3E62A

Fragment based discovery of jak-2 inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
291
Chain Sequence
RDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Fragment-based discovery of JAK-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 291
sequence length 293
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e62A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e62A01
1WBPA 2RSVA 2VTTA 1GY3A 3RNYA 3CQWA 3BYSA 4BCOA 1UNGA 3HV5A 4FOCA 5EH0A 4EYMA 3ZBXA 5K4JA 3TWJA 4D1SA 2NRYA 2CKEA 3Q4CA 1B38A 4QP1A 3ORKA 5KMKA 5KX8A 3FAAA 3NIZA 5JFVA 2X8DA 4QMXA 4UMUA 3RM6A 4P7EA 2J0IA 3DKFA 3K3IA 3DLZA 4GKIA 2BAQA 4BN1A 4FZFB 4G17A 5C27A 1W8CA 4BCJA 3QKKA 4JQ7A 4R1VA 5EHOA 4C34A 3IPHA 3HAMA 3A7GA 3LZBA 1Q8UA 2QOOA 4XMOA 5FD2A 1B6CB 4R7IA 2PMOX 4X2NA 2RGPA 3ZMMA 3KULB 3QA8A 4I5CA 5BUEA 2C69A 4XUFA 2B0QA 4FV7A 4EEVA 3TZMA 2UVZA 3QXOA 5K9IA 5A54A 3QQKA 2BIKB 2QOIA 2QQ7A 4ERWA 2VUWA 5IA2A 3C4CA 3KMUA 4TWCA 1J7LA 2YLEA 3M11A 4O6EA 3C0HA 3NW5A 3JXWA 3FYKX 3FSFA 1NT2A 2E9OA 2OW3A 4HGSA 1A48A 1OL7A 1XH6A 3LFSA 1UNHA 1OPLA 2XNBA 3GU4A 3NPCA 3PVBA 2VX0A 4FTUA 3I60A 2OKRA 1G8AA 4NIFB 5F4NA 4FX3A 4MBLA 4CFNA 4EKKA 1X8BA 3GU7A 3GC7A 2Z7RA 3DAKA 3DK6A 4I4EA 3UVQA 4EK4A 3D7ZA 3AQVA 4MXXA 4XG3A 4BKZA 2CNQA 4TN6A 3RP9A 4E26A 1PXLA 1YOLA 3ZEPA 5DEYA 2C68A 1OMWA 4U3YA 3QCSA 2JKOA 3ZYAA 1UA2A 4NK9A 4P5ZA 3RBWA 5CENA 5HVYA 5KZIA 5E4HA 1ZMWA 5ACBC 3QLFA 3WF8A 2X9FA 3U6HA 1Y6BA 2DQ7X 2JKMA 2J0KA 4YZNA 3PXZA 3PP0A 2VZ6A 2BZHB 2OH4A 3DA6A 4FV0A 1G8SA 4IAAA 1CM8A 4EC8A 3OG7A 4I20A 2ZMDA 5DR9A 4KAOA 4ZTSA 3UO4A 4EOKA 4F63A 4PL3A 4GFMA 5HZNA 4FTNA 5A6OA 3NNUA 3QQGA 4GYIA 5JFXA 4YJOA 1H07A 3H9RA 2OJGA 1QPJA 4CD0A 2PVRA 1MUOA 2PL0A 1ZRZA 4XRJA 5KMOA 2YJSA 1PMEA 4C8BA 1YWRA 3Q32A 3MH3A 3NAXA 5HIDA 5IMXA 4FIGA 4TYGA 1JKSA 5FTQA 4G3DA 4FKRA 4KBKA 5AA9A 2HYYA 4YC6A 2CDZA 4IDTA 3VBVA 4YZDA 4UMRA 2X39A 4O0WA 3LFBA 2JDTA 1WBVA 3MIYA 4QMUA 4PPAA 3HV3A 4YC3A 3NVMB 1OL5A 1ZARA 3D9VA 1OI9A 2ZOQA 2ZV8A 1M2PA 2ESMA 2JEDA 4QMVA 4BCKA 1E9HA 3OC1A 5JH6A 2RG5A 3B2WA 3PPJA 4BI0A 4RVTA 4CGAA 2AC3A 3PY1A 3OUNB 5M4CA 2EXMA 3CTJA 5BMSA 2P4IA 2OXXA 5DEWA 5M55A 4TNDA 4JVGA 2QONA 2YFXA 3EQPA 4BDEA 5HX6A 1RW8A 5BPYA 4LGGA 4KIOA 4O0YA 4BCFA 4C35A 4WO5A 4C02A 2XNMA 3FHRA 4QMLA 3TZ9A 3DDQA 4FT3A 4R7BA 3Q9XA 4GT3A 3SW7A 3O17A 4IVCA 4DTAA 1V0OA 2DS1A 5E9EA 1OUYA 1OKZA 4F7JA 2VTSA 3MY5A 4ZJIA 4FKOA 1R0EA 2VO7A 4O38A 4QTAA 1WBSA 3NCZA 5E8SA 1ZOEA 4CQEA 2O63A 2JIVA 2O8YA 2UW4A 4XOYA 1DAWA 3TXOA 5FG8A 1XHAA 1YXSA 4KSQA 4YBJA 3R7GA 4O0TA 1H01A 3QRKA 3WF7A 4OBOA 4WRSA 4G9RA 5IEYA 3G90X 3BIZA 4F1TA 2C47A 3AC5A 2XVDA 2QOBA 3D14A 3IW8A 5FP6A 3R28A 4BDKA 4Q5EA 4V04A 5D10A 1TQIA 3DY7A 3V8TA 5L6WL 4E1ZA 3GCQA 4EHZA 5HD7A 4RX5A 4PDYA 3CS9A 1Q8ZA 3UE4A 4JOAA 1OKVA 3KRJA 3TKHA 4EQMA 4AZWA 2UZUE 4IZ7A 2XKDA 3PZHA 4I92A 5EYKA 4ZXTA 3FY2A 3R02A 4BBFA 2P3GX 2W1FA 5DMZA 4CNHA 1ZAOA 5I3RA 4LGHA 2YDJA 5EI6A 3OFMA 1TQPA 3E62A 3KMMA 2ZVAA 3V3VA 2HWPA 2OIDA 3G6HA 1ATPE 2BZIB 4NSTA 4R6VA 2R3NA 3OOMA 3SHEA 3ATTA 2CN5A 3R7IA 4E20A 2W7XA 4CFMA 5CAUA 4KUJA 4GK2A 3EZRA 4WNMA 1KV1A 3OEFX 2RF9A 4QTBA 3UMXA 4FNWA 2Z2WA 2O3PA 4RSSA 3U8WA 1KUTA 2GHLA 4YNOA 1P2AA 4UWYA 1PMNA 4AFJA 4ITJA 4KKHA 4H3BA 3A7FA 5DNRA 2W4KA 4RQVA 2QHNA 3QQFA 5EW3A 4BCGA 3EQIA 3ZO2A 1U46A 2IWIA 3BWJA 5GZAA 4EK8A 3ORPA 2FYSA 1U4DA 4IB1A 4MHAA 2YIWA 2F49A 3P08A 4OTFA 5EM8A 4E6CA 2CLXA 5IISA 3VIDA 5CI6A 1JQHA 4BTJA 2OF2A 4O91A 1JKKA 4XV2A 3K2LA 4BHNA 4Y5QA 4AOTA 4FG7A 4KKEA 4J1RA 4GVAA 1U54B 5AJQA 5A4CA 1FVVA 1K9AA 4H3QA 5FM2A 4ID7A 3FLNC 3KC3A 4ZLYA 3OW4A 3BYOA 3VRYA 4L3LA 4IIRA 3FSKA 2C6EA 3GI3A 4WG5A 3RHKA 3AC1A 4A4OA 2X8EA 4RJ8A 2ZV9A 4PTGA 4DHFA 3G0FA 4J7BA 2VX3A 1YXUA 3MH0A 3UIXA 4AZEA 4CT2A 1BMKA 5DRDA 4DFLA 3EQDA 2WMSA 3QYZA 1M7NA 3FY0A 4DGNA 3LPBA 1GNGA 3PJ1A 5CNOA 4L42A 5H8EA 5LOHA 3U9CA 3HDNA 3EIDA 5FWKK 3R8ZA 3LLAA 1V0BA 3BHVA 4RT7A 4LOPA 4MH7A 4PDSA 3KQ7A 5GNKA 4BYIA 5C8NA 3I6WA 3PRFA 3I7CA 3UYTA 4F6SA 3TM0A 4QMPA 4EH2A 3TJDA 4O0SA 4TWPA 2UVXA 4C4HA 1SZMA 3VN9A 2GNLA 3DKGA 1FMKA 3C4EA 3DQWA 3QCYA 4K11A 5GJGA 2XIXA 5JZNA 4DG3E 4QMMA 1GIIA 2VWVA 3BQRA 2KTYA 1GJOA 4JDJA 5G6VA 3MWUA 4ALVA 1H27A 5J9LA 5G1XA 2FH9A 4ACMA 4C4GA 2WMUA 4WSQA 2QVSE 4YTIA 1LP4A 1SMHA 4L46A 1YRPA 4NZWB 5KZ0A 1FVTA 2DUVA 2GS6A 5BMMA 3C4WA 4FYNA 1HCLA 2ETRA 2YABA 4C4IA 4I6FA 3PG3A 4M97A 2VGOA 4DFXE 5AV0A 4N4SA 4ASZA 4APCA 3IO7A 2B52A 4HYIA 1PHKA 4ZLZA 2J90A 1NY3A 5TE0A 3PRIA 4RQKA 3AGLA 3P79A 2WMWA 3QQUA 1T45A 3U6IA 2XKEA 4K1BA 4CKIA 4ZZNA 2PVYA 1VR2A 2IZUA 4QTCA 5IG1A 2WMQA 5CSHA 2XNPA 5EW8A 5JT2A 3AMYA 4GMYA 1G5SA 4AA0A 4ZIMA 3MVHA 3FMDA 2BCJA 3F3WA 5CEMA 3CEKA 5DBXA 5K5XA 4IAKA 4ONAA 4ZSGA 2ZV7A 3GU6A 4G31A 4YLKA 2IW6A 4ITHA 3ZONA 2OIQA 3EFWA 2VWUA 4P2KA 3QX2A 3TZ8A 1APME 2VAGA 2W5BA 3BE9A 3DXNA 1KE9A 5FDPA 3TNIA 4ZZMA 3QZFA 4RVKA 4I5HA 4QQCA 2H6DA 3FZTA 3MIAA 5J8IA 3CKXA 4XP2A 4J52A 1O6LA 4GU6A 2VTAA 3LE6A 3P9JA 4MNFA 3TIYA 5LQFA 3FLZA 2BFYA 1RDQE 1OL6A 3PIXA 4DFNA 4NM3A 3LHJA 3SOAA 4EJNA 4A4XA 3QL8A 4F9WA 4BTMA 3FMJA 4LMUA 1BI7A 2PE2A 4FSZA 3WF9A 2YACA 3NMUF 5HIEA 4ZS0A 4A9TA 3G15A 2WMRA 4FIEA 4QYYA 3GOKA 4F7SA 3TZ7A 4B7TA 5HHWA 1Q8TA 2WU7A 2XS0A 4G3FA 3KL8A 4JBQA 3IW7A 4NKAA 4GFGA 1H0VA 3QXPA 5ANJA 3AC4A 3KVXA 3E93A 5JEBA 2Z7QA 2WAJA 1PKDA 2HWOA 3RWQA 4FSNA 3ZLYA 5F95A 3ZXTA 3NDMA 4BCNA 1H8FA 4YLLA 4YHJA 4NTTA 4F1OA 4FTRA 1I44A 5J5SA 1BL6A 3PTGA 2B1PA 3D2IA 1H1RA 3H3CA 3OCGA 5AUVA 4L68A 1H24A 4GG5A 4X3FA 3T9TA 3FZSA 4FT7A 3FC2A 3GGFA 4HYUA 2W96B 3O2MA 4M14A 4PP9A 3UPXA 3R7EA 3WZEA 3R2BA 4UYAA 2BUJA 3EQFA 2B55A 3D5XA 5AX9A 3ROCA 2QODA 4AF3A 2DWBA 3HP2A 2PVKA 3OCBA 4QRCA 4AW1A 2ITWA 2HK5A 2R3IA 3Q6WA 5IKWA 4DH1A 2V7AA 3MYGA 5JK3A 4DFZE 3VS1A 5E92A 3SC1A 4BWKA 4RFYA 3GQLA 4I41A 4X3FC 5IA5A 1XKKA 2Y9QA 3G33A 2XK8A 4FTOA 4E6DA 1H0WA 1VYWA 3OP5A 3BHHA 4RC2A 2QO7A 4BGGA 2PTKA 4JDKA 5TT7A 1MRVA 2YIQA 1YKRA 4FSRA 1PF8A 3POOA 1XWSA 2O64A 3WARA 4E4NA 3TCPA 2WHBA 3QRUA 4F0GA 2ZDTA 4ANBA 4RX9A 1AQ1A 4PL4A 1YDTE 3KXGA 3OWPA 1IG1A 4FV1A 4F09A 3HA6A 4FZDB 3ZDIA 2QU5A 3COKA 3VWAA 2FSOX 2R5TA 3QZHA 2JDOA 2BALA 4RZVA 4E5AX 1WVXA 1NVRA 2BFXA 2VTJA 2E9PA 2BZJA 4A4LA 5HBJA 4GK4A 4R8QA 4XLVA 3R8MA 4DINA 5L2TA 3E8CA 4MD7E 3PLAE 3P78A 3ERKA 4D4YA 2X7OA 5IDNA 4YP8A 1L8TA 3SD0A 4DEAA 3MW1A 2JIUA 3KY2A 2BVAA 3PY3A 4KINA 3VS7A 4AZFA 4DG0E 5GJFA 4TWOA 5E8UA 3UIUA 4D5HA 5ETAA 3EL8A 3RPYA 3P7AA 3TV4A 4AN2A 4QP9A 3LCOA 5HEZA 4DGLC 3WYYA 5CLPA 4YPSA 3LCSA 3L9LA 2GDOA 3EQBA 4M69B 3VUMA 5IU2A 2ETKA 2VTMA 3GUBA 3NUNA 2VNYA 3H0ZA 2VTRA 3DB8A 5AADA 5AP6A 4AS0A 4BRXA 4LL0A 3BPRA 3TDVA 3EZVA 2YIRA 2V55A 3SW4A 4XBRA 1ZY5A 2GNIA 3OZ6A 3PYYA 5HG9A 4ANMA 2YIYA 5HTBA 4KABA 2I0VA 5HE2A 4BFMA 3ORIA 3Q6UA 2B9HA 4O1OA 3WI6A 5HU9A 3LAUA 4I5PA 2O0UA 3PA3A 2JITA 1Q4LA 4YSJA 2ITVA 4H36A 5HE0A 3W2QA 2YWVA 4HNIA 4AW2A 3NSZA 3Q52A 3U87A 2A19B 3WIKA 3ZC6A 4C0TA 2B4SB 2R3LA 3DKOA 3S2PA 4ACGA 4WD5A 4WRGA 4ANLA 3REPA 4M15A 4OBQA 4BICA 2IO6A 2X2MA 4FNZA 5C4KA 4ZS4A 3AC3A 4YO4A 1XBAA 5ETCA 1YWNA 2GU8A 1QL6A 3R1YA 2F9GA 2XK9A 4AA5A 2JDVA 3QF9A 4HVIA 4LV5A 4AXAA 4M84A 4U81A 4GS6A 4YJUA 2BAKA 2UW6A 3QYWA 1A9UA 4HVSA 4OR5A 3MH2A 3JR1A 3G9NA 2VD5A 1A06A 3N4TA 3TT0A 4DAWA 3C5UA 2PWLA 3LIJA 2W0JA 4HW7A 3C50A 3TUCA 2OO8X 1NVSA 1OL1A 3RALA 4JG7A 3IG7A 2BR1A 4B6LA 2VX1A 3RAHA 4BCMA 1JAMA 4U0IA 3V8SA 4C62A 3PA5A 3NZ0A 1OIYA 3R8LA 4H1MA 5CF8A 4R5YA 2WFYA 5AP5A 5LCJA 4WG3A 4P4CA 4JQEA 3GCUA 5HG7A 3IDCA 4IAYA 1RE8A 4PNIA 3QTZA 2YIXA 3E3BX 4TYHA 3R9DA 2UZEA 4RWKA 4XG6A 4EH5A 4BIBA 4DT8A 4Y73A 3FQEA 5AP4A 3LFCA 3B8RA 5DGZA 5AM7A 4EH6A 5HLWA 3L8XA 2YA9A 2XJ1A 3C4FA 3FPMA 4GIIA 3V01A 1SVGA 1ZOGA 3GQIA 5EG3A 3GCPA 5BQ0A 3OS3A 4GFOA 3E3PA 2XK4A 4LFIA 5LWMA 3R30A 5CXHA 2ITPA 5H8BA 4EUTA 3LKMA 1UV5A 2BZKB 2W5AA 4YJQA 3ZU7A 3S1HA 4FKQA 3UGCA 2X8IA 3OHTA 2UZDA 3IW5A 3N4VA 3MA3A 2PMLX 1O6KA 4XG9A 3A7IA 3NW7A 2QLQA 3CSVA 4JDHA 4RIWB 2ZDUA 3A61A 3NIEA 3NAYA 3Q5IA 4FG8A 1GZNA 2XKFA 3PJ2A 4XG7A 5EFQA 5J1WA 3ATSA 3HRFA 3K3JA 3V5WA 1GZOA 2BDJA 3OWJA 5M4UA 4WOVA 3RM7A 5BNJA 4AFEA 1KWPA 2GPHA 2IZRA 2UZNA 2X81A 4ZK5A 4FGRA 4I24A 2Y8OA 3ZSIA 4FG9A 4DGMA 3EKKA 4L44A 2VTHA 4M68A 3CXWA 4AE6A 4E3CA 2ZMCA 3E87A 2W99B 2PYWA 3O0GA 3IOPA 4GL9A 2PUUA 4K8AA 1H4LA 2IVVA 3TV7A 3UQFA 5I9UA 4DCAA 4MBJA 3ORLA 3VW8A 2PMNX 2UV2A 3HUBA 4EH4A 5IA0A 4D4SA 1ERKA 2EB3A 3AC8A 4FVQA 2OICA 3ULZA 3UOKA 3R21A 4CZTA 2ONLA 2BAJA 4IFCA 4WKQA 2G2IA 3DBEA 4ZSJA 4IX3A 3QC9A 3ZO4A 4KBCA 3UVRA 5DA3A 3C4ZA 2W4OA 4O6LA 4OUCA 5H2UA 2Q0BA 3MA6A 4FV3A 4QYEA 4W4WA 3VUHA 2JFLA 1XO2B 3VJOA 4J8NA 4RIOA 2QNJA 4C3PA 3BU5A 4M66A 4C37A 3DJ7A 3C51A 5DPVA 2J7TA 2IZSA 4DFBA 4JAIA 4CV9A 4WSYA 4BGQA 2W5HA 2ONLC 3LXNA 3RPSA 3FZPA 4AZTA 5CZIA 3HEGA 4GU9A 5FM3A 3UG2A 1F3MC 4YGAA 4NEUA 3W32A 4QYFA 2WMVA 3M42A 2PULA 4FK3A 4OGRA 3BHUA 2GNGA 3CIKA 2XNNA 2OXYA 4EHGA 2X2KA 4O0XA 4OW8A 3VAPA 4ZTLA 3PJ8A 2YCRA 4FKWA 4APPA 3FMLA 2ZV2A 3Q2JA 4AX8A 5IZFA 4JRVA 4NKSA 2PSQA 3DK7A 2RFDA 5H8GA 4CRSA 2OJIA 2X6DA 4TYJA 4KRDA 1W84A 3LW0A 3V5PA 4FR4A 5HG5A 4ZEGA 3C4XA 3OBJA 3UNZA 4BTKA 4OTDA 2PVNA 3H9OA 5DG5A 4U42A 4GT5A 3SOCA 3IGOA 3WF5A 3EMGA 3GC8A 4JL9A 4XX9A 5CAQA 3I1AA 5L8JA 4USEA 5CALA 1FVRA 3LCDA 1JLUE 3BEAA 3MN3A 1IASA 1XH7A 4IB3A 2J9MA 2C1AA 4LRJA 4PTEA 3R7YA 4DBXA 1FPUA 2WQNA 3HRCA 4PPCA 3S00A 4KKGA 4FKJA 5JRSA 3GT8A 2XYNA 3CTQA 2R0UA 3IKAA 2QKWB 4FYOA 4L45A 4D0XA 3SGCA 3WBLA 1UU3A 3UPZA 2VWIA 3ACJA 3QRJA 4RIXA 3RWPA 5LVLA 1KV2A 5HNGA 3EB0A 2WMAA 5FEQA 2CKPA 4J95A 4D5KA 5CASA 3PXYA 2XJ0A 3KXHA 5I4NA 3ZFYA 2HELA 1F5QA 3FE3A 4I6BA 3G6GA 2VTPA 4D28A 2RFNA 3IDBA 2QU6A 3FDNA 2C3IB 4EBVA 2Y6MA 5HTIA 3NVKI 2YAAA 2C30A 2YHVA 3EFJA 3ALOA 3KXMA 4UN0C 4BZOA 4RLLA 4JG8A 1PYXA 1L3RE 4DE4A 5EK7A 1AD5A 5M07A 3TNQB 5GIOE 2VWYA 3V04A 5BVWA 3W18A 2HZIA 5HESA 4FKLA 3RAWA 2PUPA 3QCXA 4C3FA 3F2NA 2WQOA 3L8PA 2OJ9A 2XIRA 5JFSA 2JD5A 1W7HA 2WZJA 3QTXA 3PWYA 2GHGA 1BLXA 3BBWA 1H25A 3MFUA 4QMSA 4OTRA 3R7VA 2OFUA 5JQ5A 1Q24A 1P14A 3F69A 2OZAB 3Q4ZA 2WB8A 1YW2A 2FSMX 2W1EA 4I0SA 4U40A 4H1JA 4CG9A 2WTKC 1OL2A 3NR9A 4LOQA 4YU2A 4UYNA 3BWFA 4FA2A 4BKJA 4H05A 3DCVA 2YCQA 2W1ZA 4JJRA 3L9PA 5BYYA 4C61A 3VUIA 3O8TA 3QRIA 3R1SA 2GS7A 2Y4PA 1JOWB 5CF6A 4O83A 3UIMA 4ACDA 3R8UA 4QPMA 4IB5A 3FV8A 4FTQA 4HZRA 4YJPA 3DBQA 5A4QA 4U44A 4CLIA 4S2ZA 4ANSA 4R5SA 2X7FA 2WTIA 4W8EA 3CPBA 4BI1A 4BWXA 5L2WA 3ZSGA 4EOPA 4AE9A 3OUKA 2FSLX 4GUBA 3RK9A 3QA0A 3BEGA 4AGDA 4ZY4A 5M57A 4GUEA 3LFDA 4HYSA 5CTPA 2R3FA 3QTUA 2F2UA 3TG1A 3OD6X 3UZPA 3AMBA 2GSFA 2ITOA 2EVAA 5AP2A 1YXTA 2JFMA 2YN8A 3ET7A 1UU8A 3NYNA 3SDJA 3HVCA 3VBWA 1NA7A 2XYUA 2GS2A 3GU8A 4YTHA 5AUUA 5ACKA 1LEZA 3LXLA 3OTVA 3QUPA 1P5EA 1ZMVA 3DGKA 2J2IB 1MP8A 2XEYA 2Z7LA 3BE2A 4UMPA 4FSYA 3R00A 2VWXA 3F7WA 1J3HA 2YISA 3BYVA 3G5DA 4HCTA 5HCYA 3AT2A 1KOBA 2Z7SA 5F20A 1YHVA 3MVMA 3RCJA 5ITAA 1REJA 1PMUA 3DLSA 4S32A 3VS0A 4FZ7A 1W83A 2VGPA 3A7HA 2X9EA 3G2FA 3VS2A 4IWOA 5C9CA 4ZJVA 5H9BA 1JNKA 2AUHA 4U45A 4I1ZA 3FBVA 3GOPA 4IM2A 5FDXA 4D2TA 5FXQA 2Y4IB 3ZRLA 2J0MB 4EH3A 1WAKA 2P33A 3VRZA 3DBCA 2NRUA 3NW6A 3W55A 4TL0A 2CN8A 2BTRA 3R9RA 2XA4A 3KK8A 3DV3A 5I9YA 4D9UA 4EOQA 5IQIA 3Q9YA 5A14A 4GIHA 3L9NA 4DBNA 5C4LA 2VTLA 3VW6A 1REKA 3FKOA 3JUHA 3FLSA 3DT1A 4Y95A 2OH0E 5AUZA 4RA4A 3B8QA 1GZ8A 4CYIA 4DEBA 3QZGA 4IZYA 4D1XA 4DFUA 4Y5HA 2PY3A 4PDPA 4UXQA 3EN7A 2R3QA 5ANDA 4HJOA 3FC1X 4LM5A 4X2JA 1WBNA 1GZKA 2C4GA 3V5JA 4BDIA 4AN3A 4ZMEA 3DAJA 5DRBA 2R7BA 5L4QA 4FEUA 3FI8A 1UWJA 2C0IA 4IC8A 4KB8A 2F57A 5HLPA 3WZDA 3ZO3A 4AW0A 4DEIA 5IH4A 4MNEA 3GFWA 5DFPA 2Q0NA 1JSUA 5CVGA 1VJYA 3PIZA 3MJ1A 4BDCA 4AZVA 1NXKA 5B2KA 1GOLA 1MQBA 2GTMA 2VTNA 3QWKA 3R1QA 4E4XA 5K0KA 4E6QA 3FZRA 3NRMA 2DYLA 2CLQA 4XG8A 4BIDA 2UW3A 4CVAA 1KE8A 3TV6A 4G3GA 1Y8YA 4YJVA 4BB4A 2H8HA 3WOWA 2ITXA 2F7ZE 5C8KA 1IAJA 3F3TA 5HVKA 3MVJA 5BUIA 3ZOSA 2QHMA 2W9FB 5HNBA 1Z5MA 3LJ2A 4NCTA 4RA5A 1PXPA 2B9FA 2ZM3A 5ANGA 4RBLA 3ANRA 4X3FB 1IAHA 3HA8A 1Q5KA 5E8YA 4G3CA 1JVPP 4EK5A 5HI2A 3VHKA 5CVHA 2ITNA 5E8WA 3KULA 5CF4A 1XJDA 5DHJA 3FJQE 3F5GA 4YJRA 4BTFA 3DDPA 4L01A 5CSWA 3OT3A 5A6NA 4U80A 1ZYLA 2B7AA 3VO3A 3ZSHA 3S4QA 4DEDA 3FXZA 5J9YA 4CQGA 4IZ5A 4FNYA 4D58A 3G51A 1ZYJA 2ETMA 3IQ7A 3UZTA 5HU3A 2RIOA 3GNIB 3HZTA 4Q5HA 4F08A 5ANOA 4QMYA 2OGVA 3A99A 3MSSA 3R6XA 4EK6A 3SG9A 2JDSA 4OT5A 5AIRA 4QMNA 3WZUA 5HLNA 5EI8A 3NUAA 2J0LA 1GIJA 3DFAA 3T9IA 4FEWA 2F7EE 4TYEA 4NIFA 4I6HA 3KXNA 5EKNA 4EK3A 1BL7A 2BILB 2X6EA 3GB2A 4O21A 4Q9SA 5E1SA 4BIEA 4QO9A 5CSXA 1U5QA 5F9EA 3OMVA 4OBPA 5A46A 4LI5A 4CSVA 4AGUA 2R3RA 5IEVA 3QTIA 4YLJA 5AV3A 3VF8A 4M3QA 3ZFXA 2QCSA 1PY5A 5AEPA 1PRYA 5AR7A 4KS7A 3FUPA 4O84A 5CI7A 4AU8A 1AGWA 3C13A 4DLIA 3FMEA 4F0FA 4FTJA 3AG9A 4QTDA 3WYXA 5C01A 3QHWA 1ZWSA 2BHEA 4DC2A 4QNAA 1J91A 2RKUA 4DEGA 4ZTMA 4DA5A 4CV8A 1ZYDA 3E7VA 5AR4A 4QPAA 4A9SA 4CT1A 2GQSA 3WF6A 1FQ1B 5EHYA 2P2IA 5J1VA 5AAEA 5J5TA 2E2BA 5CU3A 2LGCA 5AR3A 3SAYA 4GRBA 1XBBA 3LXPA 4L00A 4YZBA 5IUHA 5AIKA 5HOAA 4MEDA 2PZIA 1R0PA 1FGKA 3EH9A 1KE7A 4Y8DA 3JY0A 3ZC5A 4WNKA 4L52A 5HO7A 2J51A 3ELJA 2C6IA 5EM7A 3ITZA 3MV5A 4WHZA 3ZM9A 3CGFA 3NLBA 4YTCA 2IN6A 2JLDA 1HOWA 3KCFA 4O96A 5I9XA 1YHSA 3UQCA 4HZSA 2C5VA 4N70A 5EOLA 4FGBA 4E5BA 1GIHA 2G15A 3ZH8A 4IJPA 1UU9A 2WTJA 4PDOA 2C6TA 4Y83A 4MK0A 4RC4A 2GNFA 3DNDA 2VNWA 3BELA 2CMWA 4RJ5A 3TN8A 2YAKA 3QTRA 1SVEA 2A4LA 5IQDA 2XNGA 1YQJA 4H58A 3IK3A 3W16A 4JR7A 2EU9A 4RWIA 1XH4A 2VWWA 4IM0A 2Q83A 4FT9A 1Z9XA 4FKVA 1FOTA 4HGLA 2XJ2A 4JG6A 5KUPA 4FV6A 2I0HA 3HECA 4HCVA 2UZTA 5I5ZA 4FKPA 2JBOA 1KOAA 3A7JA 4DH8A 3KRXA 4PMTA 4U7ZA 1NW1A 4CMOA 2HW7A 2VWZA 4YSMA 3OVVA 4D1ZA 2R3JA 3AD4A 4IX5A 3R73A 5A4EA 4CZYB 3WZKA 1UU7A 1WFCA 4OAUC 3OROA 1IA8A 3RI1A 1J7IA 4KIQA 4IAZA 4C4JA 3LOKA 1PXIA 4NTSA 4CCBA 3A4PA 3S95A 3HLLA 5IF1A 4W4VA 3Q4UA 4EOMA 1BX6A 4MAOA 5LWNA 1ZZLA 2X4ZA 5HBHA 4ORKA 3R1NA 5AMNA 1K3AA 3HV4A 3UO5A 3A8WA 3NX8A 4JXFA 3F88A 4AQCA 3HYHA 2CSNA 2C0TA 5CU2A 2UZOA 3Q2MA 3ULIA 4DT9A 4M8TA 3K5UA 4PUZA 5JGAA 2I7QA 4KD1A 4ZSEA 3VUGA 3EL7A 1Z57A 3KF7A 2ITQA 3ODZX 3ORTA 3ZO1A 5I9WA 4OTGA 1DAYA 3RNIA 3DBFA 4ANQA 4YBKA 2BRBA 3SXFA 2CGUA 2VN9A 4NJ3A 4GV1A 4NM7A 4YJSA 5DLSA 4TYHB 3FI3A 4TRLA 3QX4A 3RTPA 4OTWA 1UVRA 3FPQA 3Q96A 2PK9A 4IAIA 5DT0A 2HZNA 3CGOA 2WMTA 3PPKA 3OTUA 4EUUA 1Y91A 2Y7JA 4EZ3A 5CQUA 2R3MA 3BRBA 2WTDA 5D1JA 2XBAA 2PZYA 3DFCB 4LRMA 4DF3A 4W4YA 4E73A 2QURA 3NNWA 4A07A 2XUUA 2QC6A 3BLHA 4PP7A 2YM6A 3EN9A 3F2AA 1ND4A 1PXOA 3CJFA 3KRWA 5JGDA 3LMHA 2XRWA 2OLCA 3RPVA 2HCKA 3VF9A 3FZ1A 1YWVA 4FIIA 1FINA 4XP3A 4D4VA 5IMEA 5JFWA 1LPUA 5E8TA 4ZSAA 3D5WA 5E8XA 4LG4A 1WBWA 1YI4A 2FSTX 5DWRA 5KKRB 4G3EA 4WA9A 4YO6A 4B9DA 4OTPA 3D0EA 3BHTA 3F61A 4FVRA 4PRJA 2XIKA 3RMFA 4RJ3A 3RZFA 3O71A 5A4LA 2AC5A 2Y0AA 2ZJWA 3E8EA 4O2PA 2OG8A 4QP3A 4QP2A 3R7UA 5AFVA 3ZCLA 1Q99A 4L3JA 2VO6A 4DH5A 3QTSA 4IWPA 4PPBA 3OF0A 4U97A 5B0XA 3SRVA 3L8VA 3ZLSA 4UX9A 4PMPA 3QUEA 2BRMA 4EOLA 3AD6A 1WBTA 2RFSA 3E8DA 4NUSA 4PQNA 1U54A 4UWBA 3V5TA 5CSPA 2WGJA 4W4XA 4BCQA 4HGEA 4IZAA 2IVTA 3MI9A 3UMWA 5K4IA 4F6UA 3OWKA 4FKIA 3SQQA 3ORNA 3V8WA 4CFWA 5M06A 2C3KA 4CZUA 3A4OX 4I4FA 3ZZEA 3UZRA 4ASDA 4I93A 3QWJA 4RRVA 4S31A 5AV2A 2JGZA 3PP1A 4DGGA 3BI6A 3U54A 1YOJA 2JKQA 2ZM4A 2G9XA 1B39A 3QTWA 3RGFA 1NVQA 2WOTA 4JBVA 1PXJA 4ANNA 2BIYA 1PXNA 5CS6A 3D2KA 5FBNC 2C3LA 4XG2A 2VWBA 3EN5A 4AGWA 3ZTXA 3GCSA 5BYZA 1WVWA 2QG5A 5FP5A 4D9TA 4O7RA 3O8PA 5EYDA 4AGCA 5AV4A 1YDRE 2BDFA 2UW7A 4AW5A 5AP0A 3TACA 4UY9A 3FQSA 4S30A 5LARA 3VBXA 4CCUA 4E7WA 1SNXA 4IANA 1Q62A 1QMZA 2O65A 2WNTA 4XG4A 2CGVA 1QPCA 1DI8A 4MWHA 3HMPA 2CKQA 4MKCA 4S33A 5IH6A 4IFGA 2WQBA 4FEVA 3TTIA 3KB7A 5EDRA 1OB3A 3DU8A 4NFMA 1SNUA 3RINA 2WTCA 2XRUA 3BLQA 4IM3A 4FBXA 5GZ9A 1G3NA 4FZ6A 5CAVA 3F5XA 3QKMA 4IXPA 3UOLA 4M0YA 3BHYA 4ACHA 4BDBA 1JWHA 4NU1A 2WD1A 5TR6A 3QC4A 3HMOA 2GQGA 3V5LA 5BVNA 4NM5A 4F0IA 2JIIA 3HUCA 4N6YA 3EFKA 4K2RA 1O9UA 3UDBA 2A1AB 3Q5ZA 4TZRA 4H39A 3D4QA 2XKCA 3QZIA 3BU3A 4FSWA 4GJ3A 2C5NA 3CBLA 3W10A 4GW8A 5TOZA 3A8XA 4DEHA 5IQFA 4IJ9A 4I0TA 5EI2A 5HE1A 3EQGA 3CY3A 2QO2A 1YVJA 4RIXB 2J5FA 4KIKA 4W8DA 4FV5A 5JN2A 5KNJA 3KEXA 5AAFA 4HVGA 3OT8A 4IW0A 4M7IA 3TL8A 1OIQA 3KRRA 2F4JA 4O7WA 4FTAA 4YTFA 4IDVA 2YM3A 1IR3A 2XK7A 3TTJA 3COMA 3KU2A 4MQ1A 3V6SA 3PVGA 4JLCA 3RVGA 2IJMA 3U55A 1XH9A 3HMIA 4UB7A 2QR7A 4IH8A 3GXLA 4UXLA 4L7FA 3DNEA 2CCIA 3DPKA 3ZEWA 3CR0A 3FMKA 2B53A 4E93A 4AOJA 1U59A 4BDJA 4F70A 3ZLWA 5LMKA 1JPAA 4BI2A 4A06A 2W1HA 3PXKA 4LRKA 4E4MA 3IONA 3AOXA 1OITA 3DOGA 1ZXEA 5KHWA 5CZHA 4TNBA 3BGPA 3ZRMA 3KREA 3CJGA 3CY2A 3VQUA 2IZTA 3KF4A 4DITA 3GENA 4USDA 4A9YA 4D2PA 4PNKA 2VO3A 2HXLA 2VV9A 4HNFA 5J7HA 1URCA 3BV2A 1W98A 4XV1A 2BPMA 5LMKC 1VYZA 4F4PA 3SX9A 4XOZA 3VULA 2EXEA 4IAFA 1M2QA 4O1PA 2HXQA 3F3ZA 2EXCX 2QKRA 4QP6A 3PVWA 4MD8E 5BVOA 4LL5A 3C7QA 2B9IA 2YM5A 3LVPA 1IRKA 2J4ZA 4U9AA 4DG2E 4F9BA 5DI1A 4LOOA 5CF5A 2ACXA 5HIBA 2R64A 5FEDA 1VEBA 3Q60A 1YDSE 5AX3A 3HMNA 4DEEA 1Q97A 2XH5A 3ID6C 2YDIA 3LFAA 1Q41A 4IBMA 4OTQA 4WG4A 3VVHA 4EH9A 2XCHA 4RGJA 4TT7A 4BKYA 5E1EA 5GZ8A 4R7HA 3DQXA 2C6MA 2PMIA 3MS9A 2UUEA 1JBPE 4L43A 4M67A 5F1ZA 4AAAA 1E1XA 2QI8A 3P5KA 4AA4A 4UV0A 3LM5A 2OF4A 4F9AA 4Z7HA 3TUDA 4C7TA 3JS2A 2R2PA 3KRLA 4J99A 4BC6A 5IA3A 3BLRA 2HY81 4DYMA 4MF1A 2ITTA 4LMNA 4CKJA 4C58A 3SVVA 2C6LA 3DXPA 5TO8A 1LEWA 4FTIA 4ZP5A 3L8SA 3PXRA 4L3PA 4O0UA 4RWJA 4CKRA 2PU8A 1BKXA 3B2TA 3EN4A 1M7QA 4QYHA 3VNTA 5CEPA 1J1CA 3GP0A 4JT3A 3JYAA 4TTHB 5HGIA 3HL7A 3JVRA 3OXIA 3LQ3A 4NH1A 2BMCA 3FMMA 4FSUA 1BUHA 4IVDA 4YHTA 3MPTA 3LJ0A 4ZOGA 4ASXA 2ITZA 1SYKA 1FMOE 1H1SA 4IQ6A 3ZBFA 3ZZWA 3U9NA 3MFSA 3EJ1A 1FGIA 2VO0A 4BDDA 3WZJA 1KE6A 1BYGA 3UJGA 1M14A 2V0DA 2OXDA 5AUTA 2QLUA 4JX7A 1PXMA 1H08A 4OLIA 1ZYCA 4ITIA 5DT3A 4C59A 5JQ8A 5LMBA 5M56A 3VBTA 2W4JA 2X0GA 4PWNA 3W33A 3F5PA 4XNEA 3FI4A 3ODYX 5LVPA 4JIKA 4BHZA 1UNLA 4DTKA 4QMQA 3V51A 2QO9A 3COHA 3KXXA 5CEKA 3I6UA 4D2SA 2X4FA 4P90A 3M2WA 4DGOA 4KNBA 4I0RA 3E88A 4J97A 4MXYA 1YXXA 4FV2A 5E8ZA 5EQPA 4RLKA 2PVHA 3UVPA 1H1PA 5ANEA 5CXZA 4R1YA 4M69A 1ZLTA 2J0JA 3MY0A 5BVKA 4L9IA 4CTCA 3Q4TA 4O7SA 2Z60A 4ZJJA 4BZDA 3HGKA 3JY9A 3VHEA 5L2IA 3IS5A 1GAGA 3FI2A 2YZAA 2WIPA 3LJ1A 3WIGA 4DCEA 2BHHA 2CNUA 2NO3A 2ERKA 2WKMA 4I3ZA 4L67A 4LUEA 2XIYA 3D7TA 3I0OA 5CEIA 1EH4A 4GKHA 3BKBA 4MNEB 2OK1A 3IOKA 3PJCA 3LQ5A 2HENA 3CE3A 4L8MA 4DLJA 3H4JA 5CT0A 2XIZA 2YLFA 5EDPA 4FZAB 2CKOA 2E9VA 3MTFA 5FRIA 1Y6AA 3OXTA 1YI6A 1QPEA 3C5IA 3N51A 1DI9A 4FT5A 1ZZ2A 4PMMA 4XYFA 2G01A 5CY3A 3W8QA 4FV4A 5J7BA 5H3QA 4FF8A 2UZVA 3JVSA 1MRYA 4NM0A 3MPMA 3R8PA 3D15A 4V05A 5A3XA 3UP7A 3E5AA 4KWPA 4AT5A 2QG7A 3ALNA 2VTIA 4BZNA 5IQGA 3PY0A 3NYOA 4QMZA 3RZBA 4FI1A 5CT7A 5IDPA 3UO6A 4EZ7A 2I1MA 4O7LA 3QQJA 3BCEA 5FTGA 1PYEA 3DKCA 4FSQA 2XK3A 4JBOA 3UC4A 4BWPA 3SG8A 3FL4A 4UEUA 3E92A 3HRBA 2VTOA 2W1CA 3MPAA 3NS9A 3TNWA 4UMQA 4NL0A 3P7CA 5AR8A 4ZTQA 4MXAA 4TYIA 3D5VA 2JKKA 4FKGA 4HYHA 3OW3A 3QD0A 2XM9A 5HG8A 4HVHA 1URWA 3OY3A 4FSTA 2IVUA 2J50A 4LQMA 3I0QA 4X21A 5IQCA 3THBA 3MB7A 4XEYA 4BR3A 2W05A 1R3CA 4RJ7A 3LFEA 3AXWA 3LLTA 4RZWA 4WBBB 3HX4A 2UW9A 3R0TA 4A7CA 4FMQA 5CQWA 3H0YA 3KFAA 3TI1A 1S9IA 3ANQA 3EOCA 2ITUA 3C1XA 2W1DA 3DS6A 4Z7GA 4UALA 2VTQA 3BYUA 2ITYA 4FE2A 2ZM1A 2W06A 1WVYA 3RK5A 2I6LA 5CX9A 2LAVA 2R7IA 4WNPA 3NCGA 1OKYA 3QD3A 4ZY6A 4ZY5A 3OXZA 3ZXZA 4LUDA 1DS5A 4MF0A 4EOJA 2I0YA 4NJDA 4Y72A 3RPRA 4CYJA 2O5KA 4I6QA 2QOLA 4ZLOA 5DIAA 3GFEA 5DR6A 4CXAA 5D7AA 3VBQA 4JR3A 3IDPA 5TKDA 2R9SA 3Q9ZA 5EHLA 2GFSA 3PG1A 1CDKA 2W17A 2HAKA 4ZTNA 5HORA 4FTCA 5BYLA 1XH8A 1JSVA 3NUYA 4UZDA 4NT4A 4OT6A 5AUWA 3RCDA 4RX8A 4OAVB 4IC7A 1ZMUA 5FQDC 3OY1A 1CKJA 2P2HA 2X1NA 2UZWE 4N6ZA 4QPSA 3ETAA 4RWLA 3MJ2A 5T3QA 5HICA 5GJDA 5CEQA 1YOMA 3NWWA 3SV0A 5AP3A 1RQQA 3SKCA 3UYSA 3DTCA 4X2GA 5KBQA 4EYJA 3O51A 5CU4A 3TKIA 4RIWA 3EFLA 4BGHA 2H9VA 4J8MA 3DBDA 4XH6A 4YHFA 3LFFA 3FZOA 5HX8A 4XLIA 3POZA 4XCUA 1H1WA 3R04A 1J7UA 5LCKA 1FBNA 5DVRA 4GVJA 4KIPA 2PE1A 2V5QA 3DXQA 3O8UA 3S3IA 5IQHA 4BDHA 4YR8A 4ZZOA 2Y6OA 4CG8A 4RX7A 2XBJA 3FWQA 3QCQA 5FTOA 2JBPA 4CFFA 3TDWA 5EOBA 3UBDA 2R3PA 3QD4A 4IB0A 2OSCA 1H26A 3UIBA 5A4TA 1QCFA 4TW9A 1ZYSA 2IVSA 5CANA 5GIPE 3CD8A 5HBEA 4GSBA 4IACA 2XCKA 3V5QA 4KA3A 2BKZA 3DAEA 4AWIA 3FEGA 3QGWA 3HDMA 2I0EA 3RAIA 4FKUA 5CAPA 1T46A 2HW6A 4RIYA 2R3HA 4C57A 3OCSA 1OM1A 3RPOA 1V1KA 2C5YA 4D55A 3O96A 5C03A 3DK3A 5IUIA 3UG1A 3R7OA 1PW2A 4CFUA 2QD9A 1MQ4A 3NYXA 5KMNA 2REIA 3SA0A 3P86A 3BYMA 1VZOA 2QOQA 4KRCA 5HNIX 2IPXA 1RJBA 5C1QB 4X0MA 2XB7A 4X3JA 2I40A 2CGWA 3QTQA 4MXOA 1U5RA 2BTSA 4G2FA 3LMGA 4QYGA 2FO0A 5FGKA 4L6QA 4F7LA 4YNEA 2HZ4A 4QQTA 2BKKA 4MCVA 4FTLA 3I79A 5IQEA 4U43A 3IW6A 4R3PA 1SVHA 1XR1A 2CGXA 3I5ZA 4V0GA 5AAGA 3CP9A 1W0XC 1CKPA 2R3GA 4C36A 3F3UA 3P0MA 1OGUA 1XH5A 4M13A 4B99A 4R78A 4C4EA 4U41A 3A62A 4CFXA 3R8VA 3H30A 3ORZA 3MB6A 4YUQA 1MRUA 4MD9E 4FV9A 1CKIA 4IADA 3AMAA 4FL3A 4JDIA 5HE3A 4AT4A 3L9MA 1Y57A 2P0CA 4PY1A 2G1TA 4OTIA 4H3PA 3DJ6A 4RJ4A 3MFTA 2XP2A 2W1IA 3PFQA 3W2RA 4F9YA 1Y8GA 4FC0A 4IEBA 5J95A 4PMSA 3NGAA 4J53A 5I9ZA 2C5OA 4P5QA 4AUAA 3LCKA 3LFNA 5IEXA 4O0VA 3QAME 3OEZA 2V7OA 4I5MA 4R3CA 4UZHA 5D9HA 4GK3A 2PUNA 3TNPC 3K54A 2V62A 4LYNA 4EBWA 4QTEA 2A27A 5IUGA 4K9YA 3SXRA 1R1WA 3DJ5A 4LV8A 4RC3A 4MWIA 1HCKA 4GEOA 4PF4A 5LXMA 4NCTC 4G16A 1UWHA 4BF2A 5AV1A 4O0RA 5LMAA 4ANOA 3BV3A 1Q8YA 3EHAA 3NEWA 4CMTA 4ENXA 5EQYA 2ZB1A 4BCIA 3MESA 4D2WA 3K5VA 2YCFA 3R2YA 2SRCA 1V0PA 3QGYA 5ANIA 3P1AA 3RJCA 2C6OA 4JBPA 2YJRA 3KN5A 4JQ8A 4USFA 2WPAA 4XP0A 2PVJA 4EWHA 4F6WA 2QR8A 1KE5A 5B2MA 1W82A 3QHRA 5ETIA 2YITA 1DM2A 1M2RA 4MVFA 4Q2AA 5HCXA 1XQZA 5CWZA 4BCPA 4HPUE 3F7ZA 3ORXA 3MTLA 2YZLA 4YZCA 4A9UA 4MXCA 5M4FA 1UKIA 2P55A 5E8VA 5DH3A 4D4RA 4QD6A 4N0SA 4CTBA 5L8LA 3AT3A 1P4FA 5CVFA 4RG0A 1Q3WA 3E7OA 3QBNA 3SRVB 3R63A 3QKLA 5ANKA 3FYJX 3EYHA 4X6QC 5HVJA 3PPZA 4Y85A 5KO1A 3VC4A 4K33A 3COIA 4JI9A 3PE1A 1M17A 4GJ2A 4JRNA 2OZAA 4WIHA 5E91A 4O22A 4ENYA 2Z02A 4DTBA 2OFVA 2OIBA 2WXVA 4GCJA 2F2CB 3O7LD 2G2HA 3O7LB 3VS3A 3ZDUA 4J96A 4J98A 4AN9A 4XRLA 5BVEA 2UW0A 3A60A 4RVMA 4FVPA 4WBOA 4AZSA 1STCE 2UW8A 2C5XA 5D11A 3SLSA 1OKWA 3CCNA 4FL1A 3ACKA 4U8ZA 3UTOA 3T8OA 3PDTA 1PMVA 5CSVA 4CEGA 5L2SA 4KS8A 4G34A 3LFQA 1XBCA 3I4BA 4X7QA 2C6KA 3M1SA 3U4WA 1TVOA 2BDWA 2PVLA 4AG8A 1YXVA 3E8NA 4FKTA 4EZ5A 5HO6A 5KCVA 4O7ZA 4ZMFA 2R3OA 4ZTHA 4EC9A 4IMYA 3HMMA 4MX9A 3T3VA 4U3ZA 3LQ8A 4MQ2A 3CQUA 3F2RA 2G2FA 2J6MA 2WTVA 1OPKA 2QOHA 3PSBA 4OTHA 4A9RA 2J5EA 5CEOA 3R01A 4NWMA 3H10A 5M09A 3KK9A 4E8AA 4DN5A 2ZYBA 1TKIA 2RG6A 4BDFA 3KGAA 5DE2A 5FBOA 3D5UA 2PHKA 2GMXA 3HV7A 2PZPA 1ZOHA 3HV6A 2JAMA 3FLQA 3T3UA 5FXSA 2XZSA 4I21A 4R3RA 3L1SA 3U6JA 2R4BA 4HOKA 4K77A 3KA0A 4U6RA 5DT4A 5EM5A 3U51A 3O23A 4AACA 4PX6A 2X2LA 1PJKA 3OCTA 4DH7A 2XF0A 4UMTA 3NYVA 5JRQA 3VJNA 3HAVA 2XM8A 3Q04A 4FODA 1IEPA 4KIKB 2HY0A 4O82A 3UQGA 1Q3DA 1K2PA 4XS2A 2A0CX 3ZUUA 1OIUA 4K6ZA 4F99A 2FVDA 3FQHA 4QMTA 4BCHA 2OBJA 1O6YA 2FA2A 4ZAUA 3VQHA 2NPQA 3NUPA 4F7NA 4FIHA 5M53A 2F7XE 3UNKA 2XK6A 3CQEA 5E90A 1OBDA 4FTTA 4DH3A 3F9NA 5EDQA 4TPTA 1OBGA 2Y4IC 2PE0A 2WQMA 4ALUA 4FNXA 4C2WA 3G9LX 2O2UA 2YM8A 3D94A 3GC9A 4JS8A 4ZTRA 2WO6A 3VS6A 4ARKA 5L8KA 4JAJA 3RAKA 1WBOA 4EQCA 5BUJA 2WELA 4GYGA 3IECA 4EOOA 1S9JA 4G6LA 4O7NA 1PXKA 4B4LA 3N9XA 3MGYA 3R9HA 2JAVA 4EI4A 4V01A 5EW9A 3CD3A 4QP7A 2UZLA 3MY1A 3RHXA 5AR5A 2EB2A 3BZ3A 5C8MA 4Z55A 5IA4A 2EWAA 4NFNA 3GU5A 4QMOA 5GHVA 3CC6A 4EKLA 3EYGA 3AGMA 4C2VA 3KMWA 2WEIA 4EOIA 4MXZA 5AM6A 2YERA 3PXFA 3ENHA 2OU7A 3PWDA 4I94A 2BRGA 4E5WA 4F1MA 4RMZA 4IWDA 2GTNA 4BDAA 5JMSA 1CMKE 3EKNA 2BRNA 4MYGA 5K5NA 3CPCA 1CTPE 2XNEA 3QFVA 4I22A 2QOKA 2XEZA 4ZSLA 3IGGA 1JKLA 1JSTA 1OVEA 3GEQA 2JDRA 3Q9WA 5KMLA 2OJFE 2BRHA 5JZJA 3AT4A 4HVDA 4Z3VA 5C26A 3C9WA 4XJ0A 3MH1A 4XHKB 2KULA 2H34A 3KXZA 5JSMA 4HPTE 4W9XA 2PPQA 4M0ZA 3MVLA 1F0QA 3MBLA 2RFEA 2YM7A 3W2PA 1YHWA 2GNHA 2NP8A 5D12A 5T68A 1E1VA 4Y46A 3NUUA 4I23A 5LJJA 3I5NA 3F66A 2RL5A 3F5UA 3W2OA 4D0WA 3BU6A 4GT4A 4QQJA 4B0GA 4IVAA 2CPKE 3P23A 3BGQA 1WZYA 1WMKA 4TWNA 4RJ6A 3AD5A 3VUDA 4C38A 2YDKA 2B9JA 4QOXA 3TUBA 2NNWB 2OJJA 3ORMA 5L6PA 5DOSA 4G5JA 5DN3A 3HNGA 3GBZA 4C33A 3R9OA 3RKBA 4FIJA 2GFCA 5IH5A 5ICPA 4O86A 4U5JA 1LUFA 3DZOA 4FICA 5FUTA 3C0IA 5CU0A 2C3JA 3WE8A 1QPDA 3F6XA 3PXQA 4BY9E 2WOUA 3GCVA 5AA8A 2FGIA 3CTHA 2HIWA 4IWQA 2WIHA 3W2CA 5M4IA 4MBIA 3V6RA 4NW5A 3W2SA 4WT6A 3ROYA 5KBRA 4JNWA 4II5A 3BQCA 2GHMA 3RK7A 2GNJA 3QU0A 3QRTA 4CRLA 5FEEA 4DFYA 4HCUA 2WMXA 4IVBA 4CLJA 5K0XA 5EM6A 2YCSA 5EQEA 3EN6A 4UWCA 4CMUA 4W9WA 4N57A 1LR4A 2ZB0A 2AYPA 2PZ5A 5HKMA 3VS5A 5LVOA 2PUIA 3TEIA 4FUYA 3TNHA 3PVUA 3ZM4A 5IQBA 4RFMA 3G0EA 1Q8WA 3II5A 4YPDA 4BVUA 4EHEA 5J9ZA 2UVYA 3D7TB 4EWQA 4YZMA 3ENMA 3TKUA 3U4UA 3E64A 3C0GA 4EOSA 4BYJA 5HQ0A 1OPJA 4O27B 2PZRA 1KSWA 3OOGA 3QALE 2ERZE 4JX3A 4BDGA 3NNVA 4Z16A 2C6DA 2C1BA 3LXKA 3PSDA 3KCKA 3PUPA 3PE2A 2IG7A 4R77A 3I7BA 2BROA 3VS4A 4LGDA 3W1FA 2ZAZA 5B2LA 2YM4A 4QP8A 5J87A 3PA4A 5KMMA 3TJCA 5BX0A 4YURA 1OIRA 4FK6A 4MTAA 4FSMA 2HZ0A 2IW9A 4ASEA 4D2RA 4EORA 5I0BA 4XV9A 1P4OA 4O2ZA 5IQAA 3P7BA 3PZEA 3A2CA 4FKSA 4YC8A 5IPJA 3UP2A 1CSNA 2CJMA 4YJTA 3LMIA 5LVNA 4QT1A 2CCHA 2E9NA 3O50A 2CHLA 3S0OA 2V22A 2WEVA 2EUFB 4BBEA 1R39A 4L7SA 3KN6A 2B54A 3EQCA 3KVWA 3HKOA 4FTKA 4PL5A 4QNYA 4PV0A 4ALWA 3IW4A 3Q53A 5KMJA 3WILA 5TF9A 2QOFA 5F94A 4WUNA 3QQLA 3NUSA 3CKWA 4EL9A 3P4KA 2WTKB 5AUXA 3R9NA 3W8LA 4C4FA 4J71A 5HTCA 1OUKA 1Q61A 4O7TA 3EWHA 1ZY4A 4AP7A 5HCZA 3FMNA 4IE9A 3LM0A 5AUYA 3FXXA 5I9VA 5AP1A 4U79A 4IX4A 4O7VA 2IW8A 3TIZA 3QUDA 5T6KA 3VUTA 3DB6A 3R22A 5L2QA 4G6OA 3F3VA 4TXCA 3ZFMA 4NW6A 3FMHA 4G9CA 5L3AA 1I09A 1R78A 4QP4A 5ETFA 1BI8A 4FV8A 2PVFA 3FKNA 2OZOA 4G5PA 4EQUA 5FLFA 1YI3A 5L6OA 4ERKA 4RVLA 3QLGA 3ZRKA 3H9FA 2QOCA 5K3YA 3AC2A 4NYEA 5HO8A 3DZQA 4IHPA 3KKVA 5FXRA 5IA1A 4QQ5A 2R0IA 3FL5A 3Q3BA 3NNXA 3DTWA 3N4UA 4X6RA 4UBAA 4L53A 2VU3A 3GVUA 3HP5A 3QQHA 4E6AA 1SM2A 4EJ7A 1PKGA 4M12A 4EH7A 4WNOA 2X7GA 5M51A 5J79A 3ZHPC 2C0OA 2VRXA 4FTMA 3SXSA 3QD2B 4E4LA 4AT3A 3PIYA 3E63A 4AOIA 1WCCA 3GC0A 5KMIA 1OZ1A 4GH2A 2YWPA 4RFZA 4F65A 2HOGA 1H28A 5LVMA 4FIFA 4YZ9A 4HGTA 1JKTA 2W1GA 4YJNA 5EYCA 4Q9ZA 1H00A 5D41A 2E9UA 5BVDA 2A2AA 5CAOA 2YEXA 3ZLXA 2WTWA 4FL2A 4C3RA 2R3KA 3FHIA 4KSPA 4EH8A 5JGBA 1UKHA 3VBYA 2JC6A 3FKLA 4B8MA 3UC3A 5CNNA 4ACCA 4BL1A 5JKGA 2XNOA 2UW5A 4BBMA 4QMWA 1IA9A 2UZBA 3UNJA 3EQHA 4X2KA 4K0YA 4WUAA 5DR2A 5KHXA 3PJ3A 3D83A 5M44A 3LCTA 5CU6A 4EHVA 4YMJA 3MDYA 3R71A 4CFVA 3FXWA 3JPVA 2CNVA 4FT0A 5AR2A 3UOHA 5KKRC 4FOBA 2PVMA 2WU6A 4RIYB 5HD4A 3OWLA 3FLYA 3I81A 3OBGA 5D7VA 3PLSA 4S34A 3PSCA 2WQEA 4FEQA 3EQRA 2Z8CA 1OECA 4IX6A 2W9ZB 5E7RA 4B8LA 3ZS5A 3WE4A 3VUKA 5DYJA 3R83A 4X2FA 4TKSA 1J1BA 4K18A 4EONA 3ZUTA 3UODA 1H1QA 4Z9LA 1TQMA 4TY1A 1M52A 5AWMA 2OWBA 3FLWA 2WMBA 4FEXA 5AP7A 3CLYA 3MFRA 3NUXA 4G1WA 4RPVA 2H96A 5I3OA 4O7YA 4F9CA 2FB8A 4GG7A 3BGZA 5A9UA 2GCDA 5KE0A 4O81A 4F64A 4G6NA 5EKOA 3UOJA 4XBUA 4PTCA 5EYMA 3ZUVA 2GQRA 3F82A 4JIAA 5BVFA 3BBTB 4V0GB 4XV3A 5CYIA 5B7VA 5GINE 2OI4X 2XMYA 5M08A 4KBAA 4D2VA 2FUMA 4FUXA 3BX5A
chains in the Genus database with same CATH superfamily
1WBPA 2RSVA 2VTTA 1GY3A 3RNYA 3CQWA 3BYSA 4BCOA 1UNGA 3HV5A 4FOCA 5EH0A 4EYMA 3ZBXA 5K4JA 3TWJA 4D1SA 2NRYA 2CKEA 3Q4CA 1B38A 4QP1A 3ORKA 5KMKA 5KX8A 3FAAA 3NIZA 5JFVA 2X8DA 4QMXA 4O4BB 3RM6A 4UMUA 4P7EA 2J0IA 3DKFA 3K3IA 3DLZA 4GKIA 2BAQA 4BN1A 4FZFB 4G17A 5C27A 1W8CA 4BCJA 3QKKA 4JQ7A 4R1VA 5EHOA 4C34A 3IPHA 3HAMA 2XALA 3A7GA 3LZBA 1Q8UA 2QOOA 4XMOA 5FD2A 1B6CB 4R7IA 2PMOX 4X2NA 2RGPA 3ZMMA 3KULB 3QA8A 4I5CA 5BUEA 2C69A 4XUFA 2B0QA 4FV7A 4EEVA 3TZMA 2UVZA 3QXOA 5K9IA 5A54A 3QQKA 2BIKB 2QOIA 2QQ7A 4ERWA 2VUWA 5IA2A 3C4CA 3KMUA 4TWCA 1J7LA 2YLEA 3M11A 4O6EA 3C0HA 3NW5A 3JXWA 3FYKX 3FSFA 1NT2A 2E9OA 2OW3A 4HGSA 1A48A 1OL7A 1XH6A 3LFSA 1UNHA 1OPLA 2XNBA 3GU4A 3NPCA 3PVBA 2VX0A 4FTUA 3I60A 2OKRA 1G8AA 4NIFB 5F4NA 4FX3A 4MBLA 4CFNA 4EKKA 1X8BA 3GU7A 3GC7A 2Z7RA 3DAKA 3DK6A 4I4EA 3UVQA 4EK4A 3D7ZA 3AQVA 4MXXA 4XG3A 4BKZA 2CNQA 4TN6A 3RP9A 4QEBA 4E26A 1PXLA 1YOLA 3ZEPA 5DEYA 2C68A 1OMWA 4U3YA 3QCSA 2JKOA 3ZYAA 1UA2A 4NK9A 4P5ZA 3RBWA 5CENA 5HVYA 5KZIA 5E4HA 1ZMWA 5ACBC 3QLFA 3WF8A 2X9FA 3U6HA 1Y6BA 2DQ7X 2JKMA 2J0KA 4YZNA 3PXZA 3PP0A 2VZ6A 2BZHB 2OH4A 3DA6A 4FV0A 1G8SA 3PUFC 4IAAA 1CM8A 4EC8A 3OG7A 4I20A 2ZMDA 5DR9A 4KAOA 4ZTSA 3UO4A 4EOKA 4F63A 4PL3A 4GFMA 5HZNA 4FTNA 5A6OA 3NNUA 3QQGA 4GYIA 5JFXA 4YJOA 1H07A 3H9RA 2OJGA 1QPJA 4CD0A 2PVRA 1MUOA 2PL0A 1ZRZA 4XRJA 5KMOA 2YJSA 1PMEA 4C8BA 1YWRA 3Q32A 3MH3A 3NAXA 5HIDA 5IMXA 4FIGA 4TYGA 2XANA 3W0MA 1JKSA 5FTQA 4G3DA 4FKRA 4KBKA 5AA9A 2HYYA 4YC6A 2CDZA 4IDTA 3VBVA 4YZDA 4UMRA 2X39A 4O0WA 3LFBA 2JDTA 1WBVA 3MIYA 4QMUA 4PPAA 3HV3A 4O4EA 4YC3A 3NVMB 1OL5A 1ZARA 3D9VA 1OI9A 2ZOQA 2ZV8A 1M2PA 2ESMA 2JEDA 4QMVA 4BCKA 1E9HA 3OC1A 5JH6A 2RG5A 3B2WA 3PPJA 4BI0A 4RVTA 4CGAA 2AC3A 3PY1A 3OUNB 5M4CA 2EXMA 3CTJA 5BMSA 2P4IA 2OXXA 5DEWA 5M55A 4TNDA 4JVGA 2QONA 2YFXA 3EQPA 4BDEA 5HX6A 1RW8A 5BPYA 4LGGA 4KIOA 4O0YA 4BCFA 4C35A 4WO5A 4C02A 2XNMA 3AKLA 3FHRA 4QMLA 3TZ9A 3DDQA 4FT3A 4R7BA 3Q9XA 4GT3A 3SW7A 3O17A 4FJVA 4IVCA 4DTAA 1V0OA 2DS1A 4AXFA 5E9EA 1OUYA 1OKZA 4F7JA 2VTSA 3MY5A 4ZJIA 4FKOA 1R0EA 2VO7A 1XMMA 4O38A 4QTAA 1WBSA 3NCZA 5E8SA 1ZOEA 3UDSA 4CQEA 2O63A 2JIVA 2O8YA 2UW4A 4XOYA 1DAWA 3TXOA 5FG8A 1XHAA 1YXSA 4KSQA 4YBJA 3R7GA 4O0TA 1H01A 3QRKA 3WF7A 4OBOA 4WRSA 4G9RA 5IEYA 3G90X 3BIZA 4F1TA 2C47A 3AC5A 2XVDA 2QOBA 3D14A 3IW8A 5FP6A 3R28A 4BDKA 4Q5EA 4V04A 5D10A 1TQIA 3DY7A 3V8TA 5L6WL 4E1ZA 3GCQA 4EHZA 5HD7A 4RX5A 4PDYA 3CS9A 1Q8ZA 3UE4A 4JOAA 1OKVA 3KRJA 3TKHA 4EQMA 4AZWA 2UZUE 4IZ7A 2XKDA 3PZHA 4I92A 5EYKA 4ZXTA 3FY2A 3R02A 4BBFA 2P3GX 2W1FA 5DMZA 4CNHA 1ZAOA 5I3RA 4LGHA 2YDJA 5EI6A 3OFMA 3W0QA 1TQPA 3E62A 3KMMA 2ZVAA 3V3VA 3P5JC 2HWPA 2OIDA 3G6HA 1ATPE 2BZIB 4NSTA 4R6VA 2R3NA 3OOMA 3SHEA 3ATTA 2CN5A 3R7IA 4E20A 2W7XA 4CFMA 5CAUA 4KUJA 4GK2A 3EZRA 4WNMA 1KV1A 3OEFX 2RF9A 4QTBA 4DHZA 3UMXA 4FNWA 2Z2WA 2O3PA 4RSSA 3U8WA 1KUTA 2GHLA 4YNOA 1P2AA 4UWYA 1PMNA 4AFJA 4ITJA 4KKHA 4H3BA 3A7FA 5DNRA 1ST0A 2W4KA 4RQVA 2QHNA 3QQFA 5EW3A 4BCGA 3EQIA 3ZO2A 1U46A 2IWIA 3BWJA 5GZAA 4EK8A 3ORPA 2FYSA 1U4DA 4IB1A 4MHAA 2YIWA 2F49A 3P08A 4OTFA 5EM8A 4E6CA 2CLXA 5IISA 3VIDA 5CI6A 1JQHA 4BTJA 2OF2A 4O91A 1JKKA 4XV2A 3K2LA 4BHNA 4Y5QA 4AOTA 4FG7A 4KKEA 4J1RA 4GVAA 1U54B 5AJQA 5A4CA 1FVVA 1K9AA 4H3QA 5FM2A 4ID7A 3FLNC 3KC3A 4ZLYA 3OW4A 3BYOA 3VRYA 4L3LA 4IIRA 3FSKA 2C6EA 3GI3A 4WG5A 3RHKA 3AC1A 4A4OA 2X8EA 4RJ8A 2ZV9A 4PTGA 4DHFA 3G0FA 4J7BA 2VX3A 1YXUA 3MH0A 3UIXA 4AZEA 4CT2A 1BMKA 5DRDA 4DFLA 3EQDA 2WMSA 3QYZA 1M7NA 3FY0A 4DGNA 3LPBA 1GNGA 3PJ1A 5CNOA 4L42A 5H8EA 5LOHA 3U9CA 2X0PA 3HDNA 3EIDA 5FWKK 3R8ZA 3LLAA 1V0BA 3BHVA 4RT7A 4LOPA 4MH7A 4PDSA 3KQ7A 5GNKA 4BYIA 5C8NA 3I6WA 3PRFA 3I7CA 3UYTA 4F6SA 3TM0A 4QMPA 4EH2A 3TJDA 4O0SA 4TWPA 3ML1A 2UVXA 4C4HA 1SZMA 3VN9A 2GNLA 3DKGA 1FMKA 3C4EA 3DQWA 3QCYA 4K11A 5GJGA 2XIXA 5JZNA 4DG3E 4QMMA 1GIIA 2VWVA 3BQRA 2KTYA 1GJOA 4JDJA 5G6VA 3MWUA 4ALVA 1H27A 5J9LA 5G1XA 2FH9A 4ACMA 4C4GA 2WMUA 4WSQA 2QVSE 4YTIA 1LP4A 1SMHA 4L46A 1YRPA 4NZWB 5KZ0A 1FVTA 2DUVA 2GS6A 5BMMA 3C4WA 4FYNA 1HCLA 2ETRA 2YABA 4C4IA 4I6FA 3PG3A 4M97A 2VGOA 4DFXE 5AV0A 4N4SA 4ASZA 4APCA 3IO7A 2B52A 4HYIA 1PHKA 4ZLZA 2J90A 1NY3A 5TE0A 3PRIA 4RQKA 3AGLA 3P79A 2WMWA 3QQUA 1T45A 3U6IA 2XKEA 4K1BA 4CKIA 4ZZNA 2PVYA 1VR2A 2IZUA 4QTCA 3BL9A 5IG1A 2WMQA 5CSHA 2XNPA 5EW8A 5JT2A 3AMYA 4GMYA 1G5SA 4AA0A 4ZIMA 3MVHA 3FMDA 2BCJA 3F3WA 5CEMA 3CEKA 5DBXA 5K5XA 4IAKA 4ONAA 4ZSGA 2ZV7A 3GU6A 4G31A 4YLKA 2IW6A 4ITHA 3ZONA 2OIQA 3EFWA 2VWUA 4P2KA 3QX2A 3TZ8A 1APME 2VAGA 2W5BA 3BE9A 3DXNA 1KE9A 5FDPA 3TNIA 4ZZMA 4AXCA 3QZFA 2IF8A 4RVKA 4I5HA 4QQCA 2H6DA 3FZTA 3MIAA 5J8IA 3CKXA 4XP2A 4J52A 1O6LA 4GU6A 2VTAA 3LE6A 3P9JA 4MNFA 3TIYA 5LQFA 4QDVA 3FLZA 2BFYA 1RDQE 1OL6A 3PIXA 4DFNA 4NM3A 3LHJA 3SOAA 4EJNA 4A4XA 3QL8A 4F9WA 4BTMA 3FMJA 4LMUA 1BI7A 2PE2A 4FSZA 3WF9A 2YACA 3NMUF 5HIEA 4ZS0A 4A9TA 3G15A 2WMRA 4FIEA 4QYYA 3GOKA 4F7SA 3TZ7A 4B7TA 5HHWA 1Q8TA 2WU7A 2XS0A 4G3FA 3KL8A 4JBQA 3IW7A 4NKAA 4GFGA 1H0VA 3QXPA 5ANJA 3AC4A 3KVXA 3E93A 5JEBA 2Z7QA 2WAJA 1PKDA 2HWOA 3RWQA 4FSNA 3ZLYA 5F95A 3ZXTA 3NDMA 4BCNA 1H8FA 4YLLA 4YHJA 4NTTA 4F1OA 4FTRA 1I44A 5J5SA 1BL6A 3PTGA 2B1PA 3D2IA 1H1RA 3H3CA 3OCGA 5AUVA 3AKKA 4L68A 1H24A 2IEWA 4GG5A 4X3FA 3T9TA 3FZSA 4FT7A 3FC2A 3GGFA 4HYUA 2W96B 3O2MA 4M14A 4PP9A 3UPXA 3R7EA 3WZEA 3R2BA 4UYAA 2BUJA 3EQFA 2B55A 3D5XA 5AX9A 3ROCA 2QODA 4AF3A 2DWBA 3HP2A 2PVKA 3OCBA 4QRCA 4AW1A 2ITWA 2HK5A 2R3IA 3Q6WA 5IKWA 4DH1A 2V7AA 3MYGA 5JK3A 2ZFYA 4DFZE 3VS1A 5E92A 3SC1A 4BWKA 4RFYA 3GQLA 4I41A 4X3FC 5IA5A 1XKKA 2Y9QA 2AQXA 2XK8A 3G33A 4FTOA 4E6DA 1H0WA 1VYWA 3OP5A 3BHHA 4RC2A 2QO7A 4BGGA 2PTKA 4JDKA 5TT7A 1MRVA 2YIQA 1VLRA 1YKRA 4FSRA 1PF8A 3POOA 1XWSA 2O64A 3WARA 4E4NA 3TCPA 2WHBA 3QRUA 4F0GA 2ZDTA 4ANBA 4RX9A 1AQ1A 4PL4A 1YDTE 3KXGA 3OWPA 1IG1A 4FV1A 4F09A 3HA6A 4FZDB 3ZDIA 2QU5A 3COKA 3VWAA 2FSOX 2R5TA 3QZHA 2JDOA 2BALA 4RZVA 4E5AX 1WVXA 1NVRA 2BFXA 2VTJA 2E9PA 2BZJA 4A4LA 5HBJA 4GK4A 4R8QA 4XLVA 3R8MA 4DINA 5L2TA 3E8CA 4MD7E 3PLAE 3P78A 3ERKA 4D4YA 2X7OA 5IDNA 4YP8A 1L8TA 3SD0A 4DEAA 3MW1A 2JIUA 3KY2A 2BVAA 3PY3A 4KINA 3VS7A 4AZFA 4DG0E 5GJFA 4TWOA 5E8UA 3UIUA 4D5HA 5ETAA 3EL8A 3RPYA 3P7AA 3TV4A 4AN2A 4QP9A 3LCOA 5HEZA 4DGLC 3WYYA 5CLPA 4YPSA 3LCSA 3L9LA 2GDOA 3EQBA 4M69B 3VUMA 5IU2A 2ETKA 2VTMA 3GUBA 3NUNA 4O4CA 2VNYA 3H0ZA 2VTRA 3DB8A 5AADA 5AP6A 4AS0A 4BRXA 4LL0A 3BPRA 3TDVA 3EZVA 2YIRA 2V55A 3SW4A 4XBRA 1ZY5A 2GNIA 3OZ6A 3PYYA 5HG9A 4ANMA 2YIYA 5HTBA 4KABA 2I0VA 5HE2A 4BFMA 3ORIA 3Q6UA 2B9HA 4O1OA 3WI6A 5HU9A 3LAUA 4I5PA 4DDIA 2O0UA 3PA3A 2JITA 1Q4LA 4YSJA 2ITVA 4H36A 5HE0A 3W2QA 2YWVA 4HNIA 4AW2A 3NSZA 3Q52A 3U87A 2A19B 3WIKA 3ZC6A 4C0TA 2B4SB 2R3LA 3DKOA 3S2PA 4ACGA 4WD5A 4WRGA 4ANLA 3REPA 4M15A 4OBQA 4BICA 2IO6A 2X2MA 4FNZA 5C4KA 4ZS4A 3AC3A 4YO4A 1XBAA 5ETCA 1YWNA 2GU8A 1QL6A 3R1YA 2F9GA 2XK9A 4AA5A 2JDVA 3QF9A 4HVIA 4LV5A 4AXAA 4M84A 4U81A 4GS6A 4YJUA 2BAKA 2UW6A 3QYWA 1A9UA 4HVSA 4OR5A 3MH2A 3JR1A 3G9NA 2VD5A 1A06A 3N4TA 3TT0A 4DAWA 3C5UA 2PWLA 3LIJA 2W0JA 4HW7A 3C50A 3TUCA 2OO8X 1NVSA 1OL1A 3RALA 4JG7A 3IG7A 2BR1A 4B6LA 2VX1A 3RAHA 4BCMA 1JAMA 4U0IA 3V8SA 4C62A 3PA5A 1XMLA 3NZ0A 1OIYA 3R8LA 4H1MA 5CF8A 4R5YA 2WFYA 5AP5A 5LCJA 4WG3A 4P4CA 4JQEA 3GCUA 5HG7A 3IDCA 4IAYA 1RE8A 4PNIA 3QTZA 2YIXA 3E3BX 4TYHA 3R9DA 2UZEA 4RWKA 4XG6A 4EH5A 4BIBA 4DT8A 4Y73A 3FQEA 5AP4A 3LFCA 3B8RA 5DGZA 5AM7A 4EH6A 5HLWA 3L8XA 2YA9A 2XJ1A 3C4FA 3FPMA 4GIIA 3V01A 1SVGA 1ZOGA 3GQIA 5EG3A 3GCPA 5BQ0A 3OS3A 4GFOA 3E3PA 2XK4A 4LFIA 5LWMA 3R30A 5CXHA 2ITPA 5H8BA 4EUTA 3LKMA 1UV5A 2BZKB 2W5AA 4YJQA 3ZU7A 3S1HA 4FKQA 3UGCA 2X8IA 3OHTA 2UZDA 3IW5A 3N4VA 3MA3A 2PMLX 1O6KA 4XG9A 3A7IA 3NW7A 2QLQA 3CSVA 3NFGB 4JDHA 4RIWB 2ZDUA 3A61A 3NIEA 3NAYA 3Q5IA 4FG8A 1GZNA 2XKFA 3PJ2A 4XG7A 5EFQA 5J1WA 3ATSA 3HRFA 3K3JA 3V5WA 1GZOA 2BDJA 3OWJA 5M4UA 4WOVA 3RM7A 5BNJA 4AFEA 1KWPA 2GPHA 2IZRA 2UZNA 2X81A 4ZK5A 4FGRA 4I24A 2Y8OA 3ZSIA 4FG9A 4DGMA 3EKKA 4QDEA 4L44A 2VTHA 4M68A 3CXWA 4AE6A 4E3CA 2ZMCA 3E87A 2W99B 2PYWA 3O0GA 3IOPA 4GL9A 2PUUA 4K8AA 1H4LA 2IVVA 3TV7A 3UQFA 5I9UA 4DCAA 4MBJA 3ORLA 3VW8A 2PMNX 2UV2A 3HUBA 4EH4A 5IA0A 4D4SA 1ERKA 2EB3A 3AC8A 4FVQA 2OICA 3ULZA 3UOKA 3R21A 4CZTA 2ONLA 2BAJA 4IFCA 4WKQA 2G2IA 3DBEA 4ZSJA 4IX3A 3QC9A 3ZO4A 4KBCA 3UVRA 5DA3A 3C4ZA 2W4OA 4O6LA 4OUCA 5H2UA 2Q0BA 3MA6A 4FV3A 4QYEA 4W4WA 3VUHA 2JFLA 1XO2B 3VJOA 4J8NA 4RIOA 2QNJA 4C3PA 3BU5A 4M66A 4C37A 3DJ7A 3C51A 5DPVA 2J7TA 2IZSA 4DFBA 4JAIA 4CV9A 4WSYA 4BGQA 2W5HA 2ONLC 3LXNA 3RPSA 3FZPA 4AZTA 3W0OA 5CZIA 3HEGA 4GU9A 5FM3A 3UG2A 1F3MC 4YGAA 4NEUA 3W32A 4QYFA 2WMVA 3M42A 2PULA 4FK3A 4OGRA 3BHUA 2GNGA 3CIKA 2XNNA 2OXYA 3W0PA 4EHGA 2X2KA 4O0XA 4OW8A 3VAPA 4ZTLA 3PJ8A 2YCRA 4FKWA 4APPA 3FMLA 2ZV2A 3Q2JA 4AX8A 5IZFA 4JRVA 4NKSA 1OGYA 2PSQA 3DK7A 2RFDA 5H8GA 4CRSA 2OJIA 2X6DA 4TYJA 4KRDA 1W84A 3LW0A 3V5PA 4FR4A 5HG5A 4ZEGA 3C4XA 3OBJA 3UNZA 4BTKA 4OTDA 2PVNA 3H9OA 5DG5A 4U42A 4GT5A 3SOCA 3IGOA 3WF5A 3EMGA 3GC8A 4JL9A 4XX9A 5CAQA 3I1AA 5L8JA 4USEA 5CALA 1FVRA 3LCDA 1JLUE 3BEAA 3MN3A 1IASA 1XH7A 4IB3A 2J9MA 2C1AA 4LRJA 4PTEA 3R7YA 4DBXA 1FPUA 2WQNA 3HRCA 4PPCA 3S00A 4KKGA 4FKJA 5JRSA 3GT8A 2XYNA 3CTQA 2R0UA 3IKAA 2QKWB 4FYOA 4L45A 4D0XA 3SGCA 3WBLA 1UU3A 3UPZA 2VWIA 3ACJA 3QRJA 4RIXA 3RWPA 4MUQA 5LVLA 1KV2A 5HNGA 3EB0A 2WMAA 5FEQA 2CKPA 4J95A 4D5KA 5CASA 3PXYA 2XJ0A 3KXHA 5I4NA 3ZFYA 2HELA 1F5QA 3FE3A 4I6BA 3G6GA 2VTPA 4D28A 2RFNA 3IDBA 2QU6A 3FDNA 2C3IB 4EBVA 2Y6MA 5HTIA 3NVKI 2YAAA 4O4DA 2C30A 2YHVA 3EFJA 3ALOA 3KXMA 4UN0C 4BZOA 4RLLA 4JG8A 1PYXA 1L3RE 4DE4A 5EK7A 1AD5A 5M07A 3TNQB 5GIOE 2VWYA 3V04A 5BVWA 3W18A 2HZIA 5HESA 4FKLA 3RAWA 2PUPA 3QCXA 4C3FA 3F2NA 2WQOA 3BLAA 3L8PA 2OJ9A 2XIRA 5JFSA 2JD5A 1W7HA 2WZJA 3QTXA 3PWYA 2GHGA 1BLXA 3BBWA 1H25A 3MFUA 4QMSA 4OTRA 3R7VA 2OFUA 5JQ5A 1Q24A 1P14A 3F69A 2OZAB 3Q4ZA 2WB8A 1YW2A 2FSMX 2W1EA 4I0SA 4U40A 4H1JA 4CG9A 2WTKC 1OL2A 3NR9A 4LOQA 4YU2A 4UYNA 3BWFA 4FA2A 4BKJA 4H05A 3DCVA 2YCQA 2W1ZA 4JJRA 3L9PA 5BYYA 4C61A 3VUIA 3O8TA 3QRIA 3R1SA 2GS7A 2Y4PA 1JOWB 5CF6A 4O83A 3UIMA 4ACDA 3R8UA 4QPMA 4IB5A 3FV8A 4FTQA 4HZRA 4YJPA 3DBQA 5A4QA 4U44A 4CLIA 4S2ZA 4ANSA 4R5SA 2X7FA 2WTIA 4W8EA 3CPBA 4BI1A 4BWXA 5L2WA 3ZSGA 4EOPA 4AE9A 3OUKA 2FSLX 4GUBA 3RK9A 3QA0A 3BEGA 4AGDA 4ZY4A 5M57A 4GUEA 3LFDA 4HYSA 5CTPA 2R3FA 3QTUA 2F2UA 3TG1A 3OD6X 3UZPA 3AMBA 2GSFA 2ITOA 2EVAA 5AP2A 1YXTA 2JFMA 2YN8A 3ET7A 1UU8A 3NYNA 3SDJA 3HVCA 3VBWA 1NA7A 2XYUA 2GS2A 3GU8A 4YTHA 5AUUA 5ACKA 1LEZA 3LXLA 3OTVA 3QUPA 1P5EA 1ZMVA 3DGKA 2J2IB 1MP8A 2XEYA 2Z7LA 3BE2A 4UMPA 4FSYA 3R00A 2VWXA 3F7WA 1J3HA 2YISA 3BYVA 3G5DA 4HCTA 5HCYA 3AT2A 1KOBA 2Z7SA 5F20A 1YHVA 3MVMA 3RCJA 5ITAA 1REJA 1PMUA 3DLSA 4S32A 3VS0A 4FZ7A 1W83A 2VGPA 3A7HA 2X9EA 3G2FA 3VS2A 4IWOA 5C9CA 4ZJVA 5H9BA 1JNKA 2AUHA 4U45A 4I1ZA 3FBVA 3GOPA 4IM2A 5FDXA 4D2TA 5FXQA 2Y4IB 3ZRLA 2J0MB 4EH3A 1WAKA 2P33A 3VRZA 3DBCA 2NRUA 3NW6A 3W55A 4TL0A 2CN8A 2BTRA 3R9RA 2XA4A 3KK8A 3DV3A 5I9YA 4D9UA 4EOQA 5IQIA 3Q9YA 5A14A 4GIHA 3L9NA 4DBNA 5C4LA 2VTLA 3VW6A 1REKA 3FKOA 3JUHA 3FLSA 3DT1A 4Y95A 2OH0E 5AUZA 4RA4A 3B8QA 1GZ8A 4CYIA 4DEBA 3QZGA 4IZYA 4D1XA 4DFUA 4Y5HA 2PY3A 4PDPA 4UXQA 3EN7A 2R3QA 5ANDA 4HJOA 3FC1X 4LM5A 4X2JA 1WBNA 1GZKA 2C4GA 3V5JA 4BDIA 4AN3A 4ZMEA 3DAJA 5DRBA 2R7BA 5L4QA 4FEUA 3FI8A 1UWJA 2C0IA 4IC8A 4KB8A 2F57A 5HLPA 3WZDA 3ZO3A 4AW0A 4DEIA 5IH4A 4MNEA 3GFWA 5DFPA 2Q0NA 1JSUA 5CVGA 1VJYA 3PIZA 3MJ1A 4BDCA 4AZVA 1NXKA 5B2KA 1GOLA 1MQBA 2GTMA 2VTNA 3QWKA 3R1QA 4E4XA 5K0KA 4E6QA 3FZRA 3NRMA 2DYLA 2CLQA 4XG8A 4BIDA 2UW3A 4CVAA 1KE8A 3TV6A 4G3GA 1Y8YA 4YJVA 4BB4A 2H8HA 3WOWA 2ITXA 2F7ZE 5C8KA 1IAJA 3F3TA 5HVKA 3MVJA 5BUIA 3ZOSA 2QHMA 2W9FB 5HNBA 1Z5MA 3LJ2A 4NCTA 4RA5A 1PXPA 2B9FA 2ZM3A 5ANGA 4RBLA 3ANRA 4X3FB 1IAHA 3HA8A 1Q5KA 5E8YA 4G3CA 1JVPP 4EK5A 5HI2A 3VHKA 5CVHA 2ITNA 5E8WA 3KULA 5CF4A 1XJDA 5DHJA 3FJQE 3F5GA 4YJRA 2X0OA 4BTFA 3DDPA 4L01A 5CSWA 4AAYA 3OT3A 5A6NA 4U80A 1ZYLA 2B7AA 3VO3A 3ZSHA 3S4QA 4DEDA 3FXZA 5J9YA 4CQGA 4IZ5A 4FNYA 4D58A 3G51A 1ZYJA 2ETMA 3IQ7A 3UZTA 5HU3A 2RIOA 3GNIB 3HZTA 4Q5HA 4F08A 5ANOA 4QMYA 2OGVA 3A99A 3MSSA 3R6XA 4EK6A 3SG9A 2JDSA 4OT5A 5AIRA 4QMNA 3WZUA 5HLNA 5EI8A 3NUAA 4O4FA 2J0LA 1GIJA 3DFAA 3T9IA 4FEWA 2F7EE 4TYEA 4NIFA 4I6HA 3KXNA 5EKNA 4EK3A 1BL7A 2BILB 2X6EA 3GB2A 4O21A 4Q9SA 5E1SA 4BIEA 4QO9A 5CSXA 1U5QA 5F9EA 3OMVA 4OBPA 5A46A 4LI5A 4F78A 4CSVA 2NYAA 4AGUA 2R3RA 5IEVA 3QTIA 4YLJA 5AV3A 3VF8A 4M3QA 3ZFXA 2QCSA 1PY5A 5AEPA 1PRYA 5AR7A 3TYKA 4KS7A 3FUPA 4O84A 5CI7A 4AU8A 1AGWA 3C13A 4DLIA 3FMEA 4F0FA 4FTJA 3AG9A 2XAOA 4QTDA 3WYXA 5C01A 3QHWA 1ZWSA 2BHEA 4DC2A 4QNAA 1J91A 2RKUA 4DEGA 4ZTMA 4DA5A 4CV8A 1ZYDA 3E7VA 5AR4A 4QPAA 4A9SA 4CT1A 2GQSA 3WF6A 1FQ1B 5EHYA 2P2IA 5J1VA 5AAEA 5J5TA 2E2BA 5CU3A 2LGCA 5AR3A 3SAYA 4GRBA 1XBBA 3LXPA 4L00A 4YZBA 5IUHA 5AIKA 5HOAA 4MEDA 2PZIA 1R0PA 1FGKA 3EH9A 1KE7A 4Y8DA 3JY0A 3ZC5A 4WNKA 4L52A 5HO7A 2J51A 3ELJA 2C6IA 5EM7A 3ITZA 3MV5A 4WHZA 3ZM9A 3CGFA 3NLBA 4YTCA 2IN6A 2JLDA 1HOWA 3KCFA 4O96A 5I9XA 1YHSA 3UQCA 4HZSA 2C5VA 4N70A 5EOLA 4FGBA 4E5BA 1GIHA 2G15A 2AEGA 3ZH8A 4IJPA 1UU9A 2WTJA 4PDOA 2C6TA 4Y83A 4MK0A 4RC4A 2GNFA 3DNDA 2VNWA 3BELA 2CMWA 4RJ5A 3TN8A 2YAKA 3QTRA 1SVEA 2A4LA 5IQDA 2XNGA 1YQJA 4H58A 3IK3A 3W16A 4JR7A 2EU9A 4RWIA 1XH4A 2VWWA 4IM0A 2Q83A 4FT9A 1Z9XA 4FKVA 1FOTA 4HGLA 2XJ2A 4JG6A 5KUPA 4FV6A 2I0HA 3HECA 4HCVA 2UZTA 5I5ZA 4FKPA 2JBOA 1KOAA 3A7JA 4DH8A 3KRXA 4PMTA 4U7ZA 1NW1A 4CMOA 2HW7A 2VWZA 4YSMA 3OVVA 4D1ZA 2R3JA 3AD4A 4IX5A 3R73A 5A4EA 4CZYB 3WZKA 1UU7A 1WFCA 4OAUC 3OROA 1IA8A 3RI1A 1J7IA 4KIQA 4IAZA 4C4JA 3LOKA 1PXIA 4NTSA 4CCBA 3A4PA 3S95A 3HLLA 5IF1A 4W4VA 3Q4UA 4EOMA 1BX6A 4MAOA 5LWNA 1ZZLA 2X4ZA 5HBHA 4ORKA 3R1NA 5AMNA 1K3AA 3HV4A 3UO5A 3A8WA 3NX8A 4JXFA 3F88A 4AQCA 5BV3A 3HYHA 2CSNA 2C0TA 5CU2A 2UZOA 3Q2MA 3ULIA 4DT9A 4M8TA 3K5UA 4PUZA 5JGAA 2I7QA 4KD1A 4ZSEA 3VUGA 3