3E5SA

Crystal structure of staphylococcal nuclease variant delta+phs l103k at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e5sA00
2PQEA 3ITPA 5HURA 4EQPA 1EY9A 5CR3A 1ENCA 4K5WA 5J39A 4ZUIA 1SYDA 2F0MA 1EYDA 4KJNA 3EJIA 3HZXA 1STNA 3PMFA 4K8IA 5EKLA 1EY6A 4N9PA 2F0LA 2EY5A 4ME5A 2EYPA 4K2KA 3DMUA 5CV9A 5E3FA 4PMCA 1JOOA 5KRUA 4TRDA 5EKKA 2F0KA 3MZ5A 4KD4A 4WORA 1F2ZA 5F2DA 4EQOA 2F0VA 2RKSA 2SNSA 5IGBA 4MIUA 2F0NA 4NKLA 4NDXA 5CV6A 2F0IA 2LKVA 1KDAA 3VA5A 5C6AA 4B9WA 4K14A 1SNPA 3U9OA 2O4XA 4DFAA 4K2LA 4ZUJA 1SYGA 1IHZA 2F0UA 3QB3A 2RDFA 1STBA 2EXZA 1SYBA 2SNMA 3P1HA 4QB4A 2PW5A 1SNOA 3P75A 4NMZA 4RKBA 1EYAA 3S9WA 4K8JA 3E5SA 3BDCA 3QOLA 2F0QA 4EVOA 4KY5A 2M00A 3NQTA 4I65A 5JOBA 1JORA 4KY7A 3DHQA 1EY5A 4KV6A 1KAAA 5DAUA 1SNQA 5C3XA 5KEEA 4HTHA 5ISRA 1SYCA 4KJOA 2HQEA 1A3VA 1EYCA 3ERQA 3NHHA 1SNMA 3SXHA 3V2TA 1TR5A 3MEHA 3NUCA 4EQNA 4DU9A 5C3WA 5C4ZA 5JAVA 2PYKA 4IUNA 1EY0A 1TQOA 5I6YA 3MXPA 5CGKA 1STYA 5KIXA 4KTAA 5CC4A 5KYLA 2KHSA 5I9OA 3NXWA 1KABA 2F0OA 3SHLA 3H6MA 3LX0A 4HMJA 3D8GA 1EQVA 2EYHA 2F0PA 2EYLA 5E1FA 2F0SA 3D4WA 3EROA 3HEJA 4S3SA 2F3VA 3SK4A 5IODA 3EVQA 4NP5A 3C1EA 3OSOA 2OXPA 1EY8A 5IGFA 3TMEA 4PMBA 3TP8A 4DGZA 1NSNS 1STAA 4HMIA 2PW7A 3TP5A 2RBMA 4ZQ3A 5IGEA 4KHVA 4QF4A 2EY6A 1STGA 1AEXA 2F0HA 1JOKA 4H7BA 1KDBA 4G57A 5C5LA 1SNCA 5C5MA 3D6CA 5HGTA 2ENBA 1A2TA 1ENAA 1F2YA 2EY2A 3OMGA 3NK9A 5DEHA 5K5PA 3BDLA 1U9RA 4ODGA 4KD3A 5I9PA 1EZ8A 5IGCA 1EY7A 2EYMA 5KGUA 4R8NA 3C1FA 3D4DA 1SNDA 5M9OA 3SK6A 3QOJA 2F3WA 4K6DA 1NUCA 4DF7A 1STHA 4F8MA 2PZUA 5IIFA 3RUZA 2EYOA 4J1MA 2EY1A 1KDCA 1RKNA 3MHBA 2F0DA 4B9XA 2SOBA 4K5VA 1TT2A 4IALA 4N9TA 5CV4A 1F2MA 5NUCA 5C4HA 3SK8A 2F0EA 2KQ3A 5KYIA 1JOQA 3T13A 1EY4A 1A3TA 5IGGA 2EYFA 4LAAA 1A3UA 2OEOA 2F0WA 4OL7A 1II3A 5CV8A 2WACA 2F0TA 4QMGA 5CV7A 2EYJA 5EGTA 1SYFA 3SK5A 4ID6A 4K5XA 2PZWA 2F0GA 1EZ6A 4J6HA 2PZTA 4YIJA 3SR1A 3OMCA 2F0JA 3NP8A 4RKLA 5CV5A 1A2UA 4KY6A 3T16A 5IOCA 3MVVA 3TP7A 5J22A 1SYEA 3OWFA 2F0FA 4F7XA 3TP6A 3R3OA 4IZ8A 4PNYA 5IGDA 5I6WA 2NUCA 4WRDA 4E6IA 2QDBA 5J1ZA 2OF1A
chains in the Genus database with same CATH superfamily
4AH6A 3O13A 3A8JE 1LTBD 3A5UA 4ZKBB 1NNXA 1RTNA 2J7ZA 3VR3A 5A35A 4IURA 2NN6I 2EYPA 1EQTA 2DN8A 2F0KA 3MZ5A 3NBHA 3GQBA 1O7LA 3EBEA 5F2DA 1SROA 3R2IA 4JI1Q 1Q81C 2LKVA 1KDAA 2A73B 5C0XH 2KCNA 3EFXD 2CWAA 5IT9c 2LS01 2PW5A 1UUPA 1EYAA 4K8JA 4HCSA 2F0QA 1VMPA 4JI6Q 4JYAL 2K1BA 2R92H 2N88A 3GTPB 1PH6A 1JB3A 4KJOA 1CTMA 1WCMB 3ND8A 2O2LD 3KF8B 5FOBB 1VQBA 4DR1L 2F0OA 1BCPF 4HEDA 2DY7A 3D8GA 2LMCB 5C4XH 3RZOH 2MO0A 4IPCA 4OIJA 1IBML 2F52A 4LF4Q 1CSQA 4DV7L 5I2XA 4I7ZC 2B63G 1EY8A 3RLFA 5IGFA 1XJVA 1K0SA 2XWJB 3TP5A 1U4PA 5CBAE 4JOIA 1KDBA 1XTCD 5T1IA 5M5XH 1VQ7A 4CBVA 1T5XD 1LACA 4P71A 1F2YA 1FL0A 2EYMA 4B3RQ 4R8NA 4DAVA 5M9OA 2K05A 4K6DA 2B39A 1B9MA 1STHA 3CCUA 1X3GA 5M5YB 4A3IG 3I4OA 3KFUA 3CRLC 2EY1A 2I0QA 1TT2A 1TWCH 4A3MB 2QF7A 4DR6Q 1HNXQ 3TRZA 1V9PA 1CZGA 1TU2B 1JWUD 2PMZB 4DR5L 3PGZA 1HZBA 1JWMD 4JCVE 1N34Q 4ME3A 4DR7L 1XNQL 3T56B 2VXWA 3TP6A 2FFKB 1TWGB 2JA6B 2JSOA 2ATWA 1QZGA 5IP7G 3GTGB 2HDMA 5JVG3 1KQSA 3HOVG 4WRDA 4CKCA 1HNZQ 4ZUIA 1F77A 5G3LF 3K0XA 4RGNA 4CDDC 2KEEA 4KI0A 3OTOL 3BZDB 5E3FA 4FF2A 2NN6H 3HFZB 4POGA 3K5OA 4QIWE 4RG1A 2IY5B 1PH1A 3CP0A 1SMYD 5BR8L 3AFQA 1U4LA 2NTSA 4HSPA 1IBLQ 4B3SQ 4YHHQ 1YHQA 4X3KA 1QVGA 1Y1VH 5TSSA 1CA6A 1VQ4A 4DV3L 1AN8A 2HIXA 4YWMA 2FJ2A 1VQAA 4BBSH 4CKEA 1WVLA 1I3QB 3CC2A 1QVFA 2R3ZA 1I5FA 1L0XB 4JI8Q 4IUVA 2A6ED 2CW0C 3FKIB 1Y8OB 1CFMA 3U9SA 4IUNA 5EPJA 1WTPA 2Y0SB 3DEOA 1HCZA 1CKMA 3RN5A 1IW7C 3GV6A 2F0SA 3S1RH 2K5QA 4X64Q 1VQ8A 3Q24A 3B6YA 5IP9H 1NSNS 1V1OA 5IGEA 4KHVA 5CBEE 3T1YQ 1AEXA 2JN4A 1LYLA 5C5MA 4DAPA 2Z9HA 5HGTA 1E22A 4A3JG 5K5PA 4RCNA 1GKHA 4LJZC 4GKJL 2PI2E 4JOIC 2VB3X 3HKZG 3VR6A 3FP9A 1HNWL 2XRQD 1ZEQX 2ZXRA 1RKNA 2EJFC 1PZID 2VUMG 4IALA 4YY3L 4JV5Q 3PF4A 1B8AA 1FYCA 3PO2H 3S1QH 1C4QA 2RDGA 1C9OA 4R4QA 3J80E 1EZ6A 4E6IA 5I2YA 1FJGL 1PRTC 5CV5A 4XT3B 1LTLA 4X62Q 3MAQA 3R3OA 4AQYL 3PIPA 4KKUA 5J39A 4K5WA 1TWFH 1UE5A 2PI2A 3T1HQ 1YVCA 4PMWA 1NTGA 4WORA 4POFA 4AYBG 2RSNA 1XNRQ 1ASZA 4JI0L 2JK8A 2SNSA 4ZKCB 2R92B 1SAPA 5K36G 2PNHA 3I70A 1B1ZA 2GVAA 5L37A 1WTHA 4LF9Q 1SYGA 1ZKOA 3S1MH 5LL6X 4ZYSA 1HXYD 4DNRB 2WB1E 3BDCA 1PH4A 5C4XB 1MKHA 1B7YB 4V0BA 1YNJC 2M00A 5LL6S 3CC7A 2WFWA 3K58A 1ESRA 1KAAA 1SNQA 3GDEA 3HOXG 1EYCA 4GNXB 3BJUA 4A3LG 2K32A 4WJWA 5C4ZA 4J8QA 3VYUA 5M5XB 1D2BA 1HR0L 4X6AH 4X3SA 4DV6L 2MFIA 1YJ9A 4HMJA 4OHJA 1I4RA 5E7NA 1IKLA 4F88A 3PUWA 1V8QA 2AQ3B 2C35B 2PQAA 3C1EA 1RIPA 2K52A 3NENA 3W1BA 5IWAQ 3K59A 2ZM6Q 3ULPA 1PH7A 4OO1H 2OQ0A 4H7BA 4XDXA 1TWCB 2EVBA 5E4XA 2R7ZH 1ENAA 1XMOL 1M90C 1J5EQ 5GAGC 1PFNA 1PZKD 1WI5A 2CCZA 4DNIA 1HQRD 4EX5A 1EWIA 1MHWC 5BN3A 2ZTCA 4C3HH 4X66Q 3AMUA 3RUZA 1QCBD 1D5ZC 1B53A 1ZYRD 1Z7TA 2XN9C 5CV4A 4M1UB 1LTSD 4BY1H 1TY2A 3STBC 3U4ZA 3IAYA 1F9PA 3CD6A 4DV0L 1H9RA 1GUNA 5EGTA 1SE4A 5EJWA 3AYHB 3NP8A 4FYDA 2D2CC 2IJ0A 1OO9B 1GM5A 1VQOA 1Y1WG 2OWOA 3IKJA 2UXCL 2CH4A 3WWVA 4G7HC 4LUZA 3DWPA 3J7AF 1Y1VB 4X3TA 3CU7A 3VDYA 2CQOA 1UE7A 1X3EA 5CV9A 4Y52H 4LF7L 4XYOA 1VF5C 1JOOA 1Q46A 3A54A 4L8JA 1ONLA 4V190 4BBSB 3TS2A 4O1NA 3CKIB 2E76C 2FINB 1JT8A 2O4XA 2NBFA 1IXRA 1E7ZA 3H09A 5DM73 1V1PA 2M9VA 3S1RB 3NQTA 3J81i 1GD7A 1FGBD 2VW9A 1YNND 2ZTDA 5BN5A 1PHJA 2KA7A 1I94L 5I6YA 3I4MG 3M7GA 2QW7A 2E2IH 4ZAIA 4DR2L 4A93G 1HH2P 4JI2Q 3L3OC 5E1FA 3UE0A 4LFCL 2UXBQ 3D4WA 2D9UA 2A69C 4BA2I 4NXNL 4KMUC 1PRTF 3R93A 1EIGA 4PMBA 4HMIA 1QE6A 4G7OC 3H94A 4RH6A 5JJIA 2P5ZX 3HOUH 3PF5A 2EY6A 3VR2A 1KIXA 1JOKA 3CQZH 4JBJA 4G57A 2K5DA 2OT2A 1IYUA 4FF1A 1O7ZA 2K6AA 2NZHA 3VA7A 5C0XJ 1MSGA 3CMAA 4TKOB 3PO2B 1EZ8A 2DY8A 3S1QB 5HY6A 1XPUA 2JA5B 1Q82C 2WP8J 5LMNQ 2R93B 4FXKC 2VB2X 1CA5A 5JEAH 3NPPA 4XXEA 1BQQT 3M9BA 3HOZH 1E1TA 5M3MB 3CPWA 2BH8A 3J81c 2JE6I 4OX9L 3HP3A 1WCMH 2Z0SA 5AJ3Q 2OEOA 4DUYL 2UUAQ 2NVQB 3KDFA 1TWFB 1ILQA 4C56C 4QGUA 2ES2A 2GVBA 4DUZQ 3IFDA 1TY0A 1XTDA 4ZCKA 3HG9A 4K6LA 3TQYA 1GOZA 2RQXA 3J7A5 2VNUD 3CRKC 1SE3A 1IL8A 1RL2A 3ITPA 1HJPA 1XWEA 3P7JA 1GHKA 2A68D 3WDNA 1MBYA 2B3GA 1TIID 3KBGA 4FP5D 5JJKA 1EQRA 2G5DA 4DV5L 3MWYW 1BCPC 1HHVA 5GAHC 3NQIA 3JAML 1N33L 4FDBA 4OIKA 3J7ZC 2I5HA 2YYZA 1O7IA 1NE3A 1QUQA 3TSSA 1TWHH 2AWNA 4K14A 3U4VA 2HD3A 2E5LL 1SMXA 1HUMA 2EXZA 3HRZC 4JBKA 1SNOA 1EEFD 4GKKQ 4EVOA 1D1IA 1F9QA 4C3JH 4I65A 4UPAA 2B2WA 1GJXA 1JE5A 3EA6A 2I5LX 1HRJA 3K7AH 2O5JC 1I4GA 2KVMA 3ZYYX 3QR8A 1A6XA 3ER0A 4QQBX 5D65A 2R7ZB 4OELB 3HOWH 3LX0A 1AE2A 4MTKA 1YHAA 2EYLA 5IODA 2WKDA 1P16A 3T51B 1STAA 5DNFA 4C3HB 4LF8Q 3A7LA 2KCCA 1BXTA 3TN2A 4FF4A 1PV4A 1U4RA 3QO2A 3NK9A 4BY1B 4ODGA 4KHPQ 1ZXTA 5DM63 4DV1Q 4IJLA 4A3MG 1CKNA 5IT9L 5FO8B 3BZCA 4FNFA 1JJ2A 2ZJPA 1JB7A 2PZUA 2Q2IA 2HT1A 2K4KA 2JJQA 1A0IA 1A62A 2EIFA 5C3EH 3HKZE 1LT3D 3UDXA 4JI4L 1H9MA 1DONA 1Y8PB 5ELOA 2JA6G 1LTGD 2IPKD 1JMCA 2VQEL 2O5IC 4MN3A 2K75A 2EYJA 3F1ZA 5GADC 2DJFC 3AU7A 4O0AA 4B3MQ 4PZ8A 4BY7H 4HJ5A 2AWOA 5EPKA 2YV5A 4HN7A 4R4CA 3MXNA 1Q8IA 1N36L 4A75A 3S17B 3HKSA 1FGUA 1MIUA 3KK7A 4NPSA 4BWGB 4IN3A 1DGSA 1LT5D 5H1SE 1NCVA 1YJNA 4LUVA 4IFDH 4KJNA 3HZXA 4JI1L 3NWSA 3ONAB 1VF7A 2F0LA 3KLSX 1PLFA 2HHHL 1HA5A 1WTOA 3WOEA 3K57A 3RLNA 1Q86C 3K0YA 2D0PA 3M85A 2F0NA 3CCEA 5IYDH 2K04A 3TREA 1LT4D 1RJTA 2XTIA 1MI2A 1VQDA 2Z8LA 2UXDL 2ZXOA 4NW2A 1X55A 4CDEC 1EU3A 4AYBE 3GTKH 2E2IB 2SNMA 4K0KL 4RKBA 4X3UA 1BBXC 3FKIG 1SDFA 1BKBA 1JC7A 3LGJA 2Y0SG 4LF5L 1UE1A 4HCEA 3SXHA 2XSCA 3HOUB 3MEHA 3CQZB 5KIXA 1EY0A 3MA2B 2B2WC 1LABA 3L2PA 4EQ5A 1N8RC 2F0PA 3FDTA 1A63A 4APVA 2EE1A 3HEJA 2XVSA 2SDFA 1NMGA 3F2UA 2Z1CA 3TP8A 5IYCG 3K5LA 4WJ3M 1ICWA 1WJJA 4RGOS 4YWLA 4QJFA 5C5LA 1QNUA 1EYGA 1WYDA 3HOZB 2TMPA 4WJ4A 1A2TA 1CKOA 5DEHA 5C44H 2R7DA 3S1NH 3CW2C 1E2VA 2WINB 4DR6L 3AEVA 4LFBL 3F8TA 2OCEA 2L55A 3MXUA 1WOCA 3HOYB 1OXUA 1C48A 5NUCA 2N49A 3M3YH 1A3TA 2EYFA 2KHIA 1EU4A 1FR3A 2PQAB 2WV6D 1L1OC 2Q2HA 3SR1A 1J6QA 1VQHA 1HNZL 5C0XG 3C3LA 1VS0A 2NUCA 3LWUA 2L11A 2XGTA 3M4YA 1TKWB 3I8ZA 1Z9FA 3K7UC 1TWHB 4DAMA 2UU9Q 3A8IE 3Q22A 4AIMA 1W2BA 2R92G 4B3SL 1UNSA 1SXTA 1GO3E 5D3DA 2N55A 4KHZA 4X65Q 1EQQA 1D5XC 4GOPB 3BVMA 4PG3A 4XYQA 4DK3C 2UUCL 2RSOA 4C3JB 3UDIA 4L5TA 4CKBA 1H9SA 4OEMB 4YCWA 2A6HD 3WOFA 3CHBD 3K7AB 5C4XG 2EDGA 4G7ZC 3U9OA 1I4XA 4OXPA 5T1GA 3HOWB 3G4SA 3E5SA 2D5DA 2ICIA 1RDPD 5A2QE 3RD4A 2A5HA 1SLJA 1JE4A 1BCPB 4DV7Q 1PFSA 4LMQD 4XIGS 1Y69U 1OXVA 2H4OA 1FNWA 3TZUA 4EQNA 4DU9A 4A3GB 2AQ2B 1UE6A 1KRTA 4IQZA 4JI7L 4GN4B 2F1MA 3SK4A 1TS3A 2H5XA 3OSOA 5ELFA 3H3VC 3KUPA 3PV0A 1PTOF 3MTSA 1S72A 1QJOA 4PV1C 2NYZD 3QJYA 1B2TA 2KEDA 2N8NA 5C3EB 5I9PA 1V1PB 2IX0A 2N3SA 2AQ1B 3ERSX 1LT6D 3QOJA 2VZAA 1NUCA 4KLKA 4DR5Q 4BY7B 2KECA 2MNAA 3ZJYC 3TS0A 1R4QB 4HJAA 3FHWA 3DEPA 4N9TA 1SMYC 4C3IH 2NVXH 2FXQA 1XNQQ 3PO3H 1UWVA 4DR7Q 4P2CB 4R1JA 2RCNA 3I91A 1PFMA 4X62L 5KYIA 3I73A 1X3FA 4A3KB 2NN6G 5IGGA 2K14A 1E2WA 1II3A 2KOLA 3GTQH 1NR4A 3HS0C 3OPOA 2F0GA 5JVH3 2PZTA 5KGUA 4IUQA 2ZXPA 3M4QA 1Y1VG 3OTOQ 2J4XA 3T1HL 2JA8H 3R8BA 1PDQA 4DR3Q 4JW0A 2A6EC 3RLOA 1E24A 2V1CC 5CR3A 3TBIB 2C9OA 4BBSG 4Z9CB 3K6OA 1HFNA 4DAYA 3GTKB 2Z6KA 4PMCA 3C46A 2D0OA 2JA5H 1CK1A 4DV3Q 1AZQA 2R93H 4A3BH 1WTVA 5JEAJ 1V1QA 4NDXA 1STEA 5KNBA 2B2TA 5M3MH 2F0UA 5IYBH 5FO9B 5IP9G 3CAMA 5KNCA 4NXMQ 4LFAL 2NVQH 4HJ8A 2ZJQA 1O78A 3KF6B 4KY7A 3DHQA 3S2HB 2WAQB 1YI2A 2HQEA 2F4VQ 1JR0D 1IBKL 1N32L 1S3OA 2QEJC 2ID0A 4UY8C 4Y7NH 5IWAL 4A4IA 5I9OA 1I50H 3SHLA 4DR4Q 5C44B 3S1NB 1EOTA 3GD7A 4KKSA 1J5EL 4FF3A 2JEAI 4GKJQ 4UP9A 3GV3A 4UDUC 4OONA 3PO2G 1PH3A 3J7YW 5JJLA 1QUQB 3S15B 2JA7H 1STGA 2JA5G 1PFBA 3G6EA 1JJCB 3S14H 3OMGA 5EBDA 4B3TL 4YY3Q 2PO4A 5EBCA 3M3YB 1LLRD 2EQSA 5JPNC 3C1FA 4RFBA 2TSSA 5M3MG 3GTLH 4F87A 4GLXA 4DF7A 4L63B 4IPDA 1O80A 1E1OA 1KNAA 1HQMC 4DN4M 1BBUA 2XRSD 1BR9A 5I4DA 2PPBC 3PUXA 1KNEA 1W6KA 1I6VC 2KHJA 3T13A 3JAME 4CJ2C 4AQYQ 2IHEA 2PMZE 3A56A 4TSSA 2Z4IA 3OMCA 5A2QL 1K83H 5KNDA 1XPOA 2IX1A 1TWAH 4LNQA 4A3CH 1BF4A 2E8GA 1SYEA 2GN5A 1AZPA 2VQFQ 3P20A 4PNYA 4IUUA 3Q0AA 5J1ZA 1SJHD 4IPHA 4N8X1 5M3FH 4JI0Q 2PCFB 4BXXH 2L4NA 4PZ6A 4DV2Q 1S5CD 1X3QA 2XWBB 3VYSA 1EY6A 1LV9A 3CMEA 1VQMA 3GTOH 5EAYA 5E4WC 3ULJA 1L1OB 2OQKA 2Z6KC 2EXDA 3Q6SA 1G291 1FNUA 2AMCB 2KJXA 2FMMA 3RZDB 2E2HH 4R4IA 3D0FA 3J81L 2E2JB 4OO1G 1HTLD 4DV6Q 2R7FA 1M8AA 4NB3A 1PMRA 2B2TC 3TEHB 2L1BA 2R7ZG 1JORA 4C1NI 1DOMA 1SYCA 2FHTA 5IT9E 2HIVA 1ZYRC 1G2TA 3S17H 4ZLTF 5C3WA 3K5MA 2PYKA 1XYIA 3MXPA 5CC4A 2Y0SE 4C3HG 1C7YA 4GLVB 5FLXL 4A3JB 4IFDJ 1WTRA 5EPLA 2K7VA 1NBWA 5ELCA 1XMOQ 5EKIA 2BE5D 4BY1G 2K5WA 3G48A 2B8GA 3HKZB 1RODA 2MHVA 2DJGC 4QF4A 4C3IB 3PO3B 2NVXB 1HTPA 4YCUA 5M5WH 3S2DH 4HIDA 1U9RA 4ABNA 4JI3L 2OTJA 3GTQB 1D5MC 1H9KA 1E0BA 5AJ3L 4DV0Q 2UUAL 1DYQA 3GP7A 1KDCA 2F0DA 3NBHB 3PSIA 1GVPA 4DUZL 4O42A 2JA8B 3J7AV 1L0YB 3I90A 4QY7A 3H15A 1HZ9A 1EY4A 3C2PA 1DCZA 4GLAC 4P72A 2UXCQ 5IGCA 3SVMA 4XQNA 4G4KA 2B8FA 3KLWA 1RF2D 4KY6A 2B2UA 2AHOB 1GHJA 1YBYA 1T9HA 4LF7Q 2HDLA 1YNNC 4A3BB 1EEID 3L0OA 2E74C 3LWEA 4AYBB 2MUYA 2OF1A 2B29A 3QIAA 1Q1EA 1K73C 4M8AA 4DNTB 1YITA 3NWTA 1RCVD 3S16H 4HIOA 1QB5D 4R4OA 4RGMA 3M7NA 3PIP3 1B9NA 5KRUA 1X3PA 5EKKA 2LSSA 2MP1A 2F0VA 3E0JA 5IGBA 1K8AC 1KRSA 4XT1B 3HOYH 4B9WA 3HOXB 4IJHA 3TDQA 1PA6A 4Y7NB 3QB3A 1GUGA 1X6OA 3J80i 1I94Q 1I50B 3P75A 4NMZA 3CCJA 5FLXc 1R4PB 4DV4L 3HOUG 1CI3M 4DR2Q 3BYTB 3VR5A 2EJMA 2C5CA 4LFCQ 4NXNQ 2HQLA 1Y14B 3A5ZB 4HTHA 1OTCA 2MO1A 3ERQA 4L5SA 2JA7B 1PRTB 3NTIA 3S14B 2JQOA 1PH8A 2IX3A 5JEAG 2EYHA 1A8VA 3HOZG 1K9MC 3GTLB 3TMEA 1WCMG 5FJ8H 1XPRA 2RBMA 1MGSA 4H0LC 3MC0B 3I4NH 2IWHA 2ENBA 4GZYC 3CCQA 2A68C 4BBRH 4IOAA 3HOYG 2DNEA 4OX9Q 2RCFA 2X69A 3D4DA 1TS2A 1EIHA 4DXGA 3M4OH 4DUYQ 4IUTA 5FKAC 3SEBA 1K83B 2NZOA 3MFGA 1TWAB 3D31A 2KCTA 3JC66 3NBIA 3J80c 4B3ML 4GNXA 2XNAC 4LK1C 3CCLA 1DOKA 4PZ7A 1S5DD 5M3FB 1Y1WB 4RCOA 5CV8A 4A3GH 5CV7A 2NB0A 5LMUQ 4P75A 2E2DC 1GUOA 1H95A 3MEFA 5J22A 1A2UA 1HA6A 1VQEA 4DV5Q 3GTOB 2F0FA 2K5VA 3D4RA 4A3FH 1N33Q 4RMFA 3RMHA 2PQEA 2B2UC 1VQPA 3BZKA 3SGIA 1ENCA 4JPBW 4KN7C 4C3JG 1BDOA 2E2HB 1I4HA 2NZ1D 4N9PA 2NVTH 2QDLA 2L9HA 1E2ZA 1QVCA 4OWTB 4QIWB 1VCIA 5DLQE 3KBXA 3W2DA 1OXSC 1TVXA 1PTOC 2L15A 3BYYB 4DK0A 3HOWG 4CJ1B 5CV6A 5GAEC 5C6AA 3H0GH 1XMQQ 1SNPA 1I6HH 3D3RA 4YCVA 4DFAA 3CCVA 1T5EA 4QUCA 1IHZA 1L2FA 1STBA 5ELDA 4A3KH 1RHPA 2JYOA 4DA2A 5FLMH 3QOLA 4A3GG 1TS4A 1FNVA 1AW7A 2K5NA 4EGVA 4ZK9B 2QGQA 1GUSA 2L5TA 1KHIA 3IFTA 4DAYB 3NELA 5M5WB 1PH9A 3S2DB 3OYYA 4JI6L 3NTKA 2K5HA 1Z6HA 1KC8C 3SE0A 4NP5A 3NE5B 2A74C 3W5OA 2KBNA 5C3EG 3BVZA 2CHBD 1VQ5A 3FPPA 2UUBQ 1F9RA 4JBWA 2BH2A 2DUDA 5J3BA 2KCMA 1PTOH 4BY7G 3X3NA 3N6RA 4LF4L 4KD3A 1AP0A 3CPFA 1EIYB 4JI4Q 2KENA 2VQEQ 2K33A 3W1GA 1JICA 1GUWA 4IFDG 2SOBA 3S2HH 1N36Q 2B63H 4B3RL 4DXFA 4GNXC 2F0TA 2YTXA 3SK5A 1VQFA 4K5XA 5LMNW 5I6WA 3S16B 1BBWA 5IOCA 5IYDG 2UU9L 1Z47A 1XXGA 2LXJA 2HHHQ 3VR4A 1HNXL 2DGYA 4X65L 4LF6Q 4R4TA 4L5RC 2AUKA 3S15H 4A3IH 1YZ6A 3U58A 4JI5Q 4FXDA 4JVZA 1N34L 2UXDQ 3QWNA 1AH9A 1YEZA 4K2KA 1U0LA 2Q8IB 4HIKA 1K0RA 1JQYD 1SJED 4ZRZA 2K03A 1WTXA 1HPCA 4K0KQ 2Z6BA 4ALPA 1K3BC 2K50A 4MIUA 1X9NA 2IL8A 1MJEA 3H3VI 3T4AC 1QNKA 1X65A 2RHSB 4LF5Q 4RA8A 2LFNA 1S5ED 2WAQG 3E3XA 1QILA 5IP7H 3HOVH 2DNCA 2WB1B 2V4DA 4KY5A 4LW1A 1IBLL 2M2LA 1OXTA 1PYBA 5KEEA 5C44G 4YHHL 4A3EB 1KAWA 4RHSA 3NHHA 3R2TA 1WFQA 1QWYA 3I7FA 3NUCA 1N9WA 2X6GA 3I4NB 3GTJH 4JYAQ 1STYA 4KTAA 3K81C 4BBRB 2QEXA 1JCKB 4JG2A 1LM0A 2F3VA 2ZTEA 3M4OB 4JI8L 1KXLA 4JK1C 3M4PA 3IL8A 5ELNA 4LFBQ 1G51A 4DR1Q 1VQLA 3URYA 1CHQD 1YNXA 1S5BD 1IBMQ 3D6CA 4H02A 1SR3A 3BDLA 4A3DB 1QZHA 1EWCA 4X64L 1CSPA 1Q12A 5COYA 3RZDH 2EPBA 2EZVA 3FEWX 5FK9C 1SNDA 1IKMA 2F3WA 2E2JH 1KLUD 3T1YL 1DXMA 1S40A 3E9HA 4QL5A 3OW7A 1O7YA 2CW0D 3F2CA 1K28A 2SEBD 3SK8A 2A6HC 1EFWA 2F03A 4A3FB 1PH5A 4DK6C 4MZ9A 2MJ8A 4QUFA 4A76A 4R9WA 4UP8A 3RN2A 2F0WA 2WACA 3G6JB 1IW7D 4BS9A 1NMFA 4DR3L 3CC4A 3NTHA 1SRUA 1NAPA 1V43A 1PZJD 1B4OA 3T16A 5CMDA 4A3JH 3MVVA 5JPMC 2CQAA 2NVTB 1HZAA 4WFN3 4JV5L 3J81E 1SFOH 1YJWA 2CH4W 2HCIA 2UUCQ 4MNOA 3G7LA 5C4JB 1FVIA 3H0GB 1G91A 1I6HB 2VUMH 3EJIA 1YHBA 3ND9A 4IUPA 1W3SA 1XX8A 3PUZA 1EL0A 1ENFA 5FLXE 3A74A 1R9TH 4NXML 2RKSA 1Q1BA 2F3IA 4RAUC 2F0IA 1SN8A 1K3RA 2H1EA 3H3VH 3DWAA 3GO5A 1WTWA 1JJGA 4K2LA 4OWWB 3P1HA 2F4VL 4OO1I 1PRTD 5BR8Q 4CDCC 2L0CA 4JI7Q 1XNRL 2F4IA 5LHY1 1TXYA 4C2MH 1TS5A 3UI2A 3PIO3 3I56A 4DR4L 1J9OA 2RVLA 1MJCA 3V2TA 4LF9L 3KLRA 4C1NK 4MHEA 3EQLC 2VL6A 5CGKA 1PTOB 5KYLA 4HSVA 4HIMA 3NXWA 1LTTD 1D7QA 1DM0B 3N52A 1EQVA 2HUGA 5GROA 5K36H 4FXGC 3KDFB 1BUVT 4H13C 4HJ7A 3KOJA 4C3IG 5FLMG 3BU2A 3PO3G 1K8OA 2FMCA 3RR5A 3PUYA 1B3QA 1QG7A 1X32A 2CVRA 2RHQB 2B2VA 1SEBD 1KL9A 5CYUA 4L6TB 1B3AA 3KJPA 1ILPA 2EY2A 2RDHA 2B63B 1JWSD 1H9JA 5D3IB 2L12A 2YTVA 3HOXH 1EWHA 4A3LH 2JA8G 3DM1A 1YNJD 3CCSA 2MQHA 2ZM6L 2NTTA 1Y8NB 4J1MA 3CCRA 1CHPD 4B9XA 3GTMH 1BO0A 2BDOA 1A15A 3FRPB 1VDZA 1HNWQ 2Q8RE 1A3UA 4OL7A 4A3IB 5D14A 4KN4C 2VQFL 3K5NA 1X56A 4U68A 4A3BG 2R93G 4YIJA 4X66L 2QA4A 1ET6A 1KTKA 2F0JA 4RKLA 3TP7A 4DV2L 1VQKA 2I5MX 2BA0A 2AKWB 1VQGA 3L7ZC 4OWXB 5IYBG 1FJGQ 1G6ZA 2VY3A 3RZOB 4K8IA 3KF8A 2MGSA 5EKLA 1L0WA 3I72A 3KYHC 2ICEC 3HOVB 4ME5A 3DXJC 2QILA 3AFPA 1I4QA 4LFAQ 3T53B 1U5KA 3AQQA 3OIQA 1MD2D 3VA5A 3STBD 1E3PA 1VQNA 3A7AB 3S24A 5BN4A 3Q8DA 4R8IA 3GTJB 1IBKQ 4KD4A 1N32Q 2IW3A 1CT1D 1MSHA 4QB4A 2JEBI 3IRBA 3S9WA 1Y1WH 1WTQA 2NWGA 1LTAD 1Q90A 2JA7G 2VS1A 1CKNB 3A55A 2YU9H 1K8GA 2G9DA 1EY5A 5C3XA 1U4MA 4TVAB 1A3VA 3OWEB 4N8FA 5JAVA 1IYJB 2QKIC 1NY4A 1LO5D 2ZT9C 3HGBA 3E0EA 3BDOA 4IOCA 3L9AX 2G9HD 2WKCA 4IO9A 1J8IA 3RNUA 1NR2A 4B3TQ 4GOPA 2CFMA 3EROA 4RGTA 3I2ZA 4B08A 2OXPA 3VYTA 3BS1A 2I07B 4DGZA 1HR0Q 1D8LA 2PW7A 1ESFA 2JP1A 3MXNB 5ELEA 4KKTA 5IY0A 3KLSA 1CQVA 2F0HA 2BA1A 1ICFB 3PCOB 4J15A 3F2DA 4JI2L 4L5QA 1M4VA 2NVYH 3UDFA 4A3CG 2UXBL 1EY7A 2B2VC 3E9IA 1D6EC 1BNZA 3SK6A 1BVSA 3QG1A 3I4MH 3K8AA 2Q2TA 1AE3A 3BG3A 2WIIB 4F8MA 2B2YA 5M3FG 4BXXG 5IIFA 4A93H 1DZ1A 2LXKA 3MHBA 4KK7A 4FO2A 1HZCA 1KLGD 2BCOA 4K5VA 5AFWA 1SFOB 1DJRD 1JOQA 2Q8TA 2X6LA 1QOHA 1PYWD 4MTNA 4P74A 5LMNL 2R61A 1SYFA 2A69D 3KJOA 3G71A 2PZWA 2VUMB 4HAEA 3ICEA 1Q3LA 3DWQA 3K80C 4F7XA 1S5FD 3I55A 4U673 4IZ8A 1R9TB 5HURA 3FMCA 4RHRA 4EQPA 3CXCA 1EY9A 1PVOA 1EYDA 4BA1I 3PMFA 1STNA 2PNRC 1EFID 2A1AA 2BOSA 3J81j 3DMUA 2RF4A 2BDNA 3OOCA 2BE5C 2A19A 4FVMA 4XQJA 1F2ZA 4EQOA 2R6GA 5EQ0A 4C2MB 1CQFA 3EN2A 4XQQA 4NKLA 1W6JA 3J80L 4DKAC 2Z4HA 2RDFA 3CCMA 1SYBA 4YWKA 4TQUS 2I46A 2CWPA 3MXGA 2WAQE 4JC0A 2KUMA 1P8LA 4QCLA 1VQ6A 1UEBA 3A0JA 1FD7D 3FVQA 4GKKL 1VQIA 2CKZB 1KABA 1G6PA 2EJGC 4UAIA 1CUKA 1BCPD 1D1KA 3D6WA 4S3SA 3VYRA 3EVQA 4JI3Q 5HGQA 3GTPH 1LTRD 3SDZA 4ZQ3A 1Q7YC 4GOPC 1SSOA 4XTCS 3GTMB 1ASYA 1GXDC 1K8MA 1SNCA 2ALYB 4H44C 4CHTB 3MFYA 1HFGA 3U50C 1EUJA 1CZWA 4LUOA 3NEMA 3KF6A 4LF8L 1F2LA 2EYOA 4IFDI 5LMUL 4RWSC 4ILWA 5GQOA 2ASBA 1IZ6A 1H9SB 4KHPL 2KQ3A 3S1MB 1OXXK 4A3EH 3I3CA 4DV1L 1VQCA 2B2YC 4GN5A 1BOSA 4LWCA 4QMGA 1VQJA 4J6HA 3Q23A 1NJIC 2A8VA 5M5YH 1IYVA 3E6ZX 4CGYB 4UP7A 1RTOA 3UDGA 1B44D 4A3MH 2OTLA 4UHVA 5IGDA 1EIFA 2QDBA 3PQIA 3I4LA 4PQXA 1SBBB 1SYDA 2F0MA 2IT1A 5ELBA 1AFPA 5G3LD 1VMCA 4A3DH 2EY5A 1S4ZA 4HR7B 1XMQL 2XIWA 1YIJA 3OIPA 3OW2A 4GN3B 1SE8A 2AUJD 4TRDA 1TWGH 5IE8A 1IL2A 2JA9A 2JA6H 4DV4Q 2YU9B 3DUZA 3GTGH 1RD9D 3LNNA 2LY7A 4CDFC 2WB1G 5C0XI 1F9SA 1C8CA 3CF5A 3JAMi 1GUTA 1DD2A 3ULLA 4ZUJA 4CJ0B 4P73A 1PYSB 3DLLA 5FJ8G 2K28A 4A3EG 1UEAB 1G8ZD 2JXMB 1PTOD 1PH2A 4DPGA 3I4NG 4HJ9A 3NSWA 5JOBA 1KD1C 4KV6A 4ULLA 5DAUA 4BBRG 5ISRA 3A8KE 1WD0A 2E5LQ 3PUVA 2N78A 1SNMA 2MPMA 4IPGA 2Q2UA 1TR5A 3BVGA 1TQOA 4O2DA 1C0AA 2KHSA 2UUBL 3DM3A 4GS3A 2YTYA 3H6MA 1M1KC 2NVYB 1HR0W 2J0TD 5C4JH 2HCCA 3X3MA 1DOLA 5JJZA 1PXUA 2E75C 1L1OA 1I3QH 4I7AA 4OGQC 2GA4B 3I4MB 4Q0FA 4A3DG 2K01A 3UE1A 3TZDA 4A93B 4JBMA 3FKIH 2RA4A 3H91A 1G2SA 1CM9A 3F2BA 2QCPX 3JAMc 4Q5VA 3FPUB 5CORA 4A3FG 3W3AA 1WD1A 1HUNA 1UAPA 1EOVA 5FO7B 1I4PA 1Q8KA 1X54A 1B50A 1VQ9A 1SE2A 1F2MA 5C4HA 2F0EA 5IYCH 4LAAA 2ZJRA 2D62A 4LF6L 4DK1A 4ID6A 3V05A 2IHFA 3V96A 3AB9A 3H0GG 3OWFA 4JI5L 3PIOA 3OHXC 1LTID 4A3KG 2EOTA 1ET9A 1ML0D 3EIVA 1B70B 1LUZA
chains in the Genus database with same CATH topology
3O13A 3A8JE 1LTBD 4ZKBB 1RTNA 2J7ZA 3VR3A 5A35A 4IURA 2NN6I 2EYPA 1EQTA 2DN8A 2F0KA 3MZ5A 3NBHA 3GQBA 1O7LA 5F2DA 3R2IA 2LKVA 1KDAA 2A73B 5C0XH 2KCNA 3EFXD 2LS01 2PW5A 1UUPA 1EYAA 4K8JA 4HCSA 2F0QA 1VMPA 2K1BA 2N88A 3GTPB 1JB3A 4KJOA 1CTMA 1WCMB 3ND8A 2O2LD 5FOBB 2F0OA 1BCPF 4HEDA 2DY7A 3D8GA 2LMCB 4OIJA 5I2XA 4I7ZC 1EY8A 3RLFA 5IGFA 2XWJB 3TP5A 1U4PA 5CBAE 1KDBA 1XTCD 5T1IA 4CBVA 1T5XD 1LACA 1F2YA 2EYMA 4R8NA 4DAVA 5M9OA 2K05A 4K6DA 2B39A 1B9MA 1STHA 5M5YB 3CRLC 2EY1A 1TT2A 4A3MB 2QF7A 1CZGA 1TU2B 1JWUD 2PMZB 1JWMD 3T56B 2VXWA 3TP6A 2FFKB 1TWGB 2JA6B 2JSOA 3GTGB 2HDMA 5JVG3 4WRDA 4CKCA 4ZUIA 1F77A 5G3LF 4RGNA 2KEEA 4KI0A 3BZDB 5E3FA 4FF2A 2NN6H 3K5OA 1SMYD 1U4LA 2NTSA 4HSPA 4X3KA 5TSSA 1CA6A 1AN8A 2FJ2A 4CKEA 1WVLA 1I3QB 2R3ZA 1L0XB 4IUVA 2A6ED 2CW0C 3FKIB 1Y8OB 1CFMA 3U9SA 4IUNA 5EPJA 1WTPA 2Y0SB 3DEOA 1HCZA 1IW7C 3GV6A 2F0SA 2K5QA 3Q24A 1NSNS 1V1OA 5IGEA 4KHVA 5CBEE 1AEXA 5C5MA 4DAPA 5HGTA 5K5PA 4RCNA 4LJZC 2VB3X 3VR6A 2XRQD 1ZEQX 2ZXRA 1RKNA 2EJFC 1PZID 4IALA 1FYCA 1C4QA 2RDGA 3J80E 1EZ6A 4E6IA 5I2YA 1PRTC 5CV5A 4XT3B 3MAQA 3R3OA 4KKUA 5J39A 4K5WA 4PMWA 4WORA 2RSNA 2SNSA 4ZKCB 2R92B 1SAPA 5K36G 3I70A 1B1ZA 1SYGA 1ZKOA 5LL6X 4ZYSA 1HXYD 4DNRB 3BDCA 5C4XB 4V0BA 1YNJC 2M00A 5LL6S 3K58A 1ESRA 1KAAA 1SNQA 1EYCA 2K32A 4WJWA 5C4ZA 4J8QA 5M5XB 1D2BA 4X3SA 4HMJA 4OHJA 1I4RA 1IKLA 4F88A 3PUWA 1V8QA 2AQ3B 3C1EA 3K59A 4OO1H 4H7BA 4XDXA 1TWCB 2EVBA 5E4XA 1ENAA 1PFNA 1PZKD 1HQRD 5BN3A 3AMUA 3RUZA 1QCBD 1D5ZC 1B53A 1ZYRD 1Z7TA 2XN9C 5CV4A 4M1UB 1LTSD 1TY2A 3IAYA 1F9PA 1H9RA 1GUNA 5EGTA 1SE4A 5EJWA 3NP8A 4FYDA 2D2CC 2IJ0A 1OO9B 3IKJA 4G7HC 3DWPA 3J7AF 1Y1VB 4X3TA 3CU7A 5CV9A 4XYOA 1VF5C 1JOOA 3A54A 4L8JA 1ONLA 4V190 4BBSB 4O1NA 3CKIB 2E76C 2FINB 2O4XA 2NBFA 3H09A 5DM73 1V1PA 2M9VA 3S1RB 3NQTA 1FGBD 1YNND 5BN5A 2KA7A 5I6YA 3M7GA 4ZAIA 3L3OC 5E1FA 3D4WA 2D9UA 2A69C 4BA2I 4KMUC 1PRTF 3R93A 1EIGA 4PMBA 4HMIA 1QE6A 4G7OC 3H94A 4RH6A 2EY6A 3VR2A 1JOKA 4G57A 2K5DA 2OT2A 1IYUA 4FF1A 1O7ZA 2K6AA 3VA7A 5C0XJ 1MSGA 3PO2B 4TKOB 1EZ8A 2DY8A 3S1QB 2JA5B 2WP8J 2R93B 4FXKC 2VB2X 1CA5A 5JEAH 3NPPA 4XXEA 1BQQT 5M3MB 2JE6I 3HP3A 2OEOA 2NVQB 1TWFB 1ILQA 4C56C 3IFDA 1TY0A 3HG9A 4K6LA 1GOZA 2RQXA 2VNUD 3CRKC 1SE3A 1IL8A 3ITPA 1GHKA 1XWEA 3P7JA 2A68D 3WDNA 1MBYA 1TIID 3KBGA 4FP5D 3MWYW 1BCPC 1HHVA 3NQIA 3JAML 4OIKA 2YYZA 3TSSA 2AWNA 4K14A 2EXZA 1HUMA 3HRZC 1SNOA 1EEFD 4EVOA 1D1IA 1F9QA 4I65A 2B2WA 1GJXA 3EA6A 1HRJA 2O5JC 1I4GA 2KVMA 3ZYYX 1A6XA 5D65A 2R7ZB 3LX0A 2EYLA 5IODA 2WKDA 3T51B 1STAA 5DNFA 4C3HB 3A7LA 2KCCA 1BXTA 3TN2A 4FF4A 1U4RA 3QO2A 3NK9A 4BY1B 4ODGA 1ZXTA 5DM63 5IT9L 5FO8B 4FNFA 2PZUA 1LT3D 1H9MA 1DONA 1Y8PB 1LTGD 2IPKD 2O5IC 4MN3A 2EYJA 3AU7A 2AWOA 5EPKA 4HN7A 3MXNA 1Q8IA 3S17B 3KK7A 4BWGB 4IN3A 1LT5D 1NCVA 4IFDH 4KJNA 3HZXA 3NWSA 3ONAB 1VF7A 2F0LA 3KLSX 1PLFA 1HA5A 1WTOA 3WOEA 3K57A 3K0YA 3M85A 2F0NA 2K04A 1LT4D 1RJTA 1MI2A 2Z8LA 2ZXOA 4NW2A 1EU3A 2E2IB 2SNMA 4RKBA 4X3UA 1BBXC 1SDFA 1JC7A 4HCEA 3SXHA 2XSCA 3HOUB 3MEHA 3CQZB 5KIXA 1EY0A 3MA2B 2B2WC 1LABA 2F0PA 3FDTA 2EE1A 3HEJA 2XVSA 2SDFA 3F2UA 2Z1CA 3TP8A 3K5LA 1ICWA 4RGOS 5C5LA 1QNUA 3HOZB 2TMPA 1A2TA 5DEHA 1E2VA 2WINB 2L55A 3MXUA 3HOYB 1OXUA 1C48A 5NUCA 1A3TA 2EYFA 1EU4A 1FR3A 2WV6D 3SR1A 5C0XG 3C3LA 2NUCA 3LWUA 2L11A 3M4YA 1TKWB 3I8ZA 1TWHB 3A8IE 3Q22A 1UNSA 1SXTA 5D3DA 2N55A 4KHZA 1D5XC 3BVMA 4XYQA 2RSOA 4C3JB 4CKBA 1H9SA 2A6HD 3WOFA 3CHBD 3K7AB 2EDGA 4G7ZC 3U9OA 1I4XA 5T1GA 3HOWB 3E5SA 2D5DA 2ICIA 1RDPD 5A2QE 3RD4A 2A5HA 1JE4A 1BCPB 4LMQD 4XIGS 1Y69U 1OXVA 2H4OA 1FNWA 3TZUA 4EQNA 4DU9A 4A3GB 2AQ2B 4IQZA 2F1MA 3SK4A 1TS3A 3OSOA 5ELFA 3H3VC 3KUPA 3PV0A 1PTOF 3MTSA 1QJOA 4PV1C 2NYZD 3QJYA 1B2TA 2KEDA 5C3EB 5I9PA 1V1PB 2IX0A 2AQ1B 1LT6D 3QOJA 1NUCA 4BY7B 2KECA 1R4QB 4N9TA 3DEPA 1SMYC 4P2CB 3I91A 1PFMA 5KYIA 3I73A 4A3KB 2NN6G 5IGGA 1E2WA 1II3A 2KOLA 1NR4A 3HS0C 3OPOA 2F0GA 5JVH3 2PZTA 5KGUA 4IUQA 2ZXPA 2J4XA 3R8BA 1PDQA 2A6EC 5CR3A 3TBIB 2C9OA 4Z9CB 3K6OA 1HFNA 4DAYA 3GTKB 4PMCA 3C46A 1CK1A 1AZQA 1WTVA 5JEAJ 4NDXA 1STEA 5KNBA 2B2TA 2F0UA 5FO9B 5KNCA 1O78A 4KY7A 3DHQA 3S2HB 2WAQB 2HQEA 1JR0D 2QEJC 2ID0A 5I9OA 3SHLA 5C44B 3S1NB 1EOTA 3GD7A 4KKSA 4FF3A 2JEAI 3GV3A 4UDUC 3J7YW 3S15B 1STGA 1PFBA 3OMGA 5EBDA 2PO4A 5EBCA 3M3YB 1LLRD 5JPNC 3C1FA 4RFBA 2TSSA 4F87A 4DF7A 4L63B 1O80A 1KNAA 1HQMC 4DN4M 2XRSD 5I4DA 1BR9A 2PPBC 3PUXA 1KNEA 1W6KA 1I6VC 3T13A 3JAME 4CJ2C 3A56A 4TSSA 2Z4IA 3OMCA 5A2QL 5KNDA 2IX1A 1BF4A 1SYEA 1AZPA 3P20A 4PNYA 4IUUA 3Q0AA 5J1ZA 1SJHD 2PCFB 2L4NA 1S5CD 1X3QA 2XWBB 3VYSA 1EY6A 1LV9A 5E4WC 3Q6SA 1G291 1FNUA 2KJXA 2FMMA 3RZDB 3J81L 2E2JB 4OO1G 1HTLD 1M8AA 1PMRA 2B2TC 2L1BA 1JORA 4C1NI 1DOMA 1SYCA 2FHTA 5IT9E 1ZYRC 1G2TA 4ZLTF 5C3WA 3K5MA 2PYKA 1XYIA 3MXPA 5CC4A 4C3HG 5FLXL 4A3JB 4IFDJ 1WTRA 5EPLA 2K7VA 5ELCA 5EKIA 2BE5D 2K5WA 2B8GA 3HKZB 1RODA 2MHVA 4QF4A 4C3IB 3PO3B 2NVXB 1HTPA 1U9RA 4ABNA 3GTQB 1D5MC 1H9KA 1E0BA 1DYQA 3GP7A 1KDCA 2F0DA 4O42A 2JA8B 3J7AV 1L0YB 3I90A 1EY4A 3C2PA 1DCZA 5IGCA 3SVMA 4XQNA 4G4KA 2B8FA 4KY6A 1RF2D 2B2UA 1GHJA 2HDLA 1YNNC 4A3BB 1EEID 3LWEA 2E74C 4AYBB 2MUYA 2OF1A 3QIAA 1Q1EA 4M8AA 4DNTB 3NWTA 1RCVD 1QB5D 4RGMA 3M7NA 3PIP3 1B9NA 5KRUA 1X3PA 5EKKA 2MP1A 2F0VA 3E0JA 5IGBA 4XT1B 4B9WA 3HOXB 3TDQA 4Y7NB 3QB3A 1GUGA 1I50B 3P75A 4NMZA 1R4PB 1CI3M 3BYTB 3VR5A 2EJMA 2C5CA 4HTHA 3ERQA 2JA7B 1PRTB 3NTIA 3S14B 2IX3A 5JEAG 2EYHA 3GTLB 3TMEA 2RBMA 1MGSA 4H0LC 3MC0B 2IWHA 2ENBA 4GZYC 2A68C 2DNEA 2X69A 3D4DA 1TS2A 1EIHA 4DXGA 4IUTA 5FKAC 3SEBA 1K83B 3MFGA 1TWAB 3D31A 3NBIA 2XNAC 4LK1C 1DOKA 1S5DD 5M3FB 1Y1WB 4RCOA 5CV8A 5CV7A 2NB0A 2E2DC 1GUOA 5J22A 1A2UA 1HA6A 3GTOB 2F0FA 3D4RA 3RMHA 2PQEA 2B2UC 1ENCA 4KN7C 4C3JG 1BDOA 2E2HB 1I4HA 2NZ1D 4N9PA 2L9HA 1E2ZA 4QIWB 1VCIA 3KBXA 3W2DA 1OXSC 1TVXA 1PTOC 3BYYB 4DK0A 4CJ1B 5CV6A 5C6AA 1SNPA 3D3RA 4DFAA 1T5EA 4QUCA 1IHZA 1STBA 5ELDA 1RHPA 2JYOA 4DA2A 3QOLA 1TS4A 1FNVA 1AW7A 4EGVA 4ZK9B 1GUSA 2L5TA 3IFTA 5M5WB 3S2DB 3NTKA 1Z6HA 3SE0A 4NP5A 3NE5B 2A74C 3BVZA 2CHBD 3FPPA 1F9RA 4JBWA 1PTOH 3X3NA 3N6RA 4KD3A 1AP0A 2K33A 1JICA 1GUWA 4IFDG 2SOBA 4DXFA 2F0TA 3SK5A 4K5XA 5I6WA 3S16B 5IOCA 1Z47A 1XXGA 3VR4A 2AUKA 4FXDA 3QWNA 4K2KA 2Q8IB 1JQYD 1SJED 4ZRZA 2K03A 1WTXA 1HPCA 4MIUA 2IL8A 3T4AC 1QNKA 4RA8A 2LFNA 1S5ED 1QILA 2DNCA 2WB1B 2V4DA 4KY5A 2M2LA 1OXTA 5KEEA 4A3EB 4RHSA 3NHHA 3R2TA 1QWYA 3NUCA 2X6GA 3I4NB 1STYA 4KTAA 4BBRB 1JCKB 2F3VA 3M4OB 4JK1C 3IL8A 3URYA 1CHQD 1S5BD 3D6CA 3BDLA 4A3DB 1EWCA 1Q12A 2EZVA 5COYA 2EPBA 3FEWX 5FK9C 1SNDA 1IKMA 2F3WA 1KLUD 1DXMA 1O7YA 3OW7A 2CW0D 2SEBD 3SK8A 2A6HC 2F03A 4A3FB 2MJ8A 4QUFA 4R9WA 2F0WA 2WACA 3G6JB 1IW7D 4BS9A 3NTHA 1NAPA 1V43A 1PZJD 1B4OA 3T16A 5CMDA 3MVVA 5JPMC 2CQAA 2NVTB 4WFN3 3J81E 2HCIA 3G7LA 5C4JB 3H0GB 1G91A 1I6HB 3EJIA 3ND9A 4IUPA 1EL0A 1XX8A 3PUZA 1ENFA 5FLXE 2RKSA 1Q1BA 4RAUC 2F0IA 2H1EA 3DWAA 3GO5A 1WTWA 4K2LA 3P1HA 4OO1I 1PRTD 2L0CA 2F4IA 5LHY1 3PIO3 1TS5A 3UI2A 1J9OA 2RVLA 3V2TA 3KLRA 4C1NK 4MHEA 3EQLC 5CGKA 1PTOB 5KYLA 4HSVA 3NXWA 1LTTD 1DM0B 3N52A 1EQVA 2HUGA 5K36H 4FXGC 1BUVT 4H13C 4C3IG 1K8OA 2FMCA 3PUYA 1QG7A 1X32A 2CVRA 2B2VA 1SEBD 5CYUA 4L6TB 1B3AA 1ILPA 2EY2A 2RDHA 2B63B 1JWSD 1H9JA 5D3IB 2L12A 1EWHA 3DM1A 1YNJD 2NTTA 1Y8NB 4J1MA 1CHPD 4B9XA 1BO0A 2BDOA 1A15A 3FRPB 1VDZA 2Q8RE 1A3UA 4OL7A 4A3IB 5D14A 4KN4C 3K5NA 4U68A 4YIJA 1ET6A 1KTKA 2F0JA 4RKLA 3TP7A 2BA0A 3L7ZC 1G6ZA 3RZOB 4K8IA 3KF8A 2MGSA 5EKLA 3I72A 2ICEC 3HOVB 4ME5A 3DXJC 2QILA 1I4QA 3T53B 3OIQA 1MD2D 3VA5A 3A7AB 5BN4A 4R8IA 3GTJB 4KD4A 2IW3A 1CT1D 1MSHA 4QB4A 2JEBI 3S9WA 1WTQA 2NWGA 1LTAD 1Q90A 3A55A 2G9DA 1EY5A 5C3XA 1U4MA 1A3VA 3OWEB 5JAVA 2QKIC 1LO5D 2ZT9C 3HGBA 3BDOA 3L9AX 2G9HD 2WKCA 1J8IA 1NR2A 3EROA 4RGTA 4B08A 2OXPA 3VYTA 3BS1A 2I07B 4DGZA 2PW7A 1ESFA 2JP1A 5ELEA 4KKTA 3KLSA 1CQVA 2F0HA 2BA1A 1M4VA 1EY7A 2B2VC 1D6EC 1BNZA 3SK6A 3QG1A 3BG3A 2WIIB 4F8MA 2B2YA 5IIFA 1DZ1A 3MHBA 4KK7A 4FO2A 1KLGD 2BCOA 4K5VA 5AFWA 1SFOB 1DJRD 1JOQA 2Q8TA 2X6LA 1QOHA 1PYWD 2R61A 1SYFA 2A69D 2VUMB 2PZWA 4HAEA 1Q3LA 3DWQA 4F7XA 1S5FD 4U673 4IZ8A 1R9TB 5HURA 3FMCA 4RHRA 4EQPA 1EY9A 1EYDA 4BA1I 3PMFA 1STNA 2PNRC 1EFID 2BOSA 3DMUA 2BDNA 3OOCA 2BE5C 4FVMA 4XQJA 1F2ZA 4EQOA 2R6GA 5EQ0A 4C2MB 1CQFA 4XQQA 4NKLA 1W6JA 3J80L 2Z4HA 2RDFA 1SYBA 4TQUS 2I46A 3MXGA 2KUMA 4QCLA 1FD7D 3FVQA 1KABA 2EJGC 1BCPD 1D1KA 3D6WA 4S3SA 3VYRA 3EVQA 1LTRD 3SDZA 4ZQ3A 1SSOA 4XTCS 3GTMB 4CHTB 1GXDC 1K8MA 1SNCA 4H44C 3MFYA 1HFGA 1CZWA 1F2LA 2EYOA 4IFDI 4RWSC 4ILWA 1H9SB 2KQ3A 3S1MB 1OXXK 3I3CA 2B2YC 1BOSA 4QMGA 4J6HA 3Q23A 1IYVA 3E6ZX 4CGYB 1RTOA 1B44D 5IGDA 2QDBA 3I4LA 4PQXA 1SBBB 1SYDA 2F0MA 2IT1A 5ELBA 1AFPA 5G3LD 1VMCA 2EY5A 1S4ZA 4HR7B 2XIWA 3OIPA 2AUJD 4TRDA 2YU9B 3DUZA 1RD9D 3LNNA 2LY7A 5C0XI 1F9SA 1C8CA 1GUTA 1DD2A 4ZUJA 4CJ0B 2K28A 1UEAB 1G8ZD 2JXMB 1PTOD 3NSWA 5JOBA 4KV6A 4ULLA 5DAUA 5ISRA 3A8KE 1WD0A 3PUVA 1SNMA 2MPMA 1TR5A 3BVGA 2EOTA 1TQOA 2KHSA 3H6MA 2NVYB 2J0TD 2HCCA 3X3MA 1DOLA 5JJZA 1PXUA 2E75C 4OGQC 2GA4B 3I4MB 4Q0FA 2K01A 3TZDA 4A93B 2RA4A 3H91A 1G2SA 1CM9A 2QCPX 4Q5VA 3FPUB 5CORA 3W3AA 1WD1A 1HUNA 1UAPA 5FO7B 1I4PA 1B50A 1SE2A 1F2MA 5C4HA 2F0EA 4LAAA 2D62A 4DK1A 4ID6A 3V05A 3V96A 3AB9A 3OWFA 3OHXC 1LTID 3VYUA 1ET9A 1ML0D 4UAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  3ITP A;  5HUR A;  4EQP A;  1EY9 A;  5CR3 A;  1ENC A;  4K5W A;  5J39 A;  4ZUI A;  1SYD A;  2F0M A;  1EYD A;  4KJN A;  3EJI A;  3HZX A;  1STN A;  3PMF A;  4K8I A;  5EKL A;  1EY6 A;  4N9P A;  2F0L A;  2EY5 A;  4ME5 A;  2EYP A;  4K2K A;  3DMU A;  5CV9 A;  5E3F A;  4PMC A;  1JOO A;  5KRU A;  4TRD A;  5EKK A;  2F0K A;  3MZ5 A;  4KD4 A;  4WOR A;  1F2Z A;  5F2D A;  4EQO A;  2F0V A;  2RKS A;  2SNS A;  5IGB A;  4MIU A;  2F0N A;  4NKL A;  4NDX A;  5CV6 A;  2F0I A;  2LKV A;  1KDA A;  3VA5 A;  5C6A A;  4B9W A;  4K14 A;  1SNP A;  3U9O A;  2O4X A;  4DFA A;  4K2L A;  4ZUJ A;  1SYG A;  1IHZ A;  2F0U A;  3QB3 A;  2RDF A;  1STB A;  2EXZ A;  1SYB A;  2SNM A;  3P1H A;  4QB4 A;  2PW5 A;  1SNO A;  3P75 A;  4NMZ A;  4RKB A;  1EYA A;  3S9W A;  4K8J A;  3E5S A;  3BDC A;  3QOL A;  2F0Q A;  4EVO A;  4KY5 A;  2M00 A;  3NQT A;  4I65 A;  5JOB A;  1JOR A;  4KY7 A;  3DHQ A;  1EY5 A;  4KV6 A;  1KAA A;  5DAU A;  1SNQ A;  5C3X A;  5KEE A;  4HTH A;  5ISR A;  1SYC A;  4KJO A;  2HQE A;  1A3V A;  1EYC A;  3ERQ A;  3NHH A;  1SNM A;  3SXH A;  3V2T A;  1TR5 A;  3MEH A;  3NUC A;  4EQN A;  4DU9 A;  5C3W A;  5C4Z A;  5JAV A;  2PYK A;  4IUN A;  1EY0 A;  1TQO A;  5I6Y A;  3MXP A;  5CGK A;  1STY A;  5KIX A;  4KTA A;  5CC4 A;  5KYL A;  2KHS A;  5I9O A;  3NXW A;  1KAB A;  2F0O A;  3SHL A;  3H6M A;  3LX0 A;  4HMJ A;  3D8G A;  1EQV A;  2EYH A;  2F0P A;  2EYL A;  5E1F A;  2F0S A;  3D4W A;  3ERO A;  3HEJ A;  4S3S A;  2F3V A;  3SK4 A;  5IOD A;  3EVQ A;  4NP5 A;  3C1E A;  3OSO A;  2OXP A;  1EY8 A;  5IGF A;  3TME A;  4PMB A;  3TP8 A;  4DGZ A;  1NSN S;  1STA A;  4HMI A;  2PW7 A;  3TP5 A;  2RBM A;  4ZQ3 A;  5IGE A;  4KHV A;  4QF4 A;  2EY6 A;  1STG A;  1AEX A;  2F0H A;  1JOK A;  4H7B A;  1KDB A;  4G57 A;  5C5L A;  1SNC A;  5C5M A;  3D6C A;  5HGT A;  2ENB A;  1A2T A;  1ENA A;  1F2Y A;  2EY2 A;  3OMG A;  3NK9 A;  5DEH A;  5K5P A;  3BDL A;  1U9R A;  4ODG A;  4KD3 A;  5I9P A;  1EZ8 A;  5IGC A;  1EY7 A;  2EYM A;  5KGU A;  4R8N A;  3C1F A;  3D4D A;  1SND A;  5M9O A;  3SK6 A;  3QOJ A;  2F3W A;  4K6D A;  1NUC A;  4DF7 A;  1STH A;  4F8M A;  2PZU A;  5IIF A;  3RUZ A;  2EYO A;  4J1M A;  2EY1 A;  1KDC A;  1RKN A;  3MHB A;  2F0D A;  4B9X A;  2SOB A;  4K5V A;  1TT2 A;  4IAL A;  4N9T A;  5CV4 A;  1F2M A;  5NUC A;  5C4H A;  3SK8 A;  2F0E A;  2KQ3 A;  5KYI A;  1JOQ A;  3T13 A;  1EY4 A;  1A3T A;  5IGG A;  2EYF A;  4LAA A;  1A3U A;  2OEO A;  2F0W A;  4OL7 A;  1II3 A;  5CV8 A;  2WAC A;  2F0T A;  4QMG A;  5CV7 A;  2EYJ A;  5EGT A;  1SYF A;  3SK5 A;  4ID6 A;  4K5X A;  2PZW A;  2F0G A;  1EZ6 A;  4J6H A;  2PZT A;  4YIJ A;  3SR1 A;  3OMC A;  2F0J A;  3NP8 A;  4RKL A;  5CV5 A;  1A2U A;  4KY6 A;  3T16 A;  5IOC A;  3MVV A;  3TP7 A;  5J22 A;  1SYE A;  3OWF A;  2F0F A;  4F7X A;  3TP6 A;  3R3O A;  4IZ8 A;  4PNY A;  5IGD A;  5I6W A;  2NUC A;  4WRD A;  4E6I A;  2QDB A;  5J1Z A;  2OF1 A; 
#chains in the Genus database with same CATH topology
 4AH6 A;  3O13 A;  3A8J E;  1LTB D;  3A5U A;  4ZKB B;  1NNX A;  1RTN A;  2J7Z A;  3VR3 A;  5A35 A;  4IUR A;  2NN6 I;  2EYP A;  1EQT A;  2DN8 A;  2F0K A;  3MZ5 A;  3NBH A;  3GQB A;  1O7L A;  3EBE A;  5F2D A;  1SRO A;  3R2I A;  4JI1 Q;  1Q81 C;  2LKV A;  1KDA A;  2A73 B;  5C0X H;  2KCN A;  3EFX D;  2CWA A;  5IT9 c;  2LS0 1;  2PW5 A;  1UUP A;  1EYA A;  4K8J A;  4HCS A;  2F0Q A;  1VMP A;  4JI6 Q;  4JYA L;  2K1B A;  2R92 H;  2N88 A;  3GTP B;  1PH6 A;  1JB3 A;  4KJO A;  1CTM A;  1WCM B;  3ND8 A;  2O2L D;  3KF8 B;  5FOB B;  1VQB A;  4DR1 L;  2F0O A;  1BCP F;  4HED A;  2DY7 A;  3D8G A;  2LMC B;  5C4X H;  3RZO H;  2MO0 A;  4IPC A;  4OIJ A;  1IBM L;  2F52 A;  4LF4 Q;  1CSQ A;  4DV7 L;  5I2X A;  4I7Z C;  2B63 G;  1EY8 A;  3RLF A;  5IGF A;  1XJV A;  1K0S A;  2XWJ B;  3TP5 A;  1U4P A;  5CBA E;  4JOI A;  1KDB A;  1XTC D;  5T1I A;  5M5X H;  1VQ7 A;  4CBV A;  1T5X D;  1LAC A;  4P71 A;  1F2Y A;  1FL0 A;  2EYM A;  4B3R Q;  4R8N A;  4DAV A;  5M9O A;  2K05 A;  4K6D A;  2B39 A;  1B9M A;  1STH A;  3CCU A;  1X3G A;  5M5Y B;  4A3I G;  3I4O A;  3KFU A;  3CRL C;  2EY1 A;  2I0Q A;  1TT2 A;  1TWC H;  4A3M B;  2QF7 A;  4DR6 Q;  1HNX Q;  3TRZ A;  1V9P A;  1CZG A;  1TU2 B;  1JWU D;  2PMZ B;  4DR5 L;  3PGZ A;  1HZB A;  1JWM D;  4JCV E;  1N34 Q;  4ME3 A;  4DR7 L;  1XNQ L;  3T56 B;  2VXW A;  3TP6 A;  2FFK B;  1TWG B;  2JA6 B;  2JSO A;  2ATW A;  1QZG A;  5IP7 G;  3GTG B;  2HDM A;  5JVG 3;  1KQS A;  3HOV G;  4WRD A;  4CKC A;  1HNZ Q;  4ZUI A;  1F77 A;  5G3L F;  3K0X A;  4RGN A;  4CDD C;  2KEE A;  4KI0 A;  3OTO L;  3BZD B;  5E3F A;  4FF2 A;  2NN6 H;  3HFZ B;  4POG A;  3K5O A;  4QIW E;  4RG1 A;  2IY5 B;  1PH1 A;  3CP0 A;  1SMY D;  5BR8 L;  3AFQ A;  1U4L A;  2NTS A;  4HSP A;  1IBL Q;  4B3S Q;  4YHH Q;  1YHQ A;  4X3K A;  1QVG A;  1Y1V H;  5TSS A;  1CA6 A;  1VQ4 A;  4DV3 L;  1AN8 A;  2HIX A;  4YWM A;  2FJ2 A;  1VQA A;  4BBS H;  4CKE A;  1WVL A;  1I3Q B;  3CC2 A;  1QVF A;  2R3Z A;  1I5F A;  1L0X B;  4JI8 Q;  4IUV A;  2A6E D;  2CW0 C;  3FKI B;  1Y8O B;  1CFM A;  3U9S A;  4IUN A;  5EPJ A;  1WTP A;  2Y0S B;  3DEO A;  1HCZ A;  1CKM A;  3RN5 A;  1IW7 C;  3GV6 A;  2F0S A;  3S1R H;  2K5Q A;  4X64 Q;  1VQ8 A;  3Q24 A;  3B6Y A;  5IP9 H;  1NSN S;  1V1O A;  5IGE A;  4KHV A;  5CBE E;  3T1Y Q;  1AEX A;  2JN4 A;  1LYL A;  5C5M A;  4DAP A;  2Z9H A;  5HGT A;  1E22 A;  4A3J G;  5K5P A;  4RCN A;  1GKH A;  4LJZ C;  4GKJ L;  2PI2 E;  4JOI C;  2VB3 X;  3HKZ G;  3VR6 A;  3FP9 A;  1HNW L;  2XRQ D;  1ZEQ X;  2ZXR A;  1RKN A;  2EJF C;  1PZI D;  2VUM G;  4IAL A;  4YY3 L;  4JV5 Q;  3PF4 A;  1B8A A;  1FYC A;  3PO2 H;  3S1Q H;  1C4Q A;  2RDG A;  1C9O A;  4R4Q A;  3J80 E;  1EZ6 A;  4E6I A;  5I2Y A;  1FJG L;  1PRT C;  5CV5 A;  4XT3 B;  1LTL A;  4X62 Q;  3MAQ A;  3R3O A;  4AQY L;  3PIP A;  4KKU A;  5J39 A;  4K5W A;  1TWF H;  1UE5 A;  2PI2 A;  3T1H Q;  1YVC A;  4PMW A;  1NTG A;  4WOR A;  4POF A;  4AYB G;  2RSN A;  1XNR Q;  1ASZ A;  4JI0 L;  2JK8 A;  2SNS A;  4ZKC B;  2R92 B;  1SAP A;  5K36 G;  2PNH A;  3I70 A;  1B1Z A;  2GVA A;  5L37 A;  1WTH A;  4LF9 Q;  1SYG A;  1ZKO A;  3S1M H;  5LL6 X;  4ZYS A;  1HXY D;  4DNR B;  2WB1 E;  3BDC A;  1PH4 A;  5C4X B;  1MKH A;  1B7Y B;  4V0B A;  1YNJ C;  2M00 A;  5LL6 S;  3CC7 A;  2WFW A;  3K58 A;  1ESR A;  1KAA A;  1SNQ A;  3GDE A;  3HOX G;  1EYC A;  4GNX B;  3BJU A;  4A3L G;  2K32 A;  4WJW A;  5C4Z A;  4J8Q A;  3VYU A;  5M5X B;  1D2B A;  1HR0 L;  4X6A H;  4X3S A;  4DV6 L;  2MFI A;  1YJ9 A;  4HMJ A;  4OHJ A;  1I4R A;  5E7N A;  1IKL A;  4F88 A;  3PUW A;  1V8Q A;  2AQ3 B;  2C35 B;  2PQA A;  3C1E A;  1RIP A;  2K52 A;  3NEN A;  3W1B A;  5IWA Q;  3K59 A;  2ZM6 Q;  3ULP A;  1PH7 A;  4OO1 H;  2OQ0 A;  4H7B A;  4XDX A;  1TWC B;  2EVB A;  5E4X A;  2R7Z H;  1ENA A;  1XMO L;  1M90 C;  1J5E Q;  5GAG C;  1PFN A;  1PZK D;  1WI5 A;  2CCZ A;  4DNI A;  1HQR D;  4EX5 A;  1EWI A;  1MHW C;  5BN3 A;  2ZTC A;  4C3H H;  4X66 Q;  3AMU A;  3RUZ A;  1QCB D;  1D5Z C;  1B53 A;  1ZYR D;  1Z7T A;  2XN9 C;  5CV4 A;  4M1U B;  1LTS D;  4BY1 H;  1TY2 A;  3STB C;  3U4Z A;  3IAY A;  1F9P A;  3CD6 A;  4DV0 L;  1H9R A;  1GUN A;  5EGT A;  1SE4 A;  5EJW A;  3AYH B;  3NP8 A;  4FYD A;  2D2C C;  2IJ0 A;  1OO9 B;  1GM5 A;  1VQO A;  1Y1W G;  2OWO A;  3IKJ A;  2UXC L;  2CH4 A;  3WWV A;  4G7H C;  4LUZ A;  3DWP A;  3J7A F;  1Y1V B;  4X3T A;  3CU7 A;  3VDY A;  2CQO A;  1UE7 A;  1X3E A;  5CV9 A;  4Y52 H;  4LF7 L;  4XYO A;  1VF5 C;  1JOO A;  1Q46 A;  3A54 A;  4L8J A;  1ONL A;  4V19 0;  4BBS B;  3TS2 A;  4O1N A;  3CKI B;  2E76 C;  2FIN B;  1JT8 A;  2O4X A;  2NBF A;  1IXR A;  1E7Z A;  3H09 A;  5DM7 3;  1V1P A;  2M9V A;  3S1R B;  3NQT A;  3J81 i;  1GD7 A;  1FGB D;  2VW9 A;  1YNN D;  2ZTD A;  5BN5 A;  1PHJ A;  2KA7 A;  1I94 L;  5I6Y A;  3I4M G;  3M7G A;  2QW7 A;  2E2I H;  4ZAI A;  4DR2 L;  4A93 G;  1HH2 P;  4JI2 Q;  3L3O C;  5E1F A;  3UE0 A;  4LFC L;  2UXB Q;  3D4W A;  2D9U A;  2A69 C;  4BA2 I;  4NXN L;  4KMU C;  1PRT F;  3R93 A;  1EIG A;  4PMB A;  4HMI A;  1QE6 A;  4G7O C;  3H94 A;  4RH6 A;  5JJI A;  2P5Z X;  3HOU H;  3PF5 A;  2EY6 A;  3VR2 A;  1KIX A;  1JOK A;  3CQZ H;  4JBJ A;  4G57 A;  2K5D A;  2OT2 A;  1IYU A;  4FF1 A;  1O7Z A;  2K6A A;  2NZH A;  3VA7 A;  5C0X J;  1MSG A;  3CMA A;  4TKO B;  3PO2 B;  1EZ8 A;  2DY8 A;  3S1Q B;  5HY6 A;  1XPU A;  2JA5 B;  1Q82 C;  2WP8 J;  5LMN Q;  2R93 B;  4FXK C;  2VB2 X;  1CA5 A;  5JEA H;  3NPP A;  4XXE A;  1BQQ T;  3M9B A;  3HOZ H;  1E1T A;  5M3M B;  3CPW A;  2BH8 A;  3J81 c;  2JE6 I;  4OX9 L;  3HP3 A;  1WCM H;  2Z0S A;  5AJ3 Q;  2OEO A;  4DUY L;  2UUA Q;  2NVQ B;  3KDF A;  1TWF B;  1ILQ A;  4C56 C;  4QGU A;  2ES2 A;  2GVB A;  4DUZ Q;  3IFD A;  1TY0 A;  1XTD A;  4ZCK A;  3HG9 A;  4K6L A;  3TQY A;  1GOZ A;  2RQX A;  3J7A 5;  2VNU D;  3CRK C;  1SE3 A;  1IL8 A;  1RL2 A;  3ITP A;  1HJP A;  1XWE A;  3P7J A;  1GHK A;  2A68 D;  3WDN A;  1MBY A;  2B3G A;  1TII D;  3KBG A;  4FP5 D;  5JJK A;  1EQR A;  2G5D A;  4DV5 L;  3MWY W;  1BCP C;  1HHV A;  5GAH C;  3NQI A;  3JAM L;  1N33 L;  4FDB A;  4OIK A;  3J7Z C;  2I5H A;  2YYZ A;  1O7I A;  1NE3 A;  1QUQ A;  3TSS A;  1TWH H;  2AWN A;  4K14 A;  3U4V A;  2HD3 A;  2E5L L;  1SMX A;  1HUM A;  2EXZ A;  3HRZ C;  4JBK A;  1SNO A;  1EEF D;  4GKK Q;  4EVO A;  1D1I A;  1F9Q A;  4C3J H;  4I65 A;  4UPA A;  2B2W A;  1GJX A;  1JE5 A;  3EA6 A;  2I5L X;  1HRJ A;  3K7A H;  2O5J C;  1I4G A;  2KVM A;  3ZYY X;  3QR8 A;  1A6X A;  3ER0 A;  4QQB X;  5D65 A;  2R7Z B;  4OEL B;  3HOW H;  3LX0 A;  1AE2 A;  4MTK A;  1YHA A;  2EYL A;  5IOD A;  2WKD A;  1P16 A;  3T51 B;  1STA A;  5DNF A;  4C3H B;  4LF8 Q;  3A7L A;  2KCC A;  1BXT A;  3TN2 A;  4FF4 A;  1PV4 A;  1U4R A;  3QO2 A;  3NK9 A;  4BY1 B;  4ODG A;  4KHP Q;  1ZXT A;  5DM6 3;  4DV1 Q;  4IJL A;  4A3M G;  1CKN A;  5IT9 L;  5FO8 B;  3BZC A;  4FNF A;  1JJ2 A;  2ZJP A;  1JB7 A;  2PZU A;  2Q2I A;  2HT1 A;  2K4K A;  2JJQ A;  1A0I A;  1A62 A;  2EIF A;  5C3E H;  3HKZ E;  1LT3 D;  3UDX A;  4JI4 L;  1H9M A;  1DON A;  1Y8P B;  5ELO A;  2JA6 G;  1LTG D;  2IPK D;  1JMC A;  2VQE L;  2O5I C;  4MN3 A;  2K75 A;  2EYJ A;  3F1Z A;  5GAD C;  2DJF C;  3AU7 A;  4O0A A;  4B3M Q;  4PZ8 A;  4BY7 H;  4HJ5 A;  2AWO A;  5EPK A;  2YV5 A;  4HN7 A;  4R4C A;  3MXN A;  1Q8I A;  1N36 L;  4A75 A;  3S17 B;  3HKS A;  1FGU A;  1MIU A;  3KK7 A;  4NPS A;  4BWG B;  4IN3 A;  1DGS A;  1LT5 D;  5H1S E;  1NCV A;  1YJN A;  4LUV A;  4IFD H;  4KJN A;  3HZX A;  4JI1 L;  3NWS A;  3ONA B;  1VF7 A;  2F0L A;  3KLS X;  1PLF A;  2HHH L;  1HA5 A;  1WTO A;  3WOE A;  3K57 A;  3RLN A;  1Q86 C;  3K0Y A;  2D0P A;  3M85 A;  2F0N A;  3CCE A;  5IYD H;  2K04 A;  3TRE A;  1LT4 D;  1RJT A;  2XTI A;  1MI2 A;  1VQD A;  2Z8L A;  2UXD L;  2ZXO A;  4NW2 A;  1X55 A;  4CDE C;  1EU3 A;  4AYB E;  3GTK H;  2E2I B;  2SNM A;  4K0K L;  4RKB A;  4X3U A;  1BBX C;  3FKI G;  1SDF A;  1BKB A;  1JC7 A;  3LGJ A;  2Y0S G;  4LF5 L;  1UE1 A;  4HCE A;  3SXH A;  2XSC A;  3HOU B;  3MEH A;  3CQZ B;  5KIX A;  1EY0 A;  3MA2 B;  2B2W C;  1LAB A;  3L2P A;  4EQ5 A;  1N8R C;  2F0P A;  3FDT A;  1A63 A;  4APV A;  2EE1 A;  3HEJ A;  2XVS A;  2SDF A;  1NMG A;  3F2U A;  2Z1C A;  3TP8 A;  5IYC G;  3K5L A;  4WJ3 M;  1ICW A;  1WJJ A;  4RGO S;  4YWL A;  4QJF A;  5C5L A;  1QNU A;  1EYG A;  1WYD A;  3HOZ B;  2TMP A;  4WJ4 A;  1A2T A;  1CKO A;  5DEH A;  5C44 H;  2R7D A;  3S1N H;  3CW2 C;  1E2V A;  2WIN B;  4DR6 L;  3AEV A;  4LFB L;  3F8T A;  2OCE A;  2L55 A;  3MXU A;  1WOC A;  3HOY B;  1OXU A;  1C48 A;  5NUC A;  2N49 A;  3M3Y H;  1A3T A;  2EYF A;  2KHI A;  1EU4 A;  1FR3 A;  2PQA B;  2WV6 D;  1L1O C;  2Q2H A;  3SR1 A;  1J6Q A;  1VQH A;  1HNZ L;  5C0X G;  3C3L A;  1VS0 A;  2NUC A;  3LWU A;  2L11 A;  2XGT A;  3M4Y A;  1TKW B;  3I8Z A;  1Z9F A;  3K7U C;  1TWH B;  4DAM A;  2UU9 Q;  3A8I E;  3Q22 A;  4AIM A;  1W2B A;  2R92 G;  4B3S L;  1UNS A;  1SXT A;  1GO3 E;  5D3D A;  2N55 A;  4KHZ A;  4X65 Q;  1EQQ A;  1D5X C;  4GOP B;  3BVM A;  4PG3 A;  4XYQ A;  4DK3 C;  2UUC L;  2RSO A;  4C3J B;  3UDI A;  4L5T A;  4CKB A;  1H9S A;  4OEM B;  4YCW A;  2A6H D;  3WOF A;  3CHB D;  3K7A B;  5C4X G;  2EDG A;  4G7Z C;  3U9O A;  1I4X A;  4OXP A;  5T1G A;  3HOW B;  3G4S A;  3E5S A;  2D5D A;  2ICI A;  1RDP D;  5A2Q E;  3RD4 A;  2A5H A;  1SLJ A;  1JE4 A;  1BCP B;  4DV7 Q;  1PFS A;  4LMQ D;  4XIG S;  1Y69 U;  1OXV A;  2H4O A;  1FNW A;  3TZU A;  4EQN A;  4DU9 A;  4A3G B;  2AQ2 B;  1UE6 A;  1KRT A;  4IQZ A;  4JI7 L;  4GN4 B;  2F1M A;  3SK4 A;  1TS3 A;  2H5X A;  3OSO A;  5ELF A;  3H3V C;  3KUP A;  3PV0 A;  1PTO F;  3MTS A;  1S72 A;  1QJO A;  4PV1 C;  2NYZ D;  3QJY A;  1B2T A;  2KED A;  2N8N A;  5C3E B;  5I9P A;  1V1P B;  2IX0 A;  2N3S A;  2AQ1 B;  3ERS X;  1LT6 D;  3QOJ A;  2VZA A;  1NUC A;  4KLK A;  4DR5 Q;  4BY7 B;  2KEC A;  2MNA A;  3ZJY C;  3TS0 A;  1R4Q B;  4HJA A;  3FHW A;  3DEP A;  4N9T A;  1SMY C;  4C3I H;  2NVX H;  2FXQ A;  1XNQ Q;  3PO3 H;  1UWV A;  4DR7 Q;  4P2C B;  4R1J A;  2RCN A;  3I91 A;  1PFM A;  4X62 L;  5KYI A;  3I73 A;  1X3F A;  4A3K B;  2NN6 G;  5IGG A;  2K14 A;  1E2W A;  1II3 A;  2KOL A;  3GTQ H;  1NR4 A;  3HS0 C;  3OPO A;  2F0G A;  5JVH 3;  2PZT A;  5KGU A;  4IUQ A;  2ZXP A;  3M4Q A;  1Y1V G;  3OTO Q;  2J4X A;  3T1H L;  2JA8 H;  3R8B A;  1PDQ A;  4DR3 Q;  4JW0 A;  2A6E C;  3RLO A;  1E24 A;  2V1C C;  5CR3 A;  3TBI B;  2C9O A;  4BBS G;  4Z9C B;  3K6O A;  1HFN A;  4DAY A;  3GTK B;  2Z6K A;  4PMC A;  3C46 A;  2D0O A;  2JA5 H;  1CK1 A;  4DV3 Q;  1AZQ A;  2R93 H;  4A3B H;  1WTV A;  5JEA J;  1V1Q A;  4NDX A;  1STE A;  5KNB A;  2B2T A;  5M3M H;  2F0U A;  5IYB H;  5FO9 B;  5IP9 G;  3CAM A;  5KNC A;  4NXM Q;  4LFA L;  2NVQ H;  4HJ8 A;  2ZJQ A;  1O78 A;  3KF6 B;  4KY7 A;  3DHQ A;  3S2H B;  2WAQ B;  1YI2 A;  2HQE A;  2F4V Q;  1JR0 D;  1IBK L;  1N32 L;  1S3O A;  2QEJ C;  2ID0 A;  4UY8 C;  4Y7N H;  5IWA L;  4A4I A;  5I9O A;  1I50 H;  3SHL A;  4DR4 Q;  5C44 B;  3S1N B;  1EOT A;  3GD7 A;  4KKS A;  1J5E L;  4FF3 A;  2JEA I;  4GKJ Q;  4UP9 A;  3GV3 A;  4UDU C;  4OON A;  3PO2 G;  1PH3 A;  3J7Y W;  5JJL A;  1QUQ B;  3S15 B;  2JA7 H;  1STG A;  2JA5 G;  1PFB A;  3G6E A;  1JJC B;  3S14 H;  3OMG A;  5EBD A;  4B3T L;  4YY3 Q;  2PO4 A;  5EBC A;  3M3Y B;  1LLR D;  2EQS A;  5JPN C;  3C1F A;  4RFB A;  2TSS A;  5M3M G;  3GTL H;  4F87 A;  4GLX A;  4DF7 A;  4L63 B;  4IPD A;  1O80 A;  1E1O A;  1KNA A;  1HQM C;  4DN4 M;  1BBU A;  2XRS D;  1BR9 A;  5I4D A;  2PPB C;  3PUX A;  1KNE A;  1W6K A;  1I6V C;  2KHJ A;  3T13 A;  3JAM E;  4CJ2 C;  4AQY Q;  2IHE A;  2PMZ E;  3A56 A;  4TSS A;  2Z4I A;  3OMC A;  5A2Q L;  1K83 H;  5KND A;  1XPO A;  2IX1 A;  1TWA H;  4LNQ A;  4A3C H;  1BF4 A;  2E8G A;  1SYE A;  2GN5 A;  1AZP A;  2VQF Q;  3P20 A;  4PNY A;  4IUU A;  3Q0A A;  5J1Z A;  1SJH D;  4IPH A;  4N8X 1;  5M3F H;  4JI0 Q;  2PCF B;  4BXX H;  2L4N A;  4PZ6 A;  4DV2 Q;  1S5C D;  1X3Q A;  2XWB B;  3VYS A;  1EY6 A;  1LV9 A;  3CME A;  1VQM A;  3GTO H;  5EAY A;  5E4W C;  3ULJ A;  1L1O B;  2OQK A;  2Z6K C;  2EXD A;  3Q6S A;  1G29 1;  1FNU A;  2AMC B;  2KJX A;  2FMM A;  3RZD B;  2E2H H;  4R4I A;  3D0F A;  3J81 L;  2E2J B;  4OO1 G;  1HTL D;  4DV6 Q;  2R7F A;  1M8A A;  4NB3 A;  1PMR A;  2B2T C;  3TEH B;  2L1B A;  2R7Z G;  1JOR A;  4C1N I;  1DOM A;  1SYC A;  2FHT A;  5IT9 E;  2HIV A;  1ZYR C;  1G2T A;  3S17 H;  4ZLT F;  5C3W A;  3K5M A;  2PYK A;  1XYI A;  3MXP A;  5CC4 A;  2Y0S E;  4C3H G;  1C7Y A;  4GLV B;  5FLX L;  4A3J B;  4IFD J;  1WTR A;  5EPL A;  2K7V A;  1NBW A;  5ELC A;  1XMO Q;  5EKI A;  2BE5 D;  4BY1 G;  2K5W A;  3G48 A;  2B8G A;  3HKZ B;  1ROD A;  2MHV A;  2DJG C;  4QF4 A;  4C3I B;  3PO3 B;  2NVX B;  1HTP A;  4YCU A;  5M5W H;  3S2D H;  4HID A;  1U9R A;  4ABN A;  4JI3 L;  2OTJ A;  3GTQ B;  1D5M C;  1H9K A;  1E0B A;  5AJ3 L;  4DV0 Q;  2UUA L;  1DYQ A;  3GP7 A;  1KDC A;  2F0D A;  3NBH B;  3PSI A;  1GVP A;  4DUZ L;  4O42 A;  2JA8 B;  3J7A V;  1L0Y B;  3I90 A;  4QY7 A;  3H15 A;  1HZ9 A;  1EY4 A;  3C2P A;  1DCZ A;  4GLA C;  4P72 A;  2UXC Q;  5IGC A;  3SVM A;  4XQN A;  4G4K A;  2B8F A;  3KLW A;  1RF2 D;  4KY6 A;  2B2U A;  2AHO B;  1GHJ A;  1YBY A;  1T9H A;  4LF7 Q;  2HDL A;  1YNN C;  4A3B B;  1EEI D;  3L0O A;  2E74 C;  3LWE A;  4AYB B;  2MUY A;  2OF1 A;  2B29 A;  3QIA A;  1Q1E A;  1K73 C;  4M8A A;  4DNT B;  1YIT A;  3NWT A;  1RCV D;  3S16 H;  4HIO A;  1QB5 D;  4R4O A;  4RGM A;  3M7N A;  3PIP 3;  1B9N A;  5KRU A;  1X3P A;  5EKK A;  2LSS A;  2MP1 A;  2F0V A;  3E0J A;  5IGB A;  1K8A C;  1KRS A;  4XT1 B;  3HOY H;  4B9W A;  3HOX B;  4IJH A;  3TDQ A;  1PA6 A;  4Y7N B;  3QB3 A;  1GUG A;  1X6O A;  3J80 i;  1I94 Q;  1I50 B;  3P75 A;  4NMZ A;  3CCJ A;  5FLX c;  1R4P B;  4DV4 L;  3HOU G;  1CI3 M;  4DR2 Q;  3BYT B;  3VR5 A;  2EJM A;  2C5C A;  4LFC Q;  4NXN Q;  2HQL A;  1Y14 B;  3A5Z B;  4HTH A;  1OTC A;  2MO1 A;  3ERQ A;  4L5S A;  2JA7 B;  1PRT B;  3NTI A;  3S14 B;  2JQO A;  1PH8 A;  2IX3 A;  5JEA G;  2EYH A;  1A8V A;  3HOZ G;  1K9M C;  3GTL B;  3TME A;  1WCM G;  5FJ8 H;  1XPR A;  2RBM A;  1MGS A;  4H0L C;  3MC0 B;  3I4N H;  2IWH A;  2ENB A;  4GZY C;  3CCQ A;  2A68 C;  4BBR H;  4IOA A;  3HOY G;  2DNE A;  4OX9 Q;  2RCF A;  2X69 A;  3D4D A;  1TS2 A;  1EIH A;  4DXG A;  3M4O H;  4DUY Q;  4IUT A;  5FKA C;  3SEB A;  1K83 B;  2NZO A;  3MFG A;  1TWA B;  3D31 A;  2KCT A;  3JC6 6;  3NBI A;  3J80 c;  4B3M L;  4GNX A;  2XNA C;  4LK1 C;  3CCL A;  1DOK A;  4PZ7 A;  1S5D D;  5M3F B;  1Y1W B;  4RCO A;  5CV8 A;  4A3G H;  5CV7 A;  2NB0 A;  5LMU Q;  4P75 A;  2E2D C;  1GUO A;  1H95 A;  3MEF A;  5J22 A;  1A2U A;  1HA6 A;  1VQE A;  4DV5 Q;  3GTO B;  2F0F A;  2K5V A;  3D4R A;  4A3F H;  1N33 Q;  4RMF A;  3RMH A;  2PQE A;  2B2U C;  1VQP A;  3BZK A;  3SGI A;  1ENC A;  4JPB W;  4KN7 C;  4C3J G;  1BDO A;  2E2H B;  1I4H A;  2NZ1 D;  4N9P A;  2NVT H;  2QDL A;  2L9H A;  1E2Z A;  1QVC A;  4OWT B;  4QIW B;  1VCI A;  5DLQ E;  3KBX A;  3W2D A;  1OXS C;  1TVX A;  1PTO C;  2L15 A;  3BYY B;  4DK0 A;  3HOW G;  4CJ1 B;  5CV6 A;  5GAE C;  5C6A A;  3H0G H;  1XMQ Q;  1SNP A;  1I6H H;  3D3R A;  4YCV A;  4DFA A;  3CCV A;  1T5E A;  4QUC A;  1IHZ A;  1L2F A;  1STB A;  5ELD A;  4A3K H;  1RHP A;  2JYO A;  4DA2 A;  5FLM H;  3QOL A;  4A3G G;  1TS4 A;  1FNV A;  1AW7 A;  2K5N A;  4EGV A;  4ZK9 B;  2QGQ A;  1GUS A;  2L5T A;  1KHI A;  3IFT A;  4DAY B;  3NEL A;  5M5W B;  1PH9 A;  3S2D B;  3OYY A;  4JI6 L;  3NTK A;  2K5H A;  1Z6H A;  1KC8 C;  3SE0 A;  4NP5 A;  3NE5 B;  2A74 C;  3W5O A;  2KBN A;  5C3E G;  3BVZ A;  2CHB D;  1VQ5 A;  3FPP A;  2UUB Q;  1F9R A;  4JBW A;  2BH2 A;  2DUD A;  5J3B A;  2KCM A;  1PTO H;  4BY7 G;  3X3N A;  3N6R A;  4LF4 L;  4KD3 A;  1AP0 A;  3CPF A;  1EIY B;  4JI4 Q;  2KEN A;  2VQE Q;  2K33 A;  3W1G A;  1JIC A;  1GUW A;  4IFD G;  2SOB A;  3S2H H;  1N36 Q;  2B63 H;  4B3R L;  4DXF A;  4GNX C;  2F0T A;  2YTX A;  3SK5 A;  1VQF A;  4K5X A;  5LMN W;  5I6W A;  3S16 B;  1BBW A;  5IOC A;  5IYD G;  2UU9 L;  1Z47 A;  1XXG A;  2LXJ A;  2HHH Q;  3VR4 A;  1HNX L;  2DGY A;  4X65 L;  4LF6 Q;  4R4T A;  4L5R C;  2AUK A;  3S15 H;  4A3I H;  1YZ6 A;  3U58 A;  4JI5 Q;  4FXD A;  4JVZ A;  1N34 L;  2UXD Q;  3QWN A;  1AH9 A;  1YEZ A;  4K2K A;  1U0L A;  2Q8I B;  4HIK A;  1K0R A;  1JQY D;  1SJE D;  4ZRZ A;  2K03 A;  1WTX A;  1HPC A;  4K0K Q;  2Z6B A;  4ALP A;  1K3B C;  2K50 A;  4MIU A;  1X9N A;  2IL8 A;  1MJE A;  3H3V I;  3T4A C;  1QNK A;  1X65 A;  2RHS B;  4LF5 Q;  4RA8 A;  2LFN A;  1S5E D;  2WAQ G;  3E3X A;  1QIL A;  5IP7 H;  3HOV H;  2DNC A;  2WB1 B;  2V4D A;  4KY5 A;  4LW1 A;  1IBL L;  2M2L A;  1OXT A;  1PYB A;  5KEE A;  5C44 G;  4YHH L;  4A3E B;  1KAW A;  4RHS A;  3NHH A;  3R2T A;  1WFQ A;  1QWY A;  3I7F A;  3NUC A;  1N9W A;  2X6G A;  3I4N B;  3GTJ H;  4JYA Q;  1STY A;  4KTA A;  3K81 C;  4BBR B;  2QEX A;  1JCK B;  4JG2 A;  1LM0 A;  2F3V A;  2ZTE A;  3M4O B;  4JI8 L;  1KXL A;  4JK1 C;  3M4P A;  3IL8 A;  5ELN A;  4LFB Q;  1G51 A;  4DR1 Q;  1VQL A;  3URY A;  1CHQ D;  1YNX A;  1S5B D;  1IBM Q;  3D6C A;  4H02 A;  1SR3 A;  3BDL A;  4A3D B;  1QZH A;  1EWC A;  4X64 L;  1CSP A;  1Q12 A;  5COY A;  3RZD H;  2EPB A;  2EZV A;  3FEW X;  5FK9 C;  1SND A;  1IKM A;  2F3W A;  2E2J H;  1KLU D;  3T1Y L;  1DXM A;  1S40 A;  3E9H A;  4QL5 A;  3OW7 A;  1O7Y A;  2CW0 D;  3F2C A;  1K28 A;  2SEB D;  3SK8 A;  2A6H C;  1EFW A;  2F03 A;  4A3F B;  1PH5 A;  4DK6 C;  4MZ9 A;  2MJ8 A;  4QUF A;  4A76 A;  4R9W A;  4UP8 A;  3RN2 A;  2F0W A;  2WAC A;  3G6J B;  1IW7 D;  4BS9 A;  1NMF A;  4DR3 L;  3CC4 A;  3NTH A;  1SRU A;  1NAP A;  1V43 A;  1PZJ D;  1B4O A;  3T16 A;  5CMD A;  4A3J H;  3MVV A;  5JPM C;  2CQA A;  2NVT B;  1HZA A;  4WFN 3;  4JV5 L;  3J81 E;  1SFO H;  1YJW A;  2CH4 W;  2HCI A;  2UUC Q;  4MNO A;  3G7L A;  5C4J B;  1FVI A;  3H0G B;  1G91 A;  1I6H B;  2VUM H;  3EJI A;  1YHB A;  3ND9 A;  4IUP A;  1W3S A;  1XX8 A;  3PUZ A;  1EL0 A;  1ENF A;  5FLX E;  3A74 A;  1R9T H;  4NXM L;  2RKS A;  1Q1B A;  2F3I A;  4RAU C;  2F0I A;  1SN8 A;  1K3R A;  2H1E A;  3H3V H;  3DWA A;  3GO5 A;  1WTW A;  1JJG A;  4K2L A;  4OWW B;  3P1H A;  2F4V L;  4OO1 I;  1PRT D;  5BR8 Q;  4CDC C;  2L0C A;  4JI7 Q;  1XNR L;  2F4I A;  5LHY 1;  1TXY A;  4C2M H;  1TS5 A;  3UI2 A;  3PIO 3;  3I56 A;  4DR4 L;  1J9O A;  2RVL A;  1MJC A;  3V2T A;  4LF9 L;  3KLR A;  4C1N K;  4MHE A;  3EQL C;  2VL6 A;  5CGK A;  1PTO B;  5KYL A;  4HSV A;  4HIM A;  3NXW A;  1LTT D;  1D7Q A;  1DM0 B;  3N52 A;  1EQV A;  2HUG A;  5GRO A;  5K36 H;  4FXG C;  3KDF B;  1BUV T;  4H13 C;  4HJ7 A;  3KOJ A;  4C3I G;  5FLM G;  3BU2 A;  3PO3 G;  1K8O A;  2FMC A;  3RR5 A;  3PUY A;  1B3Q A;  1QG7 A;  1X32 A;  2CVR A;  2RHQ B;  2B2V A;  1SEB D;  1KL9 A;  5CYU A;  4L6T B;  1B3A A;  3KJP A;  1ILP A;  2EY2 A;  2RDH A;  2B63 B;  1JWS D;  1H9J A;  5D3I B;  2L12 A;  2YTV A;  3HOX H;  1EWH A;  4A3L H;  2JA8 G;  3DM1 A;  1YNJ D;  3CCS A;  2MQH A;  2ZM6 L;  2NTT A;  1Y8N B;  4J1M A;  3CCR A;  1CHP D;  4B9X A;  3GTM H;  1BO0 A;  2BDO A;  1A15 A;  3FRP B;  1VDZ A;  1HNW Q;  2Q8R E;  1A3U A;  4OL7 A;  4A3I B;  5D14 A;  4KN4 C;  2VQF L;  3K5N A;  1X56 A;  4U68 A;  4A3B G;  2R93 G;  4YIJ A;  4X66 L;  2QA4 A;  1ET6 A;  1KTK A;  2F0J A;  4RKL A;  3TP7 A;  4DV2 L;  1VQK A;  2I5M X;  2BA0 A;  2AKW B;  1VQG A;  3L7Z C;  4OWX B;  5IYB G;  1FJG Q;  1G6Z A;  2VY3 A;  3RZO B;  4K8I A;  3KF8 A;  2MGS A;  5EKL A;  1L0W A;  3I72 A;  3KYH C;  2ICE C;  3HOV B;  4ME5 A;  3DXJ C;  2QIL A;  3AFP A;  1I4Q A;  4LFA Q;  3T53 B;  1U5K A;  3AQQ A;  3OIQ A;  1MD2 D;  3VA5 A;  3STB D;  1E3P A;  1VQN A;  3A7A B;  3S24 A;  5BN4 A;  3Q8D A;  4R8I A;  3GTJ B;  1IBK Q;  4KD4 A;  1N32 Q;  2IW3 A;  1CT1 D;  1MSH A;  4QB4 A;  2JEB I;  3IRB A;  3S9W A;  1Y1W H;  1WTQ A;  2NWG A;  1LTA D;  1Q90 A;  2JA7 G;  2VS1 A;  1CKN B;  3A55 A;  2YU9 H;  1K8G A;  2G9D A;  1EY5 A;  5C3X A;  1U4M A;  4TVA B;  1A3V A;  3OWE B;  4N8F A;  5JAV A;  1IYJ B;  2QKI C;  1NY4 A;  1LO5 D;  2ZT9 C;  3HGB A;  3E0E A;  3BDO A;  4IOC A;  3L9A X;  2G9H D;  2WKC A;  4IO9 A;  1J8I A;  3RNU A;  1NR2 A;  4B3T Q;  4GOP A;  2CFM A;  3ERO A;  4RGT A;  3I2Z A;  4B08 A;  2OXP A;  3VYT A;  3BS1 A;  2I07 B;  4DGZ A;  1HR0 Q;  1D8L A;  2PW7 A;  1ESF A;  2JP1 A;  3MXN B;  5ELE A;  4KKT A;  5IY0 A;  3KLS A;  1CQV A;  2F0H A;  2BA1 A;  1ICF B;  3PCO B;  4J15 A;  3F2D A;  4JI2 L;  4L5Q A;  1M4V A;  2NVY H;  3UDF A;  4A3C G;  2UXB L;  1EY7 A;  2B2V C;  3E9I A;  1D6E C;  1BNZ A;  3SK6 A;  1BVS A;  3QG1 A;  3I4M H;  3K8A A;  2Q2T A;  1AE3 A;  3BG3 A;  2WII B;  4F8M A;  2B2Y A;  5M3F G;  4BXX G;  5IIF A;  4A93 H;  1DZ1 A;  2LXK A;  3MHB A;  4KK7 A;  4FO2 A;  1HZC A;  1KLG D;  2BCO A;  4K5V A;  5AFW A;  1SFO B;  1DJR D;  1JOQ A;  2Q8T A;  2X6L A;  1QOH A;  1PYW D;  4MTN A;  4P74 A;  5LMN L;  2R61 A;  1SYF A;  2A69 D;  3KJO A;  3G71 A;  2PZW A;  2VUM B;  4HAE A;  3ICE A;  1Q3L A;  3DWQ A;  3K80 C;  4F7X A;  1S5F D;  3I55 A;  4U67 3;  4IZ8 A;  1R9T B;  5HUR A;  3FMC A;  4RHR A;  4EQP A;  3CXC A;  1EY9 A;  1PVO A;  1EYD A;  4BA1 I;  3PMF A;  1STN A;  2PNR C;  1EFI D;  2A1A A;  2BOS A;  3J81 j;  3DMU A;  2RF4 A;  2BDN A;  3OOC A;  2BE5 C;  2A19 A;  4FVM A;  4XQJ A;  1F2Z A;  4EQO A;  2R6G A;  5EQ0 A;  4C2M B;  1CQF A;  3EN2 A;  4XQQ A;  4NKL A;  1W6J A;  3J80 L;  4DKA C;  2Z4H A;  2RDF A;  3CCM A;  1SYB A;  4YWK A;  4TQU S;  2I46 A;  2CWP A;  3MXG A;  2WAQ E;  4JC0 A;  2KUM A;  1P8L A;  4QCL A;  1VQ6 A;  1UEB A;  3A0J A;  1FD7 D;  3FVQ A;  4GKK L;  1VQI A;  2CKZ B;  1KAB A;  1G6P A;  2EJG C;  4UAI A;  1CUK A;  1BCP D;  1D1K A;  3D6W A;  4S3S A;  3VYR A;  3EVQ A;  4JI3 Q;  5HGQ A;  3GTP H;  1LTR D;  3SDZ A;  4ZQ3 A;  1Q7Y C;  4GOP C;  1SSO A;  4XTC S;  3GTM B;  1ASY A;  1GXD C;  1K8M A;  1SNC A;  2ALY B;  4H44 C;  4CHT B;  3MFY A;  1HFG A;  3U50 C;  1EUJ A;  1CZW A;  4LUO A;  3NEM A;  3KF6 A;  4LF8 L;  1F2L A;  2EYO A;  4IFD I;  5LMU L;  4RWS C;  4ILW A;  5GQO A;  2ASB A;  1IZ6 A;  1H9S B;  4KHP L;  2KQ3 A;  3S1M B;  1OXX K;  4A3E H;  3I3C A;  4DV1 L;  1VQC A;  2B2Y C;  4GN5 A;  1BOS A;  4LWC A;  4QMG A;  1VQJ A;  4J6H A;  3Q23 A;  1NJI C;  2A8V A;  5M5Y H;  1IYV A;  3E6Z X;  4CGY B;  4UP7 A;  1RTO A;  3UDG A;  1B44 D;  4A3M H;  2OTL A;  4UHV A;  5IGD A;  1EIF A;  2QDB A;  3PQI A;  3I4L A;  4PQX A;  1SBB B;  1SYD A;  2F0M A;  2IT1 A;  5ELB A;  1AFP A;  5G3L D;  1VMC A;  4A3D H;  2EY5 A;  1S4Z A;  4HR7 B;  1XMQ L;  2XIW A;  1YIJ A;  3OIP A;  3OW2 A;  4GN3 B;  1SE8 A;  2AUJ D;  4TRD A;  1TWG H;  5IE8 A;  1IL2 A;  2JA9 A;  2JA6 H;  4DV4 Q;  2YU9 B;  3DUZ A;  3GTG H;  1RD9 D;  3LNN A;  2LY7 A;  4CDF C;  2WB1 G;  5C0X I;  1F9S A;  1C8C A;  3CF5 A;  3JAM i;  1GUT A;  1DD2 A;  3ULL A;  4ZUJ A;  4CJ0 B;  4P73 A;  1PYS B;  3DLL A;  5FJ8 G;  2K28 A;  4A3E G;  1UEA B;  1G8Z D;  2JXM B;  1PTO D;  1PH2 A;  4DPG A;  3I4N G;  4HJ9 A;  3NSW A;  5JOB A;  1KD1 C;  4KV6 A;  4ULL A;  5DAU A;  4BBR G;  5ISR A;  3A8K E;  1WD0 A;  2E5L Q;  3PUV A;  2N78 A;  1SNM A;  2MPM A;  4IPG A;  2Q2U A;  1TR5 A;  3BVG A;  1TQO A;  4O2D A;  1C0A A;  2KHS A;  2UUB L;  3DM3 A;  4GS3 A;  2YTY A;  3H6M A;  1M1K C;  2NVY B;  1HR0 W;  2J0T D;  5C4J H;  2HCC A;  3X3M A;  1DOL A;  5JJZ A;  1PXU A;  2E75 C;  1L1O A;  1I3Q H;  4I7A A;  4OGQ C;  2GA4 B;  3I4M B;  4Q0F A;  4A3D G;  2K01 A;  3UE1 A;  3TZD A;  4A93 B;  4JBM A;  3FKI H;  2RA4 A;  3H91 A;  1G2S A;  1CM9 A;  3F2B A;  2QCP X;  3JAM c;  4Q5V A;  3FPU B;  5COR A;  4A3F G;  3W3A A;  1WD1 A;  1HUN A;  1UAP A;  1EOV A;  5FO7 B;  1I4P A;  1Q8K A;  1X54 A;  1B50 A;  1VQ9 A;  1SE2 A;  1F2M A;  5C4H A;  2F0E A;  5IYC H;  4LAA A;  2ZJR A;  2D62 A;  4LF6 L;  4DK1 A;  4ID6 A;  3V05 A;  2IHF A;  3V96 A;  3AB9 A;  3H0G G;  3OWF A;  4JI5 L;  3PIO A;  3OHX C;  1LTI D;  4A3K G;  2EOT A;  1ET9 A;  1ML0 D;  3EIV A;  1B70 B;  1LUZ A; 
#chains in the Genus database with same CATH homology
 3O13 A;  3A8J E;  1LTB D;  4ZKB B;  1RTN A;  2J7Z A;  3VR3 A;  5A35 A;  4IUR A;  2NN6 I;  2EYP A;  1EQT A;  2DN8 A;  2F0K A;  3MZ5 A;  3NBH A;  3GQB A;  1O7L A;  5F2D A;  3R2I A;  2LKV A;  1KDA A;  2A73 B;  5C0X H;  2KCN A;  3EFX D;  2LS0 1;  2PW5 A;  1UUP A;  1EYA A;  4K8J A;  4HCS A;  2F0Q A;  1VMP A;  2K1B A;  2N88 A;  3GTP B;  1JB3 A;  4KJO A;  1CTM A;  1WCM B;  3ND8 A;  2O2L D;  5FOB B;  2F0O A;  1BCP F;  4HED A;  2DY7 A;  3D8G A;  2LMC B;  4OIJ A;  5I2X A;  4I7Z C;  1EY8 A;  3RLF A;  5IGF A;  2XWJ B;  3TP5 A;  1U4P A;  5CBA E;  1KDB A;  1XTC D;  5T1I A;  4CBV A;  1T5X D;  1LAC A;  1F2Y A;  2EYM A;  4R8N A;  4DAV A;  5M9O A;  2K05 A;  4K6D A;  2B39 A;  1B9M A;  1STH A;  5M5Y B;  3CRL C;  2EY1 A;  1TT2 A;  4A3M B;  2QF7 A;  1CZG A;  1TU2 B;  1JWU D;  2PMZ B;  1JWM D;  3T56 B;  2VXW A;  3TP6 A;  2FFK B;  1TWG B;  2JA6 B;  2JSO A;  3GTG B;  2HDM A;  5JVG 3;  4WRD A;  4CKC A;  4ZUI A;  1F77 A;  5G3L F;  4RGN A;  2KEE A;  4KI0 A;  3BZD B;  5E3F A;  4FF2 A;  2NN6 H;  3K5O A;  1SMY D;  1U4L A;  2NTS A;  4HSP A;  4X3K A;  5TSS A;  1CA6 A;  1AN8 A;  2FJ2 A;  4CKE A;  1WVL A;  1I3Q B;  2R3Z A;  1L0X B;  4IUV A;  2A6E D;  2CW0 C;  3FKI B;  1Y8O B;  1CFM A;  3U9S A;  4IUN A;  5EPJ A;  1WTP A;  2Y0S B;  3DEO A;  1HCZ A;  1IW7 C;  3GV6 A;  2F0S A;  2K5Q A;  3Q24 A;  1NSN S;  1V1O A;  5IGE A;  4KHV A;  5CBE E;  1AEX A;  5C5M A;  4DAP A;  5HGT A;  5K5P A;  4RCN A;  4LJZ C;  2VB3 X;  3VR6 A;  2XRQ D;  1ZEQ X;  2ZXR A;  1RKN A;  2EJF C;  1PZI D;  4IAL A;  1FYC A;  1C4Q A;  2RDG A;  3J80 E;  1EZ6 A;  4E6I A;  5I2Y A;  1PRT C;  5CV5 A;  4XT3 B;  3MAQ A;  3R3O A;  4KKU A;  5J39 A;  4K5W A;  4PMW A;  4WOR A;  2RSN A;  2SNS A;  4ZKC B;  2R92 B;  1SAP A;  5K36 G;  3I70 A;  1B1Z A;  1SYG A;  1ZKO A;  5LL6 X;  4ZYS A;  1HXY D;  4DNR B;  3BDC A;  5C4X B;  4V0B A;  1YNJ C;  2M00 A;  5LL6 S;  3K58 A;  1ESR A;  1KAA A;  1SNQ A;  1EYC A;  2K32 A;  4WJW A;  5C4Z A;  4J8Q A;  5M5X B;  1D2B A;  4X3S A;  4HMJ A;  4OHJ A;  1I4R A;  1IKL A;  4F88 A;  3PUW A;  1V8Q A;  2AQ3 B;  3C1E A;  3K59 A;  4OO1 H;  4H7B A;  4XDX A;  1TWC B;  2EVB A;  5E4X A;  1ENA A;  1PFN A;  1PZK D;  1HQR D;  5BN3 A;  3AMU A;  3RUZ A;  1QCB D;  1D5Z C;  1B53 A;  1ZYR D;  1Z7T A;  2XN9 C;  5CV4 A;  4M1U B;  1LTS D;  1TY2 A;  3IAY A;  1F9P A;  1H9R A;  1GUN A;  5EGT A;  1SE4 A;  5EJW A;  3NP8 A;  4FYD A;  2D2C C;  2IJ0 A;  1OO9 B;  3IKJ A;  4G7H C;  3DWP A;  3J7A F;  1Y1V B;  4X3T A;  3CU7 A;  5CV9 A;  4XYO A;  1VF5 C;  1JOO A;  3A54 A;  4L8J A;  1ONL A;  4V19 0;  4BBS B;  4O1N A;  3CKI B;  2E76 C;  2FIN B;  2O4X A;  2NBF A;  3H09 A;  5DM7 3;  1V1P A;  2M9V A;  3S1R B;  3NQT A;  1FGB D;  1YNN D;  5BN5 A;  2KA7 A;  5I6Y A;  3M7G A;  4ZAI A;  3L3O C;  5E1F A;  3D4W A;  2D9U A;  2A69 C;  4BA2 I;  4KMU C;  1PRT F;  3R93 A;  1EIG A;  4PMB A;  4HMI A;  1QE6 A;  4G7O C;  3H94 A;  4RH6 A;  2EY6 A;  3VR2 A;  1JOK A;  4G57 A;  2K5D A;  2OT2 A;  1IYU A;  4FF1 A;  1O7Z A;  2K6A A;  3VA7 A;  5C0X J;  1MSG A;  3PO2 B;  4TKO B;  1EZ8 A;  2DY8 A;  3S1Q B;  2JA5 B;  2WP8 J;  2R93 B;  4FXK C;  2VB2 X;  1CA5 A;  5JEA H;  3NPP A;  4XXE A;  1BQQ T;  5M3M B;  2JE6 I;  3HP3 A;  2OEO A;  2NVQ B;  1TWF B;  1ILQ A;  4C56 C;  3IFD A;  1TY0 A;  3HG9 A;  4K6L A;  1GOZ A;  2RQX A;  2VNU D;  3CRK C;  1SE3 A;  1IL8 A;  3ITP A;  1GHK A;  1XWE A;  3P7J A;  2A68 D;  3WDN A;  1MBY A;  1TII D;  3KBG A;  4FP5 D;  3MWY W;  1BCP C;  1HHV A;  3NQI A;  3JAM L;  4OIK A;  2YYZ A;  3TSS A;  2AWN A;  4K14 A;  2EXZ A;  1HUM A;  3HRZ C;  1SNO A;  1EEF D;  4EVO A;  1D1I A;  1F9Q A;  4I65 A;  2B2W A;  1GJX A;  3EA6 A;  1HRJ A;  2O5J C;  1I4G A;  2KVM A;  3ZYY X;  1A6X A;  5D65 A;  2R7Z B;  3LX0 A;  2EYL A;  5IOD A;  2WKD A;  3T51 B;  1STA A;  5DNF A;  4C3H B;  3A7L A;  2KCC A;  1BXT A;  3TN2 A;  4FF4 A;  1U4R A;  3QO2 A;  3NK9 A;  4BY1 B;  4ODG A;  1ZXT A;  5DM6 3;  5IT9 L;  5FO8 B;  4FNF A;  2PZU A;  1LT3 D;  1H9M A;  1DON A;  1Y8P B;  1LTG D;  2IPK D;  2O5I C;  4MN3 A;  2EYJ A;  3AU7 A;  2AWO A;  5EPK A;  4HN7 A;  3MXN A;  1Q8I A;  3S17 B;  3KK7 A;  4BWG B;  4IN3 A;  1LT5 D;  1NCV A;  4IFD H;  4KJN A;  3HZX A;  3NWS A;  3ONA B;  1VF7 A;  2F0L A;  3KLS X;  1PLF A;  1HA5 A;  1WTO A;  3WOE A;  3K57 A;  3K0Y A;  3M85 A;  2F0N A;  2K04 A;  1LT4 D;  1RJT A;  1MI2 A;  2Z8L A;  2ZXO A;  4NW2 A;  1EU3 A;  2E2I B;  2SNM A;  4RKB A;  4X3U A;  1BBX C;  1SDF A;  1JC7 A;  4HCE A;  3SXH A;  2XSC A;  3HOU B;  3MEH A;  3CQZ B;  5KIX A;  1EY0 A;  3MA2 B;  2B2W C;  1LAB A;  2F0P A;  3FDT A;  2EE1 A;  3HEJ A;  2XVS A;  2SDF A;  3F2U A;  2Z1C A;  3TP8 A;  3K5L A;  1ICW A;  4RGO S;  5C5L A;  1QNU A;  3HOZ B;  2TMP A;  1A2T A;  5DEH A;  1E2V A;  2WIN B;  2L55 A;  3MXU A;  3HOY B;  1OXU A;  1C48 A;  5NUC A;  1A3T A;  2EYF A;  1EU4 A;  1FR3 A;  2WV6 D;  3SR1 A;  5C0X G;  3C3L A;  2NUC A;  3LWU A;  2L11 A;  3M4Y A;  1TKW B;  3I8Z A;  1TWH B;  3A8I E;  3Q22 A;  1UNS A;  1SXT A;  5D3D A;  2N55 A;  4KHZ A;  1D5X C;  3BVM A;  4XYQ A;  2RSO A;  4C3J B;  4CKB A;  1H9S A;  2A6H D;  3WOF A;  3CHB D;  3K7A B;  2EDG A;  4G7Z C;  3U9O A;  1I4X A;  5T1G A;  3HOW B;  3E5S A;  2D5D A;  2ICI A;  1RDP D;  5A2Q E;  3RD4 A;  2A5H A;  1JE4 A;  1BCP B;  4LMQ D;  4XIG S;  1Y69 U;  1OXV A;  2H4O A;  1FNW A;  3TZU A;  4EQN A;  4DU9 A;  4A3G B;  2AQ2 B;  4IQZ A;  2F1M A;  3SK4 A;  1TS3 A;  3OSO A;  5ELF A;  3H3V C;  3KUP A;  3PV0 A;  1PTO F;  3MTS A;  1QJO A;  4PV1 C;  2NYZ D;  3QJY A;  1B2T A;  2KED A;  5C3E B;  5I9P A;  1V1P B;  2IX0 A;  2AQ1 B;  1LT6 D;  3QOJ A;  1NUC A;  4BY7 B;  2KEC A;  1R4Q B;  4N9T A;  3DEP A;  1SMY C;  4P2C B;  3I91 A;  1PFM A;  5KYI A;  3I73 A;  4A3K B;  2NN6 G;  5IGG A;  1E2W A;  1II3 A;  2KOL A;  1NR4 A;  3HS0 C;  3OPO A;  2F0G A;  5JVH 3;  2PZT A;  5KGU A;  4IUQ A;  2ZXP A;  2J4X A;  3R8B A;  1PDQ A;  2A6E C;  5CR3 A;  3TBI B;  2C9O A;  4Z9C B;  3K6O A;  1HFN A;  4DAY A;  3GTK B;  4PMC A;  3C46 A;  1CK1 A;  1AZQ A;  1WTV A;  5JEA J;  4NDX A;  1STE A;  5KNB A;  2B2T A;  2F0U A;  5FO9 B;  5KNC A;  1O78 A;  4KY7 A;  3DHQ A;  3S2H B;  2WAQ B;  2HQE A;  1JR0 D;  2QEJ C;  2ID0 A;  5I9O A;  3SHL A;  5C44 B;  3S1N B;  1EOT A;  3GD7 A;  4KKS A;  4FF3 A;  2JEA I;  3GV3 A;  4UDU C;  3J7Y W;  3S15 B;  1STG A;  1PFB A;  3OMG A;  5EBD A;  2PO4 A;  5EBC A;  3M3Y B;  1LLR D;  5JPN C;  3C1F A;  4RFB A;  2TSS A;  4F87 A;  4DF7 A;  4L63 B;  1O80 A;  1KNA A;  1HQM C;  4DN4 M;  2XRS D;  5I4D A;  1BR9 A;  2PPB C;  3PUX A;  1KNE A;  1W6K A;  1I6V C;  3T13 A;  3JAM E;  4CJ2 C;  3A56 A;  4TSS A;  2Z4I A;  3OMC A;  5A2Q L;  5KND A;  2IX1 A;  1BF4 A;  1SYE A;  1AZP A;  3P20 A;  4PNY A;  4IUU A;  3Q0A A;  5J1Z A;  1SJH D;  2PCF B;  2L4N A;  1S5C D;  1X3Q A;  2XWB B;  3VYS A;  1EY6 A;  1LV9 A;  5E4W C;  3Q6S A;  1G29 1;  1FNU A;  2KJX A;  2FMM A;  3RZD B;  3J81 L;  2E2J B;  4OO1 G;  1HTL D;  1M8A A;  1PMR A;  2B2T C;  2L1B A;  1JOR A;  4C1N I;  1DOM A;  1SYC A;  2FHT A;  5IT9 E;  1ZYR C;  1G2T A;  4ZLT F;  5C3W A;  3K5M A;  2PYK A;  1XYI A;  3MXP A;  5CC4 A;  4C3H G;  5FLX L;  4A3J B;  4IFD J;  1WTR A;  5EPL A;  2K7V A;  5ELC A;  5EKI A;  2BE5 D;  2K5W A;  2B8G A;  3HKZ B;  1ROD A;  2MHV A;  4QF4 A;  4C3I B;  3PO3 B;  2NVX B;  1HTP A;  1U9R A;  4ABN A;  3GTQ B;  1D5M C;  1H9K A;  1E0B A;  1DYQ A;  3GP7 A;  1KDC A;  2F0D A;  4O42 A;  2JA8 B;  3J7A V;  1L0Y B;  3I90 A;  1EY4 A;  3C2P A;  1DCZ A;  5IGC A;  3SVM A;  4XQN A;  4G4K A;  2B8F A;  4KY6 A;  1RF2 D;  2B2U A;  1GHJ A;  2HDL A;  1YNN C;  4A3B B;  1EEI D;  3LWE A;  2E74 C;  4AYB B;  2MUY A;  2OF1 A;  3QIA A;  1Q1E A;  4M8A A;  4DNT B;  3NWT A;  1RCV D;  1QB5 D;  4RGM A;  3M7N A;  3PIP 3;  1B9N A;  5KRU A;  1X3P A;  5EKK A;  2MP1 A;  2F0V A;  3E0J A;  5IGB A;  4XT1 B;  4B9W A;  3HOX B;  3TDQ A;  4Y7N B;  3QB3 A;  1GUG A;  1I50 B;  3P75 A;  4NMZ A;  1R4P B;  1CI3 M;  3BYT B;  3VR5 A;  2EJM A;  2C5C A;  4HTH A;  3ERQ A;  2JA7 B;  1PRT B;  3NTI A;  3S14 B;  2IX3 A;  5JEA G;  2EYH A;  3GTL B;  3TME A;  2RBM A;  1MGS A;  4H0L C;  3MC0 B;  2IWH A;  2ENB A;  4GZY C;  2A68 C;  2DNE A;  2X69 A;  3D4D A;  1TS2 A;  1EIH A;  4DXG A;  4IUT A;  5FKA C;  3SEB A;  1K83 B;  3MFG A;  1TWA B;  3D31 A;  3NBI A;  2XNA C;  4LK1 C;  1DOK A;  1S5D D;  5M3F B;  1Y1W B;  4RCO A;  5CV8 A;  5CV7 A;  2NB0 A;  2E2D C;  1GUO A;  5J22 A;  1A2U A;  1HA6 A;  3GTO B;  2F0F A;  3D4R A;  3RMH A;  2PQE A;  2B2U C;  1ENC A;  4KN7 C;  4C3J G;  1BDO A;  2E2H B;  1I4H A;  2NZ1 D;  4N9P A;  2L9H A;  1E2Z A;  4QIW B;  1VCI A;  3KBX A;  3W2D A;  1OXS C;  1TVX A;  1PTO C;  3BYY B;  4DK0 A;  4CJ1 B;  5CV6 A;  5C6A A;  1SNP A;  3D3R A;  4DFA A;  1T5E A;  4QUC A;  1IHZ A;  1STB A;  5ELD A;  1RHP A;  2JYO A;  4DA2 A;  3QOL A;  1TS4 A;  1FNV A;  1AW7 A;  4EGV A;  4ZK9 B;  1GUS A;  2L5T A;  3IFT A;  5M5W B;  3S2D B;  3NTK A;  1Z6H A;  3SE0 A;  4NP5 A;  3NE5 B;  2A74 C;  3BVZ A;  2CHB D;  3FPP A;  1F9R A;  4JBW A;  1PTO H;  3X3N A;  3N6R A;  4KD3 A;  1AP0 A;  2K33 A;  1JIC A;  1GUW A;  4IFD G;  2SOB A;  4DXF A;  2F0T A;  3SK5 A;  4K5X A;  5I6W A;  3S16 B;  5IOC A;  1Z47 A;  1XXG A;  3VR4 A;  2AUK A;  4FXD A;  3QWN A;  4K2K A;  2Q8I B;  1JQY D;  1SJE D;  4ZRZ A;  2K03 A;  1WTX A;  1HPC A;  4MIU A;  2IL8 A;  3T4A C;  1QNK A;  4RA8 A;  2LFN A;  1S5E D;  1QIL A;  2DNC A;  2WB1 B;  2V4D A;  4KY5 A;  2M2L A;  1OXT A;  5KEE A;  4A3E B;  4RHS A;  3NHH A;  3R2T A;  1QWY A;  3NUC A;  2X6G A;  3I4N B;  1STY A;  4KTA A;  4BBR B;  1JCK B;  2F3V A;  3M4O B;  4JK1 C;  3IL8 A;  3URY A;  1CHQ D;  1S5B D;  3D6C A;  3BDL A;  4A3D B;  1EWC A;  1Q12 A;  2EZV A;  5COY A;  2EPB A;  3FEW X;  5FK9 C;  1SND A;  1IKM A;  2F3W A;  1KLU D;  1DXM A;  1O7Y A;  3OW7 A;  2CW0 D;  2SEB D;  3SK8 A;  2A6H C;  2F03 A;  4A3F B;  2MJ8 A;  4QUF A;  4R9W A;  2F0W A;  2WAC A;  3G6J B;  1IW7 D;  4BS9 A;  3NTH A;  1NAP A;  1V43 A;  1PZJ D;  1B4O A;  3T16 A;  5CMD A;  3MVV A;  5JPM C;  2CQA A;  2NVT B;  4WFN 3;  3J81 E;  2HCI A;  3G7L A;  5C4J B;  3H0G B;  1G91 A;  1I6H B;  3EJI A;  3ND9 A;  4IUP A;  1EL0 A;  1XX8 A;  3PUZ A;  1ENF A;  5FLX E;  2RKS A;  1Q1B A;  4RAU C;  2F0I A;  2H1E A;  3DWA A;  3GO5 A;  1WTW A;  4K2L A;  3P1H A;  4OO1 I;  1PRT D;  2L0C A;  2F4I A;  5LHY 1;  3PIO 3;  1TS5 A;  3UI2 A;  1J9O A;  2RVL A;  3V2T A;  3KLR A;  4C1N K;  4MHE A;  3EQL C;  5CGK A;  1PTO B;  5KYL A;  4HSV A;  3NXW A;  1LTT D;  1DM0 B;  3N52 A;  1EQV A;  2HUG A;  5K36 H;  4FXG C;  1BUV T;  4H13 C;  4C3I G;  1K8O A;  2FMC A;  3PUY A;  1QG7 A;  1X32 A;  2CVR A;  2B2V A;  1SEB D;  5CYU A;  4L6T B;  1B3A A;  1ILP A;  2EY2 A;  2RDH A;  2B63 B;  1JWS D;  1H9J A;  5D3I B;  2L12 A;  1EWH A;  3DM1 A;  1YNJ D;  2NTT A;  1Y8N B;  4J1M A;  1CHP D;  4B9X A;  1BO0 A;  2BDO A;  1A15 A;  3FRP B;  1VDZ A;  2Q8R E;  1A3U A;  4OL7 A;  4A3I B;  5D14 A;  4KN4 C;  3K5N A;  4U68 A;  4YIJ A;  1ET6 A;  1KTK A;  2F0J A;  4RKL A;  3TP7 A;  2BA0 A;  3L7Z C;  1G6Z A;  3RZO B;  4K8I A;  3KF8 A;  2MGS A;  5EKL A;  3I72 A;  2ICE C;  3HOV B;  4ME5 A;  3DXJ C;  2QIL A;  1I4Q A;  3T53 B;  3OIQ A;  1MD2 D;  3VA5 A;  3A7A B;  5BN4 A;  4R8I A;  3GTJ B;  4KD4 A;  2IW3 A;  1CT1 D;  1MSH A;  4QB4 A;  2JEB I;  3S9W A;  1WTQ A;  2NWG A;  1LTA D;  1Q90 A;  3A55 A;  2G9D A;  1EY5 A;  5C3X A;  1U4M A;  1A3V A;  3OWE B;  5JAV A;  2QKI C;  1LO5 D;  2ZT9 C;  3HGB A;  3BDO A;  3L9A X;  2G9H D;  2WKC A;  1J8I A;  1NR2 A;  3ERO A;  4RGT A;  4B08 A;  2OXP A;  3VYT A;  3BS1 A;  2I07 B;  4DGZ A;  2PW7 A;  1ESF A;  2JP1 A;  5ELE A;  4KKT A;  3KLS A;  1CQV A;  2F0H A;  2BA1 A;  1M4V A;  1EY7 A;  2B2V C;  1D6E C;  1BNZ A;  3SK6 A;  3QG1 A;  3BG3 A;  2WII B;  4F8M A;  2B2Y A;  5IIF A;  1DZ1 A;  3MHB A;  4KK7 A;  4FO2 A;  1KLG D;  2BCO A;  4K5V A;  5AFW A;  1SFO B;  1DJR D;  1JOQ A;  2Q8T A;  2X6L A;  1QOH A;  1PYW D;  2R61 A;  1SYF A;  2A69 D;  2VUM B;  2PZW A;  4HAE A;  1Q3L A;  3DWQ A;  4F7X A;  1S5F D;  4U67 3;  4IZ8 A;  1R9T B;  5HUR A;  3FMC A;  4RHR A;  4EQP A;  1EY9 A;  1EYD A;  4BA1 I;  3PMF A;  1STN A;  2PNR C;  1EFI D;  2BOS A;  3DMU A;  2BDN A;  3OOC A;  2BE5 C;  4FVM A;  4XQJ A;  1F2Z A;  4EQO A;  2R6G A;  5EQ0 A;  4C2M B;  1CQF A;  4XQQ A;  4NKL A;  1W6J A;  3J80 L;  2Z4H A;  2RDF A;  1SYB A;  4TQU S;  2I46 A;  3MXG A;  2KUM A;  4QCL A;  1FD7 D;  3FVQ A;  1KAB A;  2EJG C;  1BCP D;  1D1K A;  3D6W A;  4S3S A;  3VYR A;  3EVQ A;  1LTR D;  3SDZ A;  4ZQ3 A;  1SSO A;  4XTC S;  3GTM B;  4CHT B;  1GXD C;  1K8M A;  1SNC A;  4H44 C;  3MFY A;  1HFG A;  1CZW A;  1F2L A;  2EYO A;  4IFD I;  4RWS C;  4ILW A;  1H9S B;  2KQ3 A;  3S1M B;  1OXX K;  3I3C A;  2B2Y C;  1BOS A;  4QMG A;  4J6H A;  3Q23 A;  1IYV A;  3E6Z X;  4CGY B;  1RTO A;  1B44 D;  5IGD A;  2QDB A;  3I4L A;  4PQX A;  1SBB B;  1SYD A;  2F0M A;  2IT1 A;  5ELB A;  1AFP A;  5G3L D;  1VMC A;  2EY5 A;  1S4Z A;  4HR7 B;  2XIW A;  3OIP A;  2AUJ D;  4TRD A;  2YU9 B;  3DUZ A;  1RD9 D;  3LNN A;  2LY7 A;  5C0X I;  1F9S A;  1C8C A;  1GUT A;  1DD2 A;  4ZUJ A;  4CJ0 B;  2K28 A;  1UEA B;  1G8Z D;  2JXM B;  1PTO D;  3NSW A;  5JOB A;  4KV6 A;  4ULL A;  5DAU A;  5ISR A;  3A8K E;  1WD0 A;  3PUV A;  1SNM A;  2MPM A;  1TR5 A;  3BVG A;  2EOT A;  1TQO A;  2KHS A;  3H6M A;  2NVY B;  2J0T D;  2HCC A;  3X3M A;  1DOL A;  5JJZ A;  1PXU A;  2E75 C;  4OGQ C;  2GA4 B;  3I4M B;  4Q0F A;  2K01 A;  3TZD A;  4A93 B;  2RA4 A;  3H91 A;  1G2S A;  1CM9 A;  2QCP X;  4Q5V A;  3FPU B;  5COR A;  3W3A A;  1WD1 A;  1HUN A;  1UAP A;  5FO7 B;  1I4P A;  1B50 A;  1SE2 A;  1F2M A;  5C4H A;  2F0E A;  4LAA A;  2D62 A;  4DK1 A;  4ID6 A;  3V05 A;  3V96 A;  3AB9 A;  3OWF A;  3OHX C;  1LTI D;  3VYU A;  1ET9 A;  1ML0 D;  4UAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...