3E5WA

Crystal structure analysis of fp611
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
226
Chain Sequence
SLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYCQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Red fluorescent protein eqFP611
publication title Trans-cis isomerization is responsible for the red-shifted fluorescence in variants of the red fluorescent protein eqFP611.
pubmed doi rcsb
source organism Entacmaea quadricolor
molecule tags Fluorescent protein
total genus 62
structure length 226
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3e5wA00
3DQDA 4B30A 1EMAA 4W7EA 3DQJA 4W7XA 1EMEA 3DQEA 3SG7A 1KYPA 4P1QA 4IK3A 4AS8A 2VAEA 4DXPA 3GB3A 1OXEA 3DQNA 5FHVA 4W6OA 5DTLA 4P76A 1YJ2A 2IE2A 4KF4A 2A48A 5DQBA 3G9AA 2GW3A 3LF3A 3TMRA 4KPIA 1H6RA 1XA9A 1JBZA 3GL4A 4XOVA 3SVDA 2G3OA 3ST0A 3CFAA 4LJDA 1Z1PA 1ZGOA 4W77A 5T3IA 4DXNA 4H48A 3ADFA 3DQ9A 5DPJA 1ZUXA 4W6IA 4W6BA 2Y0GA 5DRFA 4W7RA 2YFPA 4RYSA 3DQKA 1W7TA 3MGFA 4W6MA 3BXBA 3SV5A 4DXQA 4W6PA 4OQWA 4XOWA 4KGFA 1MOUA 2IOVA 4IK1A 4W6AA 4OGSA 3DQ2A 3DQCA 3PJ7A 4H3NA 3ZUJA 4RYWA 2FWQA 3ZULA 2HCGA 3GJ2A 2OTBA 2WHSA 4HE4A 4ZF5A 2DD9A 3LVAA 4LQUA 3SVUA 4W76A 2VZXA 2OKYA 3SVRA 4J89A 1H4UA 1MYWA 2QRFA 4B30B 2QU1A 5DTYA 2G6YA 4DKMA 4KAGA 3OSQA 4OJ0A 4W6NA 4H3MA 2OJKA 3SSHA 2G6XA 1F0BA 4LW5A 3DQOA 2DDCA 1G7KA 5KTGA 1EMGA 2H5QA 3VICA 4Q9XA 3DQAA 4KW4A 5LTRA 4DXIA 2IB5A 2FZUA 2Z6YA 3DQ5A 3PIBA 2H6VA 2DUHA 2HPWA 3LVCA 3S05A 2G2SB 3UG0A 4KEXA 2O29A 4JEOA 4W6TA 2O24A 5EB6A 1W7UA 1RM9A 4PPJA 3ED8A 1Q4AA 1Q4CA 5FVGA 5HGEA 2YDZA 1XMZA 2PXWA 1C4FA 2B3QA 3U0NA 1EMFA 4H3LA 3SG3A 1Q4DA 1YFPA 2A56B 2QLHA 3DPXA 3EK8A 5DTXA 5DPIA 2G5ZB 4TZGA 3DQ3A 4W7CA 2ZO7A 1BFPA 3ST2A 5LTPA 1Q4BA 2HGDA 1MOVA 2HQKA 3AI5A 4KF5C 4ZB1A 2H9WA 5LK4A 4L1IA 3E5VA 3SVOA 1GFLA 2A50B 2EMNA 2WISA 3DQ1A 2WSOA 5DPGA 4W6LA 3EVUA 5EBJA 1ZGQA 3EVPA 2PXSA 1Q73A 4W73A 5H87A 4LJBA 3W1CA 3LA1A 2QLEA 4KA9A 4IK9A 4DKNA 5EXUA 1RMPA 4W72A 2DUFA 4RTCA 5H89A 2V4EA 2EMDA 3SS0A 3ST4A 2WURA 3UFZA 5BTTA 1ZGPA 4Q7TA 2G6EA 4ORNA 3W1DA 2H5OA 2AWKA 2Q57A 3EVVA 3SVCA 2YE1A 4XL5A 2WHTA 3SSVA 1GL4A 2DUGA 5EB7A 3VHTB 2WSNA 3PJ5A 2GW4B 4Q9WA 3ZTFA 4IK8A 4W6CA 2QT2A 4LQTA 3NF0A 1W7SA 2H5PA 4W6GA 4GESB 4DXMA 3CD1A 4IZNA 3DQ6A 3OSRA 4JRBA 3PJBA 1EMKA 4GF6B 1UISA 5DPHA 3U8PA 2WIQA 4HQ8A 4KW9A 3DQMA 2BTJA 4LJDC 4LJCA 4KW8A 3SG2A 3AI4A 3SSYA 3EK4A 1QYOA 4HVFA 3DQHA 4UTSA 1KP5A 3V3DA 4EN1A 4W6HA 2VVHA 4Z4MA 4J88A 3BX9A 1GGXA 3GJ1A 3SSLA 4EDSA 3NT3A 1YZWA 4JFGA 2DDDA 3E5TA 4U2VA 2VVJA 5DU0A 5HZSA 2GX0A 2QZ0A 3VHTA 1JBYA 4PFEA 3CD9A 3LVDA 4BDUA 5HZOA 3RWAA 3DQ4A 4OHSA 3WCKA 4L12A 2HJOA 3DPZA 3U0KA 3NT9A 1B9CA 2V4EB 3SVEA 2AWJA 3SVBA 4W6FA 3DQ8A 3M22A 5BTTB 2H8QA 4ZIOA 2Z6ZA 2OGRA 4PPLA 4EULA 3O78A 2G3DB 4Q7UA 4W6RA 3IR8A 1QY3A 1F09A 2JADA 4ZF4A 2A54B 1EMCA 1YHGA 4I2YA 3WLCA 1XQMA 2Z6XA 2RH7A 3DPWA 3SVNA 2A47A 2OKWA 4H47A 5AQBB 3BXAA 3SRYA 2AWMA 3SG6A 3DQ7A 5EXCI 4ZBLA 3U0MA 4W74A 4JGEA 4W6UA 4XGYA 5DTZA 2FL1A 4JF9A 3EK7A 4AR7A 4KGEA 3SSTA 4EMQA 4OY4A 2QLGB 2B3PA 2DD7A 4R6BA 4W6JA 1XSSA 4L13A 3TMTA 3RWTA 3ZUFA 5FVIA 2HGYA 4DXOA 2HQZA 2VADA 3DQLA 1OXDA 1YHHA 4W7DA 5HZUA 2VVIA 3U8AA 1XAEA 2AWLA 5HZTA 5EJUA 2C9IA 4TZAA 3CFHA 1RRXA 1HUYA 3SG5A 2G16B 2HRSA 3WLDA 1JC0A 2AHAA 4W75A 3CBEA 2WHUA 1QYFA 3DQIA 5DRGA 3SSPA 5EHUA 1Q4EA 2AH8A 2ZMUA 4W6KA 3DQUA 3CGLA 2A53B 3LF4B 3O77A 3U0LA 3P28A 3CB9A 1EMMA 2YE0A 4GOBA 5H88A 3SSKA 3EKJA 2ICRA 2QLGA 3IP2A 3H1RA 5EXBA 2QLIA 3H1OA 4HQ9A 2V4EC 2P4MA 3E5WA 1QYQA 4Z4KA 3M24A 2EMOA 2GX2A 1KYRA 4IK5A 4R6DA 1KYSA 3OGOA 3AKOA 3KCTA 4Q7RA 3SG4A 2ARLA 1S6ZA 4J8AA 3EVRA 4IK4A 2DUIA 5BT0A 3ST3A 3U8CA 2C9JA 4XVPA 4W69A 2A52B 5FVFA 3GEXA 3VK1A 4W7FA 5BQLA 3LS3A 3K1KA 4ZFSA 2H5RA 4W6SA 1Z1QA 5J2OA 4KF5A 5DQMA 4B5YA 4ANJA 5HW9A 5F9GA 2OTEA 4JC2A 1RMMA 1YJFA 2Q6PA 2IB6A 3LSAA 3BXCA 5HBDA 3P8UA 3NEDA 3DQFA 2HFCA 2ZO6A 3A8SA 1RMOA 3NEZA 2DUEA 1CV7A 3KCSA 2POXA 1OXFA 4N3DA 4W7AA 4W6DA 1EMLA 5DY6A 2O2BA 3EKHA 2ZMWA 4PPKA 4HQCA 4NWSA 1QXTA 4ZINA 3I19A 1JC1A 4ZF3A 5LTQA 2Z1OA 2A46A 4EDOA 3CFFA 1HCJA 1YHIA 3SVSA 1EMBA
chains in the Genus database with same CATH superfamily
3DQDA 4B30A 1EMAA 4W7EA 3DQJA 4W7XA 1EMEA 3DQEA 3SG7A 1KYPA 4P1QA 4IK3A 4AS8A 2VAEA 4DXPA 3GB3A 1OXEA 3DQNA 5FHVA 4W6OA 5DTLA 4P76A 1YJ2A 2IE2A 4KF4A 2A48A 5DQBA 3G9AA 2GW3A 3LF3A 3TMRA 4KPIA 1H6RA 1XA9A 1JBZA 3GL4A 4XOVA 3SVDA 2G3OA 3ST0A 3CFAA 4LJDA 1Z1PA 1ZGOA 4W77A 5T3IA 4DXNA 4H48A 3ADFA 3DQ9A 5DPJA 1ZUXA 4W6IA 4W6BA 2Y0GA 5DRFA 4W7RA 2YFPA 4RYSA 3DQKA 1W7TA 3MGFA 4W6MA 3BXBA 3SV5A 4DXQA 4W6PA 4OQWA 4XOWA 4KGFA 1MOUA 2IOVA 4IK1A 4W6AA 4OGSA 3DQ2A 3DQCA 3PJ7A 4H3NA 3ZUJA 4RYWA 2FWQA 3ZULA 2HCGA 3GJ2A 2OTBA 2WHSA 4HE4A 4ZF5A 2DD9A 3LVAA 4LQUA 3SVUA 4W76A 2VZXA 2OKYA 3SVRA 4J89A 1H4UA 1MYWA 2QRFA 4B30B 2QU1A 5DTYA 2G6YA 4DKMA 4KAGA 3OSQA 4OJ0A 4W6NA 4H3MA 2OJKA 3SSHA 2G6XA 1F0BA 4LW5A 3DQOA 2DDCA 1G7KA 5KTGA 1EMGA 2H5QA 3VICA 4Q9XA 3DQAA 4KW4A 5LTRA 4DXIA 2IB5A 2FZUA 2Z6YA 3DQ5A 3PIBA 2H6VA 2DUHA 2HPWA 3LVCA 3S05A 2G2SB 3UG0A 4KEXA 2O29A 4JEOA 4W6TA 2O24A 5EB6A 1W7UA 1RM9A 4PPJA 3ED8A 1Q4AA 1Q4CA 5FVGA 5HGEA 2YDZA 1XMZA 2PXWA 1C4FA 2B3QA 3U0NA 1EMFA 4H3LA 3SG3A 1Q4DA 1YFPA 2A56B 2QLHA 3DPXA 3EK8A 5DTXA 5DPIA 2G5ZB 4TZGA 3DQ3A 4W7CA 2ZO7A 1BFPA 3ST2A 5LTPA 1Q4BA 2HGDA 1MOVA 2HQKA 3AI5A 4KF5C 4ZB1A 2H9WA 5LK4A 4L1IA 3E5VA 3SVOA 1GFLA 2A50B 2EMNA 2WISA 3DQ1A 2WSOA 5DPGA 4W6LA 3EVUA 5EBJA 1ZGQA 3EVPA 2PXSA 1Q73A 4W73A 5H87A 4LJBA 3W1CA 3LA1A 2QLEA 4KA9A 4IK9A 4DKNA 5EXUA 1RMPA 4W72A 2DUFA 4RTCA 5H89A 2V4EA 2EMDA 3SS0A 3ST4A 2WURA 3UFZA 5BTTA 1ZGPA 4Q7TA 2G6EA 4ORNA 3W1DA 2H5OA 2AWKA 2Q57A 3EVVA 3SVCA 2YE1A 4XL5A 2WHTA 3SSVA 1GL4A 2DUGA 5EB7A 3VHTB 2WSNA 3PJ5A 2GW4B 4Q9WA 3ZTFA 4IK8A 4W6CA 2QT2A 4LQTA 3NF0A 1W7SA 2H5PA 4W6GA 4GESB 4DXMA 3CD1A 4IZNA 3DQ6A 3OSRA 4JRBA 3PJBA 1EMKA 4GF6B 1UISA 5DPHA 3U8PA 2WIQA 4HQ8A 4KW9A 3DQMA 2BTJA 4LJDC 4LJCA 4KW8A 3SG2A 3AI4A 3SSYA 3EK4A 1QYOA 4HVFA 3DQHA 4UTSA 1KP5A 3V3DA 4EN1A 4W6HA 2VVHA 4Z4MA 4J88A 3BX9A 1GGXA 3GJ1A 3SSLA 4EDSA 3NT3A 1YZWA 4JFGA 2DDDA 3E5TA 4U2VA 2VVJA 5DU0A 5HZSA 2GX0A 2QZ0A 3VHTA 1JBYA 4PFEA 3CD9A 3LVDA 4BDUA 5HZOA 3RWAA 3DQ4A 4OHSA 3WCKA 4L12A 2HJOA 3DPZA 3U0KA 3NT9A 1B9CA 2V4EB 3SVEA 2AWJA 3SVBA 4W6FA 3DQ8A 3M22A 5BTTB 2H8QA 4ZIOA 2Z6ZA 2OGRA 4PPLA 4EULA 3O78A 2G3DB 4Q7UA 4W6RA 3IR8A 1QY3A 1F09A 2JADA 4ZF4A 2A54B 1EMCA 1YHGA 4I2YA 3WLCA 1XQMA 2Z6XA 2RH7A 3DPWA 3SVNA 2A47A 2OKWA 4H47A 5AQBB 3BXAA 3SRYA 2AWMA 3SG6A 3DQ7A 5EXCI 4ZBLA 3U0MA 4W74A 4JGEA 4W6UA 4XGYA 5DTZA 2FL1A 4JF9A 3EK7A 4AR7A 4KGEA 3SSTA 4EMQA 4OY4A 2QLGB 2B3PA 2DD7A 4R6BA 4W6JA 1XSSA 4L13A 3TMTA 3RWTA 3ZUFA 5FVIA 2HGYA 4DXOA 2HQZA 2VADA 3DQLA 1OXDA 1YHHA 4W7DA 5HZUA 2VVIA 3U8AA 1XAEA 2AWLA 5HZTA 5EJUA 2C9IA 4TZAA 3CFHA 1RRXA 1HUYA 3SG5A 2G16B 2HRSA 3WLDA 1JC0A 2AHAA 4W75A 3CBEA 2WHUA 1QYFA 3DQIA 5DRGA 3SSPA 5EHUA 1Q4EA 2AH8A 2ZMUA 4W6KA 3DQUA 3CGLA 2A53B 3LF4B 3O77A 3U0LA 3P28A 3CB9A 1EMMA 2YE0A 4GOBA 5H88A 3SSKA 3EKJA 2ICRA 2QLGA 3IP2A 3H1RA 5EXBA 2QLIA 3H1OA 4HQ9A 2V4EC 2P4MA 3E5WA 1QYQA 4Z4KA 3M24A 2EMOA 2GX2A 1KYRA 4IK5A 4R6DA 1KYSA 3OGOA 3AKOA 3KCTA 4Q7RA 3SG4A 2ARLA 1S6ZA 4J8AA 3EVRA 4IK4A 2DUIA 5BT0A 3ST3A 3U8CA 2C9JA 4XVPA 4W69A 2A52B 5FVFA 3GEXA 3VK1A 4W7FA 5BQLA 3LS3A 3K1KA 4ZFSA 2H5RA 4W6SA 1Z1QA 5J2OA 4KF5A 5DQMA 4B5YA 4ANJA 5HW9A 5F9GA 2OTEA 4JC2A 1RMMA 1YJFA 2Q6PA 2IB6A 3LSAA 3BXCA 5HBDA 3P8UA 3NEDA 3DQFA 2HFCA 2ZO6A 3A8SA 1RMOA 3NEZA 2DUEA 1CV7A 3KCSA 2POXA 1OXFA 4N3DA 4W7AA 4W6DA 1EMLA 5DY6A 2O2BA 3EKHA 2ZMWA 4PPKA 4HQCA 4NWSA 1QXTA 4ZINA 3I19A 1JC1A 4ZF3A 5LTQA 2Z1OA 2A46A 4EDOA 3CFFA 1HCJA 1YHIA 3SVSA 1EMBA
chains in the Genus database with same CATH topology
3DQDA 4B30A 1EMAA 4W7EA 3DQJA 4W7XA 1EMEA 3DQEA 3SG7A 1KYPA 4P1QA 4IK3A 4AS8A 2VAEA 4DXPA 3GB3A 1OXEA 3DQNA 5FHVA 4W6OA 5DTLA 4P76A 1YJ2A 2IE2A 4KF4A 2A48A 5DQBA 3G9AA 2GW3A 3LF3A 3TMRA 4KPIA 1H6RA 1XA9A 1JBZA 3GL4A 4XOVA 3SVDA 2G3OA 3ST0A 3CFAA 4LJDA 1Z1PA 1ZGOA 4W77A 5T3IA 4DXNA 4H48A 3ADFA 3DQ9A 5DPJA 1ZUXA 4W6IA 4W6BA 2Y0GA 5DRFA 4W7RA 2YFPA 4RYSA 3DQKA 1W7TA 3MGFA 4W6MA 3BXBA 3SV5A 4DXQA 4W6PA 4OQWA 4XOWA 4KGFA 1MOUA 2IOVA 4IK1A 4W6AA 4OGSA 3DQ2A 3DQCA 3PJ7A 4H3NA 3ZUJA 4RYWA 2FWQA 3ZULA 2HCGA 3GJ2A 2OTBA 2WHSA 4HE4A 4ZF5A 2DD9A 3LVAA 4LQUA 3SVUA 4W76A 2VZXA 2OKYA 3SVRA 4J89A 1H4UA 1MYWA 2QRFA 4B30B 2QU1A 5DTYA 2G6YA 4DKMA 4KAGA 3OSQA 4OJ0A 4W6NA 4H3MA 2OJKA 3SSHA 2G6XA 1F0BA 4LW5A 3DQOA 2DDCA 1G7KA 5KTGA 1EMGA 2H5QA 3VICA 4Q9XA 3DQAA 4KW4A 5LTRA 4DXIA 2IB5A 2FZUA 2Z6YA 3DQ5A 3PIBA 2H6VA 2DUHA 2HPWA 3LVCA 3S05A 2G2SB 3UG0A 4KEXA 2O29A 4JEOA 4W6TA 2O24A 5EB6A 1W7UA 1RM9A 4PPJA 3ED8A 1Q4AA 1Q4CA 5FVGA 5HGEA 2YDZA 1XMZA 2PXWA 1C4FA 2B3QA 3U0NA 1EMFA 4H3LA 3SG3A 1Q4DA 1YFPA 2A56B 2QLHA 3DPXA 3EK8A 5DTXA 5DPIA 2G5ZB 4TZGA 3DQ3A 4W7CA 2ZO7A 1BFPA 3ST2A 5LTPA 1Q4BA 2HGDA 1MOVA 2HQKA 3AI5A 4KF5C 4ZB1A 2H9WA 5LK4A 4L1IA 3E5VA 3SVOA 1GFLA 2A50B 2EMNA 2WISA 3DQ1A 2WSOA 5DPGA 4W6LA 3EVUA 5EBJA 1ZGQA 3EVPA 2PXSA 1Q73A 4W73A 5H87A 4LJBA 3W1CA 3LA1A 2QLEA 4KA9A 4IK9A 4DKNA 5EXUA 1RMPA 4W72A 2DUFA 4RTCA 5H89A 2V4EA 2EMDA 3SS0A 3ST4A 2WURA 3UFZA 5BTTA 1ZGPA 4Q7TA 2G6EA 4ORNA 3W1DA 2H5OA 2AWKA 2Q57A 3EVVA 3SVCA 2YE1A 4XL5A 2WHTA 3SSVA 1GL4A 2DUGA 5EB7A 3VHTB 2WSNA 3PJ5A 2GW4B 4Q9WA 3ZTFA 4IK8A 4W6CA 2QT2A 4LQTA 3NF0A 1W7SA 2H5PA 4W6GA 4GESB 4DXMA 3CD1A 4IZNA 3DQ6A 3OSRA 4JRBA 3PJBA 1EMKA 4GF6B 1UISA 5DPHA 3U8PA 2WIQA 4HQ8A 4KW9A 3DQMA 2BTJA 4LJDC 4LJCA 4KW8A 3SG2A 3AI4A 3SSYA 3EK4A 1QYOA 4HVFA 3DQHA 4UTSA 1KP5A 3V3DA 4EN1A 4W6HA 2VVHA 4Z4MA 4J88A 3BX9A 1GGXA 3GJ1A 3SSLA 4EDSA 3NT3A 1YZWA 4JFGA 2DDDA 3E5TA 4U2VA 2VVJA 5DU0A 5HZSA 2GX0A 2QZ0A 3VHTA 1JBYA 4PFEA 3CD9A 3LVDA 4BDUA 5HZOA 3RWAA 3DQ4A 4OHSA 3WCKA 4L12A 2HJOA 3DPZA 3U0KA 3NT9A 1B9CA 2V4EB 3SVEA 2AWJA 3SVBA 4W6FA 3DQ8A 3M22A 5BTTB 2H8QA 4ZIOA 2Z6ZA 2OGRA 4PPLA 4EULA 3O78A 2G3DB 4Q7UA 4W6RA 3IR8A 1QY3A 1F09A 2JADA 4ZF4A 2A54B 1EMCA 1YHGA 4I2YA 3WLCA 1XQMA 2Z6XA 2RH7A 3DPWA 3SVNA 2A47A 2OKWA 4H47A 5AQBB 3BXAA 3SRYA 2AWMA 3SG6A 3DQ7A 5EXCI 4ZBLA 3U0MA 4W74A 4JGEA 4W6UA 4XGYA 5DTZA 2FL1A 4JF9A 3EK7A 4AR7A 4KGEA 3SSTA 4EMQA 4OY4A 2QLGB 2B3PA 2DD7A 4R6BA 4W6JA 1XSSA 4L13A 3TMTA 3RWTA 3ZUFA 5FVIA 2HGYA 4DXOA 2HQZA 2VADA 3DQLA 1OXDA 1YHHA 4W7DA 5HZUA 2VVIA 3U8AA 1XAEA 2AWLA 5HZTA 5EJUA 2C9IA 4TZAA 3CFHA 1RRXA 1HUYA 3SG5A 2G16B 2HRSA 3WLDA 1JC0A 2AHAA 4W75A 3CBEA 2WHUA 1QYFA 3DQIA 5DRGA 3SSPA 5EHUA 1Q4EA 2AH8A 2ZMUA 4W6KA 3DQUA 3CGLA 2A53B 3LF4B 3O77A 3U0LA 3P28A 3CB9A 1EMMA 2YE0A 4GOBA 5H88A 3SSKA 3EKJA 2ICRA 2QLGA 3IP2A 3H1RA 5EXBA 2QLIA 3H1OA 4HQ9A 2V4EC 2P4MA 3E5WA 1QYQA 4Z4KA 3M24A 2EMOA 2GX2A 1KYRA 4IK5A 4R6DA 1KYSA 3OGOA 3AKOA 3KCTA 4Q7RA 3SG4A 2ARLA 1S6ZA 4J8AA 3EVRA 4IK4A 2DUIA 5BT0A 3ST3A 3U8CA 2C9JA 4XVPA 4W69A 2A52B 5FVFA 3GEXA 3VK1A 4W7FA 5BQLA 3LS3A 3K1KA 4ZFSA 2H5RA 4W6SA 1Z1QA 5J2OA 4KF5A 5DQMA 4B5YA 4ANJA 5HW9A 5F9GA 2OTEA 4JC2A 1RMMA 1YJFA 2Q6PA 2IB6A 3LSAA 3BXCA 5HBDA 3P8UA 3NEDA 3DQFA 2HFCA 2ZO6A 3A8SA 1RMOA 3NEZA 2DUEA 1CV7A 3KCSA 2POXA 1OXFA 4N3DA 4W7AA 4W6DA 1EMLA 5DY6A 2O2BA 3EKHA 2ZMWA 4PPKA 4HQCA 4NWSA 1QXTA 4ZINA 3I19A 1JC1A 4ZF3A 5LTQA 2Z1OA 2A46A 4EDOA 3CFFA 1HCJA 1YHIA 3SVSA 1EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQD A;  4B30 A;  1EMA A;  4W7E A;  3DQJ A;  4W7X A;  1EME A;  3DQE A;  3SG7 A;  1KYP A;  4P1Q A;  4IK3 A;  4AS8 A;  2VAE A;  4DXP A;  3GB3 A;  1OXE A;  3DQN A;  5FHV A;  4W6O A;  5DTL A;  4P76 A;  1YJ2 A;  2IE2 A;  4KF4 A;  2A48 A;  5DQB A;  3G9A A;  2GW3 A;  3LF3 A;  3TMR A;  4KPI A;  1H6R A;  1XA9 A;  1JBZ A;  3GL4 A;  4XOV A;  3SVD A;  2G3O A;  3ST0 A;  3CFA A;  4LJD A;  1Z1P A;  1ZGO A;  4W77 A;  5T3I A;  4DXN A;  4H48 A;  3ADF A;  3DQ9 A;  5DPJ A;  1ZUX A;  4W6I A;  4W6B A;  2Y0G A;  5DRF A;  4W7R A;  2YFP A;  4RYS A;  3DQK A;  1W7T A;  3MGF A;  4W6M A;  3BXB A;  3SV5 A;  4DXQ A;  4W6P A;  4OQW A;  4XOW A;  4KGF A;  1MOU A;  2IOV A;  4IK1 A;  4W6A A;  4OGS A;  3DQ2 A;  3DQC A;  3PJ7 A;  4H3N A;  3ZUJ A;  4RYW A;  2FWQ A;  3ZUL A;  2HCG A;  3GJ2 A;  2OTB A;  2WHS A;  4HE4 A;  4ZF5 A;  2DD9 A;  3LVA A;  4LQU A;  3SVU A;  4W76 A;  2VZX A;  2OKY A;  3SVR A;  4J89 A;  1H4U A;  1MYW A;  2QRF A;  4B30 B;  2QU1 A;  5DTY A;  2G6Y A;  4DKM A;  4KAG A;  3OSQ A;  4OJ0 A;  4W6N A;  4H3M A;  2OJK A;  3SSH A;  2G6X A;  1F0B A;  4LW5 A;  3DQO A;  2DDC A;  1G7K A;  5KTG A;  1EMG A;  2H5Q A;  3VIC A;  4Q9X A;  3DQA A;  4KW4 A;  5LTR A;  4DXI A;  2IB5 A;  2FZU A;  2Z6Y A;  3DQ5 A;  3PIB A;  2H6V A;  2DUH A;  2HPW A;  3LVC A;  3S05 A;  2G2S B;  3UG0 A;  4KEX A;  2O29 A;  4JEO A;  4W6T A;  2O24 A;  5EB6 A;  1W7U A;  1RM9 A;  4PPJ A;  3ED8 A;  1Q4A A;  1Q4C A;  5FVG A;  5HGE A;  2YDZ A;  1XMZ A;  2PXW A;  1C4F A;  2B3Q A;  3U0N A;  1EMF A;  4H3L A;  3SG3 A;  1Q4D A;  1YFP A;  2A56 B;  2QLH A;  3DPX A;  3EK8 A;  5DTX A;  5DPI A;  2G5Z B;  4TZG A;  3DQ3 A;  4W7C A;  2ZO7 A;  1BFP A;  3ST2 A;  5LTP A;  1Q4B A;  2HGD A;  1MOV A;  2HQK A;  3AI5 A;  4KF5 C;  4ZB1 A;  2H9W A;  5LK4 A;  4L1I A;  3E5V A;  3SVO A;  1GFL A;  2A50 B;  2EMN A;  2WIS A;  3DQ1 A;  2WSO A;  5DPG A;  4W6L A;  3EVU A;  5EBJ A;  1ZGQ A;  3EVP A;  2PXS A;  1Q73 A;  4W73 A;  5H87 A;  4LJB A;  3W1C A;  3LA1 A;  2QLE A;  4KA9 A;  4IK9 A;  4DKN A;  5EXU A;  1RMP A;  4W72 A;  2DUF A;  4RTC A;  5H89 A;  2V4E A;  2EMD A;  3SS0 A;  3ST4 A;  2WUR A;  3UFZ A;  5BTT A;  1ZGP A;  4Q7T A;  2G6E A;  4ORN A;  3W1D A;  2H5O A;  2AWK A;  2Q57 A;  3EVV A;  3SVC A;  2YE1 A;  4XL5 A;  2WHT A;  3SSV A;  1GL4 A;  2DUG A;  5EB7 A;  3VHT B;  2WSN A;  3PJ5 A;  2GW4 B;  4Q9W A;  3ZTF A;  4IK8 A;  4W6C A;  2QT2 A;  4LQT A;  3NF0 A;  1W7S A;  2H5P A;  4W6G A;  4GES B;  4DXM A;  3CD1 A;  4IZN A;  3DQ6 A;  3OSR A;  4JRB A;  3PJB A;  1EMK A;  4GF6 B;  1UIS A;  5DPH A;  3U8P A;  2WIQ A;  4HQ8 A;  4KW9 A;  3DQM A;  2BTJ A;  4LJD C;  4LJC A;  4KW8 A;  3SG2 A;  3AI4 A;  3SSY A;  3EK4 A;  1QYO A;  4HVF A;  3DQH A;  4UTS A;  1KP5 A;  3V3D A;  4EN1 A;  4W6H A;  2VVH A;  4Z4M A;  4J88 A;  3BX9 A;  1GGX A;  3GJ1 A;  3SSL A;  4EDS A;  3NT3 A;  1YZW A;  4JFG A;  2DDD A;  3E5T A;  4U2V A;  2VVJ A;  5DU0 A;  5HZS A;  2GX0 A;  2QZ0 A;  3VHT A;  1JBY A;  4PFE A;  3CD9 A;  3LVD A;  4BDU A;  5HZO A;  3RWA A;  3DQ4 A;  4OHS A;  3WCK A;  4L12 A;  2HJO A;  3DPZ A;  3U0K A;  3NT9 A;  1B9C A;  2V4E B;  3SVE A;  2AWJ A;  3SVB A;  4W6F A;  3DQ8 A;  3M22 A;  5BTT B;  2H8Q A;  4ZIO A;  2Z6Z A;  2OGR A;  4PPL A;  4EUL A;  3O78 A;  2G3D B;  4Q7U A;  4W6R A;  3IR8 A;  1QY3 A;  1F09 A;  2JAD A;  4ZF4 A;  2A54 B;  1EMC A;  1YHG A;  4I2Y A;  3WLC A;  1XQM A;  2Z6X A;  2RH7 A;  3DPW A;  3SVN A;  2A47 A;  2OKW A;  4H47 A;  5AQB B;  3BXA A;  3SRY A;  2AWM A;  3SG6 A;  3DQ7 A;  5EXC I;  4ZBL A;  3U0M A;  4W74 A;  4JGE A;  4W6U A;  4XGY A;  5DTZ A;  2FL1 A;  4JF9 A;  3EK7 A;  4AR7 A;  4KGE A;  3SST A;  4EMQ A;  4OY4 A;  2QLG B;  2B3P A;  2DD7 A;  4R6B A;  4W6J A;  1XSS A;  4L13 A;  3TMT A;  3RWT A;  3ZUF A;  5FVI A;  2HGY A;  4DXO A;  2HQZ A;  2VAD A;  3DQL A;  1OXD A;  1YHH A;  4W7D A;  5HZU A;  2VVI A;  3U8A A;  1XAE A;  2AWL A;  5HZT A;  5EJU A;  2C9I A;  4TZA A;  3CFH A;  1RRX A;  1HUY A;  3SG5 A;  2G16 B;  2HRS A;  3WLD A;  1JC0 A;  2AHA A;  4W75 A;  3CBE A;  2WHU A;  1QYF A;  3DQI A;  5DRG A;  3SSP A;  5EHU A;  1Q4E A;  2AH8 A;  2ZMU A;  4W6K A;  3DQU A;  3CGL A;  2A53 B;  3LF4 B;  3O77 A;  3U0L A;  3P28 A;  3CB9 A;  1EMM A;  2YE0 A;  4GOB A;  5H88 A;  3SSK A;  3EKJ A;  2ICR A;  2QLG A;  3IP2 A;  3H1R A;  5EXB A;  2QLI A;  3H1O A;  4HQ9 A;  2V4E C;  2P4M A;  3E5W A;  1QYQ A;  4Z4K A;  3M24 A;  2EMO A;  2GX2 A;  1KYR A;  4IK5 A;  4R6D A;  1KYS A;  3OGO A;  3AKO A;  3KCT A;  4Q7R A;  3SG4 A;  2ARL A;  1S6Z A;  4J8A A;  3EVR A;  4IK4 A;  2DUI A;  5BT0 A;  3ST3 A;  3U8C A;  2C9J A;  4XVP A;  4W69 A;  2A52 B;  5FVF A;  3GEX A;  3VK1 A;  4W7F A;  5BQL A;  3LS3 A;  3K1K A;  4ZFS A;  2H5R A;  4W6S A;  1Z1Q A;  5J2O A;  4KF5 A;  5DQM A;  4B5Y A;  4ANJ A;  5HW9 A;  5F9G A;  2OTE A;  4JC2 A;  1RMM A;  1YJF A;  2Q6P A;  2IB6 A;  3LSA A;  3BXC A;  5HBD A;  3P8U A;  3NED A;  3DQF A;  2HFC A;  2ZO6 A;  3A8S A;  1RMO A;  3NEZ A;  2DUE A;  1CV7 A;  3KCS A;  2POX A;  1OXF A;  4N3D A;  4W7A A;  4W6D A;  1EML A;  5DY6 A;  2O2B A;  3EKH A;  2ZMW A;  4PPK A;  4HQC A;  4NWS A;  1QXT A;  4ZIN A;  3I19 A;  1JC1 A;  4ZF3 A;  5LTQ A;  2Z1O A;  2A46 A;  4EDO A;  3CFF A;  1HCJ A;  1YHI A;  3SVS A;  1EMB A; 
#chains in the Genus database with same CATH topology
 3DQD A;  4B30 A;  1EMA A;  4W7E A;  3DQJ A;  4W7X A;  1EME A;  3DQE A;  3SG7 A;  1KYP A;  4P1Q A;  4IK3 A;  4AS8 A;  2VAE A;  4DXP A;  3GB3 A;  1OXE A;  3DQN A;  5FHV A;  4W6O A;  5DTL A;  4P76 A;  1YJ2 A;  2IE2 A;  4KF4 A;  2A48 A;  5DQB A;  3G9A A;  2GW3 A;  3LF3 A;  3TMR A;  4KPI A;  1H6R A;  1XA9 A;  1JBZ A;  3GL4 A;  4XOV A;  3SVD A;  2G3O A;  3ST0 A;  3CFA A;  4LJD A;  1Z1P A;  1ZGO A;  4W77 A;  5T3I A;  4DXN A;  4H48 A;  3ADF A;  3DQ9 A;  5DPJ A;  1ZUX A;  4W6I A;  4W6B A;  2Y0G A;  5DRF A;  4W7R A;  2YFP A;  4RYS A;  3DQK A;  1W7T A;  3MGF A;  4W6M A;  3BXB A;  3SV5 A;  4DXQ A;  4W6P A;  4OQW A;  4XOW A;  4KGF A;  1MOU A;  2IOV A;  4IK1 A;  4W6A A;  4OGS A;  3DQ2 A;  3DQC A;  3PJ7 A;  4H3N A;  3ZUJ A;  4RYW A;  2FWQ A;  3ZUL A;  2HCG A;  3GJ2 A;  2OTB A;  2WHS A;  4HE4 A;  4ZF5 A;  2DD9 A;  3LVA A;  4LQU A;  3SVU A;  4W76 A;  2VZX A;  2OKY A;  3SVR A;  4J89 A;  1H4U A;  1MYW A;  2QRF A;  4B30 B;  2QU1 A;  5DTY A;  2G6Y A;  4DKM A;  4KAG A;  3OSQ A;  4OJ0 A;  4W6N A;  4H3M A;  2OJK A;  3SSH A;  2G6X A;  1F0B A;  4LW5 A;  3DQO A;  2DDC A;  1G7K A;  5KTG A;  1EMG A;  2H5Q A;  3VIC A;  4Q9X A;  3DQA A;  4KW4 A;  5LTR A;  4DXI A;  2IB5 A;  2FZU A;  2Z6Y A;  3DQ5 A;  3PIB A;  2H6V A;  2DUH A;  2HPW A;  3LVC A;  3S05 A;  2G2S B;  3UG0 A;  4KEX A;  2O29 A;  4JEO A;  4W6T A;  2O24 A;  5EB6 A;  1W7U A;  1RM9 A;  4PPJ A;  3ED8 A;  1Q4A A;  1Q4C A;  5FVG A;  5HGE A;  2YDZ A;  1XMZ A;  2PXW A;  1C4F A;  2B3Q A;  3U0N A;  1EMF A;  4H3L A;  3SG3 A;  1Q4D A;  1YFP A;  2A56 B;  2QLH A;  3DPX A;  3EK8 A;  5DTX A;  5DPI A;  2G5Z B;  4TZG A;  3DQ3 A;  4W7C A;  2ZO7 A;  1BFP A;  3ST2 A;  5LTP A;  1Q4B A;  2HGD A;  1MOV A;  2HQK A;  3AI5 A;  4KF5 C;  4ZB1 A;  2H9W A;  5LK4 A;  4L1I A;  3E5V A;  3SVO A;  1GFL A;  2A50 B;  2EMN A;  2WIS A;  3DQ1 A;  2WSO A;  5DPG A;  4W6L A;  3EVU A;  5EBJ A;  1ZGQ A;  3EVP A;  2PXS A;  1Q73 A;  4W73 A;  5H87 A;  4LJB A;  3W1C A;  3LA1 A;  2QLE A;  4KA9 A;  4IK9 A;  4DKN A;  5EXU A;  1RMP A;  4W72 A;  2DUF A;  4RTC A;  5H89 A;  2V4E A;  2EMD A;  3SS0 A;  3ST4 A;  2WUR A;  3UFZ A;  5BTT A;  1ZGP A;  4Q7T A;  2G6E A;  4ORN A;  3W1D A;  2H5O A;  2AWK A;  2Q57 A;  3EVV A;  3SVC A;  2YE1 A;  4XL5 A;  2WHT A;  3SSV A;  1GL4 A;  2DUG A;  5EB7 A;  3VHT B;  2WSN A;  3PJ5 A;  2GW4 B;  4Q9W A;  3ZTF A;  4IK8 A;  4W6C A;  2QT2 A;  4LQT A;  3NF0 A;  1W7S A;  2H5P A;  4W6G A;  4GES B;  4DXM A;  3CD1 A;  4IZN A;  3DQ6 A;  3OSR A;  4JRB A;  3PJB A;  1EMK A;  4GF6 B;  1UIS A;  5DPH A;  3U8P A;  2WIQ A;  4HQ8 A;  4KW9 A;  3DQM A;  2BTJ A;  4LJD C;  4LJC A;  4KW8 A;  3SG2 A;  3AI4 A;  3SSY A;  3EK4 A;  1QYO A;  4HVF A;  3DQH A;  4UTS A;  1KP5 A;  3V3D A;  4EN1 A;  4W6H A;  2VVH A;  4Z4M A;  4J88 A;  3BX9 A;  1GGX A;  3GJ1 A;  3SSL A;  4EDS A;  3NT3 A;  1YZW A;  4JFG A;  2DDD A;  3E5T A;  4U2V A;  2VVJ A;  5DU0 A;  5HZS A;  2GX0 A;  2QZ0 A;  3VHT A;  1JBY A;  4PFE A;  3CD9 A;  3LVD A;  4BDU A;  5HZO A;  3RWA A;  3DQ4 A;  4OHS A;  3WCK A;  4L12 A;  2HJO A;  3DPZ A;  3U0K A;  3NT9 A;  1B9C A;  2V4E B;  3SVE A;  2AWJ A;  3SVB A;  4W6F A;  3DQ8 A;  3M22 A;  5BTT B;  2H8Q A;  4ZIO A;  2Z6Z A;  2OGR A;  4PPL A;  4EUL A;  3O78 A;  2G3D B;  4Q7U A;  4W6R A;  3IR8 A;  1QY3 A;  1F09 A;  2JAD A;  4ZF4 A;  2A54 B;  1EMC A;  1YHG A;  4I2Y A;  3WLC A;  1XQM A;  2Z6X A;  2RH7 A;  3DPW A;  3SVN A;  2A47 A;  2OKW A;  4H47 A;  5AQB B;  3BXA A;  3SRY A;  2AWM A;  3SG6 A;  3DQ7 A;  5EXC I;  4ZBL A;  3U0M A;  4W74 A;  4JGE A;  4W6U A;  4XGY A;  5DTZ A;  2FL1 A;  4JF9 A;  3EK7 A;  4AR7 A;  4KGE A;  3SST A;  4EMQ A;  4OY4 A;  2QLG B;  2B3P A;  2DD7 A;  4R6B A;  4W6J A;  1XSS A;  4L13 A;  3TMT A;  3RWT A;  3ZUF A;  5FVI A;  2HGY A;  4DXO A;  2HQZ A;  2VAD A;  3DQL A;  1OXD A;  1YHH A;  4W7D A;  5HZU A;  2VVI A;  3U8A A;  1XAE A;  2AWL A;  5HZT A;  5EJU A;  2C9I A;  4TZA A;  3CFH A;  1RRX A;  1HUY A;  3SG5 A;  2G16 B;  2HRS A;  3WLD A;  1JC0 A;  2AHA A;  4W75 A;  3CBE A;  2WHU A;  1QYF A;  3DQI A;  5DRG A;  3SSP A;  5EHU A;  1Q4E A;  2AH8 A;  2ZMU A;  4W6K A;  3DQU A;  3CGL A;  2A53 B;  3LF4 B;  3O77 A;  3U0L A;  3P28 A;  3CB9 A;  1EMM A;  2YE0 A;  4GOB A;  5H88 A;  3SSK A;  3EKJ A;  2ICR A;  2QLG A;  3IP2 A;  3H1R A;  5EXB A;  2QLI A;  3H1O A;  4HQ9 A;  2V4E C;  2P4M A;  3E5W A;  1QYQ A;  4Z4K A;  3M24 A;  2EMO A;  2GX2 A;  1KYR A;  4IK5 A;  4R6D A;  1KYS A;  3OGO A;  3AKO A;  3KCT A;  4Q7R A;  3SG4 A;  2ARL A;  1S6Z A;  4J8A A;  3EVR A;  4IK4 A;  2DUI A;  5BT0 A;  3ST3 A;  3U8C A;  2C9J A;  4XVP A;  4W69 A;  2A52 B;  5FVF A;  3GEX A;  3VK1 A;  4W7F A;  5BQL A;  3LS3 A;  3K1K A;  4ZFS A;  2H5R A;  4W6S A;  1Z1Q A;  5J2O A;  4KF5 A;  5DQM A;  4B5Y A;  4ANJ A;  5HW9 A;  5F9G A;  2OTE A;  4JC2 A;  1RMM A;  1YJF A;  2Q6P A;  2IB6 A;  3LSA A;  3BXC A;  5HBD A;  3P8U A;  3NED A;  3DQF A;  2HFC A;  2ZO6 A;  3A8S A;  1RMO A;  3NEZ A;  2DUE A;  1CV7 A;  3KCS A;  2POX A;  1OXF A;  4N3D A;  4W7A A;  4W6D A;  1EML A;  5DY6 A;  2O2B A;  3EKH A;  2ZMW A;  4PPK A;  4HQC A;  4NWS A;  1QXT A;  4ZIN A;  3I19 A;  1JC1 A;  4ZF3 A;  5LTQ A;  2Z1O A;  2A46 A;  4EDO A;  3CFF A;  1HCJ A;  1YHI A;  3SVS A;  1EMB A; 
#chains in the Genus database with same CATH homology
 3DQD A;  4B30 A;  1EMA A;  4W7E A;  3DQJ A;  4W7X A;  1EME A;  3DQE A;  3SG7 A;  1KYP A;  4P1Q A;  4IK3 A;  4AS8 A;  2VAE A;  4DXP A;  3GB3 A;  1OXE A;  3DQN A;  5FHV A;  4W6O A;  5DTL A;  4P76 A;  1YJ2 A;  2IE2 A;  4KF4 A;  2A48 A;  5DQB A;  3G9A A;  2GW3 A;  3LF3 A;  3TMR A;  4KPI A;  1H6R A;  1XA9 A;  1JBZ A;  3GL4 A;  4XOV A;  3SVD A;  2G3O A;  3ST0 A;  3CFA A;  4LJD A;  1Z1P A;  1ZGO A;  4W77 A;  5T3I A;  4DXN A;  4H48 A;  3ADF A;  3DQ9 A;  5DPJ A;  1ZUX A;  4W6I A;  4W6B A;  2Y0G A;  5DRF A;  4W7R A;  2YFP A;  4RYS A;  3DQK A;  1W7T A;  3MGF A;  4W6M A;  3BXB A;  3SV5 A;  4DXQ A;  4W6P A;  4OQW A;  4XOW A;  4KGF A;  1MOU A;  2IOV A;  4IK1 A;  4W6A A;  4OGS A;  3DQ2 A;  3DQC A;  3PJ7 A;  4H3N A;  3ZUJ A;  4RYW A;  2FWQ A;  3ZUL A;  2HCG A;  3GJ2 A;  2OTB A;  2WHS A;  4HE4 A;  4ZF5 A;  2DD9 A;  3LVA A;  4LQU A;  3SVU A;  4W76 A;  2VZX A;  2OKY A;  3SVR A;  4J89 A;  1H4U A;  1MYW A;  2QRF A;  4B30 B;  2QU1 A;  5DTY A;  2G6Y A;  4DKM A;  4KAG A;  3OSQ A;  4OJ0 A;  4W6N A;  4H3M A;  2OJK A;  3SSH A;  2G6X A;  1F0B A;  4LW5 A;  3DQO A;  2DDC A;  1G7K A;  5KTG A;  1EMG A;  2H5Q A;  3VIC A;  4Q9X A;  3DQA A;  4KW4 A;  5LTR A;  4DXI A;  2IB5 A;  2FZU A;  2Z6Y A;  3DQ5 A;  3PIB A;  2H6V A;  2DUH A;  2HPW A;  3LVC A;  3S05 A;  2G2S B;  3UG0 A;  4KEX A;  2O29 A;  4JEO A;  4W6T A;  2O24 A;  5EB6 A;  1W7U A;  1RM9 A;  4PPJ A;  3ED8 A;  1Q4A A;  1Q4C A;  5FVG A;  5HGE A;  2YDZ A;  1XMZ A;  2PXW A;  1C4F A;  2B3Q A;  3U0N A;  1EMF A;  4H3L A;  3SG3 A;  1Q4D A;  1YFP A;  2A56 B;  2QLH A;  3DPX A;  3EK8 A;  5DTX A;  5DPI A;  2G5Z B;  4TZG A;  3DQ3 A;  4W7C A;  2ZO7 A;  1BFP A;  3ST2 A;  5LTP A;  1Q4B A;  2HGD A;  1MOV A;  2HQK A;  3AI5 A;  4KF5 C;  4ZB1 A;  2H9W A;  5LK4 A;  4L1I A;  3E5V A;  3SVO A;  1GFL A;  2A50 B;  2EMN A;  2WIS A;  3DQ1 A;  2WSO A;  5DPG A;  4W6L A;  3EVU A;  5EBJ A;  1ZGQ A;  3EVP A;  2PXS A;  1Q73 A;  4W73 A;  5H87 A;  4LJB A;  3W1C A;  3LA1 A;  2QLE A;  4KA9 A;  4IK9 A;  4DKN A;  5EXU A;  1RMP A;  4W72 A;  2DUF A;  4RTC A;  5H89 A;  2V4E A;  2EMD A;  3SS0 A;  3ST4 A;  2WUR A;  3UFZ A;  5BTT A;  1ZGP A;  4Q7T A;  2G6E A;  4ORN A;  3W1D A;  2H5O A;  2AWK A;  2Q57 A;  3EVV A;  3SVC A;  2YE1 A;  4XL5 A;  2WHT A;  3SSV A;  1GL4 A;  2DUG A;  5EB7 A;  3VHT B;  2WSN A;  3PJ5 A;  2GW4 B;  4Q9W A;  3ZTF A;  4IK8 A;  4W6C A;  2QT2 A;  4LQT A;  3NF0 A;  1W7S A;  2H5P A;  4W6G A;  4GES B;  4DXM A;  3CD1 A;  4IZN A;  3DQ6 A;  3OSR A;  4JRB A;  3PJB A;  1EMK A;  4GF6 B;  1UIS A;  5DPH A;  3U8P A;  2WIQ A;  4HQ8 A;  4KW9 A;  3DQM A;  2BTJ A;  4LJD C;  4LJC A;  4KW8 A;  3SG2 A;  3AI4 A;  3SSY A;  3EK4 A;  1QYO A;  4HVF A;  3DQH A;  4UTS A;  1KP5 A;  3V3D A;  4EN1 A;  4W6H A;  2VVH A;  4Z4M A;  4J88 A;  3BX9 A;  1GGX A;  3GJ1 A;  3SSL A;  4EDS A;  3NT3 A;  1YZW A;  4JFG A;  2DDD A;  3E5T A;  4U2V A;  2VVJ A;  5DU0 A;  5HZS A;  2GX0 A;  2QZ0 A;  3VHT A;  1JBY A;  4PFE A;  3CD9 A;  3LVD A;  4BDU A;  5HZO A;  3RWA A;  3DQ4 A;  4OHS A;  3WCK A;  4L12 A;  2HJO A;  3DPZ A;  3U0K A;  3NT9 A;  1B9C A;  2V4E B;  3SVE A;  2AWJ A;  3SVB A;  4W6F A;  3DQ8 A;  3M22 A;  5BTT B;  2H8Q A;  4ZIO A;  2Z6Z A;  2OGR A;  4PPL A;  4EUL A;  3O78 A;  2G3D B;  4Q7U A;  4W6R A;  3IR8 A;  1QY3 A;  1F09 A;  2JAD A;  4ZF4 A;  2A54 B;  1EMC A;  1YHG A;  4I2Y A;  3WLC A;  1XQM A;  2Z6X A;  2RH7 A;  3DPW A;  3SVN A;  2A47 A;  2OKW A;  4H47 A;  5AQB B;  3BXA A;  3SRY A;  2AWM A;  3SG6 A;  3DQ7 A;  5EXC I;  4ZBL A;  3U0M A;  4W74 A;  4JGE A;  4W6U A;  4XGY A;  5DTZ A;  2FL1 A;  4JF9 A;  3EK7 A;  4AR7 A;  4KGE A;  3SST A;  4EMQ A;  4OY4 A;  2QLG B;  2B3P A;  2DD7 A;  4R6B A;  4W6J A;  1XSS A;  4L13 A;  3TMT A;  3RWT A;  3ZUF A;  5FVI A;  2HGY A;  4DXO A;  2HQZ A;  2VAD A;  3DQL A;  1OXD A;  1YHH A;  4W7D A;  5HZU A;  2VVI A;  3U8A A;  1XAE A;  2AWL A;  5HZT A;  5EJU A;  2C9I A;  4TZA A;  3CFH A;  1RRX A;  1HUY A;  3SG5 A;  2G16 B;  2HRS A;  3WLD A;  1JC0 A;  2AHA A;  4W75 A;  3CBE A;  2WHU A;  1QYF A;  3DQI A;  5DRG A;  3SSP A;  5EHU A;  1Q4E A;  2AH8 A;  2ZMU A;  4W6K A;  3DQU A;  3CGL A;  2A53 B;  3LF4 B;  3O77 A;  3U0L A;  3P28 A;  3CB9 A;  1EMM A;  2YE0 A;  4GOB A;  5H88 A;  3SSK A;  3EKJ A;  2ICR A;  2QLG A;  3IP2 A;  3H1R A;  5EXB A;  2QLI A;  3H1O A;  4HQ9 A;  2V4E C;  2P4M A;  3E5W A;  1QYQ A;  4Z4K A;  3M24 A;  2EMO A;  2GX2 A;  1KYR A;  4IK5 A;  4R6D A;  1KYS A;  3OGO A;  3AKO A;  3KCT A;  4Q7R A;  3SG4 A;  2ARL A;  1S6Z A;  4J8A A;  3EVR A;  4IK4 A;  2DUI A;  5BT0 A;  3ST3 A;  3U8C A;  2C9J A;  4XVP A;  4W69 A;  2A52 B;  5FVF A;  3GEX A;  3VK1 A;  4W7F A;  5BQL A;  3LS3 A;  3K1K A;  4ZFS A;  2H5R A;  4W6S A;  1Z1Q A;  5J2O A;  4KF5 A;  5DQM A;  4B5Y A;  4ANJ A;  5HW9 A;  5F9G A;  2OTE A;  4JC2 A;  1RMM A;  1YJF A;  2Q6P A;  2IB6 A;  3LSA A;  3BXC A;  5HBD A;  3P8U A;  3NED A;  3DQF A;  2HFC A;  2ZO6 A;  3A8S A;  1RMO A;  3NEZ A;  2DUE A;  1CV7 A;  3KCS A;  2POX A;  1OXF A;  4N3D A;  4W7A A;  4W6D A;  1EML A;  5DY6 A;  2O2B A;  3EKH A;  2ZMW A;  4PPK A;  4HQC A;  4NWS A;  1QXT A;  4ZIN A;  3I19 A;  1JC1 A;  4ZF3 A;  5LTQ A;  2Z1O A;  2A46 A;  4EDO A;  3CFF A;  1HCJ A;  1YHI A;  3SVS A;  1EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...