY A;  3I70 A;  3L3O C;  4OL7 A;  3ERO A;  2K5W A;  2D62 A;  1SYD A;  2MNA A;  1FR3 A;  2QCP X;  4C56 C;  3HOW H;  4WJ3 M;  3GTK H;  3H0G B;  1YIT A;  4A3C H;  2CCZ A;  1UE7 A;  5BR8 L;  5GAG C;  3TP8 A;  1B3A A;  3MXN A;  3PUZ A;  3GTL B;  1NCV A;  1VS0 A;  2EJF C;  1V1P A;  2VUM G;  3TRE A;  4A3F H;  5IYD H;  1ET9 A;  4IO9 A;  2PNR C;  1K83 H;  1UNS A;  1E2Z A;  1A8V A;  1VQJ A;  2F0P A;  2NN6 G;  3TZU A;  2AMC B;  5C0X G;  2BCO A;  3M4O B;  1JT8 A;  4RHR A;  4POG A;  4HAE A;  1I4G A;  1PHJ A;  3HOV B;  4JI8 Q;  4PV1 C;  1QUQ A;  4KN7 C;  3S17 H;  2NVX B;  1AW7 A;  3AQQ A;  2RBM A;  1ASY A;  1TWG B;  5J1Z A;  1LTT D;  3H3V I;  1HFN A;  1O7L A;  1EOT A;  1VQM A;  3J7Z C;  4PMB A;  5JJZ A;  1V1O A;  2Z4I A;  2EPB A;  4PZ7 A;  4NDX A;  1JOK A;  2KEE A;  3JAM L;  1EEI D;  2F0T A;  3OOC A;  4EQO A;  1AZQ A;  1LYL A;  1SNC A;  3J80 L;  1YJW A;  2F4V Q;  2N8N A;  3AB9 A;  5CV7 A;  4CDC C;  1D1K A;  3BYT B;  4Z9C B;  1N9W A;  1XMO Q;  2FMC A;  1YNN D;  4A75 A;  4DV6 Q;  1TY2 A;  4KY5 A;  1KQS A;  5C4X B;  3LNN A;  3D4R A;  1TII D;  2A68 D;  3FEW X;  4JI1 Q;  1QIL A;  4DKA C;  1A15 A;  1V1Q A;  5I2X A;  4YWK A;  2K5Q A;  2AQ2 B;  2AHO B;  2EY5 A;  4B3T Q;  1HHV A;  4A4I A;  2BDN A;  1IBM Q;  1LT6 D;  1WCM G;  1WOC A;  1K28 A;  5IP7 H;  1T5E A;  4LFA Q;  2F4V L;  5LL6 S;  3FKI H;  2EYF A;  1P16 A;  2JSO A;  4BY1 B;  1QB5 D;  4XT1 B;  1XMO L;  2BH8 A;  2PNH A;  5ELC A;  4DV6 L;  1GKH A;  1ENF A;  5M9O A;  4DXG A;  1OTC A;  4TQU S;  1J8I A;  1I50 B;  3H0G G;  4JI1 L;  3P7J A;  1YBY A;  1G6Z A;  1LUZ A;  2B2V A;  1GUN A;  1Q1E A;  1PH1 A;  4FYD A;  3I90 A;  1PTO B;  3PUV A;  4B3T L;  1B2T A;  2K5V A;  1TWF H;  2YV5 A;  5I6W A;  1IBM L;  4XT3 B;  1TWC B;  1Y1V B;  5FLX L;  4LFA L;  2LFN A;  1K9M C;  3W3A A;  2KHI A;  1MGS A;  1Q8I A;  1B53 A;  1RL2 A;  4KHZ A;  2NTT A;  5E3F A;  1CM9 A;  2EXZ A;  3D31 A;  3PGZ A;  2VQF Q;  4RMF A;  1R4Q B;  3I4N G;  1PTO F;  3HKZ B;  2JA7 H;  1M4V A;  3M4Y A;  1TQO A;  1YNJ D;  3HOV G;  1VMP A;  3CD6 A;  1HXY D;  2F0L A;  3NHH A;  1KDC A;  5EPK A;  1EFW A;  3GTG B;  2N78 A;  3E5S A;  2HCI A;  4A3J H;  3I4M B;  2RDH A;  1TU2 B;  2ENB A;  4TSS A;  4A3I B;  2ZTC A;  3E3X A;  5D14 A;  4QIW B;  4X6A H;  4P72 A;  2E2I H;  2ZJQ A;  4DV3 Q;  3EQL C;  4DK6 C;  4PG3 A;  4ZAI A;  1I6V C;  5A35 A;  3SK6 A;  3NBI A;  2B39 A;  3DM1 A;  3V05 A;  2A5H A;  5IGE A;  4HJ7 A;  3FHW A;  4NW2 A;  3KLS X;  5HGQ A;  2EQS A;  1DXM A;  2F0M A;  2E8G A;  4DAY B;  5C4X G;  1W6K A;  4JBW A;  5EBC A;  1Q82 C;  2JE6 I;  1TKW B;  4HTH A;  3PUW A;  3BZD B;  2Z1C A;  3U9S A;  1QVC A;  5IWA L;  1VQN A;  2QW7 A;  4DV0 Q;  4DUY L;  1BCP B;  4QGU A;  4BBR B;  2QKI C;  1TS3 A;  1E2W A;  4DV3 L;  1H9M A;  2DJF C;  1PV4 A;  3CMA A;  4HED A;  4FDB A;  4CJ0 B;  2ZT9 C;  3HZX A;  3MXN B;  2EY2 A;  3P75 A;  4K14 A;  2F0U A;  4LWC A;  1WJJ A;  1TWA B;  2JXM B;  2KCM A;  3HGB A;  4LK1 C;  4BA2 I;  1QWY A;  2D2C C;  4BY1 G;  2OTL A;  1CA5 A;  1SN8 A;  4LF9 L;  4RCN A;  3OWE B;  2CQA A;  1KRS A;  4CBV A;  3L7Z C;  3EIV A;  4FXD A;  2QF7 A;  1SLJ A;  1E2V A;  3GTQ B;  1H9K A;  1SNM A;  4GNX A;  4DV0 L;  4A3G B;  4ZQ3 A;  1EZ6 A;  2RHS B;  5KGU A;  5CC4 A;  2EJM A;  1QUQ B;  1UEA B;  3H3V C;  1F2Y A;  3K5O A;  2B2U C;  1CKN A;  1UWV A;  2WAQ G;  3S1N B;  1E1T A;  4DR1 L;  4K5W A;  2R7Z H;  3UE1 A;  4RKL A;  1Y1V G;  3DWA A;  3MFG A;  1L1O A;  1GO3 E;  4KJO A;  4F88 A;  1B7Y B;  2Z6K C;  1CUK A;  2SEB D;  3HKZ E;  5BN5 A;  2C5C A;  3RZD B;  1Q8K A;  5C44 B;  1FGB D;  3PMF A;  4J15 A;  3T1H Q;  5JVH 3;  5JPM C;  2HIX A;  5D3D A;  3HKZ G;  4KN4 C;  4ULL A;  3W1G A;  4A3D B;  3D0F A;  3QWN A;  4GLA C;  1JB7 A;  4V19 0;  2F0G A;  3ULJ A;  4G57 A;  2A8V A;  1SYG A;  1B9N A;  2MQH A;  3CCV A;  4R4C A;  2QA4 A;  2V1C C;  1Y1W G;  2F0W A;  3I4M G;  4R4O A;  2Q2H A;  4R9W A;  1GD7 A;  3HOY B;  4BBS H;  4QIW E;  1SYE A;  1R4P B;  1XPO A;  1RCV D;  4KKT A;  1NR2 A;  4A3B H;  2R93 G;  3ND8 A;  3FPP A;  1JCK B;  3CPF A;  4FF1 A;  1KHI A;  3NWS A;  5F2D A;  3A5Z B;  5M5Y H;  2DY7 A;  3IRB A;  1JOO A;  3KF8 A;  3T1H L;  3S1M H;  4DV2 Q;  1JE5 A;  4K5V A;  1EY8 A;  3MXG A;  3ITP A;  1HNZ Q;  3HEJ A;  2Y0S B;  2R92 B;  3MEF A;  2PQA A;  1FL0 A;  2E76 C;  4LW1 A;  3DEO A;  3J81 i;  4HIO A;  4HJ9 A;  1L2F A;  2SDF A;  1Q7Y C;  5IP9 H;  3S1Q B;  4GKJ Q;  4P75 A;  3WOF A;  4QY7 A;  3OMC A;  1XNQ Q;  4JYA Q;  4BBR G;  1VQO A;  1GUG A;  2OTJ A;  2CVR A;  1LTB D;  1HUM A;  4PZ6 A;  1X3P A;  4M1U B;  2B63 G;  1IYU A;  3NTH A;  4DV2 L;  4UY8 C;  1E22 A;  3F2U A;  1HNZ L;  2JEA I;  1Q12 A;  3MZ5 A;  4JOI C;  3IAY A;  2N49 A;  1F9P A;  3E6Z X;  3OYY A;  3C46 A;  4IAL A;  4HMI A;  3GTO B;  2A6H C;  1F2L A;  3K7A H;  3V96 A;  4EGV A;  4GKJ L;  2TMP A;  3U4V A;  1EYD A;  4K0K Q;  1XNQ L;  2EZV A;  4JYA L;  5K36 G;  2MO1 A;  5IYC H;  4CKB A;  5C3E B;  1VQ7 A;  1LT5 D;  1HNW L;  3VYT A;  1J9O A;  3I56 A;  3QR8 A;  1NY4 A;  2ZM6 Q;  3K80 C;  3S16 H;  3W1B A;  1N33 Q;  2JA5 H;  1LTA D;  2EYH A;  1WD0 A;  1VQD A;  5ISR A;  4OO1 G;  5C44 G;  2Q8I B;  2AUK A;  1S5B D;  3IFT A;  4L8J A;  4A3D G;  3BZK A;  1EL0 A;  2OCE A;  4M8A A;  1GUO A;  2AWO A;  2WB1 B;  3H09 A;  5FJ8 H;  3AMU A;  1YHA A;  1VQH A;  4XDX A;  3ZYY X;  1I6H B;  3HOY G;  1A63 A;  1KC8 C;  3RD4 A;  1N33 L;  3CQZ B;  2HD3 A;  5K5P A;  1LTR D;  2QIL A;  2EXD A;  2JA9 A;  4XQJ A;  3KBX A;  3PF5 A;  2WKC A;  1LAC A;  4XIG S;  2HQE A;  2L12 A;  4DR7 Q;  1L0Y B;  3DXJ C;  1BKB A;  5C4H A;  1F9Q A;  2Y0S E;  2VS1 A;  4GN3 B;  5IT9 L;  3H3V H;  2IHF A;  5DEH A;  2O5I C;  1SXT A;  1F77 A;  3E9I A;  4RWS C;  5KNC A;  1PRT B;  2CH4 W;  3DHQ A;  3A54 A;  2K4K A;  3JAM E;  4DR4 L;  1EY7 A;  1VMC A;  4A93 B;  1HPC A;  3TEH B;  3TQY A;  3PUX A;  3L9A X;  3TP7 A;  1B4O A;  1U0L A;  2F0V A;  3J80 E;  1TWH H;  1VF7 A;  3T16 A;  2ZTE A;  4GNX B;  1X6O A;  4LAA A;  4DV1 Q;  4DXF A;  3I72 A;  1PRT F;  4DR7 L;  5FKA C;  1BF4 A;  4CDD C;  2CWA A;  4DGZ A;  3BU2 A;  1CKN B;  1XTD A;  2IX1 A;  5IGF A;  2EYP A;  5ELD A;  1VQA A;  4CKC A;  2DY8 A;  2B29 A;  1K0S A;  5C6A A;  3S1R B;  1L1O B;  3MEH A;  3HKS A;  5E4W C;  4KD3 A;  1YHB A;  5CMD A;  4H44 C;  2F0I A;  3A0J A;  1L0X B;  3S14 B;  1STE A;  2IW3 A;  3RN2 A;  3GO5 A;  1EY9 A;  5ELN A;  3T13 A;  1DYQ A;  5NUC A;  4CKE A;  5KRU A;  4F87 A;  5L37 A;  1Q86 C;  4C3H G;  4HJ8 A;  5IGD A;  2KCN A;  3GTP H;  1IYJ B;  3CRL C;  2OQK A;  2GA4 B;  4JBM A;  3KOJ A;  2MO0 A;  1I4Q A;  2KHS A;  4JK1 C;  3QB3 A;  1YHQ A;  3M4P A;  4A3M G;  1EWH A;  3VR2 A;  4BY7 G;  4GLV B;  4DR6 Q;  1B1Z A;  1WI5 A;  1LTS D;  3GDE A;  3QO2 A;  4JI6 L;  5I9P A;  5H1S E;  2DJG C;  2JA8 H;  4DNT B;  1R9T H;  2WB1 E;  2R6G A;  5M3M H;  2CHB D;  2VW9 A;  3EFX D;  2HDM A;  3HOZ H;  1FNU A;  3J7Y W;  4QUC A;  2XNA C;  2WB1 G;  1HA5 A;  3HOU G;  2QEX A;  1J6Q A;  3UI2 A;  2PQA B;  4B3R Q;  1TS4 A;  2B8G A;  4DNR B;  1EQQ A;  3I91 A;  2R61 A;  3CW2 C;  2J7Z A;  3Q23 A;  4IFD H;  4LFB Q;  1I3Q B;  4DR6 L;  3MFY A;  3UDX A;  3Q0A A;  3HRZ C;  1YVC A;  4X3S A;  5C3W A;  3BS1 A;  1I4X A;  4IQZ A;  5FLM G;  3QOL A;  4GOP C;  2KBN A;  1EUJ A;  3FMC A;  4G7H C;  4JW0 A;  5CV4 A;  1X9N A;  2JA6 G;  1XPU A;  2AQ1 B;  2NZ1 D;  1PZK D;  3T53 B;  4KY6 A;  1AN8 A;  4E6I A;  4B3R L;  1BR9 A;  4HSP A;  2NVT H;  1Z9F A;  3SE0 A;  5E4X A;  3S2H H;  1ZYR C;  4RH6 A;  1EWI A;  2XIW A;  4LFB L;  3VA7 A;  2F0H A;  2F0Q A;  5J3B A;  5JJI A;  2K5H A;  3RZO H;  3RR5 A;  3H15 A;  2EY1 A;  3I3C A;  3P1H A;  1CQF A;  2PPB C;  4QCL A;  3I55 A;  3D4W A;  1BDO A;  1EQT A;  3CCU A;  3ONA B;  4A3L H;  1X54 A;  1WCM B;  2V4D A;  4HJ5 A;  3CAM A;  4YCU A;  2SNM A;  3M7G A;  3I4L A;  2JYO A;  3DMU A;  4XQQ A;  4KTA A;  1SFO H;  1NNX A;  3PCO B;  1AZP A;  1KAA A;  3MA2 B;  4U67 3;  3D6C A;  1XMQ L;  4QUF A;  1V9P A;  1QCB D;  2JK8 A;  3HOW G;  4QQB X;  4A3C G;  2WIN B;  4A3K H;  4LF5 Q;  5LMU Q;  1CKM A;  2K14 A;  3C2P A;  1DON A;  4A3E H;  1XX8 A;  3W2D A;  1B44 D;  3RMH A;  3AFP A;  5JOB A;  5IYD G;  1WFQ A;  5HY6 A;  3TDQ A;  2SNS A;  1D5M C;  3NXW A;  4HSV A;  2F3W A;  3J7A 5;  3S2D B;  4N9T A;  3SHL A;  2RKS A;  4IUV A;  1IKL A;  4ZLT F;  1JC7 A;  4ILW A;  2F0J A;  3I4N B;  2B2T A;  2JP1 A;  5T1G A;  1VDZ A;  3KLR A;  5CBE E;  5IIF A;  2P5Z X;  5DNF A;  1I94 Q;  4LF5 L;  5LMU L;  2VUM H;  3VR5 A;  4O0A A;  5GQO A;  4QMG A;  4IJH A;  3OW2 A;  2C9O A;  4NPS A;  4DAP A;  1X3E A;  2OF1 A;  2J0T D;  4JI3 Q;  4DPG A;  2KEC A;  2E75 C;  2E2H B;  4DAV A;  3PO3 B;  2FJ2 A;  4KHV A;  3ERS X;  1XPR A;  2QEJ C;  1QJO A;  5DAU A;  3PV0 A;  2O2L D;  2E5L Q;  4F7X A;  4UDU C;  4ME3 A;  4IPH A;  1H9S A;  1CZW A;  1VQF A;  3RLO A;  1I94 L;  3PO2 H;  1IXR A;  3BDL A;  5IYB G;  5KYL A;  1U4R A;  3FVQ A;  1EYG A;  3LWU A;  5FK9 C;  2UUA L;  1MJC A;  3VYU A;  2AQ3 B;  5JJK A;  3A56 A;  4L5T A;  5M5X H;  3M3Y B;  4JI3 L;  1D5Z C;  2EJG C;  1KRT A;  2A6H D;  4RHS A;  3DWP A;  2KA7 A;  1ICW A;  2B2U A;  1J5E Q;  4RGN A;  1C0A A;  2E5L L;  3KLW A;  1GHK A;  2KJX A;  5IP7 G;  1KL9 A;  1ILQ A;  1IBK L;  1AP0 A;  3FKI G;  2E2J H;  3BVM A;  1N36 Q;  4MN3 A;  3JAM c;  2JEB I;  2EYJ A;  2KVM A;  1PDQ A;  5C0X J;  2NYZ D;  3F8T A;  3HG9 A;  4RG1 A;  3J80 c;  1BO0 A;  2F0O A;  3E9H A;  3K6O A;  5IOD A;  3B6Y A;  2K05 A;  4EX5 A;  2WAQ B;  5A2Q E;  2PW5 A;  2YTY A;  5EQ0 A;  4X3U A;  1J5E L;  4F8M A;  2YYZ A;  4BA1 I;  4K8J A;  3NBH B;  1SYB A;  1ASZ A;  1PVO A;  1PYB A;  3PQI A;  2L9H A;  1CHQ D;  1N36 L;  4Q5V A;  3MXP A;  3H0G H;  1LT3 D;  1P8L A;  1QNU A;  1VQ5 A;  1K8A C;  3K5N A;  4IFD I;  4DK3 C;  2JA7 G;  1GVP A;  3KLS A;  1WTR A;  2FIN B;  4L63 B;  1OXU A;  4ZKC B;  4QF4 A;  1JOQ A;  2BOS A;  1ICF B;  4RGO S;  2I5L X;  4BS9 A;  1Y1W B;  4A3J G;  1SYC A;  2F03 A;  3S24 A;  2R3Z A;  4ZYS A;  3M4O H;  2D0O A;  4DFA A;  5IWA Q;  4XQN A;  1BCP C;  1CKO A;  4CJ2 C;  4DUY Q;  2R93 B;  1GJX A;  3KJO A;  1V43 A;  3K5L A;  3NP8 A;  2VB2 X;  3HOV H;  3CC7 A;  3PO3 G;  3J81 j;  2EDG A;  2NVX H;  1WVL A;  3S1M B;  1L0W A;  3TZD A;  2R7F A;  3GTM B;  1TWG H;  2X69 A;  5FLX c;  2KUM A;  4AH6 A;  2BA1 A;  2F0K A;  5IT9 E;  1VQE A;  1SRU A;  2F52 A;  3UDF A;  2PO4 A;  1DD2 A;  3W5O A;  4LF9 Q;  1Z47 A;  5C4J B;  5LHY 1;  1JJG A;  1PYW D;  3EA6 A;  4IUU A;  1SNQ A;  2VL6 A;  3NK9 A;  5M5W H;  1STN A;  4IUN A;  4WJW A;  2GVB A;  4WRD A;  2B2W C;  2GN5 A;  2CH4 A;  3A55 A;  2K01 A;  1VQK A;  4HIK A;  4LF8 Q;  4ZUJ A;  1PFS A;  3Q22 A;  4WOR A;  2B63 B;  4DR1 Q;  5ELO A;  4DN4 M;  2NWG A;  3NPP A;  4B9X A;  2VB3 X;  3BYY B;  4KKU A;  1BVS A;  3KK7 A;  2PYK A;  1F9S A;  3EN2 A;  4Y7N B;  1RTO A;  4BWG B;  2ZJP A;  3WOE A;  1RHP A;  2HUG A;  4KMU C;  1HCZ A;  3K8A A;  4ZK9 B;  1Y8O B;  2G9D A;  3I8Z A;  3OWF A;  2WV6 D;  3H6M A;  1NBW A;  2WAQ E;  2IX3 A;  4RFB A;  1QG7 A;  5I2Y A;  4LF8 L;  3UDG A;  1K8O A;  3S15 B;  3V2T A;  2F4I A;  4C1N K;  3CCE A;  3HOX B;  3DLL A;  2NVY B;  5G3L D;  5IOC A;  2NZO A;  2PI2 A;  4PZ8 A;  4C3J B;  4BY1 H;  1SE2 A;  3R2I A;  4H0L C;  2R7Z G;  1N32 Q;  5CR3 A;  3GTJ B;  4KKS A;  1I50 H;  1TT2 A;  4JI7 Q;  2F3V A;  1NUC A;  1WYD A;  3VR3 A;  1LTL A;  5CV6 A;  1KDA A;  4R8I A;  1PXU A;  1PTO H;  3EJI A;  5JAV A;  2ZTD A;  2NN6 I;  4KI0 A;  1TWC H;  2IPK D;  1Y1V H;  5ELE A;  4P73 A;  1H9S B;  2NVQ B;  3I7F A;  1B70 B;  1LV9 A;  5C0X I;  3F2C A;  1NTG A;  4YWM A;  1S3O A;  2K75 A;  4DF7 A;  1N32 L;  2Q8R E;  2ICE C;  1XXG A;  4BBS G;  2UUB Q;  4IUT A;  3BVZ A;  4LNQ A;  4JI7 L;  2B2V C;  3MTS A;  1KAW A;  3UE0 A;  1X3G A;  4DR2 Q;  2OEO A;  1A62 A;  3G48 A;  4J1M A;  1ZYR D;  4C2M B;  2OWO A;  3GTG H;  4RGT A;  2LKV A;  2DNE A;  3M4Q A;  1W2B A;  3I4M H;  3VYS A;  2TSS A;  5IGB A;  4R1J A;  1ESF A;  2JQO A;  2Z6B A;  1X3Q A;  1S5C D;  4A3I H;  1YNX A;  5LL6 X;  1NMG A;  1E3P A;  1FNW A;  1SE8 A;  4UPA A;  1CT1 D;  4CDE C;  2MUY A;  1ILP A;  1E0B A;  1Q3L A;  1Y69 U;  1TXY A;  2UUB L;  5IP9 G;  4ID6 A;  1JB3 A;  4JPB W;  1QVG A;  2VY3 A;  3F2B A;  5I4D A;  4OWX B;  5FO7 B;  5CYU A;  1DOM A;  4DR2 L;  4MZ9 A;  1HNW Q;  4WJ4 A;  2VZA A;  5M3F B;  4B3M Q;  4DK0 A;  3GQB A;  2A1A A;  3A7A B;  4OHJ A;  1C8C A;  3CCR A;  4BXX H;  1II3 A;  1XYI A;  1MSH A;  4PMC A;  1X56 A;  4G7O C;  2D5D A;  1K3B C;  4Q0F A;  4HMJ A;  4BBR H;  4KV6 A;  1VQC A;  2ZXO A;  2O4X A;  4C3H B;  1CZG A;  1UE6 A;  3Q8D A;  1TWA H;  5A2Q L;  3PIO A;  1A2T A;  1I5F A;  1AE3 A;  5AFW A;  5IYC G;  3HOX G;  4ALP A;  1EWC A;  2F0D A;  1ROD A;  3A8I E;  4C3J G;  4LF6 Q;  4H7B A;  1CSP A;  4DR5 Q;  4IPC A;  3LX0 A;  4B3M L;  4P2C B;  1BBW A;  4A76 A;  4L5R C;  4A3M B;  4BY7 B;  3GTQ H;  1MI2 A;  5C3X A;  2BE5 C;  3PIP A;  3ND9 A;  4QL5 A;  4A3G H;  4YCV A;  3GP7 A;  5GAE C;  2SOB A;  2Z8L A;  5K36 H;  1STG A;  1S5E D;  2L5T A;  1I4H A;  3C3L A;  2RSO A;  3K81 C;  1PRT C;  1HR0 W;  2LXJ A;  4LFC L;  1FVI A;  3GV6 A;  2K50 A;  4X3T A;  5FJ8 G;  3HOU B;  4DR4 Q;  1UUP A;  3OHX C;  1TVX A;  1SEB D;  3R2T A;  4LF6 L;  4DR5 L;  3RZD H;  1U4M A;  1KTK A;  4UP8 A;  2FMM A;  2AUJ D;  3DEP A;  1JJ2 A;  4DUZ Q;  3CRK C;  2M2L A;  4GNX C;  4FVM A;  2K28 A;  1UAP A;  4A3D H;  1M8A A;  4O1N A;  2Z0S A;  2ICI A;  1EQR A;  2A6E C;  4J8Q A;  4DA2 A;  2RF4 A;  4GKK Q;  3KBG A;  3GV3 A;  3NWT A;  1IBL Q;  3CPW A;  5IGC A;  4FO2 A;  4HCE A;  1VQ6 A;  5EKK A;  4K6D A;  1DZ1 A;  2JA6 B;  3HOY H;  3TSS A;  1B50 A;  1QZH A;  3HFZ B;  3TBI B;  1RF2 D;  1Y8P B;  2EY6 A;  1STH A;  2EIF A;  2E74 C;  1EY4 A;  4LF7 Q;  3EVQ A;  4DUZ L;  1PFB A;  1U5K A;  3CME A;  4OWW B;  4ZKB B;  2WP8 J;  3A8K E;  3PUY A;  1DOK A;  1MD2 D;  2R92 H;  1H9R A;  3BDO A;  4FF3 A;  1RKN A;  3NEL A;  2ES2 A;  5M3F G;  5JEA G;  4GKK L;  1X55 A;  2RSN A;  1IBL L;  2PZU A;  1XJV A;  2CKZ B;  2LSS A;  3S1Q H;  4Y52 H;  2QDL A;  1I4P A;  2K1B A;  5IT9 c;  4LF7 L;  1AH9 A;  5I6Y A;  4JI6 Q;  5EPL A;  2BH2 A;  1SMX A;  1BQQ T;  4DR3 Q;  1YIJ A;  4C3I B;  1RJT A;  3J81 L;  2B2Y C;  2VXW A;  1QOH A;  2IY5 B;  1QE6 A;  3OIP A;  1NJI C;  3G4S A;  3HOW B;  3GTK B;  3GTO H;  2OXP A;  1JQY D;  4B3S Q;  3PSI A;  2NB0 A;  4RAU C;  1HNX Q;  3FPU B;  1K8G A;  2WKD A;  3RUZ A;  1SE3 A;  3SDZ A; 
#chains in the Genus database with same CATH homology
 4MHE A;  5ELF A;  2LS0 1;  2KOL A;  5BN4 A;  2ZXP A;  5JPN C;  2X6L A;  4A3F B;  1IYV A;  1D6E C;  1K83 B;  1Z6H A;  2RQX A;  1AFP A;  3MAQ A;  1LT4 D;  3D8G A;  2M00 A;  1BBX C;  1BCP D;  2CW0 C;  2PZW A;  4XYQ A;  3OMG A;  3S17 B;  3NBH A;  2M9V A;  1A6X A;  2O5J C;  4K5X A;  5KIX A;  5JEA J;  4YIJ A;  4KD4 A;  1EIH A;  4KY7 A;  1KLU D;  2I07 B;  4PQX A;  4RA8 A;  3CU7 A;  3OPO A;  3SVM A;  4K6L A;  3RLF A;  1FNV A;  2IJ0 A;  1IL8 A;  3IL8 A;  5DM7 3;  3T4A C;  2NUC A;  1T5X D;  1G91 A;  1CTM A;  2K7V A;  1SNO A;  4PNY A;  4ME5 A;  5EGT A;  3MWY W;  3K57 A;  4TRD A;  1C48 A;  3FRP B;  1CHP D;  1CQV A;  1GOZ A;  1DCZ A;  3BG3 A;  5G3L F;  3G7L A;  2Z4H A;  1O80 A;  1HUN A;  1SDF A;  3FKI B;  4C3I G;  1EIG A;  2RVL A;  4S3S A;  1Y8N B;  3DWQ A;  4H13 C;  2K5D A;  3DUZ A;  1ET6 A;  1ONL A;  2Q8T A;  1C4Q A;  1TWF B;  4UAI A;  1FD7 D;  1PZI D;  4EQP A;  3D6W A;  2BA0 A;  1A2U A;  1ESR A;  1CK1 A;  4OGQ C;  3LWE A;  5TSS A;  1KNA A;  4DU9 A;  3SK5 A;  4OO1 I;  2KQ3 A;  3NSW A;  3C1E A;  1NAP A;  4B08 A;  3K58 A;  2JA7 B;  1A3V A;  2PQE A;  5IGG A;  1PFN A;  1EYC A;  2A73 B;  3VA5 A;  3CKI B;  2A69 C;  2NN6 H;  3TP5 A;  4A3J B;  5C0X H;  1D2B A;  2B2W A;  2I46 A;  1EY0 A;  4I7Z C;  2E2I B;  2ZXR A;  5EBD A;  1TY0 A;  2X6G A;  2L55 A;  4G4K A;  3MHB A;  1A3T A;  1SMY C;  3Q24 A;  3SXH A;  3A7L A;  5CGK A;  1RTN A;  5M5W B;  1KDB A;  2RDF A;  1BNZ A;  1PTO C;  2L0C A;  1ENA A;  3NQT A;  4I65 A;  4XXE A;  1ZEQ X;  3NTI A;  2WII B;  3QOJ A;  1W6J A;  1CI3 M;  5COR A;  1OXV A;  1EU4 A;  2OT2 A;  4EQN A;  3K59 A;  4R8N A;  5T1I A;  2NTS A;  2BE5 D;  1I4R A;  2PZT A;  5E1F A;  3WDN A;  4U68 A;  2DNC A;  1JIC A;  1B9M A;  2R7Z B;  1PRT D;  2IX0 A;  3OSO A;  3IKJ A;  1NR4 A;  3MXU A;  5HUR A;  1STA A;  2DN8 A;  2L4N A;  4EVO A;  1S5F D;  1IW7 C;  5BN3 A;  1G8Z D;  2A6E D;  1O7Z A;  3MC0 B;  3D4D A;  3NE5 B;  2IT1 A;  3A8J E;  4BBS B;  1LLR D;  1ENC A;  4CJ1 B;  4A3B B;  1WTO A;  1AEX A;  1IKM A;  2QDB A;  1ML0 D;  5M5Y B;  2XWB B;  5FO9 B;  4TKO B;  5ELB A;  3HS0 C;  3X3N A;  2WAC A;  5CV5 A;  1RDP D;  5C4Z A;  2H1E A;  1LAB A;  2LMC B;  4ZUI A;  3R93 A;  1SE4 A;  1DM0 B;  2F0E A;  1SBB B;  1EU3 A;  2B2T C;  3SR1 A;  1KLG D;  1Z7T A;  2IL8 A;  3FDT A;  3S9W A;  5J22 A;  1JWS D;  3C1F A;  1ZXT A;  1QNK A;  1LTG D;  1WTP A;  1OXS C;  5HGT A;  1HTP A;  4C1N I;  1VCI A;  1XTC D;  3K7A B;  4NP5 A;  2K04 A;  2IWH A;  1HTL D;  2N88 A;  3BDC A;  3J81 E;  1MBY A;  4AYB B;  2VNU D;  1V1P B;  1A3U A;  2MP1 A;  5CBA E;  3S16 B;  1BCP F;  2PMZ B;  3N52 A;  2JA5 B;  2K03 A;  2EYM A;  5KNB A;  1STY A;  2MHV A;  3OW7 A;  2CW0 D;  4XTC S;  5EJW A;  3E0J A;  2PW7 A;  3BVG A;  1SSO A;  1EEF D;  3J7A F;  3VR4 A;  4G7Z C;  1O78 A;  4KK7 A;  1V8Q A;  5COY A;  1EY6 A;  1FYC A;  1HFG A;  2EOT A;  1SAP A;  3OIQ A;  2K6A A;  1NSN S;  1PFM A;  4K2L A;  2EE1 A;  3HP3 A;  5I9O A;  1GUS A;  2XWJ B;  2J4X A;  3TME A;  2G9H D;  5KND A;  1F9R A;  4LJZ C;  4RCO A;  1TWH B;  2KED A;  2E2D C;  4FXK C;  1OXX K;  4RGM A;  2B2Y A;  4XYO A;  3QIA A;  3VR6 A;  4ABN A;  3ERQ A;  3QG1 A;  1GHJ A;  2PCF B;  1GXD C;  1EY5 A;  3TN2 A;  2F0S A;  3KUP A;  3CHB D;  1Q1B A;  1BUV T;  3NQI A;  3U9O A;  2EVB A;  1IHZ A;  1PZJ D;  1YNN C;  4L6T B;  1VF5 C;  3SK4 A;  3SK8 A;  4HN7 A;  3GTP B;  1TS5 A;  1CFM A;  2A68 C;  2MGS A;  3R3O A;  1JR0 D;  2RDG A;  5C5M A;  4FF2 A;  1O7Y A;  1S5D D;  1WTW A;  1MSG A;  4DK1 A;  4N9P A;  3IFD A;  4J6H A;  4IUR A;  5D65 A;  5FO8 B;  2JA8 B;  1U4L A;  1R9T B;  4NMZ A;  2MJ8 A;  5M3M B;  3GD7 A;  3HOZ B;  2A69 D;  2RA4 A;  2HCC A;  1G2S A;  3PIO 3;  4OO1 H;  1G29 1;  2EYO A;  1SNP A;  1S4Z A;  1EFI D;  4HCS A;  2L11 A;  5EKL A;  1X32 A;  3PIP 3;  1F2M A;  2F0N A;  1JOR A;  4OIJ A;  3D3R A;  3Q6S A;  4OIK A;  5KYI A;  2F0F A;  1SMY D;  1SND A;  4CHT B;  2LY7 A;  2BDO A;  1OO9 B;  1YNJ C;  3H91 A;  3SEB A;  2NVT B;  5CV8 A;  3NTK A;  3S2H B;  3TP6 A;  3T56 B;  5J39 A;  1PTO D;  1D1I A;  2F1M A;  4V0B A;  2K32 A;  3RZO B;  3QJY A;  3NUC A;  1OXT A;  3R8B A;  1RD9 D;  1DOL A;  4HR7 B;  3VYR A;  1LO5 D;  2ID0 A;  1F2Z A;  5FOB B;  5EKI A;  1SFO B;  1GUT A;  5JEA H;  4FF4 A;  3M7N A;  1TR5 A;  2EYL A;  3AU7 A;  5EPJ A;  1WD1 A;  3N6R A;  1K8M A;  5JVG 3;  4QB4 A;  2N55 A;  4FXG C;  4X3K A;  4A3K B;  3M85 A;  4IN3 A;  1PLF A;  4B9W A;  1ZKO A;  4A3E B;  2KCC A;  3G6J B;  4ODG A;  1H9J A;  2HDL A;  2NBF A;  1JWM D;  1IW7 D;  3URY A;  4IUP A;  1KAB A;  1HRJ A;  1KNE A;  1SJE D;  2MPM A;  5KEE A;  1BOS A;  5CV9 A;  1TS2 A;  1U4P A;  3I73 A;  2B8F A;  2XSC A;  1EQV A;  4PMW A;  4CGY B;  4IUQ A;  3H94 A;  1XWE A;  2VUM B;  4IFD G;  1G2T A;  4MIU A;  5FLX E;  2AWN A;  1STB A;  1Q90 A;  3T51 B;  1DJR D;  4O42 A;  4WFN 3;  1GUW A;  2H4O A;  2XRQ D;  3P20 A;  2XVS A;  3J7A V;  2K33 A;  2L1B A;  1PMR A;  2XRS D;  2XN9 C;  1WTX A;  3X3M A;  3PO2 B;  1SYF A;  5D3I B;  3K0Y A;  4FP5 D;  4FNF A;  3MVV A;  4K8I A;  5M5X B;  1WTV A;  1U9R A;  4IZ8 A;  4LMQ D;  1D5X C;  1LTI D;  1HQM C;  1HQR D;  1EZ8 A;  5DM6 3;  1EYA A;  1CA6 A;  2FHT A;  4RKB A;  1HA6 A;  2E2J B;  3K5M A;  4ZRZ A;  2D9U A;  2FFK B;  4K2K A;  1BXT A;  1JWU D;  1SJH D;  4NKL A;  3O13 A;  1WTQ A;  4GZY C;  2A74 C;  4IFD J;  5C5L A;  2YU9 B;  1JE4 A;  4KJN A;  4DAY A;  3I70 A;  3L3O C;  4OL7 A;  3ERO A;  2K5W A;  2D62 A;  1SYD A;  1FR3 A;  2QCP X;  4C56 C;  3H0G B;  3TP8 A;  1B3A A;  3MXN A;  3PUZ A;  3GTL B;  1NCV A;  2EJF C;  1V1P A;  1ET9 A;  2PNR C;  1UNS A;  1E2Z A;  2F0P A;  2NN6 G;  3TZU A;  5C0X G;  2BCO A;  3M4O B;  4RHR A;  4HAE A;  1I4G A;  3HOV B;  4PV1 C;  4KN7 C;  2NVX B;  1AW7 A;  2RBM A;  1TWG B;  5J1Z A;  1LTT D;  1HFN A;  1O7L A;  1EOT A;  4PMB A;  5JJZ A;  1V1O A;  2Z4I A;  2EPB A;  4NDX A;  1JOK A;  2KEE A;  3JAM L;  1EEI D;  2F0T A;  3OOC A;  4EQO A;  1AZQ A;  1SNC A;  3J80 L;  3AB9 A;  5CV7 A;  1D1K A;  3BYT B;  4Z9C B;  2FMC A;  1YNN D;  1TY2 A;  4KY5 A;  5C4X B;  3LNN A;  3D4R A;  1TII D;  2A68 D;  3FEW X;  1QIL A;  1A15 A;  5I2X A;  2K5Q A;  2AQ2 B;  2EY5 A;  1HHV A;  2BDN A;  1LT6 D;  1T5E A;  5LL6 S;  2EYF A;  2JSO A;  4BY1 B;  1QB5 D;  4XT1 B;  5ELC A;  1ENF A;  5M9O A;  4DXG A;  4TQU S;  1J8I A;  1I50 B;  3P7J A;  1G6Z A;  2B2V A;  1GUN A;  1Q1E A;  4FYD A;  3I90 A;  1PTO B;  3PUV A;  1B2T A;  5I6W A;  4XT3 B;  1TWC B;  1Y1V B;  5FLX L;  2LFN A;  3W3A A;  1MGS A;  1Q8I A;  1B53 A;  4KHZ A;  2NTT A;  5E3F A;  1CM9 A;  2EXZ A;  3D31 A;  1R4Q B;  1PTO F;  3HKZ B;  1M4V A;  3M4Y A;  1TQO A;  1YNJ D;  1VMP A;  1HXY D;  2F0L A;  3NHH A;  1KDC A;  5EPK A;  3GTG B;  3E5S A;  2HCI A;  3I4M B;  2RDH A;  1TU2 B;  2ENB A;  4TSS A;  4A3I B;  5D14 A;  4QIW B;  3EQL C;  4ZAI A;  5A35 A;  1I6V C;  3SK6 A;  3NBI A;  2B39 A;  3DM1 A;  3V05 A;  2A5H A;  5IGE A;  4NW2 A;  3KLS X;  1DXM A;  2F0M A;  1W6K A;  4JBW A;  5EBC A;  2JE6 I;  1TKW B;  4HTH A;  3PUW A;  3BZD B;  2Z1C A;  3U9S A;  1BCP B;  4BBR B;  2QKI C;  1TS3 A;  1E2W A;  1H9M A;  4HED A;  4CJ0 B;  2ZT9 C;  3HZX A;  2EY2 A;  3P75 A;  4K14 A;  2F0U A;  4LK1 C;  3HGB A;  1TWA B;  2JXM B;  4BA2 I;  1QWY A;  2D2C C;  1CA5 A;  4RCN A;  3OWE B;  2CQA A;  4CBV A;  3L7Z C;  4FXD A;  2QF7 A;  1E2V A;  3GTQ B;  1H9K A;  1SNM A;  4A3G B;  4ZQ3 A;  1EZ6 A;  5KGU A;  5CC4 A;  2EJM A;  1UEA B;  3H3V C;  1F2Y A;  3K5O A;  2B2U C;  3S1N B;  4K5W A;  4RKL A;  3MFG A;  3DWA A;  4KJO A;  4F88 A;  2SEB D;  5BN5 A;  2C5C A;  3RZD B;  5C44 B;  1FGB D;  3PMF A;  5JVH 3;  5JPM C;  5D3D A;  4KN4 C;  4ULL A;  4A3D B;  3QWN A;  4V19 0;  2F0G A;  4G57 A;  1SYG A;  1B9N A;  2F0W A;  4R9W A;  3HOY B;  1SYE A;  1R4P B;  1RCV D;  4KKT A;  1NR2 A;  3ND8 A;  3FPP A;  1JCK B;  4FF1 A;  3NWS A;  5F2D A;  2DY7 A;  3KF8 A;  1JOO A;  4K5V A;  1EY8 A;  3MXG A;  3ITP A;  3HEJ A;  2Y0S B;  2R92 B;  2E76 C;  3DEO A;  2SDF A;  3S1Q B;  3WOF A;  3OMC A;  1GUG A;  2CVR A;  1LTB D;  1HUM A;  1X3P A;  4M1U B;  1IYU A;  3NTH A;  3F2U A;  2JEA I;  1Q12 A;  3MZ5 A;  3IAY A;  1F9P A;  3E6Z X;  3C46 A;  4IAL A;  4HMI A;  3GTO B;  2A6H C;  1F2L A;  3V96 A;  4EGV A;  2TMP A;  1EYD A;  2EZV A;  5K36 G;  4CKB A;  5C3E B;  1LT5 D;  3VYT A;  1J9O A;  1LTA D;  2EYH A;  1WD0 A;  5ISR A;  4OO1 G;  2Q8I B;  2AUK A;  1S5B D;  3IFT A;  4L8J A;  1EL0 A;  4M8A A;  1GUO A;  2AWO A;  2WB1 B;  3H09 A;  3AMU A;  4XDX A;  3ZYY X;  1I6H B;  3RD4 A;  3CQZ B;  5K5P A;  1LTR D;  2QIL A;  4XQJ A;  3KBX A;  2WKC A;  1LAC A;  4XIG S;  2HQE A;  2L12 A;  1L0Y B;  3DXJ C;  5C4H A;  1F9Q A;  5IT9 L;  2O5I C;  5DEH A;  1SXT A;  1F77 A;  4RWS C;  5KNC A;  1PRT B;  3DHQ A;  3A54 A;  3JAM E;  1EY7 A;  1VMC A;  4A93 B;  1HPC A;  3PUX A;  3L9A X;  3TP7 A;  1B4O A;  2F0V A;  3J80 E;  1VF7 A;  3T16 A;  4LAA A;  4DXF A;  3I72 A;  1PRT F;  5FKA C;  1BF4 A;  4DGZ A;  2IX1 A;  5IGF A;  2EYP A;  5ELD A;  4CKC A;  2DY8 A;  5C6A A;  3S1R B;  3MEH A;  5E4W C;  4KD3 A;  5CMD A;  4H44 C;  2F0I A;  1L0X B;  3S14 B;  1STE A;  2IW3 A;  3GO5 A;  1EY9 A;  3T13 A;  1DYQ A;  5NUC A;  4CKE A;  5KRU A;  4F87 A;  4C3H G;  5IGD A;  2KCN A;  3CRL C;  2GA4 B;  1I4Q A;  2KHS A;  4JK1 C;  3QB3 A;  1EWH A;  3VR2 A;  1B1Z A;  1LTS D;  3QO2 A;  5I9P A;  4DNT B;  2R6G A;  2CHB D;  3EFX D;  2HDM A;  1FNU A;  3J7Y W;  4QUC A;  2XNA C;  1HA5 A;  3UI2 A;  1TS4 A;  2B8G A;  4DNR B;  3I91 A;  2R61 A;  2J7Z A;  3Q23 A;  4IFD H;  1I3Q B;  3MFY A;  3Q0A A;  3HRZ C;  4X3S A;  5C3W A;  3BS1 A;  1I4X A;  4IQZ A;  3QOL A;  3FMC A;  4G7H C;  5CV4 A;  2AQ1 B;  2NZ1 D;  1PZK D;  3T53 B;  4KY6 A;  1AN8 A;  4E6I A;  1BR9 A;  4HSP A;  3SE0 A;  5E4X A;  1ZYR C;  4RH6 A;  2XIW A;  3VA7 A;  2F0H A;  2F0Q A;  2EY1 A;  3I3C A;  3P1H A;  1CQF A;  2PPB C;  4QCL A;  3D4W A;  1BDO A;  1EQT A;  3ONA B;  1WCM B;  2V4D A;  2SNM A;  3M7G A;  3I4L A;  2JYO A;  3DMU A;  4XQQ A;  4KTA A;  1AZP A;  1KAA A;  3MA2 B;  4U67 3;  3D6C A;  4QUF A;  1QCB D;  2WIN B;  3C2P A;  1DON A;  1XX8 A;  3W2D A;  1B44 D;  3RMH A;  5JOB A;  3TDQ A;  2SNS A;  1D5M C;  3NXW A;  4HSV A;  2F3W A;  3S2D B;  4N9T A;  3SHL A;  2RKS A;  4IUV A;  1IKL A;  4ZLT F;  1JC7 A;  4ILW A;  2F0J A;  3I4N B;  2B2T A;  2JP1 A;  5T1G A;  1VDZ A;  3KLR A;  5CBE E;  5IIF A;  5DNF A;  3VR5 A;  4QMG A;  2C9O A;  4DAP A;  2OF1 A;  2J0T D;  2KEC A;  2E75 C;  2E2H B;  4DAV A;  3PO3 B;  2FJ2 A;  4KHV A;  2QEJ C;  1QJO A;  5DAU A;  3PV0 A;  2O2L D;  4F7X A;  4UDU C;  1H9S A;  1CZW A;  3BDL A;  5KYL A;  1U4R A;  3FVQ A;  3LWU A;  5FK9 C;  3VYU A;  2AQ3 B;  3A56 A;  3M3Y B;  1D5Z C;  2EJG C;  2A6H D;  4RHS A;  3DWP A;  2KA7 A;  1ICW A;  2B2U A;  4RGN A;  1GHK A;  2KJX A;  1ILQ A;  1AP0 A;  3BVM A;  4MN3 A;  2JEB I;  2EYJ A;  2KVM A;  1PDQ A;  5C0X J;  2NYZ D;  3HG9 A;  1BO0 A;  2F0O A;  3K6O A;  5IOD A;  2K05 A;  2WAQ B;  5A2Q E;  2PW5 A;  5EQ0 A;  4X3U A;  4F8M A;  2YYZ A;  4BA1 I;  4K8J A;  1SYB A;  2L9H A;  1CHQ D;  4Q5V A;  3MXP A;  1LT3 D;  1QNU A;  3K5N A;  4IFD I;  3KLS A;  1WTR A;  2FIN B;  4L63 B;  1OXU A;  4ZKC B;  4QF4 A;  1JOQ A;  2BOS A;  4RGO S;  4BS9 A;  1Y1W B;  1SYC A;  2F03 A;  2R3Z A;  4ZYS A;  4DFA A;  4XQN A;  1BCP C;  4CJ2 C;  2R93 B;  1GJX A;  3K5L A;  1V43 A;  3NP8 A;  2VB2 X;  2EDG A;  1WVL A;  3S1M B;  3TZD A;  3GTM B;  2X69 A;  2KUM A;  2BA1 A;  2F0K A;  5IT9 E;  2PO4 A;  1DD2 A;  1Z47 A;  5C4J B;  5LHY 1;  1PYW D;  3EA6 A;  4IUU A;  1SNQ A;  3NK9 A;  1STN A;  4IUN A;  4WJW A;  4WRD A;  2B2W C;  3A55 A;  2K01 A;  4ZUJ A;  3Q22 A;  4WOR A;  2B63 B;  4DN4 M;  2NWG A;  3NPP A;  4B9X A;  2VB3 X;  3BYY B;  4KKU A;  3KK7 A;  2PYK A;  1F9S A;  4Y7N B;  1RTO A;  4BWG B;  3WOE A;  1RHP A;  2HUG A;  4KMU C;  1HCZ A;  4ZK9 B;  1Y8O B;  2G9D A;  3I8Z A;  3OWF A;  2WV6 D;  3H6M A;  2IX3 A;  4RFB A;  1QG7 A;  5I2Y A;  1K8O A;  3S15 B;  3V2T A;  2F4I A;  4C1N K;  3HOX B;  2NVY B;  5G3L D;  5IOC A;  4C3J B;  1SE2 A;  3R2I A;  4H0L C;  5CR3 A;  3GTJ B;  4KKS A;  1TT2 A;  2F3V A;  1NUC A;  3VR3 A;  5CV6 A;  1KDA A;  4R8I A;  1PXU A;  1PTO H;  3EJI A;  5JAV A;  2NN6 I;  4KI0 A;  2IPK D;  5ELE A;  1H9S B;  2NVQ B;  1LV9 A;  5C0X I;  4DF7 A;  2Q8R E;  2ICE C;  1XXG A;  4IUT A;  3BVZ A;  2B2V C;  3MTS A;  2OEO A;  4J1M A;  1ZYR D;  4C2M B;  4RGT A;  2LKV A;  2DNE A;  3VYS A;  2TSS A;  5IGB A;  1ESF A;  1X3Q A;  1S5C D;  5LL6 X;  1FNW A;  1CT1 D;  2MUY A;  1ILP A;  1E0B A;  1Q3L A;  1Y69 U;  4ID6 A;  1JB3 A;  5I4D A;  5FO7 B;  5CYU A;  1DOM A;  5M3F B;  4DK0 A;  3GQB A;  3A7A B;  4OHJ A;  1C8C A;  1II3 A;  1XYI A;  1MSH A;  4PMC A;  4G7O C;  2D5D A;  4Q0F A;  4HMJ A;  4KV6 A;  2ZXO A;  2O4X A;  4C3H B;  1CZG A;  5A2Q L;  1A2T A;  5AFW A;  1EWC A;  4C3J G;  1ROD A;  2F0D A;  3A8I E;  4H7B A;  3LX0 A;  4P2C B;  4A3M B;  4BY7 B;  1MI2 A;  5C3X A;  2BE5 C;  3ND9 A;  3GP7 A;  2SOB A;  2Z8L A;  5K36 H;  1STG A;  1S5E D;  2L5T A;  1I4H A;  3C3L A;  2RSO A;  1PRT C;  3GV6 A;  4X3T A;  3HOU B;  1UUP A;  3OHX C;  1TVX A;  1SEB D;  3R2T A;  1U4M A;  1KTK A;  2FMM A;  2AUJ D;  3DEP A;  3CRK C;  2M2L A;  4FVM A;  2K28 A;  1UAP A;  1M8A A;  4O1N A;  2ICI A;  2A6E C;  4J8Q A;  4DA2 A;  3KBG A;  3GV3 A;  3NWT A;  5IGC A;  4FO2 A;  4HCE A;  1DZ1 A;  5EKK A;  4K6D A;  2JA6 B;  3TSS A;  1B50 A;  3TBI B;  1RF2 D;  1Y8P B;  2EY6 A;  1STH A;  2E74 C;  1EY4 A;  3EVQ A;  1PFB A;  4ZKB B;  2WP8 J;  3A8K E;  3PUY A;  1DOK A;  1MD2 D;  1H9R A;  3BDO A;  4FF3 A;  1RKN A;  5JEA G;  2RSN A;  2PZU A;  1I4P A;  2K1B A;  5I6Y A;  5EPL A;  1BQQ T;  4C3I B;  1RJT A;  3J81 L;  2B2Y C;  2VXW A;  1QOH A;  1QE6 A;  3OIP A;  3HOW B;  3GTK B;  2OXP A;  1JQY D;  2NB0 A;  4RAU C;  3FPU B;  2WKD A;  3RUZ A;  1SE3 A;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...