3E5SA

Crystal structure of staphylococcal nuclease variant delta+phs l103k at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e5sA00
1SNMA 1JOQA 4DFAA 3SK4A 5IGGA 5C4HA 1JOOA 3NUCA 5K5PA 2F0FA 5JOBA 3C1EA 5KEEA 4KY5A 5IGCA 4K2KA 3BDLA 5J1ZA 5KIXA 2F0WA 2PW7A 1A2UA 2RDFA 5C5MA 3H6MA 2PW5A 4DU9A 2F0UA 4N9PA 2F0VA 2QDBA 4K5WA 4DGZA 5KGUA 4KJOA 3T13A 1EZ8A 2SOBA 1STBA 3DHQA 4EVOA 3P75A 2F0QA 2KHSA 3QOLA 2EXZA 2O4XA 2F0JA 2EYMA 2SNSA 3VA5A 1SNDA 4R8NA 3QOJA 2ENBA 5C4ZA 1F2ZA 5HGTA 3PMFA 1EYCA 1NUCA 1SYGA 3SXHA 3D4DA 3E5SA 1STAA 3D6CA 1EYDA 4K2LA 2OF1A 3D4WA 4J1MA 3D8GA 4KY6A 2EYHA 1U9RA 4EQOA 1EY4A 2EY6A 4K5XA 2RKSA 1EY8A 5HURA 1A3VA 2PYKA 3SK5A 2KQ3A 2SNMA 3OWFA 5CR3A 3P1HA 3ERQA 4KJNA 1SNOA 4KV6A 4KTAA 2F0LA 5CV4A 3SR1A 2F0KA 1SYCA 2PZUA 3BDCA 3NQTA 3EVQA 4HTHA 4NP5A 1EY5A 5EKKA 3V2TA 4KHVA 1STHA 1EQVA 3NXWA 4RKLA 4ZQ3A 1KDCA 2F3VA 3MHBA 1ENCA 3TP8A 2EY5A 3QB3A 1STNA 2EYPA 4HMJA 4MIUA 2WACA 4KY7A 5C3WA 3DMUA 1JOKA 4TRDA 5CC4A 2EY2A 1NSNS 1IHZA 1SYEA 3T16A 3TMEA 2F0MA 3RUZA 2F3WA 1SNCA 4J6HA 5IGDA 4OL7A 4KD4A 1F2YA 3TP7A 1RKNA 5IGEA 1KABA 2EYJA 3OMCA 1KDAA 2F0DA 3NHHA 5CV5A 4IZ8A 5E1FA 5CGKA 4E6IA 1TR5A 5IIFA 3TP5A 4K14A 4ZUIA 4B9XA 3S9WA 3MXPA 5NUCA 5EGTA 3EROA 5KRUA 3HEJA 3OMGA 2F0OA 4IALA 4QMGA 5IGBA 1ENAA 5I6YA 5I9OA 5CV6A 4ZUJA 4DF7A 5C3XA 2F0NA 4B9WA 2PZTA 2F0PA 1A3UA 4NKLA 2F0GA 2LKVA 5J22A 5CV7A 2PQEA 1II3A 5KYLA 4WRDA 5IODA 1EY0A 2F0TA 4LAAA 2M00A 3MVVA 4IUNA 4ODGA 1STYA 4PMBA 1SYFA 2PZWA 4ID6A 4YIJA 1STGA 5EKLA 4S3SA 4K8JA 2OEOA 3SK6A 4EQPA 5IOCA 5CV8A 4NDXA 5DEHA 2EYOA 2F0SA 1A3TA 2F0IA 3NK9A 1SNPA 1EY9A 5KYIA 4K8IA 2OXPA 5ISRA 5E3FA 1A2TA 2NUCA 3ITPA 4RKBA 3SK8A 4F8MA 2F0EA 3LX0A 1SYBA 1EY6A 2EY1A 2HQEA 1F2MA 2F0HA 4HMIA 4QF4A 5I6WA 5M9OA 1EY7A 3R3OA 1EYAA 1JORA 1SYDA 1TQOA 4PMCA 5IGFA 4K6DA 2RBMA 4H7BA 1EZ6A 2EYLA 4EQNA 3MZ5A 3C1FA 1AEXA 3MEHA 4WORA 5C5LA 1SNQA 4G57A 1KDBA 3HZXA 3EJIA 3NP8A 5F2DA 3TP6A 3U9OA 4K5VA 1KAAA 4N9TA 3SHLA 4PNYA 4F7XA 4NMZA 4I65A 5C6AA 5DAUA 2EYFA 4ME5A 3OSOA 4KD3A 5CV9A 5J39A 1TT2A 5I9PA 5JAVA 4QB4A
chains in the Genus database with same CATH superfamily
1RTOA 4DUYQ 3S2HB 5JOBA 4BBSB 2RF4A 3J81L 2R7ZH 1B3AA 2UXDQ 4LF5L 1EZ8A 1H9SA 4JI7Q 2NVQB 4IOCA 4CJ1B 1R4PB 3RZOB 1G6PA 1KXLA 5ELCA 2L1BA 3UDGA 1JT8A 1OXSC 1HTLD 1TVXA 1EYGA 1KNAA 2L0CA 3G6EA 4PZ6A 3EFXD 3MFYA 2UUAL 3KJOA 2PYKA 1QUQB 2X6GA 4A75A 2BCOA 3ERQA 3KF8A 4C1NK 2F52A 1HZAA 4DR6Q 3PQIA 2Z1CA 1CM9A 5EAYA 2Z0SA 4MTKA 1CKNB 2GVBA 3TP8A 3CCQA 4MIUA 4OX9Q 1JOKA 5C3EB 5IT9c 4DNTB 4A3IB 2VZAA 3TMEA 4EX5A 4LF9L 3J81i 4N8FA 1PZID 2EDGA 5C44H 4B3RQ 2DUDA 1VF5C 1EIYB 3S14H 1V1PB 3DWAA 3WOEA 4ZUIA 1CQFA 1W6JA 3GTGB 2XWJB 1MSHA 2NVXH 3E3XA 5FK9C 1FGBD 2XVSA 4IFDJ 1F9QA 2WP8J 4NKLA 5E4WC 1BBXC 1PFSA 4POFA 4HSVA 3BU2A 5GROA 4ID6A 2EOTA 1BCPD 1STGA 3A8KE 2B63G 4KI0A 1VQ7A 4P72A 3MXNA 3SK8A 4CDDC 5LMUL 1O7ZA 1SLJA 4XQJA 1VQNA 1EY6A 2JA6B 3QWNA 1E2WA 1BCPC 1JORA 1BUVT 1TXYA 4C3IH 5IP9G 4DA2A 3MEHA 1Q7YC 3S1QH 3NP8A 1S5FD 4K5VA 5LMNW 1KAWA 3STBD 1WTOA 1MGSA 4XT3B 1ESRA 4C3JH 3X3NA 2IL8A 5CV9A 4KD3A 4A3EH 2Q2HA 1UEBA 1D5ZC 1HH2P 3K80C 5K5PA 3MWYW 4IFDH 1E1TA 1H9JA 5E4XA 3STBC 3JAMc 4UP9A 4GKJL 3QR8A 2E2DC 4FF3A 2F0JA 2I46A 5HGTA 4IPGA 4DXFA 3OHXC 4DV3L 2KVMA 4J1MA 3GTMB 1YNJD 4X3TA 4K5XA 2CH4W 3GV6A 2VY3A 1NE3A 4BA2I 2K6AA 5M5XB 4JI0L 1LV9A 1SYCA 3G4SA 3BG3A 3K5LA 3HKZG 4P2CB 4LF5Q 1YNJC 5E7NA 1QVFA 2ZTDA 1K3BC 4I7ZC 2E2IH 1PYBA 2QKIC 1XPUA 4IN3A 4OL7A 3FMCA 4Q0FA 1E24A 3HOYH 4JK1C 2UUAQ 2ZTCA 3VR3A 2ZM6L 2Q8RE 1PTOD 4NPSA 1BXTA 5FO9B 2WB1B 4LUVA 2BH8A 4DR5L 5ELEA 2PZTA 1JJ2A 1TWHB 3PSIA 1L1OB 1I4RA 2MHVA 4JI6Q 3RLNA 1AN8A 2M00A 3GTKH 4LFAL 3A56A 3CPWA 4LF9Q 1TWFH 2DNCA 2OQKA 5EJWA 4IQZA 1I50B 4K8JA 5EPLA 1EL0A 2B39A 1D6EC 1SE3A 1EFID 3G48A 2F0EA 2Z9HA 3LX0A 1I6HH 1CZWA 4CHTB 1CFMA 3NBHB 3CMEA 4XYQA 3R3OA 1SYDA 4O2DA 1YIJA 4A3CG 3C1FA 2Z4HA 1B4OA 3MEFA 1KDBA 1SMYD 1QNKA 1U5KA 4Q5VA 4N9TA 2N78A 4CDEC 4F7XA 2BOSA 3CW2C 2A6HC 3E9HA 5LMUQ 2B2YA 1ASYA 2JA8B 1AE2A 1V43A 1F2LA 4P73A 5KEEA 1SMYC 1PLFA 3DXJC 1QG7A 2NYZD 1Q12A 1O7IA 2FINB 3R2TA 2LY7A 1BKBA 2SNSA 2TSSA 3VA5A 5DM73 3ERSX 1OXXK 4P75A 1HA6A 1GUNA 2KEDA 3EA6A 1GXDC 1O7YA 1UE7A 1WTVA 4LMQD 3DWQA 1MBYA 1DZ1A 5CMDA 1A15A 3I4NG 2N8NA 1N8RC 4A3JH 1I3QH 2SEBD 4GKJQ 5C4XG 1YI2A 3IFDA 1B3QA 2CQOA 3NBIA 2EYPA 3TBIB 4DR1L 2WACA 2FMCA 2R93H 4HJ7A 4UY8C 1SMXA 5D3IB 4DV3Q 1K8MA 5C44G 2OWOA 3TP7A 5IGEA 1KIXA 4CJ2C 1U4LA 4B9XA 2NN6H 1D7QA 4OXPA 3CCRA 4JI0Q 1CA6A 1OXVA 2F0NA 2PQAB 4XQQA 4BY1B 3K7AB 1RD9D 3A5ZB 1UAPA 4X3KA 2E5LL 2E2HH 2AWOA 2EQSA 3SK6A 1M4VA 1ICFB 3M3YH 3GTOB 2VUMG 4O1NA 3W5OA 4GLVB 3Q23A 2WAQB 5AJ3L 2ZM6Q 2RDGA 4KKUA 4X65L 1A62A 1BCPF 3R2IA 5FO7B 3F2CA 4DR5Q 3P7JA 4PMCA 1VQ9A 4C3IG 4HCSA 1LT6D 4A3FH 5AFWA 4YY3L 4WORA 3MXUA 2PNHA 2DNEA 5F2DA 2K33A 4C3HH 3E9IA 2ICEC 3KUPA 3CKIB 3H09A 1PYWD 4L8JA 4OWWB 2XWBB 1X56A 2KCTA 4A3EG 1WTHA 4A3KH 1M1KC 2CWAA 4FDBA 2Y0SB 3M7GA 4IFDG 1TWCB 2WV6D 3RZDH 3H6MA 2Y0SE 3OYYA 1Z9FA 1QVGA 3F2UA 1N33L 1XTDA 1PRTD 2Q2TA 1VQ8A 3CD6A 2ZJPA 3I4MG 1HFNA 3CU7A 3L0OA 1Z7TA 4BWGB 3HOZG 4EQOA 1EY4A 3OOCA 2JE6I 1WYDA 3BS1A 1MJEA 1IKLA 4KJNA 1PRTC 5CBEE 3AEVA 5ISRA 4JBKA 3NXWA 2B29A 2F3VA 3GDEA 2A19A 2AQ2B 1WTPA 3F2BA 1VQMA 4KHPL 1JCKB 1V9PA 1MD2D 4FNFA 1ICWA 3VYUA 3J7AF 3Q24A 3FPUB 1P8LA 4UP7A 2FMMA 3CC2A 1I4GA 3FKIB 3KF6A 3GTLB 1GD7A 2LXKA 4DNIA 3HGBA 4OGQC 4GOPB 3HOXB 5EGTA 1JWMD 4JVZA 1HNWL 4R4CA 3X3MA 1U4RA 5C3XA 1E3PA 3J81j 4OEMB 2LKVA 4ZRZA 4DR1Q 4DR2L 4GNXC 4LAAA 3MVVA 3CRLC 4PMBA 1PTOF 2R7ZB 3KLSX 2OEOA 3OIPA 1AFPA 3SVMA 3JAME 1C48A 1WTXA 3CC4A 1DONA 3Q0AA 4DK3C 4DAPA 3S1RH 2L5TA 3BYTB 2OXPA 3MC0B 4FF4A 2VQEL 3IRBA 2EY1A 5EPKA 3TS2A 4BBRB 1WOCA 2UU9L 4JV5L 3AU7A 4X3UA 4OIJA 2TMPA 5ELNA 4A3LH 2E5LQ 1PMRA 4IUUA 4L63B 2Q2UA 1K8GA 4BBSG 3R8BA 2B63H 4PNYA 1GUSA 4PQXA 1LABA 3PCOB 5AJ3Q 1ZXTA 4ZKBB 4A93G 2V1CC 4X65Q 1JOOA 4JI2L 1FNWA 1XMQL 4DV4L 2EXDA 4KY5A 2BH2A 1PFMA 1TS3A 3IFTA 3T1YL 1KLGD 1CTMA 4IPCA 2RDFA 4A3BB 3E0EA 2KOLA 2L11A 2SOBA 3T13A 5IP9H 4YY3Q 1LTLA 3P75A 3JC66 2R6GA 1OTCA 1B7YB 4XQNA 2K75A 1CSPA 1T5XD 4A3GH 1RIPA 1EYCA 5IE8A 1X3PA 1KC8C 3HOWB 3O13A 2ZJQA 1S40A 3E0JA 1WD0A 1PYSB 4RA8A 5M3MG 3IAYA 1D1KA 4RCOA 4A3IG 2CW0D 1SE8A 1LO5D 1FR3A 3D31A 4A3JG 1XXGA 4JOIC 1STHA 4RKLA 4N8X1 2AQ3B 2HT1A 1D5XC 1N33Q 2KJXA 4UHVA 1T9HA 4CJ0B 1PVOA 2NTTA 1IHZA 4AQYL 1B9MA 2NVYH 2B2YC 1HHVA 1E2ZA 4DUZL 1HPCA 3GTPH 3OPOA 4X3SA 3M7NA 1JE5A 2AWNA 1E1OA 1TS2A 1Q90A 3JAML 3S1QB 4IZ8A 3PO3G 3K7UC 5CORA 5KRUA 4C3JB 5IYCG 2HCIA 1F9PA 5CV6A 2NB0A 3VA7A 4WRDA 4FXGC 3DUZA 1CI3M 3CPFA 4KHPQ 2RQXA 1DXMA 1H9RA 1U4PA 2HD3A 3K58A 1HCZA 3TS0A 5IOCA 1Q8KA 2IHEA 3NSWA 2K5NA 1PH6A 5G3LF 5EPJA 1PXUA 4RHSA 4RKBA 4F8MA 1FL0A 3M4OB 3J80c 1VQBA 1HNWQ 1VQPA 1CA5A 4NW2A 4MHEA 2DGYA 1HFGA 4QGUA 2QEJC 4K6DA 2KUMA 5FLXE 4KN4C 3JAMi 2Z8LA 1JQYD 5A35A 4DR2Q 4LFCL 3HRZC 3K59A 1SNQA 1EU3A 2N49A 4XT1B 4FXDA 1FNVA 4C3HG 5BN4A 5C4JH 1NR2A 4R4QA 4QCLA 3FVQA 2BE5D 5ELBA 4JYAL 1RDPD 1KNEA 1SEBD 1YNND 4ZAIA 4A3KG 2VQEQ 1QZHA 3S1NH 2E2IB 5IGGA 5C4HA 3NUCA 2WINB 3S1MH 5I2XA 2UU9Q 1D8LA 3VYTA 4JV5Q 1C4QA 1B1ZA 1H9KA 1VDZA 3HOYB 1Z47A 2JN4A 3F2DA 1JC7A 2PW5A 5KGUA 3RMHA 3CQZH 2PPBC 3KK7A 4A3CH 3G7LA 4DV6L 1YNNC 3I4LA 1HR0L 2PCFB 1IBKL 2MJ8A 2GN5A 1RCVD 1GUGA 1IYUA 2RHQB 4FF1A 3TN2A 2K5QA 2RKSA 5HURA 3I55A 2QCPX 1TWFB 4JI2Q 1XMQQ 1PRTF 4DV4Q 4L5RC 2B8FA 3T1YQ 4NXML 1B2TA 3SR1A 3LWEA 3HOUG 4GZYC 3WWVA 3BDOA 4LF4L 1ENCA 4QIWB 1I6HB 2EPBA 1XPRA 2M9VA 4QIWE 1EIFA 2IY5B 5KNCA 4J15A 1XMOL 1YITA 2WB1G 5IGDA 4FVMA 3VR5A 5IIFA 3ICEA 1CHQD 4P71A 1CSQA 1A0IA 3MXPA 1LYLA 2Q8TA 3LNNA 3I4NH 4ILWA 4ZUJA 2R92B 1A3UA 4OO1G 1E22A 1II3A 3KLWA 4BY7G 1X54A 3NENA 5C4XH 5FLXL 2KHJA 5HY6A 3D6WA 1K73C 4JCVE 2RA4A 4L6TB 1DOMA 1CZGA 4YIJA 4AQYQ 3NPPA 3I56A 4S3SA 4DUZQ 2PNRC 3UE0A 2BDNA 5BN5A 1TS5A 4PMWA 3T51B 1SYBA 2K52A 4JPBW 4DN4M 3M9BA 1RODA 2AUJD 1K9MC 2I07B 4KHZA 3CP0A 3MZ5A 3AYHB 4JI1L 1T5EA 4A3LG 1I3QB 1SFOH 1QNUA 3PIOA 1VQDA 2A6ED 1X9NA 4NMZA 3K8AA 4HAEA 4I65A 4PV1C 3HFZB 3N52A 2VUMH 2XTIA 1K83H 4R8IA 2R93B 4M8AA 2XSCA 3QJYA 3SK4A 3DEPA 3I7FA 2ALYB 2NVTH 3TREA 3A7AB 1M90C 4PG3A 2FFKB 1HZ9A 1V8QA 2A6EC 4ZKCB 2A74C 1Y1VG 4DGZA 4LFCQ 1G6ZA 1STBA 1PH7A 1YZ6A 4X64L 4A76A 3QOLA 2QGQA 4OO1I 1GJXA 4TQUS 3NTIA 3BJUA 3H15A 1VMCA 4A3GG 1JE4A 4JYAQ 1EYDA 4DK6C 1L1OC 3AFQA 4R4TA 5JVG3 2EY6A 2K32A 2KQ3A 5CR3A 1YJ9A 3CXCA 2D5DA 3M3YB 1JB7A 3S16H 3FP9A 3I4OA 2JA5H 2PZUA 4ZQ3A 4M1UB 2B8GA 4AIMA 1K0RA 5KYLA 4HMJA 4DV6Q 1RL2A 2H4OA 1HR0Q 1IBKQ 1TIID 3I4MH 3MFGA 4GNXA 4IPDA 4A3FB 1G2SA 4YWMA 3PO2B 3HOZH 1PZJD 5LMNL 4E6IA 3UI2A 5ELDA 4F87A 1JB3A 2MUYA 2JYOA 2IWHA 1QWYA 4LF4Q 5J22A 2VB2X 4LF6L 2IX0A 3I72A 1NNXA 2WAQG 4IUNA 4OWTB 1STYA 2HQLA 1SYFA 1Q3LA 2PZWA 2YTVA 4A3DB 1DJRD 1XMOQ 2EJFC 3KBXA 3H94A 1F77A 3CF5A 1MI2A 2A73B 1EIGA 1IXRA 3R93A 2ZXOA 1TY2A 4LUOA 5M9OA 1MKHA 1VQCA 3KDFB 2F4IA 3HOVH 1UE5A 3L9AX 1N9WA 1LT4D 3KBGA 1Y1WG 1PTOC 1B70B 1J9OA 3AQQA 5M5YH 2HHHL 2JA7H 4B3TL 2ATWA 4DV7L 2G9DA 4IPHA 2NZHA 4LFBL 4QY7A 1R9TH 3C1EA 3P20A 4YCWA 2E76C 1DM0B 1LTBD 1HUNA 3GP7A 2KHIA 4RGNA 2NTSA 1IZ6A 4JI1Q 3BYYB 2PI2A 1VQEA 3I8ZA 5C0XG 2Z6KC 4JOIA 1ET6A 1F2ZA 1HZCA 2D0PA 3J7ZC 1SYGA 4BBSH 4DAYB 3CCLA 2KEEA 1PFNA 4DR7L 4DV0L 1ASZA 5K36H 2K5DA 3BVZA 4LNQA 2NVQH 1ENFA 1PH8A 4A93H 1Q46A 1XNQL 3I91A 3S1RB 2VB3X 2OTLA 3BDCA 3NQTA 1GUWA 4OHJA 1EY5A 3A8JE 3ER0A 2IW3A 5I2YA 2KECA 5C3WA 3BZDB 3J80E 3J81c 4QUCA 2WKCA 1VQKA 1NSNS 5IWAL 2D0OA 5JVH3 2KBNA 1PH2A 1VQAA 4RAUC 5CGKA 3KFUA 2F0DA 1XYIA 3D3RA 4IUVA 4A3MG 4C56C 5M3MH 1I4QA 1YEZA 2B63B 1SRUA 5C3EH 5FKAC 2NZOA 4A3IH 2CKZB 4KKTA 3EN2A 2R7FA 4NXNL 4G7OC 2I5MX 4GLAC 2XRSD 3T4AC 4IUQA 3GTJH 2Z4IA 2N3SA 1CKMA 1S5ED 2QF7A 4KLKA 2MQHA 5C0XI 1QUQA 1Q86C 3VDYA 3EIVA 3MAQA 1A3TA 4TSSA 5LMNQ 3L2PA 2AKWB 5KNDA 4ZCKA 4XDXA 4B3ML 2ZTEA 4LF8L 1GM5A 4GN4B 3PO3H 4DV1L 4G7HC 1CKNA 2WKDA 1EYAA 5IYCH 5JJIA 4BXXH 3H0GG 4LF6Q 1EZ6A 5A2QE 2UXBL 4QQBX 4ULLA 3RN2A 1CK1A 4U68A 3S2DB 5BR8L 3H91A 1V1PA 2K5VA 2JA6H 1VQLA 1YBYA 4OELB 4QJFA 1L0YB 5I9PA 4IOAA 2EJGC 1WCMG 1HQMC 2NVYB 2YTYA 1SJED 1YJWA 2UUBL 3GTPB 3C3LA 1B44D 1XX8A 2MGSA 3I90A 3CCEA 1L0XB 2D2CC 1VQ6A 3AFPA 4FF2A 3HOWG 3A55A 4LF7L 5KNBA 4EVOA 4GOPC 1OXTA 2EXZA 4LFAQ 3H3VC 1FNUA 3BZCA 2DN8A 3J80L 1GKHA 3RLFA 3HKZB 2AHOB 4KY6A 2HHHQ 2BA1A 4B3TQ 2OTJA 4DV7Q 3HKZE 1F9RA 1VQIA 2HDLA 3U4VA 2NZ1D 3PGZA 1XJVA 4LFBQ 5IT9E 4KV6A 5JPNC 1BBWA 3KLSA 1L0WA 2JA5G 1WTWA 1HA5A 1KDCA 4KK7A 3GTMH 3W3AA 3QB3A 4WJ4A 1TWGH 4UAIA 1N32L 1EUJA 3KYHC 1SAPA 3T16A 1SROA 3RUZA 3KJPA 2E2JH 2F3WA 4ABNA 1SNCA 5M5XH 3CCJA 4DV0Q 4DR7Q 2DJGC 1KABA 2EYJA 1C7YA 3NHHA 4Y52H 1D1IA 2B2TC 5C4JB 1X55A 3TQYA 1XNQQ 1PH5A 1FYCA 3HEJA 1GHJA 3J80i 1Y8PB 2EZVA 1QE6A 4KKSA 5I6YA 4RWSC 3HOUH 1NAPA 2KENA 1VQOA 2N88A 3S1NB 2JK8A 1NY4A 1EQQA 5A2QL 3U4ZA 1Q1EA 4Z9CB 5IWAQ 1WFQA 1H9SB 4EQPA 1LT3D 3CQZB 5CV8A 1Q82C 4BA1I 2F0IA 4JI4L 3URYA 1Y14B 3OTOL 2R3ZA 1SXTA 1F2MA 4QF4A 4JI5L 1RJTA 4X66L 3CC7A 1EIHA 3Q6SA 3M4PA 4NXNQ 1TWAB 2B2VC 5IYDG 4AYBG 1AE3A 1EQTA 3KF8B 4OO1H 3HOVG 1LACA 4BY7H 2VXWA 3K5OA 1H95A 4ZLTF 1JMCA 2CCZA 3A54A 2CQAA 5DM63 1NR4A 3ZJYC 2EYFA 2SDFA 3KOJA 2JA7G 3T1HL 1JOQA 4B3MQ 2J0TD 5M3FG 4LF8Q 3NTHA 4CKBA 4DV1Q 1VQHA 1L1OA 3IL8A 4K2KA 3V96A 5IT9L 2F0WA 3Q8DA 4DV2L 2UXBQ 5M5WH 4O42A 4G4KA 5IY0A 3DHQA 2MO1A 5BR8Q 1VS0A 3I4NB 1NTGA 5LL6X 2JA8H 5C4ZA 4V0BA 4GN5A 4TVAB 3D4WA 1SN8A 3NBHA 5K36G 2YU9H 1UEAB 3K6OA 3TSSA 5C44B 1G51A 3MXNB 4HTHA 3EVQA 3S14B 1G8ZD 1OO9B 4LF7Q 1Y1VH 1W3SA 1BNZA 1HNZL 1EWCA 2XNAC 2B2WC 2B2UC 4QUFA 2NVXB 3HS0C 3DMUA 2IX3A 3A74A 3J7YW 1IBML 2G9HD 4Y7NH 1D2BA 2F0MA 1N34L 4KD4A 4YCVA 1BF4A 1YHQA 2F03A 1I6VC 1PTOH 3S9WA 1SFOB 3K5NA 3RLOA 3K0YA 2K1BA 4IALA 5C3EG 4R4OA 2MPMA 2ES2A 2VUMB 5JEAJ 4BS9A 2F0GA 3I3CA 4JI7L 4IJLA 2NVTB 1JICA 1AP0A 1N32Q 5J3BA 1PDQA 5EKLA 2IT1A 4HIDA 4C3IB 2GVAA 4HCEA 2ASBA 5T1IA 2CW0C 3UDXA 1AW7A 3MTSA 5KYIA 4WFN3 4ME3A 1I5FA 3FDTA 3SEBA 4DR4L 3K7AH 4RFBA 4HJ9A 4DR6L 2FJ2A 4BXXG 1B53A 2X69A 4A3EB 4JW0A 5JJZA 4JBJA 4EQNA 2WIIB 1K3RA 1QZGA 2HCCA 1E7ZA 2QA4A 5C0XJ 3V05A 1SE2A 1QOHA 2JA6G 2KA7A 4JI4Q 5J39A 2Z6KA 1XTCD 2LS01 5GAGC 3OTOQ 1WVLA 2PQAA 3K57A 3I4MB 3RD4A 1LLRD 2R61A 4X66Q 4JI5Q 4JBWA 3I2ZA 3FEWX 1KTKA 1O78A 2RSNA 3M4QA 4FXKC 5J1ZA 5JEAH 3HOZB 1LTSD 1G91A 1FJGL 4X62L 2Q8IB 1C8CA 1SNDA 3QOJA 5JJKA 1Y1WH 3QG1A 1JWUD 1O80A 1J6QA 1KL9A 2KCCA 2OF1A 3VYSA 1TWCH 4CBVA 1LTRD 3SGIA 3T1HQ 4JBMA 4OWXB 4AH6A 3S15H 4L5TA 2F0LA 1X3GA 2F0KA 4DV2Q 3V2TA 1EU4A 3MHBA 2EVBA 2BE5C 4G7ZC 1KRTA 4KY7A 2WFWA 5C0XH 3CCMA 1HTPA 1SYEA 1MSGA 1H9MA 3BZKA 1N36L 1UNSA 2OQ0A 3U58A 2E74C 1VMPA 4J6HA 4HJ5A 1F2YA 2J4XA 5E1FA 3GTKB 2IX1A 4P74A 5ELFA 2K50A 3B6YA 4FP5D 4TKOB 2Q2IA 3A5UA 2F0OA 1IL2A 5I9OA 4X6AH 4DF7A 4C2MH 5H1SE 4OONA 2ZXPA 1HNZQ 2H5XA 2QILA 3F8TA 3FKIH 1R9TB 3GTLH 4KN7C 2NBFA 1IBMQ 2JSOA 3EQLC 4L5QA 4HEDA 1PZKD 1WD1A 3HOXH 3H3VH 3SDZA 2XRQD 3NTKA 4MZ9A 4XTCS 3CCVA 1N34Q 2EYOA 3NK9A 4DAVA 4K8IA 1A2TA 3W1GA 4A3MH 1YJNA 3DEOA 1C9OA 2RBMA 4A93B 2EYLA 1HNXL 3ULPA 2K03A 3BVMA 1JR0D 3EJIA 1BQQT 3HZXA 3G71A 1XWEA 5IYBG 4BBRH 3UDFA 4GOPA 1TY0A 2RSOA 4HR7B 1TT2A 3BVGA 3TDQA 3TRZA 1QB5D 4DR4Q 1IL8A 4DFAA 4XIGS 2MO0A 2L55A 5IGCA 1W2BA 5FOBB 5KIXA 5IP7G 1A2UA 1S5CD 3H0GH 5M3MB 2XGTA 4JI6L 3OW2A 2P5ZX 1VQ4A 4PZ8A 2KHSA 1EOTA 2VNUD 3VYRA 4MNOA 2JA8G 1A8VA 4A3JB 1Q1BA 3D4DA 3ULLA 3GTJB 1KRSA 1U9RA 2LMCB 4YWKA 2K28A 4FYDA 4RHRA 4A3BH 3I70A 2XN9C 1NMGA 1PH3A 1WCMH 2YTXA 1WJJA 3CMAA 2B2TA 5EKKA 4NP5A 4LWCA 1TU2B 3HOWH 1FJGQ 4X62Q 3PO3B 1STNA 1MIUA 2LFNA 2QEXA 1J8IA 2JEAI 1VQGA 2AUKA 5EBCA 2O5JC 4LJZC 2GA4B 3GTQH 1PA6A 4IURA 3TP5A 3NQIA 4KMUC 3S17H 2E2HB 1DGSA 2A5HA 3ONAB 2M2LA 1HUMA 2K04A 3L7ZC 4HIKA 3HP3A 4DK1A 3HG9A 1J5EL 1LTTD 1LM0A 1EQRA 2CWPA 1LTAD 2B2VA 5BN3A 1K0SA 3W1BA 1N36Q 2FHTA 2ID0A 1CUKA 1DCZA 4FO2A 1I4XA 1UE6A 4J8QA 5EKIA 4C3HB 5E3FA 4WJ3M 4GKKL 4BY1G 3PUVA 1PV4A 4ZK9B 3C46A 1QILA 3L3OC 4NXMQ 5I6WA 1EY7A 3TZUA 3OW7A 1KD1C 1HJPA 5CBAE 2AQ1B 4H7BA 4A3KB 4JG2A 2QW7A 3U9SA 2A68D 3A7LA 3TP6A 3U9OA 1EFWA 1MJCA 4HSPA 3M4OH 2O2LD 3RZDB 1HRJA 3SHLA 5FLMH 2E75C 5C6AA 1JJCB 4ME5A 4GLXA 1TWGB 4QB4A 3UE1A 1SNMA 5JPMC 2A1AA 2E2JB 3KF6B 2A68C 2IHFA 3BDLA 5JEAG 2PMZB 1BR9A 1DYQA 5C5MA 4N9PA 5IYDH 1HNXQ 3J7AV 4KJOA 2PMZE 2F0QA 2EYMA 3FHWA 3HOUB 1UUPA 3A8IE 3DWPA 4R8NA 1X3QA 1WI5A 5DLQE 5GAEC 1NUCA 4LK1C 3RNUA 2Y0SG 1SDFA 1BCPB 2B2UA 2B2WA 5GADC 3D8GA 1WTRA 2JQOA 1FD7D 1YHAA 4YHHL 4H44C 5M3FH 3P1HA 1SNOA 4R9WA 5CV4A 2I5HA 4A4IA 3NWTA 2WB1E 4K0KL 1DOKA 2DY8A 3S2HH 3J7A5 2JP1A 3NE5B 4BY7B 2K14A 1HZBA 3OMCA 1YNXA 1KDAA 1KQSA 2EIFA 2K7VA 1YHBA 3OIQA 5FJ8G 1OXUA 3RZOH 1Q8IA 1RHPA 1ENAA 1IBLL 2A6HD 2KCNA 2JJQA 4UP8A 2RDHA 2F0PA 3ZYYX 5CV7A 2A69D 2L15A 3S24A 5IODA 4X64Q 1EY0A 1Y8OB 3FKIG 1S4ZA 1PHJA 2F4VL 1I94L 1K28A 1CT1D 3HOXG 2CVRA 5M5WB 4POGA 1ET9A 1W6KA 3PUYA 1DD2A 4NDXA 1P16A 5DEHA 2R92H 3HKSA 1UWVA 3CAMA 2H1EA 4O0AA 2A69C 2FXQA 1TKWB 4C1NI 3G6JB 1FVIA 4V190 2VQFL 3I73A 2JA9A 3WDNA 2R7ZG 2LSSA 1XPOA 2YU9B 4EQ5A 1Y69U 4U673 2X6LA 1B9NA 2MFIA 2IJ0A 4RH6A 5C5LA 1J5EQ 4YCUA 1NJIC 3GTGH 5DNFA 3PIO3 1MHWC 1Y1VB 2UUCL 4BBRG 4UDUC 4DV5L 5FLXc 2AMCB 4PZ7A 2ICIA 4GKKQ 1LTGD 1TS4A 4Y7NB 4A3GB 4K6LA 3FRPB 2F0FA 4OIKA 1K8AC 1LT5D 4CKCA 2CFMA 1PTOB 2PW7A 1DOLA 3PF4A 4K5WA 4CKEA 1GVPA 1I4PA 5ELOA 2XIWA 2O4XA 1QJOA 3PUZA 2L9HA 1VQFA 3PMFA 3TZDA 1SR3A 1STAA 3D6CA 4MTNA 4RGOS 2EYHA 1BDOA 3H3VI 1WTQA 4A3BG 5LHY1 1A3VA 3N6RA 1IKMA 3SK5A 3DM1A 3PF5A 5GAHC 2I0QA 4HN7A 1E2VA 1S5DD 2NWGA 1GUOA 4KHVA 1EWIA 5G3LD 2K4KA 1B8AA 3CHBD 3VR2A 2EY2A 3WOFA 2CH4A 1EEFD 2RVLA 1ILPA 2UXCL 1RKNA 2K5HA 4YHHQ 1AH9A 1RF2D 2N55A 5D65A 2WAQE 3PV0A 1A6XA 3OMGA 4DR3L 1VQJA 4HJ8A 1FGUA 3T56B 4K0KQ 2PQEA 3PUWA 3PO2H 2K01A 4H13C 2BA0A 3DM3A 3FPPA 4L5SA 3QO2A 4HJAA 2K05A 1RTNA 1S5BD 3GD7A 1SBBB 3ULJA 1LTID 1F9SA 4C3JG 4DNRB 1CQVA 1SNPA 4JI8L 2IPKD 5EQ0A 1ZKOA 2DJFC 3ITPA 2NUCA 1Y1WB 3U50C 4HMIA 1IBLQ 4A3DH 1GUTA 1TQOA 3EBEA 1AEXA 1M8AA 4RGTA 5COYA 3S1MB 3S15B 4G57A 3K0XA 2F4VQ 1I94Q 3PUXA 4RMFA 2K5WA 5FLMG 1GHKA 1X32A 1E0BA 1TWHH 1X6OA 1EWHA 1YVCA 4JI3L 2VQFQ 1STEA 1XNRL 1I4HA 2JXMB 3D0FA 3NEMA 2E8GA 3PIPA 1SSOA 4DU9A 2F0UA 1I50H 2F0VA 1PH1A 3C2PA 2VS1A 4NB3A 3DLLA 4EGVA 4C2MB 2OCEA 2UUCQ 5L37A 5IYBH 4YWLA 3E5SA 4DV5Q 1IW7D 3HOYG 1SJHD 2ZT9C 4XYOA 1K8OA 5EBDA 1EY8A 1QVCA 3KDFA 4MN3A 1X3FA 2EE1A 4KTAA 2J7ZA 4UPAA 1JWSD 3M85A 4B3SL 2G5DA 4IFDI 5IP7H 1LUZA 1AZPA 2Z6BA 3CCUA 1IW7C 1EQVA 4A3MB 3NWSA 2HIVA 2EJMA 5IGFA 2EY5A 4WJWA 4TRDA 3D4RA 2YV5A 3OWEB 1CKOA 1BO0A 3M4YA 5C4XB 4RCNA 3GQBA 1TR5A 5I4DA 2UUBQ 5NUCA 1CHPD 5IGBA 4ZYSA 4GN3B 3A0JA 4B9WA 3NELA 4B08A 2YYZA 4IUPA 2F3IA 5FO8B 3CCSA 2F0TA 4DAYA 1HXYD 1A63A 3MA2B 4RGMA 4LUZA 3H0GB 1QCBD 5D14A 4IO9A 1PRTB 1GO3E 2UXCQ 4GS3A 5JJLA 2F0SA 2R92G 4XXEA 3VR4A 4JC0A 1S72A 1HQRD 3CRKC 4DUYL 2PO4A 4DR3Q 3K81C 3UDIA 1NCVA 1ML0D 2F0HA 4LW1A 2I5LX 2C9OA 4R1JA 1V1OA 2JEBI 1PH4A 3RR5A 1K83B 1VF7A 1WCMB 4H0LC 1Z6HA 4IJHA 2UXDL 3GO5A 4DKAC 2O5IC 1V1QA 1NBWA 3IKJA 1ESFA 4DXGA 3K5MA 4H02A 4JI8Q 2A8VA 1BBUA 3OSOA 4ALPA 2CHBD 1KHIA 4GNXB 4BY1H 5D3DA 2F1MA 1VQ5A 3S2DH 4R4IA 2DY7A 1UE1A 5GQOA 2BDOA 3GTQB 4HIMA 2QDBA 3S17B 1D5MC 1SE4A 2QDLA 4IUTA 2L4NA 3GTOH 1GOZA 2R93G 3T53B 5TSSA 4OX9L 4DPGA 2VL6A 3S16B 2ENBA 2JA5B 3SXHA 4K2LA 3AMUA 1PFBA 2OT2A 4B3RL 2MP1A 2RCFA 4I7AA 2NN6G 5HGQA 2SNMA 3OWFA 1X3EA 4CGYB 1G291 1XNRQ 4JI3Q 3J81E 3TEHB 1NMFA 3MXGA 4CDCC 1Y8NB 1KLUD 1PH9A 1O7LA 3Q22A 3RN5A 2B3GA 2ZXRA 5CC4A 1G2TA 4RG1A 3KLRA 3ND8A 3W2DA 2RCNA 3ND9A 4HIOA 5CV5A 1AZQA 5T1GA 2KCMA 4K14A 3GV3A 3EROA 3E6ZX 4QMGA 3AB9A 3F1ZA 4DK0A 1BOSA 4B3SQ 3LGJA 2RHSB 4DAMA 2R7DA 1ILQA 1HR0W 1Q81C 2HDMA 4A3FG 3PO2G 4APVA 1S3OA 1X65A 4ODGA 5CYUA 2MNAA 1L2FA 4AYBB 3LWUA 1EOVA 1JJGA 3VR6A 3HOVB 1ZYRD 1EY9A 2V4DA 4AYBE 2HIXA 2PI2E 2L12A 5LL6S 1B50A 1C0AA 2HUGA 2LXJA 2HQEA 2NN6I 1IYVA 3SE0A 5FJ8H 2C35B 4A3DG 2C5CA 2D9UA 1VCIA 3PIP3 5M5YB 2ZJRA 2JA7B 5M3FB 2D62A 1ZYRC 1EEID 4QL5A 1IYJB 4CDFC 1ONLA 3QIAA 1KAAA 1U0LA 1BVSA 5DAUA 4F88A 1TWAH 1R4QB 1U4MA 2VW9A 1ZEQX 5JAVA
chains in the Genus database with same CATH topology
1RTOA 3S2HB 5JOBA 4BBSB 3J81L 1B3AA 1EZ8A 1H9SA 2NVQB 4CJ1B 1R4PB 3RZOB 5ELCA 2L1BA 1OXSC 1HTLD 1TVXA 1KNAA 2L0CA 3EFXD 3MFYA 2PYKA 2X6GA 2BCOA 3ERQA 3KF8A 4C1NK 2Z1CA 1CM9A 3TP8A 4MIUA 1JOKA 5C3EB 4DNTB 4A3IB 3TMEA 1PZID 2EDGA 1VF5C 1V1PB 3DWAA 3WOEA 4ZUIA 1CQFA 1W6JA 3GTGB 2XWJB 1MSHA 5FK9C 1FGBD 2XVSA 4IFDJ 1F9QA 2WP8J 4NKLA 5E4WC 1BBXC 4HSVA 4ID6A 2EOTA 1BCPD 1STGA 3A8KE 4KI0A 3MXNA 3SK8A 1O7ZA 4XQJA 1EY6A 2JA6B 3QWNA 1E2WA 1BCPC 1JORA 1BUVT 4DA2A 3MEHA 3NP8A 1S5FD 4K5VA 1WTOA 1MGSA 4XT3B 1ESRA 3X3NA 2IL8A 5CV9A 4KD3A 1D5ZC 5K5PA 3MWYW 4IFDH 1H9JA 5E4XA 2E2DC 4FF3A 2F0JA 2I46A 5HGTA 4DXFA 3OHXC 2KVMA 4J1MA 3GTMB 1YNJD 4X3TA 4K5XA 3GV6A 4BA2I 2K6AA 5M5XB 1LV9A 1SYCA 3K5LA 3BG3A 4P2CB 1YNJC 4I7ZC 2QKIC 4IN3A 4OL7A 3FMCA 4Q0FA 4JK1C 3VR3A 2Q8RE 1PTOD 1BXTA 5FO9B 2WB1B 5ELEA 2PZTA 1TWHB 1I4RA 2MHVA 1AN8A 2M00A 3A56A 2DNCA 5EJWA 4IQZA 1I50B 4K8JA 5EPLA 1EL0A 2B39A 1D6EC 1SE3A 1EFID 2F0EA 3LX0A 1CZWA 4CHTB 1CFMA 4XYQA 3R3OA 1SYDA 3C1FA 2Z4HA 1B4OA 1KDBA 1SMYD 1QNKA 4Q5VA 4N9TA 4F7XA 2BOSA 2A6HC 2B2YA 2JA8B 1V43A 1F2LA 5KEEA 1SMYC 1PLFA 3DXJC 1QG7A 2NYZD 1Q12A 2FINB 3R2TA 2LY7A 2SNSA 2TSSA 3VA5A 5DM73 1OXXK 1HA6A 1GUNA 2KEDA 3EA6A 1GXDC 1O7YA 1WTVA 4LMQD 3DWQA 1MBYA 1DZ1A 5CMDA 1A15A 2SEBD 3IFDA 3NBIA 2EYPA 3TBIB 2WACA 2FMCA 5D3IB 1K8MA 3TP7A 5IGEA 4CJ2C 1U4LA 4B9XA 2NN6H 1CA6A 1OXVA 2F0NA 4XQQA 4BY1B 3K7AB 1RD9D 1UAPA 4X3KA 2AWOA 3SK6A 1M4VA 3GTOB 4O1NA 3Q23A 2WAQB 2RDGA 4KKUA 1BCPF 3R2IA 5FO7B 3P7JA 4PMCA 4C3IG 4HCSA 1LT6D 5AFWA 4WORA 3MXUA 2DNEA 5F2DA 2K33A 2ICEC 3KUPA 3CKIB 3H09A 1PYWD 4L8JA 2XWBB 2Y0SB 3M7GA 4IFDG 1TWCB 2WV6D 3H6MA 3F2UA 1PRTD 1HFNA 3CU7A 1Z7TA 4BWGB 4EQOA 1EY4A 3OOCA 2JE6I 3BS1A 1IKLA 4KJNA 1PRTC 5CBEE 5ISRA 3NXWA 2F3VA 2AQ2B 1WTPA 1JCKB 1MD2D 4FNFA 1ICWA 3VYUA 3J7AF 3Q24A 3FPUB 2FMMA 1I4GA 3FKIB 3GTLB 3HGBA 4OGQC 3HOXB 5EGTA 1JWMD 3X3MA 1U4RA 5C3XA 2LKVA 4ZRZA 4LAAA 3MVVA 3CRLC 4PMBA 1PTOF 2R7ZB 3KLSX 2OEOA 3OIPA 1AFPA 3SVMA 3JAME 1C48A 1WTXA 1DONA 3Q0AA 4DAPA 2L5TA 3BYTB 2OXPA 3MC0B 4FF4A 2EY1A 5EPKA 4BBRB 3AU7A 4X3UA 4OIJA 2TMPA 1PMRA 4IUUA 4L63B 3R8BA 4PNYA 1GUSA 4PQXA 1LABA 4ZKBB 1ZXTA 1JOOA 1FNWA 4KY5A 1PFMA 1TS3A 3IFTA 1KLGD 1CTMA 2RDFA 4A3BB 2KOLA 2L11A 2SOBA 3T13A 3P75A 2R6GA 4XQNA 1T5XD 1EYCA 3HOWB 1X3PA 3O13A 3E0JA 1WD0A 4RA8A 3IAYA 1D1KA 4RCOA 2CW0D 1LO5D 1FR3A 3D31A 1XXGA 1STHA 4RKLA 2AQ3B 1D5XC 2KJXA 4CJ0B 2NTTA 1IHZA 1B9MA 2B2YC 1HHVA 1E2ZA 1HPCA 3OPOA 4X3SA 3M7NA 2AWNA 1TS2A 1Q90A 3JAML 3S1QB 4IZ8A 5CORA 5KRUA 4C3JB 2HCIA 1F9PA 5CV6A 2NB0A 3VA7A 4WRDA 4FXGC 3DUZA 1CI3M 2RQXA 1DXMA 1H9RA 1U4PA 3K58A 1HCZA 5IOCA 3NSWA 5G3LF 5EPJA 1PXUA 4RHSA 4RKBA 4F8MA 3M4OB 1CA5A 4NW2A 4MHEA 1HFGA 2QEJC 4K6DA 2KUMA 5FLXE 4KN4C 2Z8LA 1JQYD 5A35A 3HRZC 3K59A 1SNQA 1EU3A 4XT1B 4FXDA 1FNVA 4C3HG 5BN4A 1NR2A 4QCLA 3FVQA 2BE5D 5ELBA 1RDPD 1KNEA 1SEBD 1YNND 4ZAIA 2E2IB 5IGGA 5C4HA 3NUCA 2WINB 5I2XA 3VYTA 1C4QA 1B1ZA 1H9KA 1VDZA 3HOYB 1Z47A 1JC7A 2PW5A 5KGUA 3RMHA 2PPBC 3KK7A 3G7LA 1YNNC 3I4LA 2PCFB 2MJ8A 1RCVD 1GUGA 1IYUA 4FF1A 3TN2A 2K5QA 2RKSA 5HURA 2QCPX 1TWFB 1PRTF 2B8FA 1B2TA 3SR1A 3LWEA 4GZYC 3BDOA 1ENCA 4QIWB 1I6HB 2EPBA 2M9VA 5KNCA 5IGDA 4FVMA 3VR5A 5IIFA 1CHQD 3MXPA 2Q8TA 3LNNA 4ILWA 4ZUJA 2R92B 1A3UA 4OO1G 1II3A 5FLXL 3D6WA 4L6TB 2RA4A 1DOMA 1CZGA 4YIJA 3NPPA 4S3SA 2PNRC 2BDNA 5BN5A 1TS5A 4PMWA 3T51B 1SYBA 4DN4M 1RODA 2AUJD 2I07B 4KHZA 3MZ5A 1T5EA 1I3QB 1QNUA 2A6ED 4NMZA 4HAEA 4I65A 4PV1C 3N52A 4R8IA 2R93B 4M8AA 2XSCA 3QJYA 3SK4A 3DEPA 3A7AB 2FFKB 2A6EC 1V8QA 4ZKCB 2A74C 4DGZA 1G6ZA 1STBA 3QOLA 4OO1I 1GJXA 4TQUS 3NTIA 1VMCA 1JE4A 1EYDA 5JVG3 2EY6A 2K32A 2KQ3A 5CR3A 2D5DA 3M3YB 2PZUA 4ZQ3A 4M1UB 2B8GA 5KYLA 4HMJA 2H4OA 1TIID 3MFGA 4A3FB 1G2SA 3PO2B 1PZJD 4E6IA 3UI2A 5ELDA 4F87A 1JB3A 2MUYA 2JYOA 2IWHA 1QWYA 5J22A 2VB2X 2IX0A 3I72A 4IUNA 1STYA 1SYFA 1Q3LA 2PZWA 4A3DB 1DJRD 2EJFC 3KBXA 3H94A 1F77A 1MI2A 2A73B 1EIGA 3R93A 2ZXOA 1TY2A 5M9OA 2F4IA 3L9AX 1LT4D 3KBGA 1PTOC 1J9OA 2G9DA 3C1EA 3P20A 2E76C 1DM0B 1LTBD 1HUNA 3GP7A 4RGNA 2NTSA 3BYYB 3I8ZA 5C0XG 1ET6A 1F2ZA 1SYGA 2KEEA 1PFNA 5K36H 2K5DA 3BVZA 1ENFA 3I91A 3S1RB 2VB3X 3BDCA 3NQTA 1GUWA 4OHJA 1EY5A 3A8JE 2IW3A 5I2YA 2KECA 5C3WA 3BZDB 3J80E 4QUCA 2WKCA 1NSNS 5JVH3 4RAUC 5CGKA 2F0DA 1XYIA 3D3RA 4IUVA 4C56C 1I4QA 2B63B 5FKAC 4KKTA 4G7OC 2XRSD 3T4AC 4IUQA 2Z4IA 1S5ED 2QF7A 5C0XI 3MAQA 1A3TA 4TSSA 5KNDA 4XDXA 4G7HC 2WKDA 1EYAA 1EZ6A 5A2QE 4ULLA 1CK1A 4U68A 3S2DB 3H91A 1V1PA 1L0YB 5I9PA 2EJGC 1HQMC 2NVYB 1SJED 3GTPB 3C3LA 1B44D 1XX8A 2MGSA 3I90A 1L0XB 2D2CC 4FF2A 3A55A 5KNBA 4EVOA 1OXTA 2EXZA 3H3VC 1FNUA 2DN8A 3J80L 3RLFA 3HKZB 4KY6A 2BA1A 1F9RA 2HDLA 2NZ1D 5IT9E 4KV6A 5JPNC 3KLSA 1WTWA 1HA5A 1KDCA 4KK7A 3W3AA 3QB3A 4UAIA 3T16A 1SAPA 3RUZA 2F3WA 4ABNA 1SNCA 1KABA 2EYJA 3NHHA 1D1IA 2B2TC 5C4JB 1FYCA 3HEJA 1GHJA 2EZVA 1Y8PB 1QE6A 4KKSA 5I6YA 4RWSC 1NAPA 2N88A 3S1NB 5A2QL 1Q1EA 4Z9CB 1H9SB 4EQPA 1LT3D 3CQZB 5CV8A 4BA1I 2F0IA 3URYA 2R3ZA 1SXTA 1F2MA 4QF4A 1RJTA 1EIHA 3Q6SA 1TWAB 2B2VC 1EQTA 4OO1H 1LACA 2VXWA 3K5OA 4ZLTF 3A54A 2CQAA 5DM63 1NR4A 2EYFA 2SDFA 1JOQA 2J0TD 3NTHA 4CKBA 3IL8A 4K2KA 3V96A 5IT9L 2F0WA 4O42A 4G4KA 3DHQA 3I4NB 5LL6X 5C4ZA 4V0BA 3D4WA 3NBHA 5K36G 1UEAB 3K6OA 3TSSA 5C44B 4HTHA 3EVQA 3S14B 1G8ZD 1OO9B 1BNZA 1EWCA 2XNAC 2B2WC 2B2UC 4QUFA 2NVXB 3HS0C 3DMUA 2IX3A 3J7YW 2G9HD 1D2BA 2F0MA 4KD4A 1BF4A 2F03A 1I6VC 1PTOH 3S9WA 1SFOB 3K5NA 3K0YA 2K1BA 4IALA 2MPMA 2VUMB 5JEAJ 4BS9A 2F0GA 3I3CA 2NVTB 1JICA 1AP0A 1PDQA 5EKLA 2IT1A 4C3IB 4HCEA 5T1IA 2CW0C 1AW7A 3MTSA 5KYIA 4WFN3 3FDTA 3SEBA 4RFBA 2FJ2A 1B53A 2X69A 4A3EB 5JJZA 4EQNA 2WIIB 2HCCA 5C0XJ 3V05A 1SE2A 1QOHA 2KA7A 5J39A 1XTCD 2LS01 1WVLA 3K57A 3I4MB 3RD4A 1LLRD 2R61A 4JBWA 3FEWX 1KTKA 1O78A 2RSNA 4FXKC 5J1ZA 5JEAH 3HOZB 1LTSD 1G91A 2Q8IB 1C8CA 1SNDA 3QOJA 3QG1A 1JWUD 1O80A 2KCCA 3VYSA 2OF1A 4CBVA 1LTRD 2F0LA 2F0KA 3V2TA 1EU4A 3MHBA 2EVBA 2BE5C 4G7ZC 4KY7A 5C0XH 1HTPA 1SYEA 1MSGA 1H9MA 1UNSA 2E74C 1VMPA 4J6HA 1F2YA 2J4XA 5E1FA 3GTKB 2IX1A 5ELFA 4FP5D 4TKOB 2F0OA 5I9OA 4DF7A 2ZXPA 2QILA 1R9TB 4KN7C 2NBFA 2JSOA 3EQLC 4HEDA 1PZKD 1WD1A 3SDZA 2XRQD 3NTKA 4XTCS 2EYOA 3NK9A 4DAVA 4K8IA 1A2TA 3DEOA 2RBMA 4A93B 2EYLA 2K03A 3BVMA 1JR0D 3EJIA 1BQQT 3HZXA 1XWEA 1TY0A 2RSOA 4HR7B 1TT2A 3BVGA 3TDQA 1QB5D 1IL8A 4DFAA 4XIGS 2L55A 5IGCA 5FOBB 5KIXA 1A2UA 1S5CD 5M3MB 2KHSA 1EOTA 2VNUD 3VYRA 4A3JB 1Q1BA 3D4DA 3GTJB 1U9RA 2LMCB 2K28A 4FYDA 4RHRA 3I70A 2XN9C 2B2TA 5EKKA 4NP5A 1TU2B 3PO3B 1STNA 2LFNA 1J8IA 2JEAI 2AUKA 5EBCA 2O5JC 4LJZC 2GA4B 4IURA 3TP5A 3NQIA 4KMUC 2E2HB 2A5HA 3ONAB 2M2LA 1HUMA 2K04A 3L7ZC 3HP3A 4DK1A 3HG9A 1LTTD 1LTAD 2B2VA 5BN3A 2FHTA 2ID0A 1DCZA 4FO2A 1I4XA 4J8QA 5EKIA 4C3HB 5E3FA 3PUVA 4ZK9B 3C46A 1QILA 3L3OC 5I6WA 1EY7A 3TZUA 3OW7A 5CBAE 2AQ1B 4H7BA 4A3KB 3U9SA 2A68D 3A7LA 3TP6A 3U9OA 4HSPA 2O2LD 3RZDB 1HRJA 3SHLA 2E75C 5C6AA 4ME5A 1TWGB 4QB4A 1SNMA 5JPMC 2E2JB 2A68C 3BDLA 5JEAG 2PMZB 1BR9A 1DYQA 5C5MA 4N9PA 3J7AV 4KJOA 2F0QA 2EYMA 3HOUB 1UUPA 3A8IE 3DWPA 4R8NA 1X3QA 1NUCA 4LK1C 1SDFA 1BCPB 2B2UA 2B2WA 3D8GA 1WTRA 1FD7D 4H44C 3P1HA 1SNOA 4R9WA 5CV4A 3NWTA 1DOKA 2DY8A 2JP1A 3NE5B 4BY7B 3OMCA 1KDAA 2K7VA 3OIQA 1OXUA 1Q8IA 1RHPA 1ENAA 2A6HD 2KCNA 2RDHA 2F0PA 3ZYYX 5CV7A 2A69D 5IODA 1EY0A 1Y8OB 1S4ZA 1CT1D 2CVRA 5M5WB 1ET9A 1W6KA 3PUYA 1DD2A 4NDXA 5DEHA 2H1EA 2A69C 1TKWB 4C1NI 3G6JB 4V190 3I73A 3WDNA 2YU9B 1Y69U 4U673 2X6LA 1B9NA 2IJ0A 4RH6A 5C5LA 5DNFA 3PIO3 1Y1VB 4UDUC 2ICIA 1LTGD 1TS4A 4Y7NB 4A3GB 4K6LA 3FRPB 2F0FA 4OIKA 1LT5D 4CKCA 1PTOB 2PW7A 1DOLA 4K5WA 4CKEA 1I4PA 2XIWA 2O4XA 1QJOA 3PUZA 2L9HA 3PMFA 3TZDA 1STAA 3D6CA 4RGOS 2EYHA 1BDOA 1WTQA 5LHY1 1A3VA 3N6RA 1IKMA 3SK5A 3DM1A 4HN7A 1E2VA 1S5DD 2NWGA 1GUOA 4KHVA 5G3LD 3CHBD 3VR2A 2EY2A 3WOFA 1EEFD 2RVLA 1ILPA 1RKNA 1RF2D 2N55A 5D65A 3PV0A 1A6XA 3OMGA 3T56B 2PQEA 3PUWA 2K01A 4H13C 2BA0A 3FPPA 3QO2A 2K05A 1S5BD 1RTNA 3GD7A 1SBBB 1LTID 1F9SA 4C3JG 4DNRB 1CQVA 1SNPA 2IPKD 5EQ0A 1ZKOA 3ITPA 2NUCA 1Y1WB 4HMIA 1GUTA 1TQOA 1AEXA 1M8AA 4RGTA 5COYA 3S1MB 3S15B 4G57A 3PUXA 2K5WA 1GHKA 1X32A 1E0BA 1EWHA 1STEA 1I4HA 2JXMB 1SSOA 4DU9A 2F0UA 2F0VA 3C2PA 4EGVA 4C2MB 3E5SA 1IW7D 1SJHD 2ZT9C 4XYOA 1K8OA 5EBDA 1EY8A 4MN3A 2EE1A 4KTAA 2J7ZA 1JWSD 3M85A 4IFDI 1AZPA 1IW7C 1EQVA 4A3MB 3NWSA 2EJMA 5IGFA 2EY5A 4WJWA 4TRDA 3D4RA 3OWEB 1BO0A 3M4YA 5C4XB 4RCNA 3GQBA 1TR5A 5I4DA 5NUCA 1CHPD 5IGBA 4ZYSA 4B9WA 4B08A 2YYZA 4IUPA 5FO8B 2F0TA 4DAYA 1HXYD 3MA2B 4RGMA 3H0GB 1QCBD 5D14A 1PRTB 2F0SA 4XXEA 3VR4A 1HQRD 3CRKC 2PO4A 1NCVA 1ML0D 2F0HA 2C9OA 1V1OA 2JEBI 1K83B 1VF7A 1WCMB 4H0LC 1Z6HA 3GO5A 2O5IC 3IKJA 4DXGA 1ESFA 3K5MA 3OSOA 2CHBD 5D3DA 2F1MA 2DY7A 2BDOA 3GTQB 2QDBA 3S17B 1D5MC 1SE4A 4IUTA 2L4NA 1GOZA 3T53B 5TSSA 3S16B 2ENBA 2JA5B 3SXHA 4K2LA 3AMUA 1PFBA 2OT2A 2MP1A 2NN6G 2SNMA 3OWFA 4CGYB 1G291 3J81E 3MXGA 1Y8NB 1KLUD 1O7LA 3Q22A 2ZXRA 5CC4A 1G2TA 3KLRA 3ND8A 3W2DA 3ND9A 5CV5A 1AZQA 5T1GA 4K14A 3GV3A 3EROA 3E6ZX 4QMGA 3AB9A 4DK0A 1BOSA 1ILQA 2HDMA 4ODGA 5CYUA 4AYBB 3LWUA 3VR6A 3HOVB 1ZYRD 1EY9A 2V4DA 2L12A 5LL6S 1B50A 2HUGA 2HQEA 2NN6I 1IYVA 3SE0A 2C5CA 2D9UA 1VCIA 3PIP3 5M5YB 2JA7B 5M3FB 2D62A 1ZYRC 1EEID 1ONLA 3QIAA 1KAAA 5DAUA 4F88A 1R4QB 1U4MA 1ZEQX 5JAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNM A;  1JOQ A;  4DFA A;  3SK4 A;  5IGG A;  5C4H A;  1JOO A;  3NUC A;  5K5P A;  2F0F A;  5JOB A;  3C1E A;  5KEE A;  4KY5 A;  5IGC A;  4K2K A;  3BDL A;  5J1Z A;  5KIX A;  2F0W A;  2PW7 A;  1A2U A;  2RDF A;  5C5M A;  3H6M A;  2PW5 A;  4DU9 A;  2F0U A;  4N9P A;  2F0V A;  2QDB A;  4K5W A;  4DGZ A;  5KGU A;  4KJO A;  3T13 A;  1EZ8 A;  2SOB A;  1STB A;  3DHQ A;  4EVO A;  3P75 A;  2F0Q A;  2KHS A;  3QOL A;  2EXZ A;  2O4X A;  2F0J A;  2EYM A;  2SNS A;  3VA5 A;  1SND A;  4R8N A;  3QOJ A;  2ENB A;  5C4Z A;  1F2Z A;  5HGT A;  3PMF A;  1EYC A;  1NUC A;  1SYG A;  3SXH A;  3D4D A;  3E5S A;  1STA A;  3D6C A;  1EYD A;  4K2L A;  2OF1 A;  3D4W A;  4J1M A;  3D8G A;  4KY6 A;  2EYH A;  1U9R A;  4EQO A;  1EY4 A;  2EY6 A;  4K5X A;  2RKS A;  1EY8 A;  5HUR A;  1A3V A;  2PYK A;  3SK5 A;  2KQ3 A;  2SNM A;  3OWF A;  5CR3 A;  3P1H A;  3ERQ A;  4KJN A;  1SNO A;  4KV6 A;  4KTA A;  2F0L A;  5CV4 A;  3SR1 A;  2F0K A;  1SYC A;  2PZU A;  3BDC A;  3NQT A;  3EVQ A;  4HTH A;  4NP5 A;  1EY5 A;  5EKK A;  3V2T A;  4KHV A;  1STH A;  1EQV A;  3NXW A;  4RKL A;  4ZQ3 A;  1KDC A;  2F3V A;  3MHB A;  1ENC A;  3TP8 A;  2EY5 A;  3QB3 A;  1STN A;  2EYP A;  4HMJ A;  4MIU A;  2WAC A;  4KY7 A;  5C3W A;  3DMU A;  1JOK A;  4TRD A;  5CC4 A;  2EY2 A;  1NSN S;  1IHZ A;  1SYE A;  3T16 A;  3TME A;  2F0M A;  3RUZ A;  2F3W A;  1SNC A;  4J6H A;  5IGD A;  4OL7 A;  4KD4 A;  1F2Y A;  3TP7 A;  1RKN A;  5IGE A;  1KAB A;  2EYJ A;  3OMC A;  1KDA A;  2F0D A;  3NHH A;  5CV5 A;  4IZ8 A;  5E1F A;  5CGK A;  4E6I A;  1TR5 A;  5IIF A;  3TP5 A;  4K14 A;  4ZUI A;  4B9X A;  3S9W A;  3MXP A;  5NUC A;  5EGT A;  3ERO A;  5KRU A;  3HEJ A;  3OMG A;  2F0O A;  4IAL A;  4QMG A;  5IGB A;  1ENA A;  5I6Y A;  5I9O A;  5CV6 A;  4ZUJ A;  4DF7 A;  5C3X A;  2F0N A;  4B9W A;  2PZT A;  2F0P A;  1A3U A;  4NKL A;  2F0G A;  2LKV A;  5J22 A;  5CV7 A;  2PQE A;  1II3 A;  5KYL A;  4WRD A;  5IOD A;  1EY0 A;  2F0T A;  4LAA A;  2M00 A;  3MVV A;  4IUN A;  4ODG A;  1STY A;  4PMB A;  1SYF A;  2PZW A;  4ID6 A;  4YIJ A;  1STG A;  5EKL A;  4S3S A;  4K8J A;  2OEO A;  3SK6 A;  4EQP A;  5IOC A;  5CV8 A;  4NDX A;  5DEH A;  2EYO A;  2F0S A;  1A3T A;  2F0I A;  3NK9 A;  1SNP A;  1EY9 A;  5KYI A;  4K8I A;  2OXP A;  5ISR A;  5E3F A;  1A2T A;  2NUC A;  3ITP A;  4RKB A;  3SK8 A;  4F8M A;  2F0E A;  3LX0 A;  1SYB A;  1EY6 A;  2EY1 A;  2HQE A;  1F2M A;  2F0H A;  4HMI A;  4QF4 A;  5I6W A;  5M9O A;  1EY7 A;  3R3O A;  1EYA A;  1JOR A;  1SYD A;  1TQO A;  4PMC A;  5IGF A;  4K6D A;  2RBM A;  4H7B A;  1EZ6 A;  2EYL A;  4EQN A;  3MZ5 A;  3C1F A;  1AEX A;  3MEH A;  4WOR A;  5C5L A;  1SNQ A;  4G57 A;  1KDB A;  3HZX A;  3EJI A;  3NP8 A;  5F2D A;  3TP6 A;  3U9O A;  4K5V A;  1KAA A;  4N9T A;  3SHL A;  4PNY A;  4F7X A;  4NMZ A;  4I65 A;  5C6A A;  5DAU A;  2EYF A;  4ME5 A;  3OSO A;  4KD3 A;  5CV9 A;  5J39 A;  1TT2 A;  5I9P A;  5JAV A;  4QB4 A; 
#chains in the Genus database with same CATH topology
 1RTO A;  4DUY Q;  3S2H B;  5JOB A;  4BBS B;  2RF4 A;  3J81 L;  2R7Z H;  1B3A A;  2UXD Q;  4LF5 L;  1EZ8 A;  1H9S A;  4JI7 Q;  2NVQ B;  4IOC A;  4CJ1 B;  1R4P B;  3RZO B;  1G6P A;  1KXL A;  5ELC A;  2L1B A;  3UDG A;  1JT8 A;  1OXS C;  1HTL D;  1TVX A;  1EYG A;  1KNA A;  2L0C A;  3G6E A;  4PZ6 A;  3EFX D;  3MFY A;  2UUA L;  3KJO A;  2PYK A;  1QUQ B;  2X6G A;  4A75 A;  2BCO A;  3ERQ A;  3KF8 A;  4C1N K;  2F52 A;  1HZA A;  4DR6 Q;  3PQI A;  2Z1C A;  1CM9 A;  5EAY A;  2Z0S A;  4MTK A;  1CKN B;  2GVB A;  3TP8 A;  3CCQ A;  4MIU A;  4OX9 Q;  1JOK A;  5C3E B;  5IT9 c;  4DNT B;  4A3I B;  2VZA A;  3TME A;  4EX5 A;  4LF9 L;  3J81 i;  4N8F A;  1PZI D;  2EDG A;  5C44 H;  4B3R Q;  2DUD A;  1VF5 C;  1EIY B;  3S14 H;  1V1P B;  3DWA A;  3WOE A;  4ZUI A;  1CQF A;  1W6J A;  3GTG B;  2XWJ B;  1MSH A;  2NVX H;  3E3X A;  5FK9 C;  1FGB D;  2XVS A;  4IFD J;  1F9Q A;  2WP8 J;  4NKL A;  5E4W C;  1BBX C;  1PFS A;  4POF A;  4HSV A;  3BU2 A;  5GRO A;  4ID6 A;  2EOT A;  1BCP D;  1STG A;  3A8K E;  2B63 G;  4KI0 A;  1VQ7 A;  4P72 A;  3MXN A;  3SK8 A;  4CDD C;  5LMU L;  1O7Z A;  1SLJ A;  4XQJ A;  1VQN A;  1EY6 A;  2JA6 B;  3QWN A;  1E2W A;  1BCP C;  1JOR A;  1BUV T;  1TXY A;  4C3I H;  5IP9 G;  4DA2 A;  3MEH A;  1Q7Y C;  3S1Q H;  3NP8 A;  1S5F D;  4K5V A;  5LMN W;  1KAW A;  3STB D;  1WTO A;  1MGS A;  4XT3 B;  1ESR A;  4C3J H;  3X3N A;  2IL8 A;  5CV9 A;  4KD3 A;  4A3E H;  2Q2H A;  1UEB A;  1D5Z C;  1HH2 P;  3K80 C;  5K5P A;  3MWY W;  4IFD H;  1E1T A;  1H9J A;  5E4X A;  3STB C;  3JAM c;  4UP9 A;  4GKJ L;  3QR8 A;  2E2D C;  4FF3 A;  2F0J A;  2I46 A;  5HGT A;  4IPG A;  4DXF A;  3OHX C;  4DV3 L;  2KVM A;  4J1M A;  3GTM B;  1YNJ D;  4X3T A;  4K5X A;  2CH4 W;  3GV6 A;  2VY3 A;  1NE3 A;  4BA2 I;  2K6A A;  5M5X B;  4JI0 L;  1LV9 A;  1SYC A;  3G4S A;  3BG3 A;  3K5L A;  3HKZ G;  4P2C B;  4LF5 Q;  1YNJ C;  5E7N A;  1QVF A;  2ZTD A;  1K3B C;  4I7Z C;  2E2I H;  1PYB A;  2QKI C;  1XPU A;  4IN3 A;  4OL7 A;  3FMC A;  4Q0F A;  1E24 A;  3HOY H;  4JK1 C;  2UUA Q;  2ZTC A;  3VR3 A;  2ZM6 L;  2Q8R E;  1PTO D;  4NPS A;  1BXT A;  5FO9 B;  2WB1 B;  4LUV A;  2BH8 A;  4DR5 L;  5ELE A;  2PZT A;  1JJ2 A;  1TWH B;  3PSI A;  1L1O B;  1I4R A;  2MHV A;  4JI6 Q;  3RLN A;  1AN8 A;  2M00 A;  3GTK H;  4LFA L;  3A56 A;  3CPW A;  4LF9 Q;  1TWF H;  2DNC A;  2OQK A;  5EJW A;  4IQZ A;  1I50 B;  4K8J A;  5EPL A;  1EL0 A;  2B39 A;  1D6E C;  1SE3 A;  1EFI D;  3G48 A;  2F0E A;  2Z9H A;  3LX0 A;  1I6H H;  1CZW A;  4CHT B;  1CFM A;  3NBH B;  3CME A;  4XYQ A;  3R3O A;  1SYD A;  4O2D A;  1YIJ A;  4A3C G;  3C1F A;  2Z4H A;  1B4O A;  3MEF A;  1KDB A;  1SMY D;  1QNK A;  1U5K A;  4Q5V A;  4N9T A;  2N78 A;  4CDE C;  4F7X A;  2BOS A;  3CW2 C;  2A6H C;  3E9H A;  5LMU Q;  2B2Y A;  1ASY A;  2JA8 B;  1AE2 A;  1V43 A;  1F2L A;  4P73 A;  5KEE A;  1SMY C;  1PLF A;  3DXJ C;  1QG7 A;  2NYZ D;  1Q12 A;  1O7I A;  2FIN B;  3R2T A;  2LY7 A;  1BKB A;  2SNS A;  2TSS A;  3VA5 A;  5DM7 3;  3ERS X;  1OXX K;  4P75 A;  1HA6 A;  1GUN A;  2KED A;  3EA6 A;  1GXD C;  1O7Y A;  1UE7 A;  1WTV A;  4LMQ D;  3DWQ A;  1MBY A;  1DZ1 A;  5CMD A;  1A15 A;  3I4N G;  2N8N A;  1N8R C;  4A3J H;  1I3Q H;  2SEB D;  4GKJ Q;  5C4X G;  1YI2 A;  3IFD A;  1B3Q A;  2CQO A;  3NBI A;  2EYP A;  3TBI B;  4DR1 L;  2WAC A;  2FMC A;  2R93 H;  4HJ7 A;  4UY8 C;  1SMX A;  5D3I B;  4DV3 Q;  1K8M A;  5C44 G;  2OWO A;  3TP7 A;  5IGE A;  1KIX A;  4CJ2 C;  1U4L A;  4B9X A;  2NN6 H;  1D7Q A;  4OXP A;  3CCR A;  4JI0 Q;  1CA6 A;  1OXV A;  2F0N A;  2PQA B;  4XQQ A;  4BY1 B;  3K7A B;  1RD9 D;  3A5Z B;  1UAP A;  4X3K A;  2E5L L;  2E2H H;  2AWO A;  2EQS A;  3SK6 A;  1M4V A;  1ICF B;  3M3Y H;  3GTO B;  2VUM G;  4O1N A;  3W5O A;  4GLV B;  3Q23 A;  2WAQ B;  5AJ3 L;  2ZM6 Q;  2RDG A;  4KKU A;  4X65 L;  1A62 A;  1BCP F;  3R2I A;  5FO7 B;  3F2C A;  4DR5 Q;  3P7J A;  4PMC A;  1VQ9 A;  4C3I G;  4HCS A;  1LT6 D;  4A3F H;  5AFW A;  4YY3 L;  4WOR A;  3MXU A;  2PNH A;  2DNE A;  5F2D A;  2K33 A;  4C3H H;  3E9I A;  2ICE C;  3KUP A;  3CKI B;  3H09 A;  1PYW D;  4L8J A;  4OWW B;  2XWB B;  1X56 A;  2KCT A;  4A3E G;  1WTH A;  4A3K H;  1M1K C;  2CWA A;  4FDB A;  2Y0S B;  3M7G A;  4IFD G;  1TWC B;  2WV6 D;  3RZD H;  3H6M A;  2Y0S E;  3OYY A;  1Z9F A;  1QVG A;  3F2U A;  1N33 L;  1XTD A;  1PRT D;  2Q2T A;  1VQ8 A;  3CD6 A;  2ZJP A;  3I4M G;  1HFN A;  3CU7 A;  3L0O A;  1Z7T A;  4BWG B;  3HOZ G;  4EQO A;  1EY4 A;  3OOC A;  2JE6 I;  1WYD A;  3BS1 A;  1MJE A;  1IKL A;  4KJN A;  1PRT C;  5CBE E;  3AEV A;  5ISR A;  4JBK A;  3NXW A;  2B29 A;  2F3V A;  3GDE A;  2A19 A;  2AQ2 B;  1WTP A;  3F2B A;  1VQM A;  4KHP L;  1JCK B;  1V9P A;  1MD2 D;  4FNF A;  1ICW A;  3VYU A;  3J7A F;  3Q24 A;  3FPU B;  1P8L A;  4UP7 A;  2FMM A;  3CC2 A;  1I4G A;  3FKI B;  3KF6 A;  3GTL B;  1GD7 A;  2LXK A;  4DNI A;  3HGB A;  4OGQ C;  4GOP B;  3HOX B;  5EGT A;  1JWM D;  4JVZ A;  1HNW L;  4R4C A;  3X3M A;  1U4R A;  5C3X A;  1E3P A;  3J81 j;  4OEM B;  2LKV A;  4ZRZ A;  4DR1 Q;  4DR2 L;  4GNX C;  4LAA A;  3MVV A;  3CRL C;  4PMB A;  1PTO F;  2R7Z B;  3KLS X;  2OEO A;  3OIP A;  1AFP A;  3SVM A;  3JAM E;  1C48 A;  1WTX A;  3CC4 A;  1DON A;  3Q0A A;  4DK3 C;  4DAP A;  3S1R H;  2L5T A;  3BYT B;  2OXP A;  3MC0 B;  4FF4 A;  2VQE L;  3IRB A;  2EY1 A;  5EPK A;  3TS2 A;  4BBR B;  1WOC A;  2UU9 L;  4JV5 L;  3AU7 A;  4X3U A;  4OIJ A;  2TMP A;  5ELN A;  4A3L H;  2E5L Q;  1PMR A;  4IUU A;  4L63 B;  2Q2U A;  1K8G A;  4BBS G;  3R8B A;  2B63 H;  4PNY A;  1GUS A;  4PQX A;  1LAB A;  3PCO B;  5AJ3 Q;  1ZXT A;  4ZKB B;  4A93 G;  2V1C C;  4X65 Q;  1JOO A;  4JI2 L;  1FNW A;  1XMQ L;  4DV4 L;  2EXD A;  4KY5 A;  2BH2 A;  1PFM A;  1TS3 A;  3IFT A;  3T1Y L;  1KLG D;  1CTM A;  4IPC A;  2RDF A;  4A3B B;  3E0E A;  2KOL A;  2L11 A;  2SOB A;  3T13 A;  5IP9 H;  4YY3 Q;  1LTL A;  3P75 A;  3JC6 6;  2R6G A;  1OTC A;  1B7Y B;  4XQN A;  2K75 A;  1CSP A;  1T5X D;  4A3G H;  1RIP A;  1EYC A;  5IE8 A;  1X3P A;  1KC8 C;  3HOW B;  3O13 A;  2ZJQ A;  1S40 A;  3E0J A;  1WD0 A;  1PYS B;  4RA8 A;  5M3M G;  3IAY A;  1D1K A;  4RCO A;  4A3I G;  2CW0 D;  1SE8 A;  1LO5 D;  1FR3 A;  3D31 A;  4A3J G;  1XXG A;  4JOI C;  1STH A;  4RKL A;  4N8X 1;  2AQ3 B;  2HT1 A;  1D5X C;  1N33 Q;  2KJX A;  4UHV A;  1T9H A;  4CJ0 B;  1PVO A;  2NTT A;  1IHZ A;  4AQY L;  1B9M A;  2NVY H;  2B2Y C;  1HHV A;  1E2Z A;  4DUZ L;  1HPC A;  3GTP H;  3OPO A;  4X3S A;  3M7N A;  1JE5 A;  2AWN A;  1E1O A;  1TS2 A;  1Q90 A;  3JAM L;  3S1Q B;  4IZ8 A;  3PO3 G;  3K7U C;  5COR A;  5KRU A;  4C3J B;  5IYC G;  2HCI A;  1F9P A;  5CV6 A;  2NB0 A;  3VA7 A;  4WRD A;  4FXG C;  3DUZ A;  1CI3 M;  3CPF A;  4KHP Q;  2RQX A;  1DXM A;  1H9R A;  1U4P A;  2HD3 A;  3K58 A;  1HCZ A;  3TS0 A;  5IOC A;  1Q8K A;  2IHE A;  3NSW A;  2K5N A;  1PH6 A;  5G3L F;  5EPJ A;  1PXU A;  4RHS A;  4RKB A;  4F8M A;  1FL0 A;  3M4O B;  3J80 c;  1VQB A;  1HNW Q;  1VQP A;  1CA5 A;  4NW2 A;  4MHE A;  2DGY A;  1HFG A;  4QGU A;  2QEJ C;  4K6D A;  2KUM A;  5FLX E;  4KN4 C;  3JAM i;  2Z8L A;  1JQY D;  5A35 A;  4DR2 Q;  4LFC L;  3HRZ C;  3K59 A;  1SNQ A;  1EU3 A;  2N49 A;  4XT1 B;  4FXD A;  1FNV A;  4C3H G;  5BN4 A;  5C4J H;  1NR2 A;  4R4Q A;  4QCL A;  3FVQ A;  2BE5 D;  5ELB A;  4JYA L;  1RDP D;  1KNE A;  1SEB D;  1YNN D;  4ZAI A;  4A3K G;  2VQE Q;  1QZH A;  3S1N H;  2E2I B;  5IGG A;  5C4H A;  3NUC A;  2WIN B;  3S1M H;  5I2X A;  2UU9 Q;  1D8L A;  3VYT A;  4JV5 Q;  1C4Q A;  1B1Z A;  1H9K A;  1VDZ A;  3HOY B;  1Z47 A;  2JN4 A;  3F2D A;  1JC7 A;  2PW5 A;  5KGU A;  3RMH A;  3CQZ H;  2PPB C;  3KK7 A;  4A3C H;  3G7L A;  4DV6 L;  1YNN C;  3I4L A;  1HR0 L;  2PCF B;  1IBK L;  2MJ8 A;  2GN5 A;  1RCV D;  1GUG A;  1IYU A;  2RHQ B;  4FF1 A;  3TN2 A;  2K5Q A;  2RKS A;  5HUR A;  3I55 A;  2QCP X;  1TWF B;  4JI2 Q;  1XMQ Q;  1PRT F;  4DV4 Q;  4L5R C;  2B8F A;  3T1Y Q;  4NXM L;  1B2T A;  3SR1 A;  3LWE A;  3HOU G;  4GZY C;  3WWV A;  3BDO A;  4LF4 L;  1ENC A;  4QIW B;  1I6H B;  2EPB A;  1XPR A;  2M9V A;  4QIW E;  1EIF A;  2IY5 B;  5KNC A;  4J15 A;  1XMO L;  1YIT A;  2WB1 G;  5IGD A;  4FVM A;  3VR5 A;  5IIF A;  3ICE A;  1CHQ D;  4P71 A;  1CSQ A;  1A0I A;  3MXP A;  1LYL A;  2Q8T A;  3LNN A;  3I4N H;  4ILW A;  4ZUJ A;  2R92 B;  1A3U A;  4OO1 G;  1E22 A;  1II3 A;  3KLW A;  4BY7 G;  1X54 A;  3NEN A;  5C4X H;  5FLX L;  2KHJ A;  5HY6 A;  3D6W A;  1K73 C;  4JCV E;  2RA4 A;  4L6T B;  1DOM A;  1CZG A;  4YIJ A;  4AQY Q;  3NPP A;  3I56 A;  4S3S A;  4DUZ Q;  2PNR C;  3UE0 A;  2BDN A;  5BN5 A;  1TS5 A;  4PMW A;  3T51 B;  1SYB A;  2K52 A;  4JPB W;  4DN4 M;  3M9B A;  1ROD A;  2AUJ D;  1K9M C;  2I07 B;  4KHZ A;  3CP0 A;  3MZ5 A;  3AYH B;  4JI1 L;  1T5E A;  4A3L G;  1I3Q B;  1SFO H;  1QNU A;  3PIO A;  1VQD A;  2A6E D;  1X9N A;  4NMZ A;  3K8A A;  4HAE A;  4I65 A;  4PV1 C;  3HFZ B;  3N52 A;  2VUM H;  2XTI A;  1K83 H;  4R8I A;  2R93 B;  4M8A A;  2XSC A;  3QJY A;  3SK4 A;  3DEP A;  3I7F A;  2ALY B;  2NVT H;  3TRE A;  3A7A B;  1M90 C;  4PG3 A;  2FFK B;  1HZ9 A;  1V8Q A;  2A6E C;  4ZKC B;  2A74 C;  1Y1V G;  4DGZ A;  4LFC Q;  1G6Z A;  1STB A;  1PH7 A;  1YZ6 A;  4X64 L;  4A76 A;  3QOL A;  2QGQ A;  4OO1 I;  1GJX A;  4TQU S;  3NTI A;  3BJU A;  3H15 A;  1VMC A;  4A3G G;  1JE4 A;  4JYA Q;  1EYD A;  4DK6 C;  1L1O C;  3AFQ A;  4R4T A;  5JVG 3;  2EY6 A;  2K32 A;  2KQ3 A;  5CR3 A;  1YJ9 A;  3CXC A;  2D5D A;  3M3Y B;  1JB7 A;  3S16 H;  3FP9 A;  3I4O A;  2JA5 H;  2PZU A;  4ZQ3 A;  4M1U B;  2B8G A;  4AIM A;  1K0R A;  5KYL A;  4HMJ A;  4DV6 Q;  1RL2 A;  2H4O A;  1HR0 Q;  1IBK Q;  1TII D;  3I4M H;  3MFG A;  4GNX A;  4IPD A;  4A3F B;  1G2S A;  4YWM A;  3PO2 B;  3HOZ H;  1PZJ D;  5LMN L;  4E6I A;  3UI2 A;  5ELD A;  4F87 A;  1JB3 A;  2MUY A;  2JYO A;  2IWH A;  1QWY A;  4LF4 Q;  5J22 A;  2VB2 X;  4LF6 L;  2IX0 A;  3I72 A;  1NNX A;  2WAQ G;  4IUN A;  4OWT B;  1STY A;  2HQL A;  1SYF A;  1Q3L A;  2PZW A;  2YTV A;  4A3D B;  1DJR D;  1XMO Q;  2EJF C;  3KBX A;  3H94 A;  1F77 A;  3CF5 A;  1MI2 A;  2A73 B;  1EIG A;  1IXR A;  3R93 A;  2ZXO A;  1TY2 A;  4LUO A;  5M9O A;  1MKH A;  1VQC A;  3KDF B;  2F4I A;  3HOV H;  1UE5 A;  3L9A X;  1N9W A;  1LT4 D;  3KBG A;  1Y1W G;  1PTO C;  1B70 B;  1J9O A;  3AQQ A;  5M5Y H;  2HHH L;  2JA7 H;  4B3T L;  2ATW A;  4DV7 L;  2G9D A;  4IPH A;  2NZH A;  4LFB L;  4QY7 A;  1R9T H;  3C1E A;  3P20 A;  4YCW A;  2E76 C;  1DM0 B;  1LTB D;  1HUN A;  3GP7 A;  2KHI A;  4RGN A;  2NTS A;  1IZ6 A;  4JI1 Q;  3BYY B;  2PI2 A;  1VQE A;  3I8Z A;  5C0X G;  2Z6K C;  4JOI A;  1ET6 A;  1F2Z A;  1HZC A;  2D0P A;  3J7Z C;  1SYG A;  4BBS H;  4DAY B;  3CCL A;  2KEE A;  1PFN A;  4DR7 L;  4DV0 L;  1ASZ A;  5K36 H;  2K5D A;  3BVZ A;  4LNQ A;  2NVQ H;  1ENF A;  1PH8 A;  4A93 H;  1Q46 A;  1XNQ L;  3I91 A;  3S1R B;  2VB3 X;  2OTL A;  3BDC A;  3NQT A;  1GUW A;  4OHJ A;  1EY5 A;  3A8J E;  3ER0 A;  2IW3 A;  5I2Y A;  2KEC A;  5C3W A;  3BZD B;  3J80 E;  3J81 c;  4QUC A;  2WKC A;  1VQK A;  1NSN S;  5IWA L;  2D0O A;  5JVH 3;  2KBN A;  1PH2 A;  1VQA A;  4RAU C;  5CGK A;  3KFU A;  2F0D A;  1XYI A;  3D3R A;  4IUV A;  4A3M G;  4C56 C;  5M3M H;  1I4Q A;  1YEZ A;  2B63 B;  1SRU A;  5C3E H;  5FKA C;  2NZO A;  4A3I H;  2CKZ B;  4KKT A;  3EN2 A;  2R7F A;  4NXN L;  4G7O C;  2I5M X;  4GLA C;  2XRS D;  3T4A C;  4IUQ A;  3GTJ H;  2Z4I A;  2N3S A;  1CKM A;  1S5E D;  2QF7 A;  4KLK A;  2MQH A;  5C0X I;  1QUQ A;  1Q86 C;  3VDY A;  3EIV A;  3MAQ A;  1A3T A;  4TSS A;  5LMN Q;  3L2P A;  2AKW B;  5KND A;  4ZCK A;  4XDX A;  4B3M L;  2ZTE A;  4LF8 L;  1GM5 A;  4GN4 B;  3PO3 H;  4DV1 L;  4G7H C;  1CKN A;  2WKD A;  1EYA A;  5IYC H;  5JJI A;  4BXX H;  3H0G G;  4LF6 Q;  1EZ6 A;  5A2Q E;  2UXB L;  4QQB X;  4ULL A;  3RN2 A;  1CK1 A;  4U68 A;  3S2D B;  5BR8 L;  3H91 A;  1V1P A;  2K5V A;  2JA6 H;  1VQL A;  1YBY A;  4OEL B;  4QJF A;  1L0Y B;  5I9P A;  4IOA A;  2EJG C;  1WCM G;  1HQM C;  2NVY B;  2YTY A;  1SJE D;  1YJW A;  2UUB L;  3GTP B;  3C3L A;  1B44 D;  1XX8 A;  2MGS A;  3I90 A;  3CCE A;  1L0X B;  2D2C C;  1VQ6 A;  3AFP A;  4FF2 A;  3HOW G;  3A55 A;  4LF7 L;  5KNB A;  4EVO A;  4GOP C;  1OXT A;  2EXZ A;  4LFA Q;  3H3V C;  1FNU A;  3BZC A;  2DN8 A;  3J80 L;  1GKH A;  3RLF A;  3HKZ B;  2AHO B;  4KY6 A;  2HHH Q;  2BA1 A;  4B3T Q;  2OTJ A;  4DV7 Q;  3HKZ E;  1F9R A;  1VQI A;  2HDL A;  3U4V A;  2NZ1 D;  3PGZ A;  1XJV A;  4LFB Q;  5IT9 E;  4KV6 A;  5JPN C;  1BBW A;  3KLS A;  1L0W A;  2JA5 G;  1WTW A;  1HA5 A;  1KDC A;  4KK7 A;  3GTM H;  3W3A A;  3QB3 A;  4WJ4 A;  1TWG H;  4UAI A;  1N32 L;  1EUJ A;  3KYH C;  1SAP A;  3T16 A;  1SRO A;  3RUZ A;  3KJP A;  2E2J H;  2F3W A;  4ABN A;  1SNC A;  5M5X H;  3CCJ A;  4DV0 Q;  4DR7 Q;  2DJG C;  1KAB A;  2EYJ A;  1C7Y A;  3NHH A;  4Y52 H;  1D1I A;  2B2T C;  5C4J B;  1X55 A;  3TQY A;  1XNQ Q;  1PH5 A;  1FYC A;  3HEJ A;  1GHJ A;  3J80 i;  1Y8P B;  2EZV A;  1QE6 A;  4KKS A;  5I6Y A;  4RWS C;  3HOU H;  1NAP A;  2KEN A;  1VQO A;  2N88 A;  3S1N B;  2JK8 A;  1NY4 A;  1EQQ A;  5A2Q L;  3U4Z A;  1Q1E A;  4Z9C B;  5IWA Q;  1WFQ A;  1H9S B;  4EQP A;  1LT3 D;  3CQZ B;  5CV8 A;  1Q82 C;  4BA1 I;  2F0I A;  4JI4 L;  3URY A;  1Y14 B;  3OTO L;  2R3Z A;  1SXT A;  1F2M A;  4QF4 A;  4JI5 L;  1RJT A;  4X66 L;  3CC7 A;  1EIH A;  3Q6S A;  3M4P A;  4NXN Q;  1TWA B;  2B2V C;  5IYD G;  4AYB G;  1AE3 A;  1EQT A;  3KF8 B;  4OO1 H;  3HOV G;  1LAC A;  4BY7 H;  2VXW A;  3K5O A;  1H95 A;  4ZLT F;  1JMC A;  2CCZ A;  3A54 A;  2CQA A;  5DM6 3;  1NR4 A;  3ZJY C;  2EYF A;  2SDF A;  3KOJ A;  2JA7 G;  3T1H L;  1JOQ A;  4B3M Q;  2J0T D;  5M3F G;  4LF8 Q;  3NTH A;  4CKB A;  4DV1 Q;  1VQH A;  1L1O A;  3IL8 A;  4K2K A;  3V96 A;  5IT9 L;  2F0W A;  3Q8D A;  4DV2 L;  2UXB Q;  5M5W H;  4O42 A;  4G4K A;  5IY0 A;  3DHQ A;  2MO1 A;  5BR8 Q;  1VS0 A;  3I4N B;  1NTG A;  5LL6 X;  2JA8 H;  5C4Z A;  4V0B A;  4GN5 A;  4TVA B;  3D4W A;  1SN8 A;  3NBH A;  5K36 G;  2YU9 H;  1UEA B;  3K6O A;  3TSS A;  5C44 B;  1G51 A;  3MXN B;  4HTH A;  3EVQ A;  3S14 B;  1G8Z D;  1OO9 B;  4LF7 Q;  1Y1V H;  1W3S A;  1BNZ A;  1HNZ L;  1EWC A;  2XNA C;  2B2W C;  2B2U C;  4QUF A;  2NVX B;  3HS0 C;  3DMU A;  2IX3 A;  3A74 A;  3J7Y W;  1IBM L;  2G9H D;  4Y7N H;  1D2B A;  2F0M A;  1N34 L;  4KD4 A;  4YCV A;  1BF4 A;  1YHQ A;  2F03 A;  1I6V C;  1PTO H;  3S9W A;  1SFO B;  3K5N A;  3RLO A;  3K0Y A;  2K1B A;  4IAL A;  5C3E G;  4R4O A;  2MPM A;  2ES2 A;  2VUM B;  5JEA J;  4BS9 A;  2F0G A;  3I3C A;  4JI7 L;  4IJL A;  2NVT B;  1JIC A;  1AP0 A;  1N32 Q;  5J3B A;  1PDQ A;  5EKL A;  2IT1 A;  4HID A;  4C3I B;  2GVA A;  4HCE A;  2ASB A;  5T1I A;  2CW0 C;  3UDX A;  1AW7 A;  3MTS A;  5KYI A;  4WFN 3;  4ME3 A;  1I5F A;  3FDT A;  3SEB A;  4DR4 L;  3K7A H;  4RFB A;  4HJ9 A;  4DR6 L;  2FJ2 A;  4BXX G;  1B53 A;  2X69 A;  4A3E B;  4JW0 A;  5JJZ A;  4JBJ A;  4EQN A;  2WII B;  1K3R A;  1QZG A;  2HCC A;  1E7Z A;  2QA4 A;  5C0X J;  3V05 A;  1SE2 A;  1QOH A;  2JA6 G;  2KA7 A;  4JI4 Q;  5J39 A;  2Z6K A;  1XTC D;  2LS0 1;  5GAG C;  3OTO Q;  1WVL A;  2PQA A;  3K57 A;  3I4M B;  3RD4 A;  1LLR D;  2R61 A;  4X66 Q;  4JI5 Q;  4JBW A;  3I2Z A;  3FEW X;  1KTK A;  1O78 A;  2RSN A;  3M4Q A;  4FXK C;  5J1Z A;  5JEA H;  3HOZ B;  1LTS D;  1G91 A;  1FJG L;  4X62 L;  2Q8I B;  1C8C A;  1SND A;  3QOJ A;  5JJK A;  1Y1W H;  3QG1 A;  1JWU D;  1O80 A;  1J6Q A;  1KL9 A;  2KCC A;  2OF1 A;  3VYS A;  1TWC H;  4CBV A;  1LTR D;  3SGI A;  3T1H Q;  4JBM A;  4OWX B;  4AH6 A;  3S15 H;  4L5T A;  2F0L A;  1X3G A;  2F0K A;  4DV2 Q;  3V2T A;  1EU4 A;  3MHB A;  2EVB A;  2BE5 C;  4G7Z C;  1KRT A;  4KY7 A;  2WFW A;  5C0X H;  3CCM A;  1HTP A;  1SYE A;  1MSG A;  1H9M A;  3BZK A;  1N36 L;  1UNS A;  2OQ0 A;  3U58 A;  2E74 C;  1VMP A;  4J6H A;  4HJ5 A;  1F2Y A;  2J4X A;  5E1F A;  3GTK B;  2IX1 A;  4P74 A;  5ELF A;  2K50 A;  3B6Y A;  4FP5 D;  4TKO B;  2Q2I A;  3A5U A;  2F0O A;  1IL2 A;  5I9O A;  4X6A H;  4DF7 A;  4C2M H;  5H1S E;  4OON A;  2ZXP A;  1HNZ Q;  2H5X A;  2QIL A;  3F8T A;  3FKI H;  1R9T B;  3GTL H;  4KN7 C;  2NBF A;  1IBM Q;  2JSO A;  3EQL C;  4L5Q A;  4HED A;  1PZK D;  1WD1 A;  3HOX H;  3H3V H;  3SDZ A;  2XRQ D;  3NTK A;  4MZ9 A;  4XTC S;  3CCV A;  1N34 Q;  2EYO A;  3NK9 A;  4DAV A;  4K8I A;  1A2T A;  3W1G A;  4A3M H;  1YJN A;  3DEO A;  1C9O A;  2RBM A;  4A93 B;  2EYL A;  1HNX L;  3ULP A;  2K03 A;  3BVM A;  1JR0 D;  3EJI A;  1BQQ T;  3HZX A;  3G71 A;  1XWE A;  5IYB G;  4BBR H;  3UDF A;  4GOP A;  1TY0 A;  2RSO A;  4HR7 B;  1TT2 A;  3BVG A;  3TDQ A;  3TRZ A;  1QB5 D;  4DR4 Q;  1IL8 A;  4DFA A;  4XIG S;  2MO0 A;  2L55 A;  5IGC A;  1W2B A;  5FOB B;  5KIX A;  5IP7 G;  1A2U A;  1S5C D;  3H0G H;  5M3M B;  2XGT A;  4JI6 L;  3OW2 A;  2P5Z X;  1VQ4 A;  4PZ8 A;  2KHS A;  1EOT A;  2VNU D;  3VYR A;  4MNO A;  2JA8 G;  1A8V A;  4A3J B;  1Q1B A;  3D4D A;  3ULL A;  3GTJ B;  1KRS A;  1U9R A;  2LMC B;  4YWK A;  2K28 A;  4FYD A;  4RHR A;  4A3B H;  3I70 A;  2XN9 C;  1NMG A;  1PH3 A;  1WCM H;  2YTX A;  1WJJ A;  3CMA A;  2B2T A;  5EKK A;  4NP5 A;  4LWC A;  1TU2 B;  3HOW H;  1FJG Q;  4X62 Q;  3PO3 B;  1STN A;  1MIU A;  2LFN A;  2QEX A;  1J8I A;  2JEA I;  1VQG A;  2AUK A;  5EBC A;  2O5J C;  4LJZ C;  2GA4 B;  3GTQ H;  1PA6 A;  4IUR A;  3TP5 A;  3NQI A;  4KMU C;  3S17 H;  2E2H B;  1DGS A;  2A5H A;  3ONA B;  2M2L A;  1HUM A;  2K04 A;  3L7Z C;  4HIK A;  3HP3 A;  4DK1 A;  3HG9 A;  1J5E L;  1LTT D;  1LM0 A;  1EQR A;  2CWP A;  1LTA D;  2B2V A;  5BN3 A;  1K0S A;  3W1B A;  1N36 Q;  2FHT A;  2ID0 A;  1CUK A;  1DCZ A;  4FO2 A;  1I4X A;  1UE6 A;  4J8Q A;  5EKI A;  4C3H B;  5E3F A;  4WJ3 M;  4GKK L;  4BY1 G;  3PUV A;  1PV4 A;  4ZK9 B;  3C46 A;  1QIL A;  3L3O C;  4NXM Q;  5I6W A;  1EY7 A;  3TZU A;  3OW7 A;  1KD1 C;  1HJP A;  5CBA E;  2AQ1 B;  4H7B A;  4A3K B;  4JG2 A;  2QW7 A;  3U9S A;  2A68 D;  3A7L A;  3TP6 A;  3U9O A;  1EFW A;  1MJC A;  4HSP A;  3M4O H;  2O2L D;  3RZD B;  1HRJ A;  3SHL A;  5FLM H;  2E75 C;  5C6A A;  1JJC B;  4ME5 A;  4GLX A;  1TWG B;  4QB4 A;  3UE1 A;  1SNM A;  5JPM C;  2A1A A;  2E2J B;  3KF6 B;  2A68 C;  2IHF A;  3BDL A;  5JEA G;  2PMZ B;  1BR9 A;  1DYQ A;  5C5M A;  4N9P A;  5IYD H;  1HNX Q;  3J7A V;  4KJO A;  2PMZ E;  2F0Q A;  2EYM A;  3FHW A;  3HOU B;  1UUP A;  3A8I E;  3DWP A;  4R8N A;  1X3Q A;  1WI5 A;  5DLQ E;  5GAE C;  1NUC A;  4LK1 C;  3RNU A;  2Y0S G;  1SDF A;  1BCP B;  2B2U A;  2B2W A;  5GAD C;  3D8G A;  1WTR A;  2JQO A;  1FD7 D;  1YHA A;  4YHH L;  4H44 C;  5M3F H;  3P1H A;  1SNO A;  4R9W A;  5CV4 A;  2I5H A;  4A4I A;  3NWT A;  2WB1 E;  4K0K L;  1DOK A;  2DY8 A;  3S2H H;  3J7A 5;  2JP1 A;  3NE5 B;  4BY7 B;  2K14 A;  1HZB A;  3OMC A;  1YNX A;  1KDA A;  1KQS A;  2EIF A;  2K7V A;  1YHB A;  3OIQ A;  5FJ8 G;  1OXU A;  3RZO H;  1Q8I A;  1RHP A;  1ENA A;  1IBL L;  2A6H D;  2KCN A;  2JJQ A;  4UP8 A;  2RDH A;  2F0P A;  3ZYY X;  5CV7 A;  2A69 D;  2L15 A;  3S24 A;  5IOD A;  4X64 Q;  1EY0 A;  1Y8O B;  3FKI G;  1S4Z A;  1PHJ A;  2F4V L;  1I94 L;  1K28 A;  1CT1 D;  3HOX G;  2CVR A;  5M5W B;  4POG A;  1ET9 A;  1W6K A;  3PUY A;  1DD2 A;  4NDX A;  1P16 A;  5DEH A;  2R92 H;  3HKS A;  1UWV A;  3CAM A;  2H1E A;  4O0A A;  2A69 C;  2FXQ A;  1TKW B;  4C1N I;  3G6J B;  1FVI A;  4V19 0;  2VQF L;  3I73 A;  2JA9 A;  3WDN A;  2R7Z G;  2LSS A;  1XPO A;  2YU9 B;  4EQ5 A;  1Y69 U;  4U67 3;  2X6L A;  1B9N A;  2MFI A;  2IJ0 A;  4RH6 A;  5C5L A;  1J5E Q;  4YCU A;  1NJI C;  3GTG H;  5DNF A;  3PIO 3;  1MHW C;  1Y1V B;  2UUC L;  4BBR G;  4UDU C;  4DV5 L;  5FLX c;  2AMC B;  4PZ7 A;  2ICI A;  4GKK Q;  1LTG D;  1TS4 A;  4Y7N B;  4A3G B;  4K6L A;  3FRP B;  2F0F A;  4OIK A;  1K8A C;  1LT5 D;  4CKC A;  2CFM A;  1PTO B;  2PW7 A;  1DOL A;  3PF4 A;  4K5W A;  4CKE A;  1GVP A;  1I4P A;  5ELO A;  2XIW A;  2O4X A;  1QJO A;  3PUZ A;  2L9H A;  1VQF A;  3PMF A;  3TZD A;  1SR3 A;  1STA A;  3D6C A;  4MTN A;  4RGO S;  2EYH A;  1BDO A;  3H3V I;  1WTQ A;  4A3B G;  5LHY 1;  1A3V A;  3N6R A;  1IKM A;  3SK5 A;  3DM1 A;  3PF5 A;  5GAH C;  2I0Q A;  4HN7 A;  1E2V A;  1S5D D;  2NWG A;  1GUO A;  4KHV A;  1EWI A;  5G3L D;  2K4K A;  1B8A A;  3CHB D;  3VR2 A;  2EY2 A;  3WOF A;  2CH4 A;  1EEF D;  2RVL A;  1ILP A;  2UXC L;  1RKN A;  2K5H A;  4YHH Q;  1AH9 A;  1RF2 D;  2N55 A;  5D65 A;  2WAQ E;  3PV0 A;  1A6X A;  3OMG A;  4DR3 L;  1VQJ A;  4HJ8 A;  1FGU A;  3T56 B;  4K0K Q;  2PQE A;  3PUW A;  3PO2 H;  2K01 A;  4H13 C;  2BA0 A;  3DM3 A;  3FPP A;  4L5S A;  3QO2 A;  4HJA A;  2K05 A;  1RTN A;  1S5B D;  3GD7 A;  1SBB B;  3ULJ A;  1LTI D;  1F9S A;  4C3J G;  4DNR B;  1CQV A;  1SNP A;  4JI8 L;  2IPK D;  5EQ0 A;  1ZKO A;  2DJF C;  3ITP A;  2NUC A;  1Y1W B;  3U50 C;  4HMI A;  1IBL Q;  4A3D H;  1GUT A;  1TQO A;  3EBE A;  1AEX A;  1M8A A;  4RGT A;  5COY A;  3S1M B;  3S15 B;  4G57 A;  3K0X A;  2F4V Q;  1I94 Q;  3PUX A;  4RMF A;  2K5W A;  5FLM G;  1GHK A;  1X32 A;  1E0B A;  1TWH H;  1X6O A;  1EWH A;  1YVC A;  4JI3 L;  2VQF Q;  1STE A;  1XNR L;  1I4H A;  2JXM B;  3D0F A;  3NEM A;  2E8G A;  3PIP A;  1SSO A;  4DU9 A;  2F0U A;  1I50 H;  2F0V A;  1PH1 A;  3C2P A;  2VS1 A;  4NB3 A;  3DLL A;  4EGV A;  4C2M B;  2OCE A;  2UUC Q;  5L37 A;  5IYB H;  4YWL A;  3E5S A;  4DV5 Q;  1IW7 D;  3HOY G;  1SJH D;  2ZT9 C;  4XYO A;  1K8O A;  5EBD A;  1EY8 A;  1QVC A;  3KDF A;  4MN3 A;  1X3F A;  2EE1 A;  4KTA A;  2J7Z A;  4UPA A;  1JWS D;  3M85 A;  4B3S L;  2G5D A;  4IFD I;  5IP7 H;  1LUZ A;  1AZP A;  2Z6B A;  3CCU A;  1IW7 C;  1EQV A;  4A3M B;  3NWS A;  2HIV A;  2EJM A;  5IGF A;  2EY5 A;  4WJW A;  4TRD A;  3D4R A;  2YV5 A;  3OWE B;  1CKO A;  1BO0 A;  3M4Y A;  5C4X B;  4RCN A;  3GQB A;  1TR5 A;  5I4D A;  2UUB Q;  5NUC A;  1CHP D;  5IGB A;  4ZYS A;  4GN3 B;  3A0J A;  4B9W A;  3NEL A;  4B08 A;  2YYZ A;  4IUP A;  2F3I A;  5FO8 B;  3CCS A;  2F0T A;  4DAY A;  1HXY D;  1A63 A;  3MA2 B;  4RGM A;  4LUZ A;  3H0G B;  1QCB D;  5D14 A;  4IO9 A;  1PRT B;  1GO3 E;  2UXC Q;  4GS3 A;  5JJL A;  2F0S A;  2R92 G;  4XXE A;  3VR4 A;  4JC0 A;  1S72 A;  1HQR D;  3CRK C;  4DUY L;  2PO4 A;  4DR3 Q;  3K81 C;  3UDI A;  1NCV A;  1ML0 D;  2F0H A;  4LW1 A;  2I5L X;  2C9O A;  4R1J A;  1V1O A;  2JEB I;  1PH4 A;  3RR5 A;  1K83 B;  1VF7 A;  1WCM B;  4H0L C;  1Z6H A;  4IJH A;  2UXD L;  3GO5 A;  4DKA C;  2O5I C;  1V1Q A;  1NBW A;  3IKJ A;  1ESF A;  4DXG A;  3K5M A;  4H02 A;  4JI8 Q;  2A8V A;  1BBU A;  3OSO A;  4ALP A;  2CHB D;  1KHI A;  4GNX B;  4BY1 H;  5D3D A;  2F1M A;  1VQ5 A;  3S2D H;  4R4I A;  2DY7 A;  1UE1 A;  5GQO A;  2BDO A;  3GTQ B;  4HIM A;  2QDB A;  3S17 B;  1D5M C;  1SE4 A;  2QDL A;  4IUT A;  2L4N A;  3GTO H;  1GOZ A;  2R93 G;  3T53 B;  5TSS A;  4OX9 L;  4DPG A;  2VL6 A;  3S16 B;  2ENB A;  2JA5 B;  3SXH A;  4K2L A;  3AMU A;  1PFB A;  2OT2 A;  4B3R L;  2MP1 A;  2RCF A;  4I7A A;  2NN6 G;  5HGQ A;  2SNM A;  3OWF A;  1X3E A;  4CGY B;  1G29 1;  1XNR Q;  4JI3 Q;  3J81 E;  3TEH B;  1NMF A;  3MXG A;  4CDC C;  1Y8N B;  1KLU D;  1PH9 A;  1O7L A;  3Q22 A;  3RN5 A;  2B3G A;  2ZXR A;  5CC4 A;  1G2T A;  4RG1 A;  3KLR A;  3ND8 A;  3W2D A;  2RCN A;  3ND9 A;  4HIO A;  5CV5 A;  1AZQ A;  5T1G A;  2KCM A;  4K14 A;  3GV3 A;  3ERO A;  3E6Z X;  4QMG A;  3AB9 A;  3F1Z A;  4DK0 A;  1BOS A;  4B3S Q;  3LGJ A;  2RHS B;  4DAM A;  2R7D A;  1ILQ A;  1HR0 W;  1Q81 C;  2HDM A;  4A3F G;  3PO2 G;  4APV A;  1S3O A;  1X65 A;  4ODG A;  5CYU A;  2MNA A;  1L2F A;  4AYB B;  3LWU A;  1EOV A;  1JJG A;  3VR6 A;  3HOV B;  1ZYR D;  1EY9 A;  2V4D A;  4AYB E;  2HIX A;  2PI2 E;  2L12 A;  5LL6 S;  1B50 A;  1C0A A;  2HUG A;  2LXJ A;  2HQE A;  2NN6 I;  1IYV A;  3SE0 A;  5FJ8 H;  2C35 B;  4A3D G;  2C5C A;  2D9U A;  1VCI A;  3PIP 3;  5M5Y B;  2ZJR A;  2JA7 B;  5M3F B;  2D62 A;  1ZYR C;  1EEI D;  4QL5 A;  1IYJ B;  4CDF C;  1ONL A;  3QIA A;  1KAA A;  1U0L A;  1BVS A;  5DAU A;  4F88 A;  1TWA H;  1R4Q B;  1U4M A;  2VW9 A;  1ZEQ X;  5JAV A; 
#chains in the Genus database with same CATH homology
 1RTO A;  3S2H B;  5JOB A;  4BBS B;  3J81 L;  1B3A A;  1EZ8 A;  1H9S A;  2NVQ B;  4CJ1 B;  1R4P B;  3RZO B;  5ELC A;  2L1B A;  1OXS C;  1HTL D;  1TVX A;  1KNA A;  2L0C A;  3EFX D;  3MFY A;  2PYK A;  2X6G A;  2BCO A;  3ERQ A;  3KF8 A;  4C1N K;  2Z1C A;  1CM9 A;  3TP8 A;  4MIU A;  1JOK A;  5C3E B;  4DNT B;  4A3I B;  3TME A;  1PZI D;  2EDG A;  1VF5 C;  1V1P B;  3DWA A;  3WOE A;  4ZUI A;  1CQF A;  1W6J A;  3GTG B;  2XWJ B;  1MSH A;  5FK9 C;  1FGB D;  2XVS A;  4IFD J;  1F9Q A;  2WP8 J;  4NKL A;  5E4W C;  1BBX C;  4HSV A;  4ID6 A;  2EOT A;  1BCP D;  1STG A;  3A8K E;  4KI0 A;  3MXN A;  3SK8 A;  1O7Z A;  4XQJ A;  1EY6 A;  2JA6 B;  3QWN A;  1E2W A;  1BCP C;  1JOR A;  1BUV T;  4DA2 A;  3MEH A;  3NP8 A;  1S5F D;  4K5V A;  1WTO A;  1MGS A;  4XT3 B;  1ESR A;  3X3N A;  2IL8 A;  5CV9 A;  4KD3 A;  1D5Z C;  5K5P A;  3MWY W;  4IFD H;  1H9J A;  5E4X A;  2E2D C;  4FF3 A;  2F0J A;  2I46 A;  5HGT A;  4DXF A;  3OHX C;  2KVM A;  4J1M A;  3GTM B;  1YNJ D;  4X3T A;  4K5X A;  3GV6 A;  4BA2 I;  2K6A A;  5M5X B;  1LV9 A;  1SYC A;  3K5L A;  3BG3 A;  4P2C B;  1YNJ C;  4I7Z C;  2QKI C;  4IN3 A;  4OL7 A;  3FMC A;  4Q0F A;  4JK1 C;  3VR3 A;  2Q8R E;  1PTO D;  1BXT A;  5FO9 B;  2WB1 B;  5ELE A;  2PZT A;  1TWH B;  1I4R A;  2MHV A;  1AN8 A;  2M00 A;  3A56 A;  2DNC A;  5EJW A;  4IQZ A;  1I50 B;  4K8J A;  5EPL A;  1EL0 A;  2B39 A;  1D6E C;  1SE3 A;  1EFI D;  2F0E A;  3LX0 A;  1CZW A;  4CHT B;  1CFM A;  4XYQ A;  3R3O A;  1SYD A;  3C1F A;  2Z4H A;  1B4O A;  1KDB A;  1SMY D;  1QNK A;  4Q5V A;  4N9T A;  4F7X A;  2BOS A;  2A6H C;  2B2Y A;  2JA8 B;  1V43 A;  1F2L A;  5KEE A;  1SMY C;  1PLF A;  3DXJ C;  1QG7 A;  2NYZ D;  1Q12 A;  2FIN B;  3R2T A;  2LY7 A;  2SNS A;  2TSS A;  3VA5 A;  5DM7 3;  1OXX K;  1HA6 A;  1GUN A;  2KED A;  3EA6 A;  1GXD C;  1O7Y A;  1WTV A;  4LMQ D;  3DWQ A;  1MBY A;  1DZ1 A;  5CMD A;  1A15 A;  2SEB D;  3IFD A;  3NBI A;  2EYP A;  3TBI B;  2WAC A;  2FMC A;  5D3I B;  1K8M A;  3TP7 A;  5IGE A;  4CJ2 C;  1U4L A;  4B9X A;  2NN6 H;  1CA6 A;  1OXV A;  2F0N A;  4XQQ A;  4BY1 B;  3K7A B;  1RD9 D;  1UAP A;  4X3K A;  2AWO A;  3SK6 A;  1M4V A;  3GTO B;  4O1N A;  3Q23 A;  2WAQ B;  2RDG A;  4KKU A;  1BCP F;  3R2I A;  5FO7 B;  3P7J A;  4PMC A;  4C3I G;  4HCS A;  1LT6 D;  5AFW A;  4WOR A;  3MXU A;  2DNE A;  5F2D A;  2K33 A;  2ICE C;  3KUP A;  3CKI B;  3H09 A;  1PYW D;  4L8J A;  2XWB B;  2Y0S B;  3M7G A;  4IFD G;  1TWC B;  2WV6 D;  3H6M A;  3F2U A;  1PRT D;  1HFN A;  3CU7 A;  1Z7T A;  4BWG B;  4EQO A;  1EY4 A;  3OOC A;  2JE6 I;  3BS1 A;  1IKL A;  4KJN A;  1PRT C;  5CBE E;  5ISR A;  3NXW A;  2F3V A;  2AQ2 B;  1WTP A;  1JCK B;  1MD2 D;  4FNF A;  1ICW A;  3VYU A;  3J7A F;  3Q24 A;  3FPU B;  2FMM A;  1I4G A;  3FKI B;  3GTL B;  3HGB A;  4OGQ C;  3HOX B;  5EGT A;  1JWM D;  3X3M A;  1U4R A;  5C3X A;  2LKV A;  4ZRZ A;  4LAA A;  3MVV A;  3CRL C;  4PMB A;  1PTO F;  2R7Z B;  3KLS X;  2OEO A;  3OIP A;  1AFP A;  3SVM A;  3JAM E;  1C48 A;  1WTX A;  1DON A;  3Q0A A;  4DAP A;  2L5T A;  3BYT B;  2OXP A;  3MC0 B;  4FF4 A;  2EY1 A;  5EPK A;  4BBR B;  3AU7 A;  4X3U A;  4OIJ A;  2TMP A;  1PMR A;  4IUU A;  4L63 B;  3R8B A;  4PNY A;  1GUS A;  4PQX A;  1LAB A;  4ZKB B;  1ZXT A;  1JOO A;  1FNW A;  4KY5 A;  1PFM A;  1TS3 A;  3IFT A;  1KLG D;  1CTM A;  2RDF A;  4A3B B;  2KOL A;  2L11 A;  2SOB A;  3T13 A;  3P75 A;  2R6G A;  4XQN A;  1T5X D;  1EYC A;  3HOW B;  1X3P A;  3O13 A;  3E0J A;  1WD0 A;  4RA8 A;  3IAY A;  1D1K A;  4RCO A;  2CW0 D;  1LO5 D;  1FR3 A;  3D31 A;  1XXG A;  1STH A;  4RKL A;  2AQ3 B;  1D5X C;  2KJX A;  4CJ0 B;  2NTT A;  1IHZ A;  1B9M A;  2B2Y C;  1HHV A;  1E2Z A;  1HPC A;  3OPO A;  4X3S A;  3M7N A;  2AWN A;  1TS2 A;  1Q90 A;  3JAM L;  3S1Q B;  4IZ8 A;  5COR A;  5KRU A;  4C3J B;  2HCI A;  1F9P A;  5CV6 A;  2NB0 A;  3VA7 A;  4WRD A;  4FXG C;  3DUZ A;  1CI3 M;  2RQX A;  1DXM A;  1H9R A;  1U4P A;  3K58 A;  1HCZ A;  5IOC A;  3NSW A;  5G3L F;  5EPJ A;  1PXU A;  4RHS A;  4RKB A;  4F8M A;  3M4O B;  1CA5 A;  4NW2 A;  4MHE A;  1HFG A;  2QEJ C;  4K6D A;  2KUM A;  5FLX E;  4KN4 C;  2Z8L A;  1JQY D;  5A35 A;  3HRZ C;  3K59 A;  1SNQ A;  1EU3 A;  4XT1 B;  4FXD A;  1FNV A;  4C3H G;  5BN4 A;  1NR2 A;  4QCL A;  3FVQ A;  2BE5 D;  5ELB A;  1RDP D;  1KNE A;  1SEB D;  1YNN D;  4ZAI A;  2E2I B;  5IGG A;  5C4H A;  3NUC A;  2WIN B;  5I2X A;  3VYT A;  1C4Q A;  1B1Z A;  1H9K A;  1VDZ A;  3HOY B;  1Z47 A;  1JC7 A;  2PW5 A;  5KGU A;  3RMH A;  2PPB C;  3KK7 A;  3G7L A;  1YNN C;  3I4L A;  2PCF B;  2MJ8 A;  1RCV D;  1GUG A;  1IYU A;  4FF1 A;  3TN2 A;  2K5Q A;  2RKS A;  5HUR A;  2QCP X;  1TWF B;  1PRT F;  2B8F A;  1B2T A;  3SR1 A;  3LWE A;  4GZY C;  3BDO A;  1ENC A;  4QIW B;  1I6H B;  2EPB A;  2M9V A;  5KNC A;  5IGD A;  4FVM A;  3VR5 A;  5IIF A;  1CHQ D;  3MXP A;  2Q8T A;  3LNN A;  4ILW A;  4ZUJ A;  2R92 B;  1A3U A;  4OO1 G;  1II3 A;  5FLX L;  3D6W A;  4L6T B;  2RA4 A;  1DOM A;  1CZG A;  4YIJ A;  3NPP A;  4S3S A;  2PNR C;  2BDN A;  5BN5 A;  1TS5 A;  4PMW A;  3T51 B;  1SYB A;  4DN4 M;  1ROD A;  2AUJ D;  2I07 B;  4KHZ A;  3MZ5 A;  1T5E A;  1I3Q B;  1QNU A;  2A6E D;  4NMZ A;  4HAE A;  4I65 A;  4PV1 C;  3N52 A;  4R8I A;  2R93 B;  4M8A A;  2XSC A;  3QJY A;  3SK4 A;  3DEP A;  3A7A B;  2FFK B;  2A6E C;  1V8Q A;  4ZKC B;  2A74 C;  4DGZ A;  1G6Z A;  1STB A;  3QOL A;  4OO1 I;  1GJX A;  4TQU S;  3NTI A;  1VMC A;  1JE4 A;  1EYD A;  5JVG 3;  2EY6 A;  2K32 A;  2KQ3 A;  5CR3 A;  2D5D A;  3M3Y B;  2PZU A;  4ZQ3 A;  4M1U B;  2B8G A;  5KYL A;  4HMJ A;  2H4O A;  1TII D;  3MFG A;  4A3F B;  1G2S A;  3PO2 B;  1PZJ D;  4E6I A;  3UI2 A;  5ELD A;  4F87 A;  1JB3 A;  2MUY A;  2JYO A;  2IWH A;  1QWY A;  5J22 A;  2VB2 X;  2IX0 A;  3I72 A;  4IUN A;  1STY A;  1SYF A;  1Q3L A;  2PZW A;  4A3D B;  1DJR D;  2EJF C;  3KBX A;  3H94 A;  1F77 A;  1MI2 A;  2A73 B;  1EIG A;  3R93 A;  2ZXO A;  1TY2 A;  5M9O A;  2F4I A;  3L9A X;  1LT4 D;  3KBG A;  1PTO C;  1J9O A;  2G9D A;  3C1E A;  3P20 A;  2E76 C;  1DM0 B;  1LTB D;  1HUN A;  3GP7 A;  4RGN A;  2NTS A;  3BYY B;  3I8Z A;  5C0X G;  1ET6 A;  1F2Z A;  1SYG A;  2KEE A;  1PFN A;  5K36 H;  2K5D A;  3BVZ A;  1ENF A;  3I91 A;  3S1R B;  2VB3 X;  3BDC A;  3NQT A;  1GUW A;  4OHJ A;  1EY5 A;  3A8J E;  2IW3 A;  5I2Y A;  2KEC A;  5C3W A;  3BZD B;  3J80 E;  4QUC A;  2WKC A;  1NSN S;  5JVH 3;  4RAU C;  5CGK A;  2F0D A;  1XYI A;  3D3R A;  4IUV A;  4C56 C;  1I4Q A;  2B63 B;  5FKA C;  4KKT A;  4G7O C;  2XRS D;  3T4A C;  4IUQ A;  2Z4I A;  1S5E D;  2QF7 A;  5C0X I;  3MAQ A;  1A3T A;  4TSS A;  5KND A;  4XDX A;  4G7H C;  2WKD A;  1EYA A;  1EZ6 A;  5A2Q E;  4ULL A;  1CK1 A;  4U68 A;  3S2D B;  3H91 A;  1V1P A;  1L0Y B;  5I9P A;  2EJG C;  1HQM C;  2NVY B;  1SJE D;  3GTP B;  3C3L A;  1B44 D;  1XX8 A;  2MGS A;  3I90 A;  1L0X B;  2D2C C;  4FF2 A;  3A55 A;  5KNB A;  4EVO A;  1OXT A;  2EXZ A;  3H3V C;  1FNU A;  2DN8 A;  3J80 L;  3RLF A;  3HKZ B;  4KY6 A;  2BA1 A;  1F9R A;  2HDL A;  2NZ1 D;  5IT9 E;  4KV6 A;  5JPN C;  3KLS A;  1WTW A;  1HA5 A;  1KDC A;  4KK7 A;  3W3A A;  3QB3 A;  4UAI A;  3T16 A;  1SAP A;  3RUZ A;  2F3W A;  4ABN A;  1SNC A;  1KAB A;  2EYJ A;  3NHH A;  1D1I A;  2B2T C;  5C4J B;  1FYC A;  3HEJ A;  1GHJ A;  2EZV A;  1Y8P B;  1QE6 A;  4KKS A;  5I6Y A;  4RWS C;  1NAP A;  2N88 A;  3S1N B;  5A2Q L;  1Q1E A;  4Z9C B;  1H9S B;  4EQP A;  1LT3 D;  3CQZ B;  5CV8 A;  4BA1 I;  2F0I A;  3URY A;  2R3Z A;  1SXT A;  1F2M A;  4QF4 A;  1RJT A;  1EIH A;  3Q6S A;  1TWA B;  2B2V C;  1EQT A;  4OO1 H;  1LAC A;  2VXW A;  3K5O A;  4ZLT F;  3A54 A;  2CQA A;  5DM6 3;  1NR4 A;  2EYF A;  2SDF A;  1JOQ A;  2J0T D;  3NTH A;  4CKB A;  3IL8 A;  4K2K A;  3V96 A;  5IT9 L;  2F0W A;  4O42 A;  4G4K A;  3DHQ A;  3I4N B;  5LL6 X;  5C4Z A;  4V0B A;  3D4W A;  3NBH A;  5K36 G;  1UEA B;  3K6O A;  3TSS A;  5C44 B;  4HTH A;  3EVQ A;  3S14 B;  1G8Z D;  1OO9 B;  1BNZ A;  1EWC A;  2XNA C;  2B2W C;  2B2U C;  4QUF A;  2NVX B;  3HS0 C;  3DMU A;  2IX3 A;  3J7Y W;  2G9H D;  1D2B A;  2F0M A;  4KD4 A;  1BF4 A;  2F03 A;  1I6V C;  1PTO H;  3S9W A;  1SFO B;  3K5N A;  3K0Y A;  2K1B A;  4IAL A;  2MPM A;  2VUM B;  5JEA J;  4BS9 A;  2F0G A;  3I3C A;  2NVT B;  1JIC A;  1AP0 A;  1PDQ A;  5EKL A;  2IT1 A;  4C3I B;  4HCE A;  5T1I A;  2CW0 C;  1AW7 A;  3MTS A;  5KYI A;  4WFN 3;  3FDT A;  3SEB A;  4RFB A;  2FJ2 A;  1B53 A;  2X69 A;  4A3E B;  5JJZ A;  4EQN A;  2WII B;  2HCC A;  5C0X J;  3V05 A;  1SE2 A;  1QOH A;  2KA7 A;  5J39 A;  1XTC D;  2LS0 1;  1WVL A;  3K57 A;  3I4M B;  3RD4 A;  1LLR D;  2R61 A;  4JBW A;  3FEW X;  1KTK A;  1O78 A;  2RSN A;  4FXK C;  5J1Z A;  5JEA H;  3HOZ B;  1LTS D;  1G91 A;  2Q8I B;  1C8C A;  1SND A;  3QOJ A;  3QG1 A;  1JWU D;  1O80 A;  2KCC A;  3VYS A;  2OF1 A;  4CBV A;  1LTR D;  2F0L A;  2F0K A;  3V2T A;  1EU4 A;  3MHB A;  2EVB A;  2BE5 C;  4G7Z C;  4KY7 A;  5C0X H;  1HTP A;  1SYE A;  1MSG A;  1H9M A;  1UNS A;  2E74 C;  1VMP A;  4J6H A;  1F2Y A;  2J4X A;  5E1F A;  3GTK B;  2IX1 A;  5ELF A;  4FP5 D;  4TKO B;  2F0O A;  5I9O A;  4DF7 A;  2ZXP A;  2QIL A;  1R9T B;  4KN7 C;  2NBF A;  2JSO A;  3EQL C;  4HED A;  1PZK D;  1WD1 A;  3SDZ A;  2XRQ D;  3NTK A;  4XTC S;  2EYO A;  3NK9 A;  4DAV A;  4K8I A;  1A2T A;  3DEO A;  2RBM A;  4A93 B;  2EYL A;  2K03 A;  3BVM A;  1JR0 D;  3EJI A;  1BQQ T;  3HZX A;  1XWE A;  1TY0 A;  2RSO A;  4HR7 B;  1TT2 A;  3BVG A;  3TDQ A;  1QB5 D;  1IL8 A;  4DFA A;  4XIG S;  2L55 A;  5IGC A;  5FOB B;  5KIX A;  1A2U A;  1S5C D;  5M3M B;  2KHS A;  1EOT A;  2VNU D;  3VYR A;  4A3J B;  1Q1B A;  3D4D A;  3GTJ B;  1U9R A;  2LMC B;  2K28 A;  4FYD A;  4RHR A;  3I70 A;  2XN9 C;  2B2T A;  5EKK A;  4NP5 A;  1TU2 B;  3PO3 B;  1STN A;  2LFN A;  1J8I A;  2JEA I;  2AUK A;  5EBC A;  2O5J C;  4LJZ C;  2GA4 B;  4IUR A;  3TP5 A;  3NQI A;  4KMU C;  2E2H B;  2A5H A;  3ONA B;  2M2L A;  1HUM A;  2K04 A;  3L7Z C;  3HP3 A;  4DK1 A;  3HG9 A;  1LTT D;  1LTA D;  2B2V A;  5BN3 A;  2FHT A;  2ID0 A;  1DCZ A;  4FO2 A;  1I4X A;  4J8Q A;  5EKI A;  4C3H B;  5E3F A;  3PUV A;  4ZK9 B;  3C46 A;  1QIL A;  3L3O C;  5I6W A;  1EY7 A;  3TZU A;  3OW7 A;  5CBA E;  2AQ1 B;  4H7B A;  4A3K B;  3U9S A;  2A68 D;  3A7L A;  3TP6 A;  3U9O A;  4HSP A;  2O2L D;  3RZD B;  1HRJ A;  3SHL A;  2E75 C;  5C6A A;  4ME5 A;  1TWG B;  4QB4 A;  1SNM A;  5JPM C;  2E2J B;  2A68 C;  3BDL A;  5JEA G;  2PMZ B;  1BR9 A;  1DYQ A;  5C5M A;  4N9P A;  3J7A V;  4KJO A;  2F0Q A;  2EYM A;  3HOU B;  1UUP A;  3A8I E;  3DWP A;  4R8N A;  1X3Q A;  1NUC A;  4LK1 C;  1SDF A;  1BCP B;  2B2U A;  2B2W A;  3D8G A;  1WTR A;  1FD7 D;  4H44 C;  3P1H A;  1SNO A;  4R9W A;  5CV4 A;  3NWT A;  1DOK A;  2DY8 A;  2JP1 A;  3NE5 B;  4BY7 B;  3OMC A;  1KDA A;  2K7V A;  3OIQ A;  1OXU A;  1Q8I A;  1RHP A;  1ENA A;  2A6H D;  2KCN A;  2RDH A;  2F0P A;  3ZYY X;  5CV7 A;  2A69 D;  5IOD A;  1EY0 A;  1Y8O B;  1S4Z A;  1CT1 D;  2CVR A;  5M5W B;  1ET9 A;  1W6K A;  3PUY A;  1DD2 A;  4NDX A;  5DEH A;  2H1E A;  2A69 C;  1TKW B;  4C1N I;  3G6J B;  4V19 0;  3I73 A;  3WDN A;  2YU9 B;  1Y69 U;  4U67 3;  2X6L A;  1B9N A;  2IJ0 A;  4RH6 A;  5C5L A;  5DNF A;  3PIO 3;  1Y1V B;  4UDU C;  2ICI A;  1LTG D;  1TS4 A;  4Y7N B;  4A3G B;  4K6L A;  3FRP B;  2F0F A;  4OIK A;  1LT5 D;  4CKC A;  1PTO B;  2PW7 A;  1DOL A;  4K5W A;  4CKE A;  1I4P A;  2XIW A;  2O4X A;  1QJO A;  3PUZ A;  2L9H A;  3PMF A;  3TZD A;  1STA A;  3D6C A;  4RGO S;  2EYH A;  1BDO A;  1WTQ A;  5LHY 1;  1A3V A;  3N6R A;  1IKM A;  3SK5 A;  3DM1 A;  4HN7 A;  1E2V A;  1S5D D;  2NWG A;  1GUO A;  4KHV A;  5G3L D;  3CHB D;  3VR2 A;  2EY2 A;  3WOF A;  1EEF D;  2RVL A;  1ILP A;  1RKN A;  1RF2 D;  2N55 A;  5D65 A;  3PV0 A;  1A6X A;  3OMG A;  3T56 B;  2PQE A;  3PUW A;  2K01 A;  4H13 C;  2BA0 A;  3FPP A;  3QO2 A;  2K05 A;  1S5B D;  1RTN A;  3GD7 A;  1SBB B;  1LTI D;  1F9S A;  4C3J G;  4DNR B;  1CQV A;  1SNP A;  2IPK D;  5EQ0 A;  1ZKO A;  3ITP A;  2NUC A;  1Y1W B;  4HMI A;  1GUT A;  1TQO A;  1AEX A;  1M8A A;  4RGT A;  5COY A;  3S1M B;  3S15 B;  4G57 A;  3PUX A;  2K5W A;  1GHK A;  1X32 A;  1E0B A;  1EWH A;  1STE A;  1I4H A;  2JXM B;  1SSO A;  4DU9 A;  2F0U A;  2F0V A;  3C2P A;  4EGV A;  4C2M B;  3E5S A;  1IW7 D;  1SJH D;  2ZT9 C;  4XYO A;  1K8O A;  5EBD A;  1EY8 A;  4MN3 A;  2EE1 A;  4KTA A;  2J7Z A;  1JWS D;  3M85 A;  4IFD I;  1AZP A;  1IW7 C;  1EQV A;  4A3M B;  3NWS A;  2EJM A;  5IGF A;  2EY5 A;  4WJW A;  4TRD A;  3D4R A;  3OWE B;  1BO0 A;  3M4Y A;  5C4X B;  4RCN A;  3GQB A;  1TR5 A;  5I4D A;  5NUC A;  1CHP D;  5IGB A;  4ZYS A;  4B9W A;  4B08 A;  2YYZ A;  4IUP A;  5FO8 B;  2F0T A;  4DAY A;  1HXY D;  3MA2 B;  4RGM A;  3H0G B;  1QCB D;  5D14 A;  1PRT B;  2F0S A;  4XXE A;  3VR4 A;  1HQR D;  3CRK C;  2PO4 A;  1NCV A;  1ML0 D;  2F0H A;  2C9O A;  1V1O A;  2JEB I;  1K83 B;  1VF7 A;  1WCM B;  4H0L C;  1Z6H A;  3GO5 A;  2O5I C;  3IKJ A;  4DXG A;  1ESF A;  3K5M A;  3OSO A;  2CHB D;  5D3D A;  2F1M A;  2DY7 A;  2BDO A;  3GTQ B;  2QDB A;  3S17 B;  1D5M C;  1SE4 A;  4IUT A;  2L4N A;  1GOZ A;  3T53 B;  5TSS A;  3S16 B;  2ENB A;  2JA5 B;  3SXH A;  4K2L A;  3AMU A;  1PFB A;  2OT2 A;  2MP1 A;  2NN6 G;  2SNM A;  3OWF A;  4CGY B;  1G29 1;  3J81 E;  3MXG A;  1Y8N B;  1KLU D;  1O7L A;  3Q22 A;  2ZXR A;  5CC4 A;  1G2T A;  3KLR A;  3ND8 A;  3W2D A;  3ND9 A;  5CV5 A;  1AZQ A;  5T1G A;  4K14 A;  3GV3 A;  3ERO A;  3E6Z X;  4QMG A;  3AB9 A;  4DK0 A;  1BOS A;  1ILQ A;  2HDM A;  4ODG A;  5CYU A;  4AYB B;  3LWU A;  3VR6 A;  3HOV B;  1ZYR D;  1EY9 A;  2V4D A;  2L12 A;  5LL6 S;  1B50 A;  2HUG A;  2HQE A;  2NN6 I;  1IYV A;  3SE0 A;  2C5C A;  2D9U A;  1VCI A;  3PIP 3;  5M5Y B;  2JA7 B;  5M3F B;  2D62 A;  1ZYR C;  1EEI D;  1ONL A;  3QIA A;  1KAA A;  5DAU A;  4F88 A;  1R4Q B;  1U4M A;  1ZEQ X;  5JAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...