3E62A

Fragment based discovery of jak-2 inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
291
Chain Sequence
RDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Fragment-based discovery of JAK-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 291
sequence length 293
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e62A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e62A01
2QOKA 5CU6A 2E9VA 3OUKA 3PJ8A 3ORPA 4HNIA 3TNPC 5DMZA 3C5IA 1U4DA 2C3KA 2UVXA 4DC2A 2PZ5A 2VTIA 4IX4A 4L53A 4M3QA 1UNLA 5HIDA 1PMVA 4AOTA 3LMHA 3OOGA 4FTNA 3PWDA 5EHLA 5IEYA 1OECA 3AT3A 2GHMA 4QPMA 5DT4A 2QQ7A 5B2KA 5IA5A 2IZSA 3BKBA 3EN5A 4RWKA 4UXLA 4Z7HA 4RQVA 3OMVA 2B52A 2XYUA 3A60A 4WNPA 4HZSA 3NUYA 4E5BA 4FKGA 4JXFA 3RPRA 3TNWA 4AE6A 3ORIA 5HKMA 4J8MA 4AU8A 1MRVA 4IFCA 5HGIA 3OXZA 3N9XA 5BPYA 5CQUA 2FB8A 3QLGA 4WUAA 1R0EA 3BCEA 2OG8A 4FVPA 5CNNA 4K1BA 5A6OA 5AAEA 3VRZA 4YJTA 3TT0A 4CQEA 3MDYA 3SW4A 3Q2MA 3R2YA 4WHZA 2Y8OA 3RAIA 4DFNA 4IZAA 2C6DA 2WEVA 2XNEA 3Q32A 2WQNA 1OIQA 3C4CA 4LL0A 3RVGA 5IQEA 4F0FA 2H96A 4TYIA 5KX8A 3A7GA 1JSVA 1AQ1A 4XYFA 4E4LA 5E1SA 4YTHA 1RDQE 5EQYA 3VUDA 3TIYA 2YCQA 2Y7JA 4RG0A 2CPKE 1QPJA 2X1NA 4G17A 4YSMA 1RQQA 2HY81 4EH7A 4RT7A 3UYSA 2GQGA 3R28A 4AGDA 2ZM1A 1PY5A 2C1BA 3CTQA 3PE1A 3PWYA 4RA4A 3EYHA 2R3FA 5JRSA 4I5PA 4H58A 4G34A 3V8WA 3O8UA 5AP6A 4OGRA 4R1VA 4DLJA 4EBWA 3OCGA 4KABA 3UQCA 4C59A 3HDMA 2DQ7X 1DI8A 4KBAA 1H1QA 4M15A 4W4XA 5A4QA 4FZAB 3WZUA 3UOKA 3POZA 3QGWA 2VUWA 3QTRA 4FL2A 3EFWA 3SD0A 1G3NA 1Q8YA 4G2FA 4L3LA 2HWOA 1CM8A 2O63A 5AR2A 3L9LA 4NUSA 3K2LA 4R8QA 4A06A 2HIWA 2XNMA 3W2QA 4GEOA 4E5WA 3LAUA 3PJ1A 3BYUA 2O0UA 2OSCA 3I6WA 4U3YA 1PJKA 5E8SA 2BZKB 1YQJA 3M42A 4O96A 5FEDA 4FSRA 5M51A 1U5QA 4IWOA 4U0IA 5CF5A 5JH6A 3R1YA 4EONA 2XJ1A 1STCE 2YM8A 4MWIA 2YM5A 1BLXA 4GVJA 4X3FA 4AXAA 5EM5A 3TKIA 4OLIA 1W7HA 4BTKA 3FC1X 3FMLA 1H28A 4PV0A 3SKCA 2BRNA 4FSQA 4AUAA 3FHIA 4O27B 4XOZA 4C4HA 2ZM3A 1PF8A 3LLTA 4FV2A 1BL6A 4NTSA 2X4FA 3O96A 4IH8A 3WZJA 2JKMA 3FI8A 4M8TA 3ZM4A 2GFSA 2JAMA 1XH9A 2PL0A 4IB0A 4DHFA 3E92A 3FQHA 3NW5A 3N4TA 2BDWA 2R0IA 2LGCA 4YZNA 2QOHA 5HU3A 3CLYA 4WD5A 2A1AB 5IA4A 5KHWA 3IGGA 5LQFA 2JDRA 3A4OX 3OEZA 4RJ5A 3MB7A 5J8IA 5E8VA 1W0XC 4HGTA 2W1CA 3ERKA 3ZHPC 1Q24A 2YISA 3A4PA 5TE0A 4ZLOA 2QONA 4U6RA 3D4QA 4ZSGA 4HVSA 3ZFXA 2XK4A 3ZONA 3W2PA 2OZAA 4GJ3A 3OXIA 2YCFA 4E3CA 4PP7A 3TL8A 2CNQA 3PYYA 3V5LA 5AWMA 1ZOEA 4WIHA 3VRYA 5K0KA 1SMHA 3VQHA 3NEWA 5J87A 4V0GA 3ZUUA 2F49A 4LM5A 3TUDA 5KMIA 3IDPA 3A62A 3ROYA 3VUKA 3LFSA 3JPVA 2OW3A 4MQ1A 3WF9A 3OWJA 3UTOA 4RFMA 3Q4CA 4RIYB 3E5AA 2W1FA 5TF9A 5I9XA 5JMSA 4BL1A 5IQIA 4XV2A 2XM8A 4E6AA 4BCNA 4FV7A 2UZTA 5D11A 1ND4A 3KREA 1CDKA 3ZSHA 3H9FA 4NL0A 2BILB 4KIQA 5ANIA 3NCZA 3VVHA 4FTOA 4QYEA 3I7CA 4O7VA 2OU7A 4NIFA 3QTWA 3SX9A 1XH7A 5KBQA 5C27A 1W98A 2PHKA 3R9NA 3MY1A 3U54A 4XV3A 2VTMA 3EQCA 4RIWA 4LRJA 3RNYA 2YWVA 4AT4A 3PFQA 2P0CA 2R3OA 3L1SA 4E93A 4EOKA 4BCFA 2GNLA 5LARA 1DI9A 2UZUE 5JGBA 4ARKA 2DS1A 2OFUA 3DNEA 3H4JA 1XH8A 4FKLA 3KVWA 3PSDA 3UMWA 3NYXA 5IA3A 4GT4A 4ACDA 2HYYA 3O23A 2ZB1A 5EW3A 3ZLWA 4O7NA 4QTBA 2UW8A 3DK7A 4RQKA 2WB8A 2WTIA 1WMKA 4JAIA 1JSTA 4IVDA 3LMGA 4E6CA 3EFJA 3VIDA 5A4LA 1XWSA 5CF8A 2YHVA 3GC0A 1YXXA 5JFWA 3GU8A 5M09A 4FG9A 4UV0A 3DKGA 3VS3A 2PMLX 1XR1A 3NNWA 4ZS0A 1URWA 5IQCA 4GV1A 4IM0A 5M4IA 5EW8A 2PULA 2X81A 4LFIA 4UXQA 3E8EA 5CXZA 4R1YA 5LCJA 1YWRA 3BU3A 3ODYX 1ZLTA 4FTMA 2ITTA 1LP4A 4GK3A 4XBRA 1PRYA 5L8JA 4D4SA 4X2GA 3DKCA 2QG7A 4YO4A 4PMSA 2R7BA 1ZYJA 3KRLA 2W4JA 3NIEA 5J79A 3UIMA 3TTIA 5AA9A 4EZ3A 3GI3A 3FI4A 1OIYA 4ZY4A 2GDOA 3OOMA 4QYYA 3KN5A 5BMMA 2VX3A 4EH4A 1PXKA 2Z60A 3F5PA 3R9HA 5AP3A 4I22A 5FGKA 4FKTA 4AZVA 4XH6A 3MW1A 3UOHA 4PDYA 5EM6A 3V6RA 3B8QA 1TKIA 2B9FA 3LCKA 3QKLA 4RVLA 5AV0A 5DPVA 4O2PA 4DT9A 2X7OA 3R01A 4P7EA 3VN9A 2FGIA 3KRXA 5CF4A 1KE9A 3JS2A 3O50A 2JAVA 3BRBA 3HZTA 3A7IA 4QMZA 2OF2A 2B54A 2IW8A 1JPAA 2ITYA 4AW0A 4Y83A 3ALNA 3RHKA 4U42A 1CSNA 1ZZLA 4YBJA 4BKYA 5HD4A 4CZTA 2WQEA 2GMXA 4D4YA 2UW7A 1ZARA 2JITA 3FWQA 2I0VA 3I60A 3MS9A 4XG6A 1H26A 4YU2A 3I81A 4EH3A 4I94A 4IAAA 2VWZA 2WMAA 1PMNA 4MVFA 3PJCA 3W2OA 2VX1A 4RLLA 3UG2A 3QUPA 4YJPA 4ACCA 2WQBA 3K54A 4PWNA 3KXGA 3RCJA 5IH5A 3N51A 3RP9A 3UIUA 2BRGA 3TZ8A 5ITAA 5L4QA 4OTIA 3CS9A 3ZOSA 2NP8A 4J97A 4Y85A 4IDVA 4FOCA 4D1ZA 2ITQA 1WVYA 1ZMVA 1O6YA 4R5YA 1PXMA 4EOPA 2JDSA 4JG6A 3RALA 4ZLYA 4R5SA 1YWVA 3MFTA 5HLNA 4U81A 4J98A 2G01A 1YDTE 2FVDA 4OW8A 1FMKA 4CD0A 4WBBB 4D2TA 3ANQA 3WE4A 4KBCA 3I5ZA 3BYVA 2QR8A 3UQGA 3COHA 1W82A 2GS7A 4IZ7A 4LV5A 5BVEA 3MY5A 3R9DA 3AC8A 5FXRA 5HU9A 4DH5A 4IVCA 1IA9A 1Q8TA 2HXLA 3U9NA 5I9VA 5K4IA 2ITXA 5LXMA 2BUJA 4BTMA 2CKOA 2X2LA 3F69A 1YI4A 3IKAA 3KFAA 2JIUA 3HV3A 3RM6A 1OB3A 3VHEA 5IEXA 1G8SA 5DA3A 3C7QA 3ZXTA 2IVSA 3IW6A 2JDOA 2UVZA 3ATTA 4E5AX 3GUBA 2BFXA 2F2UA 1PXIA 1ZOGA 5T6KA 5I9WA 4XS2A 5EYKA 2WTJA 4OAUC 3PIZA 4USDA 5LMBA 4JAJA 4H3PA 4BGGA 2P4IA 1V0BA 1GZKA 2BROA 3MIAA 5JZJA 4O82A 1MP8A 1ZRZA 1R3CA 4TWOA 4S33A 3ZU7A 2C0OA 3QCSA 4QP2A 3W2RA 4FKSA 1WCCA 2BHEA 2OH4A 2XK8A 3HMIA 4I0TA 4IAYA 4Z9LA 3RAHA 4ACGA 4WNOA 3ORMA 4CCUA 2HZ4A 4MNEA 4B9DA 3ORLA 5A9UA 5EHYA 4YPSA 3VUGA 3MESA 2O3PA 3KK8A 4A9RA 4BDFA 3NSZA 4ALWA 1OM1A 3G90X 4F6UA 2W5HA 1P4FA 1J7LA 3VJOA 2R3KA 2SRCA 4NM0A 3FQEA 4O91A 3R7VA 3OVVA 4QO9A 4G5PA 2JIIA 2W06A 3P7BA 3K3IA 3RWPA 4D28A 4EOJA 3KXMA 4O83A 2PE0A 2WKMA 2XIXA 1M7NA 3WE8A 1GAGA 3P08A 3F3VA 1Q8WA 3GC8A 3M2WA 4U45A 3R1QA 4J7BA 3GCPA 3OC1A 4UZDA 3P1AA 1E1VA 3PY0A 2RIOA 4BI0A 4C33A 1FVVA 2A4LA 4XOYA 3ZBXA 2C4GA 4QMQA 5E9EA 4NSTA 5HIBA 4ASDA 1V0OA 4RBLA 5IA1A 3RPYA 4ZZMA 4ZMFA 3DK6A 4L00A 4M66A 4J71A 5JFSA 4DBXA 4KINA 5M4FA 4JQ8A 3UGCA 1H4LA 5CAUA 4ASZA 2DWBA 3CKXA 2HELA 4ZSEA 3S1HA 1UWJA 4XG3A 5E8XA 4RZWA 3VO3A 4ZSLA 5B7VA 5F1ZA 1LEZA 2PZRA 3OBGA 4N57A 5FTGA 4B8LA 3RPOA 1M52A 5HORA 4AF3A 2R3PA 4X2NA 4JOAA 3UVPA 4FX3A 4F70A 3MI9A 2AC5A 3QQLA 4DCAA 2BRBA 2E9UA 3F61A 4E8AA 3ORNA 2C68A 2YDJA 4QTAA 5GINE 4EH9A 2O2UA 4JR3A 1SVEA 1JWHA 2WEIA 4AT5A 2QOQA 2BIKB 2R3HA 3E64A 3QTIA 4MX9A 5DH3A 4IM2A 4AACA 2J5EA 4EHGA 3FZOA 4YJOA 5CSVA 5IA0A 1BKXA 3BBWA 1KE7A 3HEGA 1J3HA 4NTTA 3QRIA 4FIGA 4IWDA 4CFWA 4X6QC 1JQHA 4DT8A 3SHEA 5EI8A 4E7WA 1L8TA 5HEZA 4EH2A 3NUXA 3RJCA 2G15A 3ZLSA 4FZ6A 4RVMA 3VBVA 2YITA 3GENA 4FG8A 4BHZA 5EQPA 1Q61A 4R7BA 4ZZNA 3PVWA 5BVFA 5CAQA 1YXVA 5GHVA 3EKKA 5LVLA 1F5QA 3TN8A 3PY3A 4RX5A 3KMWA 4ANLA 4A9YA 4LV8A 5KBRA 1VJYA 3DXPA 3VS6A 1XJDA 3LIJA 4ERKA 4FL3A 1YW2A 4BTJA 5I9UA 3FL4A 4NKSA 2VU3A 3LM5A 4EWHA 4O81A 4X2JA 4EK6A 2JEDA 5GZAA 5L2WA 3O51A 5A46A 4G31A 3LFEA 3WF5A 3BEGA 3NCGA 3W8LA 2R3NA 4IC7A 2C6MA 4RFZA 3KF7A 3ZDIA 2YZLA 2YDIA 5J95A 3WARA 3JXWA 4EK8A 3TJCA 4F08A 3VS0A 4CFXA 3OTVA 3P78A 1Q3DA 5JKGA 1L3RE 3BGQA 4FGBA 3NIZA 2CLXA 3FLWA 1XBCA 5CX9A 3S95A 2PYWA 4NYEA 4QQJA 1QPEA 2QG5A 5BVNA 3G9NA 5AP0A 4PDSA 1Y57A 3I0QA 4MQ2A 5H9BA 4FIFA 4MH7A 5EI2A 3VC4A 3BYOA 4JS8A 5EH0A 4QYFA 3MH0A 4ITJA 4DYMA 5A4EA 3RM7A 2WIHA 5E1EA 2Z7QA 4P4CA 5DFPA 3RINA 4IAZA 4YZDA 1SZMA 2XBJA 2XIRA 3OW3A 4KSPA 4RJ4A 1M2RA 2ONLA 3BHHA 3KU2A 2WMVA 4JDKA 3PA5A 5L2SA 3R71A 2P3GX 4QP1A 4DGGA 3KKVA 2WTKB 4O1OA 5KE0A 4FV0A 5BVDA 4G3EA 3W2CA 3F9NA 2PZYA 4M84A 2JD5A 3LFFA 3M1SA 5HCZA 1G8AA 3QQGA 3ZM9A 1IAHA 4JX3A 4CQGA 4OT6A 1BI7A 4RWLA 5DEWA 1R1WA 4GRBA 2YM6A 4N6YA 4C35A 4DEBA 4O7RA 3ZO2A 1EH4A 4ZTNA 3TG1A 3CP9A 3EJ1A 2Y4PA 3U51A 2XIYA 1OL7A 3BZ3A 3DAEA 4QMXA 2VWIA 4RIXB 2ITOA 3PPKA 5CI6A 1LUFA 1Q5KA 4C3FA 4IWQA 4NCTA 5IH4A 2I6LA 2OF4A 3NNUA 5F4NA 5I4NA 3R8MA 3QQKA 5L2QA 2JBOA 3ULZA 4E26A 2YIYA 3H10A 2H9VA 2VTRA 3O7LB 3E93A 4CV8A 4DFLA 3G0EA 2XS0A 2FSLX 5FTOA 5HHWA 4AAAA 3JVSA 2J6MA 1UVRA 4JDHA 2BDFA 3DAJA 4E4MA 2GU8A 1M17A 2ETMA 2ZV2A 3FDNA 4X3FC 2Z2WA 3GQIA 4EC9A 4FEWA 3PJ2A 3VUHA 2R7IA 1P2AA 3JY9A 3P4KA 4NEUA 4O7SA 1NA7A 4W4WA 1U46A 3ZTXA 2PTKA 3IOPA 1Y6AA 3QQJA 4FSTA 4BGHA 3SOAA 4HYHA 3PVBA 4RVKA 1X8BA 2BTRA 4A9SA 4FODA 3QKMA 4FSWA 2O65A 4EOMA 3NNXA 3CGFA 4FK6A 4O7TA 5AV2A 3TDVA 4QP6A 4IEBA 3LQ8A 1XBBA 1P5EA 4U7ZA 4CMOA 1GJOA 3KULA 4ACHA 4G16A 5EG3A 3THBA 4HJOA 3ZRMA 3WIGA 2XH5A 5AUYA 1SYKA 2B1PA 4PMMA 3FLQA 3WBLA 3S2PA 3CTHA 4APCA 5IEVA 2UW0A 1YOJA 2VTJA 3KMMA 4YTIA 4IMYA 4OTRA 5LMAA 2JDTA 2OXDA 2ZV8A 3BU5A 2JIVA 2VWYA 4WOVA 4FMQA 1MQBA 4O0RA 4ZY6A 4QP3A 2HW6A 4ZTLA 4JIKA 5KZ0A 3P23A 4FUXA 1DM2A 5E91A 2B7AA 1REJA 4TTHB 4TYHB 4I5HA 1A9UA 4GG7A 4N6ZA 4U97A 1JOWB 4IZYA 3VJNA 1UWHA 5G1XA 5CU4A 4LOPA 4MKCA 4NJ3A 4C4IA 3VUMA 4AA4A 4HYUA 5BYYA 3A99A 5C4KA 4W9WA 2W1HA 3AGMA 4ZMEA 4PNIA 2YN8A 4D2PA 2RFNA 4IWPA 4YP8A 1U54A 5HX6A 2QOCA 4QMMA 3IDBA 4DGMA 4BI1A 4CZYB 4FVRA 4ERWA 3LW0A 2WQOA 2VWXA 2CNVA 1JKKA 4CFUA 4R7HA 3OHTA 2FO0A 1YDSE 1YWNA 2UZOA 4XMOA 3WOWA 3ZO3A 5LOHA 4LQMA 2J0KA 3S0OA 2JC6A 4YNOA 1FQ1B 3BLRA 2VGPA 4ITHA 4RFYA 4G5JA 4YJNA 5J9YA 2G2HA 4U43A 5E8ZA 3T9IA 4AGCA 3GCVA 3KVXA 2OIDA 3HA6A 3GP0A 4LUDA 3MTLA 2GNJA 2Y4IC 4I1ZA 3BBTB 1Q97A 1SNUA 4XV9A 4WG5A 4YC8A 5FDXA 4QQTA 3OWLA 4LGHA 4IAIA 4I5MA 4ALUA 3CY3A 3D83A 4A9TA 5C8MA 3L9MA 5AP5A 3DBQA 2I1MA 3BX5A 1OUKA 3TZ7A 4F6SA 4L42A 4YGAA 3PTGA 4QP9A 3FBVA 3OXTA 3DKOA 3MGYA 4FT0A 1IASA 2R3GA 4U44A 2BIYA 3TV4A 4CMUA 4MNFA 1RJBA 5EDPA 5CSXA 4S32A 5LCKA 1A06A 1WFCA 2W1DA 4FTKA 4ZAUA 4DE4A 2ETRA 2CGUA 4FIIA 3I4BA 5CALA 4OT5A 4F0GA 3ZBFA 3UNKA 3PG1A 1WBSA 4J1RA 2BRMA 1YRPA 1YXTA 3WYYA 4BB4A 2PUPA 3EQPA 5E4HA 3OBJA 4M13A 2WU6A 3Q53A 3GCSA 2ZOQA 2GQRA 5AMNA 1OKYA 5CEIA 3RI1A 3EQDA 4DFYA 3MV5A 3Q60A 2B9IA 3DV3A 4IJPA 4NW6A 3GXLA 2YERA 4ACMA 3NUAA 5HBJA 5FXSA 1OL5A 3QD3A 4JQ7A 4WT6A 4YJRA 3L8SA 4G9CA 3QTQA 3FSKA 4C38A 3V5TA 2XKCA 2PZPA 1FINA 1JVPP 2YAAA 3EQGA 4TRLA 4IAFA 4XRLA 4ZS4A 1SNXA 4XG9A 5JN2A 1PYEA 1PXJA 4O7WA 3GOKA 3TNIA 3H9RA 3DT1A 2IZRA 4I6QA 2UW5A 3DXNA 5H2UA 3E3PA 4YHJA 3CY2A 3UC3A 3QRKA 3S00A 3AXWA 4KBKA 3FSFA 3RTPA 5ANJA 3AD6A 3UP2A 4FSMA 5ETFA 4DGLC 2F9GA 4M12A 4R3RA 4DG2E 1KE5A 2R2PA 4QTDA 5AV3A 3A7FA 4BI2A 3GCQA 3E8CA 2ZVAA 5CVFA 5EK7A 3VBYA 1WBPA 2ZM4A 1BYGA 3QCQA 3A7HA 4S2ZA 4YZCA 4ZOGA 3KXNA 5IQFA 2P33A 4M0YA 3FZSA 4ZJJA 3PJ3A 5JFXA 3FLYA 4O1PA 4QYHA 4TYJA 4UYAA 3FXXA 4ORKA 2IVUA 3D0EA 5DYJA 2CJMA 5EM8A 3WYXA 3N4UA 3C4ZA 5CU2A 2XIZA 5JQ8A 2XJ2A 3CD3A 1YHWA 3MVHA 3ZRLA 5A4TA 3E63A 5DLSA 4EOOA 1ZYDA 4RC3A 2XNPA 4L9IA 5CZHA 2I40A 4NZWB 5JQ5A 5GIOE 3A2CA 2ERKA 4XCUA 4CYIA 4UWCA 4BYIA 3R8ZA 2BRHA 5D7AA 3QX2A 4PL5A 1JKTA 4JRVA 4R7IA 1KE6A 5E8TA 3BHTA 3SGCA 4UMTA 2KULA 4FKVA 5AR8A 3R83A 3ETAA 3NGAA 5AR7A 4RA5A 5TR6A 3VUIA 1PXLA 4PL3A 4GFOA 5CAOA 4AFEA 4HCVA 4Y8DA 4BKJA 4H3QA 5EOLA 3MWUA 3BELA 5B0XA 3GU4A 4FTJA 2W5AA 4NM3A 2R3IA 2UUEA 4LL5A 2BZJA 4YMJA 5IDPA 3RMFA 4BBMA 4IQ6A 3EKNA 3BI6A 4TWNA 3KB7A 2YDKA 5FM2A 3TACA 3Q4UA 3TEIA 2RG5A 2YLFA 1H25A 3OS3A 3NAXA 4DEEA 3QQHA 5CENA 4WRSA 2VGOA 2XMYA 3HRBA 4WNKA 3WI6A 5BQ0A 1W84A 4MXAA 5CT0A 3BLHA 3SDJA 5IZFA 4TXCA 5E8YA 2YZAA 4IB3A 1REKA 4X2KA 3SG9A 3HGKA 3FZPA 3F5UA 2FYSA 3FMNA 4RJ8A 2BAKA 4EI4A 5CVGA 2F7ZE 4RJ3A 3NZ0A 3UC4A 2F2CB 1FGKA 4BICA 2UZVA 4D58A 2PSQA 4I4FA 2HWPA 5EKOA 5HX8A 4X0MA 1T45A 4DCEA 3N4VA 3R00A 1XH5A 4C34A 1E9HA 2XA4A 4EK4A 3QQUA 2W0JA 2J0LA 3QRJA 3U4UA 3SVVA 3TV6A 4C8BA 4D2WA 3L8PA 3UZTA 4NW5A 3ZC6A 4D4RA 3D7TA 4UWYA 1Y6BA 4OBPA 1KOAA 2QNJA 2VWBA 4RIXA 4BDBA 3Q9ZA 4IVAA 4HYSA 2OJIA 5CI7A 3PRIA 2X4ZA 4BDIA 4AQCA 2WO6A 3C4FA 3RPVA 4I6HA 5CASA 3HV5A 4RVTA 4CYJA 4NKAA 3WIKA 2P2IA 4PMPA 5IQHA 5HZNA 5JZNA 4KIKB 1LEWA 4L46A 3TNQB 1CKIA 3HRFA 2OZOA 2QODA 3HL7A 2QOIA 5L2TA 5LVPA 4LGDA 3R73A 2WMXA 4O6LA 4A4OA 4OTPA 1MUOA 4CZUA 4FE2A 4ZZOA 1YOMA 4ZSJA 4M97A 5LJJA 5AX9A 4I24A 4A07A 4Y46A 3UOLA 2RL5A 2WMTA 1YOLA 2GCDA 2I0EA 5EHOA 4ZJIA 1ZY5A 3POOA 2B4SB 4UEUA 1OPLA 5CANA 3FMHA 5CEPA 5AUZA 4QPSA 4JL9A 2X9FA 2BR1A 4C02A 4B99A 3PLSA 3KMUA 5F94A 3HNGA 4FKIA 3CSVA 4USFA 1NVSA 2YM4A 3DOGA 3W1FA 4D0XA 3SRVB 3AOXA 3QD0A 3T3UA 1SM2A 2F7XE 3EIDA 4JR7A 4OTWA 3TM0A 3PY1A 2QCSA 3E7VA 4U80A 3ZO4A 3ZZEA 2HAKA 3OEFX 5LVNA 2FH9A 3II5A 4FVQA 2PU8A 2OLCA 4TPTA 3LKMA 5EM7A 5D12A 3GU5A 1XKKA 5JRQA 2A2AA 5AP2A 2J51A 4AN2A 3NDMA 3B2TA 4IHPA 3MN3A 3CXWA 3OY3A 5TKDA 4UBAA 4CEGA 5I9YA 2W7XA 4IJ9A 4CFNA 4CXAA 4EZ7A 3UIBA 2GPHA 5TT7A 4I21A 1WBTA 4ANMA 3HRCA 4HVHA 4XRJA 1JBPE 1NVRA 3EQRA 4Z16A 2B9JA 3LXKA 5D7VA 4H1MA 3S4QA 1IEPA 1ZYCA 1XHAA 3QAME 1XO2B 3MPTA 4AGWA 4BN1A 4BZNA 5AA8A 2VTTA 3RKBA 4F1MA 4YC3A 2G2FA 3U87A 1KV2A 1VZOA 3TUCA 3UODA 4USEA 3PSCA 5J5SA 3NMUF 1XH4A 3PDTA 5HTBA 3PZEA 4W4VA 4DLIA 4L3JA 2RKUA 3LPBA 2BFYA 3NVMB 4YJUA 3LMIA 2XCKA 2GSFA 4LI5A 1OI9A 4IX6A 4RRVA 1PMUA 4MTAA 4BWPA 4L44A 4AGUA 4QMVA 4JDJA 2HCKA 2J0IA 2R0UA 3AMYA 4CV9A 4ALVA 3ACKA 2ONLC 3O17A 3FV8A 5FG8A 5J5TA 4K33A 2FA2A 1YDRE 3ZDUA 4GKIA 4GK2A 2R3LA 4ITIA 4MXOA 5DE2A 4XLIA 2QC6A 5CEOA 2CGVA 4O7ZA 5GJDA 3K5UA 3AC3A 4YLKA 3NUSA 5KMKA 4UMPA 2ZV7A 5D9HA 5DWRA 2YLEA 5DN3A 5EOBA 4CTBA 3O8PA 4M69B 4A7CA 2UZEA 3F2NA 4LMUA 4H36A 3HKOA 3Q9YA 4CRLA 3HDNA 3FMDA 3ZXZA 3CC6A 3KA0A 5HTIA 5K4JA 4NCTC 1P14A 4H05A 5FLFA 4CG9A 1OITA 3I1AA 4G3GA 3LM0A 4O2ZA 4BBEA 5ANEA 2J9MA 3P79A 4IACA 3CGOA 2PWLA 2QLQA 2W1IA 4JT3A 1QMZA 4Q9ZA 4I23A 3P0MA 3DXQA 4KUJA 3PLAE 3PXZA 4L45A 2VD5A 3F3WA 4EYMA 3R9RA 2IZTA 2QHMA 2GQSA 4ZJVA 3AD4A 2WTWA 4HNFA 3R7YA 1O6LA 2FUMA 4QMNA 3LQ3A 2PPQA 3CE3A 4YBKA 3RHXA 5HTCA 4XLVA 4HCTA 4EOIA 1ZY4A 3MH1A 5AR5A 4BFMA 4OTGA 2BZHB 2E2BA 1WBNA 2XB7A 3TIZA 4XUFA 3NUUA 2VNYA 3HV4A 5IQBA 4BDJA 3ELJA 4R77A 2C0IA 3T9TA 5FBNC 4JX7A 4MBLA 4FIHA 4K8AA 1SVGA 5JK3A 3BV3A 2IO6A 2P55A 3U6IA 3DKFA 1E1XA 3QZHA 4IDTA 5A3XA 4U79A 5KMOA 3COIA 4TNBA 4G9RA 4FKUA 2EU9A 1H07A 2QOLA 4RMZA 5H8GA 2A0CX 3FYKX 3WZEA 4B4LA 4FKRA 3UVQA 3ZSIA 4C4GA 1V0PA 1ZWSA 4EHVA 3UNJA 3TKUA 5K5NA 1UU8A 1B6CB 3SLSA 5HVKA 1BI8A 2CHLA 2XBAA 2R3MA 4F6WA 4WUNA 2GHLA 2X39A 3GNIB 5CSWA 1JSUA 3EQFA 3KEXA 3Q9WA 4HYIA 2QVSE 3MSSA 2PVLA 3EMGA 4WA9A 3EFLA 4E6DA 3FKOA 3MFSA 2UV2A 3I7BA 1NT2A 3QBNA 3E3BX 3TWJA 2GTMA 1URCA 3IDCA 5GJGA 4D5HA 3DBEA 1AD5A 4XEYA 4PTEA 5HE1A 4FL1A 4BDHA 4EOSA 2PUNA 3F3TA 4JBPA 2R3JA 3R9OA 5IPJA 5AUVA 3VBWA 3IGOA 3F66A 3R7GA 3U9CA 3CD8A 3WZKA 2W17A 5E90A 4D2RA 1OL1A 3KXZA 4J95A 4S30A 1FVTA 4UYNA 5D1JA 3EZVA 2G1TA 4FA2A 3CQWA 2XEYA 3G33A 3EN4A 4AOJA 5CT7A 5AP1A 2C1AA 4UY9A 3BV2A 4PPCA 4EORA 3Q5IA 4WKQA 2XEZA 3TCPA 2XYNA 3FY2A 3O8TA 4FT3A 4AW2A 3ENMA 4KAOA 4TT7A 3QLFA 4F7LA 4K18A 3A8XA 4HVGA 3V04A 3UG1A 3BGPA 2CN8A 3OZ6A 4MBJA 1FBNA 3V5QA 5I3RA 4FT9A 2CKQA 1ERKA 3OT3A 5BYZA 1HOWA 2ITNA 2GNIA 2AYPA 3JYAA 3RZBA 4XHKB 4CFMA 3B8RA 2P2HA 3PXFA 3BQRA 1KV1A 2Z8CA 1WVXA 4I93A 4YTFA 3HAMA 5IUHA 1UKHA 3C0HA 3PA4A 5EKNA 3EN6A 3C4WA 3F82A 4I5CA 4EJ7A 2NPQA 4HGSA 3QTXA 5H8BA 3KXHA 3R7OA 3ITZA 4FKWA 3QCYA 4G6NA 2YEXA 3V5WA 3LJ2A 2QO2A 4IXPA 4LMNA 2JFMA 2WD1A 4FICA 4IAKA 4DBNA 4F9BA 2B55A 2CNUA 4FF8A 4I6BA 4YURA 4QNYA 4EKLA 5CF6A 1ZZ2A 2H34A 4JIAA 4GYGA 3NYOA 4K6ZA 5IH6A 1MQ4A 4EOLA 4F9WA 3G6GA 2QO9A 3UIXA 5ACKA 4KRDA 4G3DA 4BIEA 5HG9A 3Q96A 3KCKA 4FIEA 3HMNA 3NUPA 4U8ZA 5H3QA 5J1WA 5AEPA 2QOOA 4FZFB 5BUIA 3KK9A 4RIOA 2OGVA 4CCBA 4KA3A 2PVFA 4R3CA 4MAOA 3KGAA 4PY1A 4BZDA 4F7NA 4K0YA 1HCKA 5LMKA 2FSOX 4X2FA 3TTJA 3RAKA 3EQIA 1OUYA 4G3FA 3I6UA 4UB7A 5I9ZA 3LXPA 1OKZA 2PZIA 2VWUA 2ITUA 2Z7RA 3LCOA 4FEQA 2BMCA 5DOSA 5AUXA 3ZUVA 3BGZA 3KC3A 1RE8A 1BX6A 1IG1A 4AZTA 5H8EA 4FKJA 4XJ0A 4Y95A 4Y5QA 5ANKA 4ZXTA 4TYGA 3V5JA 4BCHA 4DF3A 4JG7A 1UV5A 1VYWA 1TVOA 3LZBA 4QTCA 4RIYA 3OCBA 3WF8A 4BYJA 3HAVA 3IQ7A 2WFYA 4O6EA 4IZ5A 3G0FA 3R02A 5CVHA 2ZAZA 3HECA 5M07A 3BWJA 2GHGA 2VWWA 4X3FB 3TKHA 2XP2A 2ZDUA 1GNGA 3HMMA 4CLJA 4FSZA 1H27A 3AQVA 3BQCA 4D1SA 5C03A 1OL2A 3VS2A 2WNTA 1YXUA 2R5TA 2X7GA 3H30A 5FM3A 5TOZA 3VS4A 4XBUA 4BDKA 4F1OA 1H0WA 3IO7A 5HVYA 4PP9A 2CDZA 3FE3A 4FT7A 3TI1A 2WGJA 1QPCA 2XIKA 3V51A 4CFFA 5M4CA 2HY0A 5EYMA 3ZEWA 1B38A 4CKIA 4BR3A 3KRRA 2WMSA 2CN5A 4Q5HA 3TUBA 4DEGA 3IOKA 4WNMA 2Y9QA 4ASXA 4FIJA 4QMYA 4F9AA 3AGLA 3RZFA 4XP0A 2BZIB 3CQEA 2EXCX 4FSNA 3W32A 3FAAA 2UZBA 3NAYA 3DB8A 4LYNA 4MXYA 4XG8A 5HLWA 4JVGA 4Q9SA 2Z7SA 2OZAB 4E73A 3FMEA 4P5QA 3V5PA 2X6DA 1H1WA 1Q99A 4IADA 4FYNA 5C8KA 3D14A 3U55A 5K3YA 4FNZA 3IW4A 3RCDA 3UP7A 2WAJA 4BCKA 5CWZA 3QL8A 4R78A 3ZO1A 4BKZA 4V0GB 3GCUA 1CKPA 3ALOA 2B53A 2C3LA 3FI3A 4DEAA 1M2QA 1TQPA 4DFXE 3IW7A 3PXRA 4PX6A 4OR5A 2YAKA 4DINA 1PXNA 1F0QA 4F9YA 4M0ZA 5HBEA 2E9OA 3GU6A 2R9SA 2X8IA 5EDRA 4B8MA 4MF0A 4QNAA 3QZGA 1KOBA 4JG8A 3TZ9A 4DEDA 4FUYA 2J7TA 2EB3A 2O64A 3M11A 1F3MC 2BKZA 4I4EA 1NXKA 1H1PA 3EN9A 4MWHA 3SC1A 3QD4A 1GIIA 5A4CA 2V5QA 2V0DA 4NM7A 2GNGA 4H39A 4M14A 3KY2A 2ITZA 3FPMA 4FKOA 4GS6A 4NIFB 2VWVA 4QP8A 4R3PA 2BHHA 2FSTX 5IUGA 4DTBA 4WRGA 2VTOA 3CJFA 5HG7A 4FNWA 3ZUTA 5DNRA 4EJNA 3CKWA 4FTRA 3BYMA 4AG8A 2G9XA 4RJ7A 4ANBA 5IU2A 5L6OA 2YFXA 4GK4A 3UQFA 3EQHA 2UW6A 3QXOA 4ANOA 2IG7A 3QZIA 3GQLA 2C47A 3OUNB 4ZK5A 4HGEA 5KMJA 5ANDA 2YA9A 4BCIA 1MRYA 3Q6UA 5FD2A 1KWPA 4QT1A 3MPMA 2Y4IB 3MJ1A 3DB6A 3FYJX 3QTSA 4V04A 4C57A 3NYVA 3ZH8A 4ZTMA 3V6SA 3AT2A 4YTCA 3EL8A 3QALE 5DRBA 4UZHA 2BKKA 1H1RA 3ZLYA 3FEGA 4KIOA 3QXPA 2X8EA 3D5XA 5AR3A 5EYDA 5HE0A 4AW5A 1NW1A 4PTCA 5M08A 5AIKA 5FTQA 3ZSGA 4F65A 2IJMA 4GT3A 4BC6A 4BDGA 3NRMA 3I0OA 5CU3A 3VAPA 5KKRC 2OJ9A 3CPBA 3DTWA 4G6OA 2X6EA 5EQEA 3C13A 1TQMA 4U40A 4NJDA 4FTIA 4BCPA 4EKKA 3FLNC 3AMAA 2LAVA 4Z3VA 2YIQA 2CLQA 3QRUA 1R0PA 4QMTA 3VBXA 3P7AA 3MPAA 2C6TA 4K11A 1B39A 2GNFA 4ZEGA 4Q2AA 1PKDA 1WAKA 2BTSA 1U59A 2BAJA 3MJ2A 3L9NA 4XP2A 5EI6A 3UE4A 2YCRA 1OBDA 2XJ0A 5C26A 2IPXA 1V1KA 3NW7A 4JI9A 4WBOA 5AJQA 3GT8A 2C3JA 2Z7LA 3DQWA 4JJRA 3EZRA 3TZMA 5HQ0A 4F9CA 2WTDA 3CJGA 5CAPA 4F09A 4UMUA 3CEKA 4QQCA 5AUTA 2OXXA 1ZXEA 2BPMA 4ANNA 1WBVA 5L2IA 4EQCA 1UU3A 5LWNA 3DTCA 3LE6A 5AUWA 4YUQA 3E87A 4IFGA 1DAWA 5L6PA 3KXXA 3HX4A 4LG4A 2I0HA 4HPTE 2ZYBA 4EQUA 2V22A 5IF1A 5CLPA 2H8HA 2F57A 3UNZA 5M06A 1Z9XA 2PK9A 4GUBA 4I0SA 4YLJA 4TKSA 3R7UA 4BF2A 3TJDA 3IW8A 2VRXA 3ET7A 4DFZE 3ZYAA 3QKKA 4GIIA 3MY0A 3D5UA 5C01A 5HO8A 3A8WA 3D15A 3NS9A 2X0GA 2XNOA 5ETIA 3FQSA 3DGKA 3OWKA 4LUEA 4UWBA 1W8CA 5ANGA 5DT3A 4YJSA 4F7SA 5HLPA 5KUPA 2JKOA 4JBOA 4RGJA 3UPXA 3NUNA 4PTGA 3V8TA 3OTUA 4F4PA 1S9JA 2WELA 4C0TA 4F7JA 4YZ9A 4D1XA 4X21A 4CLIA 3GFEA 4D5KA 4RC4A 1PMEA 4BDAA 3R8LA 3EHAA 4GUEA 1OVEA 3A61A 4MXXA 3NYNA 2J50A 3NX8A 5L6WL 5BNJA 2JKQA 4DH3A 4ZP5A 5M57A 1R78A 5HG5A 3R30A 4I92A 4QP4A 3LXNA 3VULA 4XP3A 4L6QA 4GU9A 3CR0A 3DZOA 3R21A 2RFSA 3UO4A 4MD7E 2PY3A 3DQXA 2C5OA 3FKNA 5C9CA 3RPSA 4CGAA 2VN9A 3GFWA 5BVKA 5I3OA 3TDWA 1GIHA 3BHUA 3NPCA 4O0UA 2ZDTA 4J53A 4L8MA 3ODZX 3UOJA 4J99A 5J1VA 1Q4LA 1PW2A 3SXFA 4A4XA 3HUCA 3FI2A 3RAWA 3NR9A 3PXKA 4MYGA 4FV6A 4EBVA 3SXRA 2NO3A 4OTQA 2VX0A 3LFCA 1SVHA 2UW4A 4O21A 4FYOA 4J96A 4G6LA 2WOUA 5HBHA 3FKLA 5J9ZA 2VO6A 2W96B 2VNWA 2ZMCA 4HZRA 4JLCA 4MBIA 4EQMA 3SW7A 4GU6A 1PYXA 4CMTA 2PMNX 3JUHA 2QOBA 4JNWA 3Q9XA 3FXZA 5CNOA 1UU9A 5JGAA 1FVRA 4EWQA 4II5A 4MNEB 2ETKA 5DI1A 3DJ7A 2RFDA 5ACBC 3TNHA 3TXOA 4HGLA 3FL5A 1Y8GA 3HMPA 5DT0A 1M14A 2XNBA 4C37A 3COKA 2CGWA 2YM3A 4D4VA 4ZSAA 1LR4A 5KCVA 2PMOX 4R6VA 3CCNA 2HXQA 5FP5A 4N70A 1PKGA 2E9PA 4BDEA 3EFKA 4RPVA 5IMXA 3QX4A 5AR4A 3Q6WA 4IX5A 3V01A 3KQ7A 4Z7GA 5A14A 3AMBA 1YHSA 4D2SA 1ZYSA 2YCSA 4FEVA 3UO6A 4D55A 5ANOA 3CBLA 3QHWA 2UZNA 5BUJA 5L3AA 3S3IA 3VF8A 2V7AA 3EWHA 2C5XA 2ITPA 5J7BA 5AFVA 5IQAA 4AA5A 3GGFA 3E7OA 4YHTA 4E4XA 5CU0A 5CSHA 3F5GA 4J8NA 3FLSA 4Y72A 2C6KA 1H00A 4EH8A 4I20A 4FV3A 4QRCA 2B9HA 2C30A 4OTDA 4EH5A 2XNNA 5HG8A 3ANRA 4ZLZA 4DFBA 4AZSA 3H3CA 2J0MB 4LOOA 5BYLA 4F63A 4XG7A 1QL6A 4CKJA 4TN6A 3MB6A 3C50A 4EK3A 4FGRA 4FTCA 4GIHA 2BDJA 3E88A 3EB0A 1OZ1A 3VW8A 2W05A 4G3CA 5L8KA 2X2KA 3FJQE 4F0IA 5HIEA 3D5WA 3CQUA 3PE2A 4PPBA 1R39A 2YJRA 4A4LA 4EL9A 3U8WA 4UALA 4UMRA 2QU6A 4QMPA 1K9AA 2HZIA 2OIBA 4K9YA 3IK3A 3QA8A 3FMMA 3LFAA 4HPUE 4DITA 4HVDA 3MVLA 3PPZA 3QQFA 3U6JA 3R8UA 4FEUA 5DGZA 3ZC5A 4ANQA 4QP7A 3C4XA 4B6LA 4AWIA 5BVOA 3OD6X 3LLAA 3LFDA 3OP5A 2PE2A 1OPKA 2J90A 4E1ZA 5IDNA 2XK9A 2QKWB 1U5RA 3DLSA 1DS5A 3HMOA 1MRUA 4CT2A 4KB8A 4HW7A 5HE3A 2UZDA 2AUHA 3DU8A 5JT2A 4IB5A 1CMKE 1FPUA 2J2IB 4O0XA 4BIBA 2CGXA 4DEIA 5CQWA 1XQZA 3MTFA 5DIAA 3QA0A 1KE8A 4FT5A 5CXHA 4XG4A 3ZZWA 2IN6A 3BHVA 4Q5EA 2HK5A 3PSBA 4QMSA 4KSQA 1KSWA 2C0TA 4GYIA 2WQMA 5AV1A 4RX9A 3W55A 4L67A 4AA0A 3UVRA 3H9OA 3MVJA 3SAYA 4I3ZA 2BAQA 3FZRA 3FXWA 4GFMA 2ITVA 4OBOA 3DFCB 3UZPA 1O6KA 4YR8A 4FG7A 3NNVA 2ERZE 2QR7A 2Q0NA 4I6FA 4FSYA 4KD1A 3MYGA 2WOTA 4F1TA 3PP0A 5D10A 5K5XA 2PUUA 2C69A 2ITWA 3SXSA 2YIRA 4W8DA 5JGDA 2HW7A 3FLZA 4BWKA 5JEBA 3D5VA 2YIXA 3E62A 2GFCA 3DZQA 5AM7A 4U5JA 3PUPA 3T8OA 4XX9A 1IR3A 3G15A 2OJJA 4O38A 4RZVA 4G1WA 5DG5A 3OW4A 1GZ8A 3G51A 1ZMUA 2CKEA 3Q3BA 4ZTRA 5DR6A 5IG1A 4EUUA 5CEQA 4EZ5A 1J1BA 2JFLA 1YI3A 2W5BA 2J5FA 4FK3A 3D7ZA 4D0WA 4CVAA 5AM6A 4CNHA 3BHYA 5C8NA 4GFGA 4NFNA 3UMXA 3LJ0A 3PA3A 2EUFB 3O71A 3OCTA 4WSYA 1OBGA 3Q5ZA 4YHFA 2CMWA 4BCOA 3Q4TA 5LMKC 2H6DA 3D9VA 4GT5A 2GS2A 5HESA 3BE2A 3ZEPA 3DPKA 4C4FA 3HV7A 2CKPA 3CIKA 2OICA 2RG6A 3GBZA 4EC8A 4S31A 4FV1A 4MD8E 5FDPA 1H08A 1PXPA 3R22A 4QQ5A 4TYHA 3RWQA 3R04A 1WBOA 5DR9A 4MK0A 4O0WA 2R4BA 3LQ5A 4DTAA 1I44A 2F4JA 3W18A 5E8WA 1CKJA 3MA6A 2BCJA 3IONA 4AP7A 4BTFA 3KN6A 2WMQA 3H0YA 2JBPA 4GCJA 4XV1A 1H24A 1H0VA 4BZOA 4NU1A 1XBAA 3RK7A 1AGWA 3BIZA 4FNXA 2RF9A 4L7FA 5B2MA 3NVKI 1YHVA 5DVRA 3UPZA 4AW1A 2KTYA 1Z57A 2PVMA 3OCSA 4M7IA 3VS7A 3QWKA 3E8NA 5T3QA 2PMIA 3JVRA 4BVUA 3Q04A 4WG3A 2OK1A 4FV9A 3FZ1A 4U3ZA 3UJGA 5F9EA 2PUIA 5CEMA 3F88A 3PVGA 2YIWA 4Y5HA 4IX3A 3BWFA 3LCTA 3AG9A 4C3RA 4C62A 5IMEA 3QC9A 1QPDA 1Z5MA 3LOKA 4W8EA 4YJQA 4WSQA 2HENA 2UVYA 4N4SA 2QHNA 5FQDC 1FGIA 4I0RA 4O84A 4O0VA 1Y8YA 4NT4A 4EHZA 5C4LA 3IW5A 3PZHA 3LFBA 4FTUA 3C4EA 3DJ6A 5HNBA 4DG3E 4TYEA 5EDQA 1Q8ZA 5FXQA 2EVAA 4KS7A 4EEVA 4YPDA 4AE9A 3R7EA 2WHBA 3W8QA 5M44A 2XRUA 2W1GA 2UW3A 3P7CA 4MEDA 3R8PA 2C5VA 2VO0A 3VBQA 3CTJA 5IQDA 4FKQA 2QOFA 4QMLA 4RJ6A 3DS6A 4PMTA 2QI8A 3KULB 1JNKA 2J4ZA 3DDPA 5D41A 5EW9A 5CTPA 5G6VA 5KNJA 5M56A 4DAWA 3L9PA 4ANSA 4RLKA 1NVQA 2PVKA 3QC4A 4TY1A 3ORZA 3KL8A 5JSMA 2UZWE 3SQQA 3CPCA 3W2SA 4AT3A 2X8DA 4PUZA 4BIDA 3O0GA 4C2VA 3GEQA 1DAYA 4H1JA 2IWIA 5CSPA 3QUEA 3SA0A 1VYZA 1GY3A 2JLDA 4B7TA 5BMSA 2V7OA 4QD6A 5IISA 5FEEA 5FUTA 1GZNA 4BRXA 1WZYA 2W1EA 2I7QA 4AZFA 3G5DA 2VTPA 3HVCA 3LCSA 4MXZA 1QCFA 5L8LA 4TWPA 4C4JA 1JKLA 4AOIA 4GJ2A 3OROA 4KIPA 4BHNA 3QU0A 4GH2A 4GSBA 4L01A 5ETAA 2DUVA 3L8VA 5AAFA 3DNDA 3FMJA 4JRNA 4QMWA 5TO8A 5HNGA 5CY3A 4NM5A 2GS6A 5ETCA 5K0XA 3FZTA 3QD2B 4O22A 1U54B 3V3VA 3R6XA 3U4WA 4L3PA 3ULIA 2OWBA 1GOLA 3VQUA 3C0GA 1UA2A 3DA6A 3PXYA 4GG5A 3DJ5A 5CEKA 2X9EA 2QU5A 3BPRA 2W1ZA 2W99B 4IVBA 4L52A 5KMLA 1PHKA 4MCVA 3SG8A 4CSVA 3ZCLA 3UBDA 3P9JA 3KCFA 4AN9A 3MFUA 3VWAA 2WMBA 2E9NA 4FBXA 3D2KA 4BBFA 3DFAA 4L7SA 2CCHA 5HOAA 4KKGA 1S9IA 3IS5A 5HCYA 2WXVA 3UDBA 3VHKA 4KRCA 5FBOA 3QZFA 2C3IB 1BMKA 3F3UA 1UNGA 4IIRA 4MHAA 4ID7A 5HO6A 4BGQA 4GMYA 3DBFA 4RWJA 1GZOA 4C4EA 1J7IA 3D2IA 3GVUA 4AX8A 4O7YA 3WILA 3ZFYA 3IECA 2ACXA 4PL4A 4D9UA 3L8XA 5M55A 2NRYA 4UX9A 3FUPA 3PRFA 2IZUA 2OBJA 4TWCA 3A7JA 3R0TA 5FWKK 1M2PA 4QYGA 1BUHA 2VTNA 4FTLA 3KF4A 4MXCA 3R8VA 4RX8A 3FC2A 2VTLA 4MF1A 4C36A 3LFNA 3IG7A 1VEBA 2ZJWA 3T3VA 4E4NA 3C1XA 2XKFA 2Y6OA 1G5SA 4EUTA 1YVJA 4IB1A 4JBVA 2XCHA 1H1SA 2QKRA 5A54A 3ORTA 1CTPE 3PG3A 5AUUA 5GNKA 3VBTA 3MFRA 5I5ZA 1ATPE 4KKEA 5F95A 4JDIA 4XG2A 2BVAA 3KRJA 4YZBA 4DGOA 4K77A 3DDQA 3HV6A 4YC6A 4OAVB 3EQBA 4PDOA 4PRJA 1Q62A 3BE9A 3G9LX 4W9XA 2FSMX 4XNEA 3V8SA 1ZMWA 4ZTHA 5AX3A 4MD9E 3LJ1A 2R64A 5LVOA 2YM7A 3ENHA 5J9LA 2YACA 2XNGA 5FP6A 4F64A 1UKIA 4GW8A 4P90A 4IE9A 5LWMA 4LRKA 3MH2A 3QRTA 4NWMA 1H01A 3ZLXA 1OPJA 4U41A 3OFMA 4CG8A 2XUUA 5KHXA 2NNWB 4LRMA 1A48A 3PP1A 4FC0A 1BL7A 4RC2A 2A27A 2C6OA 2C6IA 4AFJA 4AZWA 4KNBA 4CTCA 3QYWA 1JLUE 2B0QA 4C58A 1HCLA 5I0BA 4YNEA 3AC4A 3W10A 3QGYA 4O0TA 5HE2A 3LHJA 2HZNA 4N0SA 4LOQA 2PVNA 2PVJA 3MA3A 3VUTA 4TL0A 5AV4A 5E92A 2Q83A 4TNDA 1OKWA 3P86A 4E6QA 2WPAA 3HA8A 3BU6A 2R3RA 3PVUA 2IW6A 5CS6A 4BCQA 1FOTA 4L68A 2OKRA 4QMOA 4AZEA 5CZIA 5BX0A 2OI4X 2PVRA 3EOCA 4DFUA 2HOGA 2WZJA 2C6EA 1J7UA 4PF4A 5JFVA 2VZ6A 1Q3WA 3W33A 4WG4A 4UN0C 2GTNA 2RGPA 2IVTA 3R7IA 3DBCA 2OO8X 4D9TA 4EH6A 1RW8A 3OY1A 3QTUA 3QWJA 3ZS5A 4CT1A 1JAMA 2WMRA 3QCXA 4BDDA 3HP2A 3DCVA 3GC7A 1OIRA 3BYSA 5FRIA 3G6HA 5IA2A 4KIKA 1YXSA 4ASEA 2Y0AA 2VTAA 3HP5A 3ORKA 5DBXA 3C51A 5IUIA 3PIXA 1Y91A 4OBQA 2GNHA 2XK3A 2G2IA 4FEXA 1O9UA 5AP7A 2EWAA 3O2MA 3ZFMA 3FPQA 4V01A 4FR4A 5IKWA 4AS0A 4DGNA 5E8UA 2REIA 2OXYA 2XKDA 4B0GA 2EXEA 1TQIA 4KWPA 4ENXA 4EHEA 3R1SA 1T46A 2VV9A 3WF6A 4DEHA 3Q2JA 1I09A 5HD7A 4IC8A 2XRWA 3JR1A 4P5ZA 3VW6A 2PVYA 3F5XA 5DHJA 4Z55A 2QURA 4DG0E 4FTQA 5IQGA 4BDCA 5C1QB 3R2BA 2EB2A 4ONAA 5EYCA 2VO7A 1OGUA 3SRVA 4BCJA 3GB2A 3MIYA 4DH8A 4OTHA 4C3PA 4HVIA 4FV8A 4Y73A 4RX7A 2CCIA 3HLLA 5EFQA 1KUTA 5M4UA 5GJFA 4BCMA 3RNIA 2PE1A 4PDPA 2PVHA 3DLZA 3H0ZA 2YABA 3QUDA 2ZV9A 4FTTA 2X7FA 3GU7A 3F3ZA 2OIQA 4PQNA 3K3JA 3C0IA 3G2FA 2QO7A 4JQEA 2A19B 2O5KA 1K3AA 4GKHA 4O7LA 1P4OA 4DN5A 3HYHA 2IVVA 3ROCA 5DEYA 3I5NA 4EK5A 2WMUA 2UZLA 5HCXA 4HOKA 4QOXA 3NLBA 3I79A 3NWWA 4I41A 4CFVA 2C5YA 4OUCA 4GVAA 2NRUA 2O8YA 2OJGA 3D7TB 4JBQA 3OT8A 2C5NA 5HICA 1OIUA 4NK9A 4HCUA 3ACJA 4IW0A 5DR2A 2W4OA 4BCGA 2XZSA 3QFVA 5M53A 5GZ8A 2AC3A 3PPJA 4FNYA 4NFMA 4ZIMA 1OKVA 4ZTQA 3VF9A 5GZ9A 2J0JA 2R3QA 3EL7A 4IBMA 3F6XA 4OTFA 4X3JA 5A6NA 3LXLA 5ICPA 2VO3A 4L43A 3Q4ZA 2QLUA 2JKKA 4X6RA 2BALA 2XK6A 3COMA 5T68A 3GOPA 5KKRB 2XM9A 5KMNA 3W16A 5E7RA 1IA8A 1WVWA 4DH7A 3IPHA 4LGGA 4F99A 3QTZA 2VTQA 4FZ7A 2V62A 1JKSA 5HI2A 3WF7A 2YWPA 4M68A 4FI1A 4KS8A 3LCDA 5AAGA 5HVJA 2EXMA 5KMMA 2WIPA 3QHRA 2XKEA 3FY0A 2WTKC 5BVWA 4C61A 4TW9A 3F2RA 4RIWB 3PIYA 4RSSA 4C2WA 4ZY5A 1H8FA 2OFVA 3DAKA 2UW9A 3FMKA 3MH3A 4FSUA 4J52A 3AD5A 3VNTA 3ZMMA 4O0YA 2RFEA 2QD9A 1FMOE 4M69A 3UZRA 4CKRA 3GC9A 3F2AA 1IAJA 3KRWA 4QPAA 5LVMA 2W9ZB 5AP4A 2C6LA 3C9WA 2VTHA 4FTAA 2W9FB 4APPA 3BEAA 2X2MA 2ZMDA 1ZOHA 3OG7A 3VS5A 4O0SA 3ZRKA 2WTCA 4QMUA 4WO5A 2JDVA 3BLQA 1J91A 5DRDA 3QYZA 4EOQA 1UU7A 1VR2A 2HZ0A 4P2KA 5HO7A 3FHRA 3EH9A 2XK7A 5AIRA 4X7QA 1OMWA 3P5KA 4E20A 3U6HA 4YSJA 4D2VA 1OL6A 1YI6A 2Z02A 5BUEA 4EYJA 1Q41A 4V05A 2RSVA 4PNKA 4FOBA 4TZRA 4DH1A 2IW9A 2WU7A 3VS1A 3RGFA 4QTEA 4H3BA 1APME 3AC1A 4FZDB 2ESMA 3RK9A 3Q52A 3ATSA 3OWPA 3EYGA 4U9AA 3E8DA 5B2LA 2I0YA 3SV0A 5J7HA 4RWIA 3DBDA 4GL9A 4IANA 1XH6A 4IM3A 3ID6C 4BY9E 2WTVA 1J1CA 4BWXA 3QF9A 3B2WA 3UO5A 2VAGA 1NY3A 3REPA 2JGZA 2ZB0A 3K5VA 2DYLA 3PXQA 1LPUA 4K2RA 4YZMA 4YLLA 3OF0A 3AT4A 4FV5A 3LFQA 3MVMA 4PPAA 5AADA 4W4YA 3D94A 3F7ZA 3LVPA 3O7LD 3ORXA 4CRSA 2OJFE 3DK3A 1UNHA 1ZYLA 5KZIA 3UYTA 4ZTSA 1W83A 3R63A 4FV4A 4KKHA 4NH1A 5FEQA 1K2PA 1M7QA 4YJVA 1IRKA 5GIPE 5KO1A 4DTKA 4FKPA 1Q8UA 5CYIA 2V55A 2WMWA 2XVDA 3AC2A 2YJSA 1PXOA 1WBWA 5CAVA 4C7TA 3EN7A 4DA5A 4S34A 3JY0A 2VTSA 3TV7A 3RK5A 4AN3A 2XF0A 1YKRA 4ENYA 2Q0BA 2W4KA 3F7WA 3RBWA 3AC5A 4YO6A 2OH0E 5HNIX 3WZDA 1ZAOA 2CSNA 3HUBA 3DY7A 5F20A 4UMQA 3MBLA 2F7EE 4O86A 4A9UA 1GIJA 2Y6MA 5K9IA 3NW6A 3C5UA 4M67A 3R1NA 3SOCA
chains in the Genus database with same CATH superfamily
2QOKA 5CU6A 2E9VA 3OUKA 3PJ8A 3ORPA 4HNIA 3TNPC 5DMZA 3C5IA 1U4DA 2C3KA 2UVXA 4DC2A 2PZ5A 2VTIA 4IX4A 4L53A 4M3QA 1UNLA 5HIDA 1PMVA 4AOTA 3LMHA 3OOGA 4FTNA 3PWDA 5EHLA 5IEYA 1OECA 3AT3A 2GHMA 4QPMA 5DT4A 2QQ7A 5B2KA 5IA5A 2IZSA 3BKBA 3EN5A 4RWKA 4UXLA 4Z7HA 4RQVA 3OMVA 2B52A 2XYUA 3A60A 4WNPA 4HZSA 3NUYA 4E5BA 4FKGA 4JXFA 3RPRA 3TNWA 4AE6A 3ORIA 5HKMA 4J8MA 4AU8A 1MRVA 4IFCA 5HGIA 3OXZA 3N9XA 5BPYA 5CQUA 2FB8A 3QLGA 4WUAA 1R0EA 3BCEA 2OG8A 4FVPA 5CNNA 4K1BA 5A6OA 5AAEA 3VRZA 4YJTA 3TT0A 4CQEA 3MDYA 3SW4A 3Q2MA 3R2YA 4WHZA 2Y8OA 3RAIA 4DFNA 4IZAA 2C6DA 2WEVA 2XNEA 4FJVA 3Q32A 2WQNA 1OIQA 3C4CA 4LL0A 3RVGA 5IQEA 4F0FA 2H96A 4TYIA 5KX8A 3A7GA 1JSVA 1AQ1A 4XYFA 4E4LA 5E1SA 4YTHA 1RDQE 5EQYA 3VUDA 3TIYA 2YCQA 2Y7JA 4RG0A 2CPKE 1QPJA 2X1NA 4G17A 4YSMA 1RQQA 2HY81 4EH7A 4RT7A 3UYSA 2GQGA 3R28A 4AGDA 2ZM1A 1PY5A 2C1BA 3CTQA 3PE1A 3PWYA 4RA4A 3EYHA 2R3FA 5JRSA 4I5PA 2AEGA 4H58A 4G34A 3V8WA 3W0MA 3O8UA 4MUQA 5AP6A 4OGRA 4R1VA 4DLJA 4EBWA 3OCGA 4KABA 3UQCA 4DDIA 4C59A 3HDMA 2DQ7X 1DI8A 4KBAA 1H1QA 4M15A 4W4XA 5A4QA 4FZAB 3WZUA 3UOKA 3POZA 3QGWA 2VUWA 3QTRA 4FL2A 3EFWA 3SD0A 1G3NA 1Q8YA 4G2FA 4L3LA 2HWOA 1CM8A 2O63A 5AR2A 3L9LA 4NUSA 3K2LA 4R8QA 4A06A 2HIWA 2XNMA 3W2QA 4GEOA 4E5WA 3LAUA 3PJ1A 3BYUA 2O0UA 2OSCA 3I6WA 4U3YA 3NFGB 1PJKA 5E8SA 2BZKB 1YQJA 3M42A 4O96A 5FEDA 4FSRA 5M51A 1U5QA 4IWOA 4U0IA 5CF5A 5JH6A 3R1YA 4EONA 2XJ1A 1STCE 2YM8A 4MWIA 2YM5A 1BLXA 4GVJA 4X3FA 4AXAA 5EM5A 3TKIA 4OLIA 1W7HA 4BTKA 3FC1X 3FMLA 1H28A 4PV0A 3SKCA 2BRNA 4FSQA 4AUAA 3FHIA 4O27B 4XOZA 4C4HA 2ZM3A 1PF8A 3LLTA 4FV2A 1BL6A 4NTSA 2X4FA 3O96A 4IH8A 3WZJA 2JKMA 3FI8A 4M8TA 3ZM4A 2GFSA 2JAMA 1XH9A 2PL0A 4IB0A 4DHFA 3E92A 3FQHA 3NW5A 3N4TA 2BDWA 2R0IA 2LGCA 4YZNA 2QOHA 5HU3A 3CLYA 4WD5A 2A1AB 5IA4A 5KHWA 3IGGA 5LQFA 2JDRA 3A4OX 3OEZA 4RJ5A 3MB7A 5J8IA 5E8VA 1W0XC 4HGTA 2W1CA 3ERKA 3ZHPC 1Q24A 2YISA 3A4PA 5TE0A 4ZLOA 2QONA 4U6RA 3D4QA 4ZSGA 2XALA 4HVSA 3ZFXA 2XK4A 3ZONA 3W2PA 2OZAA 4GJ3A 3OXIA 2YCFA 4E3CA 4PP7A 3TL8A 2CNQA 3PYYA 3V5LA 5AWMA 1ZOEA 4WIHA 3VRYA 5K0KA 1SMHA 3VQHA 3NEWA 5J87A 4V0GA 2XAMA 3ZUUA 2F49A 4LM5A 3TUDA 5KMIA 3IDPA 3A62A 3ROYA 3VUKA 1W2FA 3LFSA 3JPVA 2OW3A 4MQ1A 3WF9A 3OWJA 3UTOA 4RFMA 3Q4CA 4RIYB 3E5AA 2W1FA 5TF9A 5I9XA 5JMSA 4BL1A 5IQIA 4XV2A 2XM8A 4E6AA 4BCNA 4FV7A 2UZTA 5D11A 1ND4A 3KREA 1CDKA 3ZSHA 3H9FA 4NL0A 2BILB 4KIQA 5ANIA 3NCZA 3VVHA 4FTOA 4QYEA 3I7CA 4O7VA 2OU7A 4NIFA 3QTWA 3SX9A 1XH7A 5KBQA 5C27A 1W98A 2PHKA 3R9NA 3MY1A 3U54A 4XV3A 2VTMA 3EQCA 4RIWA 4LRJA 3RNYA 2YWVA 4AT4A 3PFQA 2P0CA 2R3OA 3L1SA 4E93A 4EOKA 4BCFA 2GNLA 5LARA 1DI9A 2UZUE 5JGBA 4ARKA 2DS1A 2OFUA 3DNEA 3H4JA 1XH8A 4FKLA 3KVWA 3PSDA 3UMWA 3NYXA 5IA3A 4GT4A 4ACDA 2HYYA 3O23A 2ZB1A 5EW3A 3ZLWA 4O7NA 4QTBA 2UW8A 3DK7A 4RQKA 2WB8A 2WTIA 1WMKA 4JAIA 1JSTA 4IVDA 3LMGA 4E6CA 3EFJA 3VIDA 5A4LA 1XWSA 5CF8A 2YHVA 3GC0A 1YXXA 5JFWA 3GU8A 5M09A 4FG9A 4UV0A 3DKGA 3VS3A 2PMLX 1XR1A 3NNWA 4ZS0A 1URWA 5IQCA 4GV1A 4IM0A 5M4IA 5EW8A 2PULA 2X81A 4LFIA 4UXQA 3E8EA 5CXZA 4R1YA 5LCJA 1YWRA 3BU3A 3ODYX 1ZLTA 4FTMA 2ITTA 1LP4A 4GK3A 4XBRA 1PRYA 5L8JA 4D4SA 4X2GA 3DKCA 2QG7A 4YO4A 4PMSA 2R7BA 1ZYJA 3KRLA 2W4JA 3NIEA 5J79A 3UIMA 3TTIA 5AA9A 4EZ3A 3GI3A 3FI4A 1OIYA 4ZY4A 2GDOA 3OOMA 4QYYA 3KN5A 5BMMA 2VX3A 4EH4A 1PXKA 2Z60A 3F5PA 3R9HA 5AP3A 4I22A 5FGKA 4FKTA 4AZVA 4XH6A 3MW1A 3UOHA 4PDYA 5EM6A 3V6RA 3B8QA 1TKIA 2B9FA 3LCKA 3QKLA 4RVLA 5AV0A 5DPVA 4O2PA 4DT9A 2X7OA 3R01A 4P7EA 3VN9A 2FGIA 3KRXA 5CF4A 1KE9A 3JS2A 3O50A 2JAVA 3BRBA 3HZTA 3A7IA 4QMZA 2OF2A 2B54A 2IW8A 1JPAA 2ITYA 3P5JC 4AW0A 4Y83A 3ALNA 3RHKA 4U42A 1CSNA 1ZZLA 4YBJA 4BKYA 5HD4A 4CZTA 2WQEA 2GMXA 4D4YA 2UW7A 1ZARA 2JITA 3FWQA 2I0VA 3I60A 3MS9A 4XG6A 1H26A 4YU2A 3I81A 4EH3A 4I94A 4IAAA 2VWZA 2WMAA 1PMNA 4MVFA 3PJCA 3W2OA 2VX1A 4RLLA 3UG2A 3QUPA 4YJPA 4ACCA 2WQBA 3K54A 4PWNA 3KXGA 3RCJA 5IH5A 3N51A 3RP9A 3UIUA 2BRGA 3TZ8A 5ITAA 5L4QA 4OTIA 3CS9A 3ZOSA 2NP8A 4J97A 4AXDA 4Y85A 4IDVA 4FOCA 4D1ZA 2ITQA 1WVYA 1ZMVA 1O6YA 4R5YA 4AQKA 1PXMA 4EOPA 2JDSA 4JG6A 3RALA 4ZLYA 4R5SA 1YWVA 3MFTA 5HLNA 4U81A 4J98A 2G01A 1YDTE 2FVDA 4OW8A 1FMKA 4CD0A 4WBBB 4D2TA 3ANQA 3WE4A 4KBCA 3I5ZA 3BYVA 2QR8A 3UQGA 3COHA 1W82A 2GS7A 4IZ7A 4LV5A 5BVEA 3MY5A 3R9DA 3AC8A 5FXRA 3VONA 5HU9A 4DH5A 4IVCA 1IA9A 1Q8TA 2HXLA 3U9NA 5I9VA 5K4IA 2ITXA 5LXMA 2BUJA 4BTMA 2CKOA 2X2LA 3F69A 1YI4A 3IKAA 3KFAA 2JIUA 3HV3A 3RM6A 1OB3A 3VHEA 5IEXA 1G8SA 5DA3A 3C7QA 3ZXTA 2IVSA 3IW6A 2JDOA 2UVZA 3ATTA 4E5AX 3GUBA 2BFXA 2F2UA 1PXIA 1ZOGA 5T6KA 5I9WA 4XS2A 5EYKA 2WTJA 4OAUC 3PIZA 4USDA 5LMBA 4JAJA 4H3PA 4BGGA 2P4IA 1V0BA 1GZKA 2BROA 3MIAA 5JZJA 4O82A 1MP8A 1ZRZA 1R3CA 4TWOA 4S33A 3ZU7A 1G8KA 2C0OA 3QCSA 4QP2A 3W2RA 4FKSA 1WCCA 2BHEA 2OH4A 2XK8A 3HMIA 4I0TA 4IAYA 4Z9LA 3RAHA 4ACGA 4WNOA 3ORMA 4CCUA 2HZ4A 4MNEA 4B9DA 3ORLA 5A9UA 5EHYA 4YPSA 3VUGA 3MESA 2O3PA 3KK8A 4A9RA 4BDFA 3NSZA 4ALWA 1OM1A 3G90X 4F6UA 2W5HA 1P4FA 1J7LA 3VJOA 2R3KA 2SRCA 4NM0A 3FQEA 4O91A 3R7VA 3OVVA 4QO9A 4G5PA 2JIIA 2W06A 3P7BA 3K3IA 3RWPA 4D28A 4EOJA 3KXMA 4O83A 2PE0A 2WKMA 2XIXA 1M7NA 3WE8A 1GAGA 3P08A 3F3VA 1Q8WA 3GC8A 3M2WA 4U45A 3R1QA 4J7BA 3GCPA 3OC1A 4UZDA 3P1AA 1E1VA 3PY0A 2RIOA 4BI0A 4C33A 1FVVA 2A4LA 3W0OA 4XOYA 3ZBXA 2C4GA 4QMQA 5E9EA 4NSTA 5HIBA 4ASDA 1V0OA 4RBLA 5IA1A 3RPYA 4ZZMA 4ZMFA 3DK6A 4L00A 4M66A 4J71A 5JFSA 4DBXA 4KINA 5M4FA 4JQ8A 3UGCA 1H4LA 5CAUA 4ASZA 2DWBA 3CKXA 2HELA 4ZSEA 3S1HA 1UWJA 2IEWA 4XG3A 5E8XA 4RZWA 3VO3A 4ZSLA 5B7VA 5F1ZA 1LEZA 2PZRA 3OBGA 4N57A 5FTGA 4B8LA 3RPOA 1M52A 5HORA 4AF3A 2R3PA 4X2NA 4JOAA 3UVPA 4FX3A 4F70A 3MI9A 2AC5A 3QQLA 4DCAA 2BRBA 2E9UA 3F61A 4E8AA 3ORNA 2C68A 2YDJA 4QTAA 5GINE 4EH9A 2O2UA 4JR3A 1SVEA 1JWHA 2WEIA 4AT5A 2QOQA 2BIKB 2R3HA 3E64A 3QTIA 4MX9A 5DH3A 4IM2A 4AACA 2J5EA 4EHGA 3FZOA 4YJOA 5CSVA 5IA0A 1BKXA 3BBWA 1KE7A 3HEGA 1J3HA 4NTTA 3QRIA 4FIGA 4IWDA 4CFWA 4X6QC 1JQHA 4DT8A 3SHEA 5EI8A 4E7WA 1L8TA 5HEZA 4EH2A 3NUXA 3RJCA 2G15A 3ZLSA 4FZ6A 4RVMA 3VBVA 2YITA 3GENA 4FG8A 4BHZA 5EQPA 1Q61A 4R7BA 4ZZNA 3PVWA 5BVFA 5CAQA 1YXVA 5GHVA 3EKKA 5LVLA 1F5QA 3TN8A 4AXFA 3PY3A 4RX5A 3KMWA 4ANLA 4A9YA 4LV8A 5KBRA 1VJYA 3DXPA 3VS6A 1XJDA 3LIJA 4ERKA 4FL3A 1YW2A 4BTJA 5I9UA 3FL4A 4NKSA 2VU3A 3LM5A 4EWHA 4O81A 4X2JA 4EK6A 2JEDA 5GZAA 5L2WA 3O51A 5A46A 4G31A 3LFEA 3WF5A 3BEGA 3NCGA 3W8LA 2R3NA 4IC7A 2C6MA 4RFZA 3KF7A 3ZDIA 2YZLA 2YDIA 5J95A 3WARA 3JXWA 4EK8A 3TJCA 4F08A 3VS0A 4CFXA 3OTVA 3P78A 1Q3DA 5JKGA 1L3RE 3BGQA 4FGBA 3NIZA 2CLXA 3FLWA 1XBCA 5CX9A 3S95A 2PYWA 4NYEA 4QQJA 1QPEA 2QG5A 5BVNA 3G9NA 5AP0A 4PDSA 1Y57A 3I0QA 4MQ2A 5H9BA 4FIFA 4MH7A 5EI2A 3VC4A 3BYOA 4JS8A 5EH0A 4QYFA 3MH0A 4ITJA 4DYMA 5A4EA 3RM7A 2WIHA 5E1EA 2Z7QA 4P4CA 5DFPA 3RINA 4IAZA 4YZDA 1SZMA 2XBJA 2XIRA 3OW3A 4KSPA 4RJ4A 1M2RA 2ONLA 3BHHA 3KU2A 2WMVA 4JDKA 3PA5A 5L2SA 3R71A 2P3GX 4QP1A 4DGGA 3KKVA 2WTKB 4O1OA 5KE0A 4FV0A 5BVDA 4G3EA 3W2CA 3F9NA 2PZYA 4M84A 2JD5A 3LFFA 3M1SA 5HCZA 1G8AA 3QQGA 3ZM9A 1IAHA 4JX3A 4CQGA 4OT6A 1BI7A 4RWLA 5DEWA 1R1WA 4GRBA 2YM6A 4N6YA 4C35A 4DEBA 4O7RA 3ZO2A 1EH4A 4ZTNA 3TG1A 3CP9A 3EJ1A 2Y4PA 3U51A 2XIYA 1OL7A 3BZ3A 3DAEA 4QMXA 2VWIA 4RIXB 2ITOA 3PPKA 5CI6A 1LUFA 1Q5KA 4C3FA 4IWQA 4NCTA 5IH4A 2I6LA 2OF4A 3NNUA 5F4NA 5I4NA 3R8MA 3QQKA 5L2QA 2JBOA 3ULZA 4E26A 2A98A 2YIYA 3H10A 2H9VA 2VTRA 3O7LB 3E93A 4CV8A 4DFLA 3G0EA 2XS0A 2FSLX 5FTOA 5HHWA 4AAAA 3JVSA 2J6MA 1UVRA 4JDHA 2BDFA 3DAJA 4E4MA 2GU8A 4O4FA 1M17A 2ETMA 2ZV2A 3FDNA 4X3FC 2Z2WA 3GQIA 2NYAA 4EC9A 4FEWA 3PJ2A 3VUHA 2R7IA 1P2AA 3JY9A 3P4KA 4NEUA 4O7SA 1NA7A 4W4WA 1U46A 3ZTXA 2PTKA 3IOPA 1Y6AA 3QQJA 4FSTA 4BGHA 3SOAA 4HYHA 3PVBA 4RVKA 1X8BA 2BTRA 4A9SA 4FODA 3QKMA 4FSWA 2O65A 4EOMA 3NNXA 3CGFA 4FK6A 4O7TA 5AV2A 3TDVA 4QP6A 4IEBA 3LQ8A 1XBBA 1P5EA 4U7ZA 4CMOA 1GJOA 3KULA 4ACHA 4G16A 5EG3A 3THBA 4HJOA 3ZRMA 3WIGA 2XH5A 5AUYA 1SYKA 2B1PA 4PMMA 3FLQA 3WBLA 3S2PA 3CTHA 4APCA 5IEVA 2UW0A 1YOJA 2VTJA 3KMMA 4YTIA 4IMYA 4OTRA 5LMAA 2JDTA 2OXDA 2ZV8A 3BU5A 2JIVA 2VWYA 4WOVA 4FMQA 1MQBA 4O0RA 4ZY6A 4QP3A 2HW6A 4ZTLA 4JIKA 5KZ0A 3P23A 4FUXA 1DM2A 5E91A 2B7AA 1REJA 4TTHB 4TYHB 4I5HA 1A9UA 4GG7A 4N6ZA 4U97A 1JOWB 4IZYA 3VJNA 1UWHA 5G1XA 5CU4A 4LOPA 4MKCA 4NJ3A 4C4IA 3VUMA 4AA4A 4HYUA 5BYYA 3A99A 5C4KA 4W9WA 2W1HA 3AGMA 4ZMEA 4PNIA 2YN8A 4D2PA 2RFNA 4IWPA 4YP8A 1U54A 5HX6A 2QOCA 4QMMA 3IDBA 4DGMA 4BI1A 4CZYB 4FVRA 4ERWA 3LW0A 2WQOA 2VWXA 4O4BB 2CNVA 3W0PA 1JKKA 4CFUA 4R7HA 3OHTA 2FO0A 1YDSE 1YWNA 2UZOA 4XMOA 3WOWA 3ZO3A 5LOHA 4LQMA 2J0KA 3S0OA 2JC6A 4YNOA 1FQ1B 3BLRA 2VGPA 4ITHA 4RFYA 4G5JA 4YJNA 5J9YA 2G2HA 4U43A 5E8ZA 3T9IA 4AGCA 3GCVA 3KVXA 2OIDA 3HA6A 3TMOA 3GP0A 4LUDA 3MTLA 2GNJA 2Y4IC 4I1ZA 3BBTB 1Q97A 1SNUA 4XV9A 4WG5A 4YC8A 5FDXA 4QQTA 3OWLA 4LGHA 4IAIA 4I5MA 4ALUA 3CY3A 3D83A 4A9TA 5C8MA 3L9MA 5AP5A 3DBQA 2I1MA 3BX5A 1OUKA 3TZ7A 4F6SA 4L42A 4YGAA 3PTGA 4QP9A 3FBVA 3OXTA 3DKOA 3MGYA 4FT0A 1IASA 2R3GA 4U44A 2BIYA 3TV4A 4CMUA 4MNFA 1RJBA 5EDPA 5CSXA 4S32A 5LCKA 1A06A 1WFCA 2W1DA 4FTKA 4ZAUA 4DE4A 2ETRA 2CGUA 4FIIA 3I4BA 5CALA 4OT5A 4F0GA 3ZBFA 3UNKA 3PG1A 1WBSA 4J1RA 2BRMA 1YRPA 1YXTA 3WYYA 4BB4A 2PUPA 3EQPA 5E4HA 3OBJA 4M13A 2WU6A 3Q53A 3GCSA 2ZOQA 2GQRA 5AMNA 1OKYA 5CEIA 3RI1A 3EQDA 4DFYA 3MV5A 3Q60A 2B9IA 3DV3A 4IJPA 4NW6A 3GXLA 2YERA 4ACMA 3NUAA 5HBJA 5FXSA 3W0SA 1OL5A 3QD3A 4JQ7A 4WT6A 4YJRA 3L8SA 4G9CA 1TZDA 3QTQA 3FSKA 4C38A 3V5TA 2XKCA 2PZPA 1FINA 1JVPP 2YAAA 3EQGA 4TRLA 4IAFA 4XRLA 4ZS4A 1SNXA 4XG9A 5JN2A 1PYEA 1PXJA 4O7WA 3GOKA 3TNIA 3H9RA 3DT1A 2IZRA 4I6QA 2UW5A 3DXNA 5H2UA 3E3PA 4YHJA 3CY2A 3UC3A 3QRKA 3S00A 3AXWA 4KBKA 3FSFA 3RTPA 5ANJA 3AD6A 3UP2A 4FSMA 5ETFA 4DGLC 2F9GA 4M12A 4R3RA 4DG2E 1KE5A 2R2PA 4QTDA 5AV3A 3A7FA 4BI2A 3GCQA 3E8CA 2ZVAA 5CVFA 5EK7A 3VBYA 1WBPA 2ZM4A 1BYGA 3QCQA 3A7HA 4S2ZA 4YZCA 4ZOGA 3KXNA 5IQFA 2P33A 4M0YA 3FZSA 4ZJJA 3PJ3A 5JFXA 3FLYA 4O1PA 4QYHA 4TYJA 4UYAA 3FXXA 4ORKA 2IVUA 3D0EA 5DYJA 2CJMA 5EM8A 3WYXA 3N4UA 3C4ZA 5CU2A 2XIZA 5JQ8A 2XJ2A 3CD3A 1YHWA 3MVHA 3ZRLA 5A4TA 3E63A 5DLSA 4EOOA 1ZYDA 4RC3A 2XNPA 4L9IA 5CZHA 2I40A 4NZWB 5JQ5A 5GIOE 3A2CA 2ERKA 4XCUA 4CYIA 4UWCA 4BYIA 3R8ZA 2BRHA 5D7AA 3QX2A 4PL5A 1JKTA 4JRVA 4R7IA 1KE6A 5E8TA 3BHTA 3SGCA 4UMTA 2KULA 4FKVA 5AR8A 4AXEA 3R83A 2IF8A 3ETAA 3NGAA 5AR7A 4RA5A 5TR6A 3VUIA 1PXLA 4PL3A 4GFOA 5CAOA 4AFEA 4HCVA 4Y8DA 4BKJA 4H3QA 2X0PA 5EOLA 3MWUA 3BELA 5B0XA 3GU4A 4FTJA 2W5AA 4NM3A 2R3IA 2UUEA 4LL5A 2BZJA 4YMJA 5IDPA 3RMFA 4BBMA 4IQ6A 3EKNA 3BI6A 4TWNA 3KB7A 2YDKA 5FM2A 3TACA 3Q4UA 3TEIA 2RG5A 2YLFA 1H25A 3OS3A 3NAXA 4DEEA 3QQHA 5CENA 4WRSA 2VGOA 2XMYA 3HRBA 4WNKA 3WI6A 5BQ0A 1W84A 4MXAA 5CT0A 3BLHA 3SDJA 5IZFA 4TXCA 5E8YA 2YZAA 4IB3A 1REKA 4X2KA 3SG9A 3HGKA 3FZPA 3F5UA 2FYSA 3FMNA 4RJ8A 3AKKA 2BAKA 4EI4A 5CVGA 2F7ZE 4RJ3A 3NZ0A 3UC4A 2F2CB 1FGKA 4BICA 2UZVA 4D58A 2PSQA 4I4FA 2HWPA 5EKOA 5HX8A 4X0MA 1T45A 4DCEA 3N4VA 3R00A 1XH5A 4C34A 1E9HA 2XA4A 4EK4A 3QQUA 2W0JA 4BJJB 2J0LA 3QRJA 3U4UA 3SVVA 3TV6A 4C8BA 4D2WA 3L8PA 3UZTA 4NW5A 3ZC6A 4D4RA 3D7TA 4UWYA 1Y6BA 4OBPA 1KOAA 2QNJA 2VWBA 4RIXA 4BDBA 3Q9ZA 4IVAA 4HYSA 2OJIA 5CI7A 3PRIA 2X4ZA 4BDIA 1TFFA 4AQCA 2WO6A 3C4FA 3RPVA 4I6HA 5CASA 4JMQA 3HV5A 4RVTA 4CYJA 4NKAA 3WIKA 2P2IA 4PMPA 5IQHA 5HZNA 5JZNA 4KIKB 1LEWA 4L46A 3TNQB 1CKIA 3HRFA 2OZOA 2QODA 3HL7A 2QOIA 5L2TA 5LVPA 4LGDA 3R73A 2WMXA 4O6LA 4A4OA 4OTPA 1MUOA 4CZUA 4FE2A 4ZZOA 1YOMA 4ZSJA 4M97A 5LJJA 5AX9A 4I24A 4A07A 4Y46A 3UOLA 2RL5A 2WMTA 1YOLA 2GCDA 2I0EA 5EHOA 4ZJIA 1ZY5A 3POOA 2B4SB 4UEUA 1OPLA 5CANA 3FMHA 5CEPA 5AUZA 4QPSA 4JL9A 2X9FA 2BR1A 4C02A 4B99A 3PLSA 3KMUA 5F94A 3HNGA 4FKIA 3CSVA 4USFA 1NVSA 2YM4A 3DOGA 3W1FA 4D0XA 3SRVB 3AOXA 1XMLA 3QD0A 3T3UA 3UDTA 1SM2A 2F7XE 3EIDA 4JR7A 4OTWA 3TM0A 3PY1A 2QCSA 3E7VA 4U80A 3ZO4A 3ZZEA 2HAKA 3OEFX 5LVNA 3PUFC 2FH9A 3II5A 4FVQA 2PU8A 2OLCA 4TPTA 3LKMA 5EM7A 5D12A 3GU5A 1XKKA 5JRQA 2A2AA 5AP2A 2J51A 4AN2A 3NDMA 3B2TA 4IHPA 3MN3A 3CXWA 3OY3A 5TKDA 4UBAA 4CEGA 5I9YA 2W7XA 4IJ9A 4CFNA 4CXAA 4EZ7A 3UIBA 2GPHA 5TT7A 4I21A 1WBTA 4ANMA 3HRCA 4HVHA 1OGYA 4XRJA 1XMMA 1JBPE 1NVRA 3EQRA 4Z16A 2B9JA 3LXKA 5D7VA 4H1MA 3S4QA 1IEPA 1ZYCA 1XHAA 3QAME 1XO2B 3MPTA 4AGWA 4BN1A 4BZNA 5AA8A 2VTTA 3RKBA 4F1MA 4YC3A 2G2FA 4LDTA 3U87A 1KV2A 1VZOA 3TUCA 3UODA 4USEA 3PSCA 5J5SA 3NMUF 1XH4A 3PDTA 5HTBA 3PZEA 4W4VA 4DLIA 4L3JA 2RKUA 3LPBA 2BFYA 3NVMB 4YJUA 3LMIA 2XCKA 2GSFA 1W2CA 4LI5A 1OI9A 4IX6A 4RRVA 1PMUA 4MTAA 4BWPA 4L44A 4AGUA 4QMVA 4JDJA 2HCKA 2J0IA 2R0UA 3AMYA 4CV9A 4ALVA 3ACKA 2ONLC 3O17A 3FV8A 5FG8A 5J5TA 4K33A 2FA2A 1YDRE 3ZDUA 4GKIA 4GK2A 2R3LA 4ITIA 4MXOA 5DE2A 4XLIA 2QC6A 5CEOA 2CGVA 4O7ZA 5GJDA 3K5UA 3AC3A 4YLKA 3NUSA 5KMKA 4UMPA 2ZV7A 5D9HA 5DWRA 2YLEA 5DN3A 5EOBA 4CTBA 3O8PA 4M69B 4A7CA 2UZEA 3F2NA 4LMUA 4H36A 3HKOA 3Q9YA 4CRLA 3HDNA 3FMDA 3ZXZA 3CC6A 3KA0A 5HTIA 5K4JA 4NCTC 1P14A 4H05A 5FLFA 4CG9A 1OITA 3I1AA 4G3GA 3LM0A 4O2ZA 4BBEA 5ANEA 2J9MA 3P79A 4IACA 3CGOA 2PWLA 2QLQA 2W1IA 4JT3A 1QMZA 4Q9ZA 4I23A 3P0MA 3DXQA 4KUJA 3PLAE 3PXZA 4L45A 2VD5A 3F3WA 4EYMA 3R9RA 2IZTA 2QHMA 2GQSA 4ZJVA 3AD4A 2WTWA 4HNFA 3R7YA 1O6LA 2FUMA 4QMNA 3LQ3A 2PPQA 3CE3A 4YBKA 3RHXA 5HTCA 4XLVA 4HCTA 4EOIA 1ZY4A 3MH1A 5AR5A 4BFMA 4OTGA 2BZHB 2E2BA 1WBNA 2XB7A 3TIZA 4XUFA 3NUUA 2VNYA 3HV4A 5IQBA 4BDJA 3ELJA 4R77A 2C0IA 3T9TA 5FBNC 4JX7A 4MBLA 4FIHA 4K8AA 1SVGA 5JK3A 3BV3A 2IO6A 2P55A 3U6IA 3DKFA 1E1XA 3QZHA 4IDTA 5A3XA 4U79A 5KMOA 3COIA 4TNBA 4G9RA 4FKUA 2EU9A 1H07A 2QOLA 4RMZA 5H8GA 2A0CX 3FYKX 3WZEA 4B4LA 4FKRA 3UVQA 3ZSIA 4C4GA 1V0PA 1ZWSA 4EHVA 3UNJA 3TKUA 5K5NA 1UU8A 1B6CB 3SLSA 5HVKA 1BI8A 2CHLA 2XBAA 2R3MA 4F6WA 4WUNA 2GHLA 2X39A 3GNIB 5CSWA 1JSUA 3EQFA 3KEXA 3Q9WA 4HYIA 2QVSE 3MSSA 2PVLA 3EMGA 4WA9A 3EFLA 4E6DA 3FKOA 3MFSA 2UV2A 3I7BA 1NT2A 3QBNA 3E3BX 3TWJA 2GTMA 1URCA 3IDCA 5GJGA 4D5HA 3DBEA 1AD5A 4XEYA 4PTEA 5HE1A 4FL1A 4BDHA 4EOSA 2PUNA 3F3TA 4JBPA 2R3JA 3R9OA 5IPJA 5AUVA 3VBWA 3IGOA 3