3E64A

Fragment based discovery of jak-2 inhibitors
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
293
structure length
291
Chain Sequence
RDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-based discovery of JAK-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
total genus 101
structure length 291
sequence length 293
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e64A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e64A01
1PKDA 1Z5MA 2NRUA 3QL8A 4AA4A 5HX6A 3DXNA 2HZ4A 1ZRZA 2WTJA 1GIJA 3FI3A 3RALA 3WI6A 3D0EA 5HG9A 3TV7A 2YM5A 3Q9WA 4QMVA 3ZBFA 3DB8A 1VZOA 2IW8A 3TNQB 1IEPA 1G3NA 2JLDA 1QMZA 2XIZA 4WRSA 5EDQA 3PPKA 2ONLC 4U45A 3Q2JA 2QLQA 3MI9A 3GU7A 4G34A 1YXTA 2OXXA 4IWPA 5CQUA 2G2HA 4LQMA 3DTCA 4NZWB 1XR1A 3BQCA 4EONA 5E9EA 2NP8A 3FMJA 4RC4A 3RTPA 3VS3A 4A7CA 3OBJA 4RJ6A 4TKSA 3MN3A 4I6QA 4O27B 3I7BA 3NLBA 3AMYA 1VR2A 3F3UA 4GJ3A 5ANEA 3VW8A 2YACA 3OCBA 2H6DA 4R8QA 1IAHA 2R3PA 3MFUA 2Y4PA 3LFDA 2OO8X 5DT0A 5BQ0A 1Q62A 1VJYA 2EWAA 4MF0A 4BY9E 4PPCA 3ZDUA 2H9VA 2W5BA 5HBEA 3DBDA 5C8MA 5HTCA 1H1PA 4GFGA 3R7EA 4TNDA 2XJ2A 4APCA 4ZTSA 3P78A 3A60A 3EYHA 3QRUA 3BE2A 4QPMA 1U59A 5EKOA 5CXHA 3THBA 3P7CA 4UWCA 5AR4A 1SVGA 1XH5A 4KS8A 4DH1A 1OITA 2F49A 4MAOA 1P4OA 3CJGA 2B54A 3EHAA 3CP9A 2JDOA 4ZTRA 1OKWA 5FTOA 4ZJJA 4E4XA 4NW5A 4DH3A 4KBCA 4CKJA 3Q4TA 3UVPA 4AZVA 3KVXA 1WVWA 4O0WA 4RVLA 4W8DA 1Y8YA 2NO3A 4XG2A 1MP8A 4O1OA 3C0GA 2R3GA 4HVHA 3P08A 4TWCA 3GI3A 4UX9A 1OECA 2GQGA 1PXKA 5JH6A 3DAEA 2P55A 5F9EA 3MPMA 4BCIA 4FTUA 3EQFA 5EW9A 1VYZA 4DGNA 3MB7A 5D11A 5M4FA 3GNIB 3FJQE 3QTZA 1U54A 2I40A 2W4KA 4C4EA 4BCKA 3S4QA 5CLPA 3ZUUA 2QR7A 1JAMA 3R8ZA 4NJDA 4H3QA 5HE2A 4I94A 3UO5A 3OG7A 4MYGA 3OXTA 4H3PA 5HG7A 3MY1A 4C36A 4D5KA 1JOWB 3E93A 5E8XA 3CKWA 3LJ0A 5KX8A 3EN4A 3D5VA 3ZSHA 4RFZA 3PSBA 5AM7A 5G6VA 3NAYA 3VUTA 4I6BA 2J2IB 3POOA 3HRFA 3GU5A 3LM5A 3PVWA 4LV8A 5L2IA 2A1AB 1WCCA 1M14A 2OK1A 3MWUA 4XCUA 3V5PA 3FC1X 4IVAA 3PWYA 3EZRA 3CBLA 3WE8A 4C2WA 1KOBA 2J9MA 1PRYA 5E1SA 4JT3A 4QP7A 1XWSA 4O7ZA 5LVLA 4F9AA 5EHLA 1SYKA 5TO8A 3GBZA 3CTQA 3R1SA 2W0JA 4NYEA 3AC5A 2HWPA 4X3JA 3SAYA 3W2QA 3MPAA 4TTHB 4C62A 4XOYA 5K5NA 2WQOA 2CKOA 3NVKI 1Y6BA 1CKPA 3C4CA 3VHKA 2VTHA 4AW0A 2JDSA 3V5WA 5CAVA 5FEEA 3NR9A 5FRIA 1SNUA 2YDKA 3AD6A 4JG8A 4YLKA 2QC6A 5E8YA 4NU1A 4YPDA 1PXIA 5HE3A 3TCPA 3VS6A 1OKYA 4LOQA 3Q4ZA 1ZAOA 2DWBA 4YSJA 3COMA 4PDYA 3ORKA 3UNZA 4DN5A 2GHLA 4NSTA 3SC1A 4BDJA 4FKGA 3W2RA 3OT3A 2XA4A 4C38A 2C5OA 3TUCA 2PUPA 5A3XA 3EL7A 2X8EA 4ZP5A 4LOPA 3RZBA 3HP2A 3R6XA 3UTOA 3WF5A 3F2NA 5G1XA 3EQPA 4BZNA 4DFUA 4QMTA 5AUTA 4GK4A 2CCIA 4L45A 4M0YA 3UVRA 4FT3A 5BUIA 5CU6A 4L01A 2W1HA 3V5TA 4AT3A 3A8WA 1SM2A 3A8XA 1OB3A 3FKLA 1KSWA 5B2MA 3I7CA 4FT7A 4D2VA 1OL2A 1XQZA 5HO8A 3U6HA 1APME 2BRMA 4DEEA 2QR8A 4MEDA 4YZBA 3T8OA 3UPXA 5DR2A 4PMMA 3M2WA 5FTQA 3A4PA 4FV2A 4EH6A 4GG5A 3DDQA 4LMUA 2V5QA 4G17A 3ZO1A 4DFNA 2ITZA 5GZAA 4NM3A 4DT8A 2R0UA 3QKKA 2HY81 3WZUA 2HW7A 2UW0A 2QOHA 4FEQA 4JS8A 5HI2A 2PVJA 5DOSA 4RC3A 2YJRA 5EK7A 2BDJA 4H36A 3OFMA 3ZOSA 5LMAA 4RIYA 3ZC5A 5FBOA 2C5VA 3OWPA 4IB1A 2JAVA 2W5AA 1LEWA 3K3IA 4G16A 4NKAA 5FDPA 1J7IA 3I1AA 3ENHA 4FTJA 3REPA 2GNGA 4B6LA 4II5A 3COHA 4IQ6A 2BZHB 4EBVA 4EKLA 4G3EA 3OS3A 4IM3A 4B7TA 3C4XA 2XJ0A 4FSTA 5EYCA 5LARA 4JAIA 3OP5A 2Q0BA 3LFAA 1W7HA 4PX6A 5IQAA 1BLXA 4FZFB 4JJRA 2ETKA 1F0QA 1Q99A 3F66A 3ZLSA 1JWHA 3ATTA 2PVMA 5L8LA 2OLCA 3IECA 2G01A 3DKFA 4WBOA 4ANSA 5FM3A 4FV8A 4RJ7A 4YTIA 4IFCA 4L3LA 5DEWA 1RW8A 4BWXA 4O7SA 3ZO3A 1FVRA 3AC8A 4ZOGA 1UWHA 4MBIA 5GIOE 2ITNA 4TWOA 4FTQA 5HE1A 3KRXA 5EOLA 4FKSA 3TIYA 3N51A 3FXZA 5HKMA 4PMTA 2Q0NA 4MHAA 4OTRA 4PPAA 2IJMA 4JG7A 3W8QA 3TJCA 1YHVA 4FGBA 1BI7A 4BTKA 3RAHA 1Y6AA 3I0QA 4ZTHA 3QXOA 4LUDA 2W1ZA 4ERWA 4JR7A 3DA6A 5KKRC 3KQ7A 4W8EA 1B38A 4OTWA 2BAQA 1DM2A 4HGTA 3NAXA 5I9UA 4QRCA 4QTAA 2C3KA 4EOQA 2ITWA 3IOKA 3HDMA 1E1VA 4GFOA 2VRXA 4MWIA 3MJ1A 4JIAA 1OMWA 5L8JA 3HMPA 3A61A 2C68A 3ZEPA 4F09A 3PLAE 3KN5A 1JLUE 3MGYA 2RG5A 4E1ZA 5AP6A 3RAKA 2XK7A 4D9TA 1OL1A 2PZYA 3C7QA 2Z7RA 4CLJA 2F57A 5AA8A 2WIHA 3F69A 5J9YA 5CEIA 3UBDA 3HVCA 1Q3WA 3NIEA 5F95A 3NVMB 4I5PA 1LEZA 3U4WA 4KKHA 3A7IA 3KREA 1LR4A 2W06A 4E4NA 2QO2A 4PDOA 3HMIA 4HCTA 2EB2A 5IQIA 1W84A 2J0MB 4CFWA 5ITAA 4FYNA 2KULA 2PL0A 4XBRA 3PYYA 4YO6A 3P7AA 4KIQA 3V01A 3PSCA 5BUJA 2RGPA 3IW5A 5GJDA 4ZS4A 4YBJA 3TL8A 4RVTA 4NIFB 2C5NA 4OR5A 5HCYA 2CGWA 1REJA 4C35A 3OOGA 3Q4UA 2OZAB 2RFSA 2BKKA 3QLGA 2WOUA 3EFWA 4L46A 3QD3A 4FV4A 4U9AA 3Q5ZA 3KMMA 4WA9A 2VO3A 4U3YA 3RBWA 5IUIA 5LCKA 4DHFA 2C6MA 2ZB1A 2FSTX 4JRVA 5FXSA 2CGUA 1H24A 2VNWA 1CKIA 4R1VA 1V0PA 4W9WA 4XMOA 3FZSA 2C6DA 4O38A 2O5KA 3BZ3A 3OCTA 3DK7A 5DMZA 4JBOA 1WBSA 1PMNA 5CSHA 3C0HA 4ZTNA 1YI6A 4CQGA 2JKQA 1PXMA 3KK8A 3D7TB 4EBWA 2OFUA 2QOIA 3AGLA 2BZJA 3KCFA 4ZZOA 5HNIX 2UUEA 3PXFA 2W5HA 4E3CA 2JGZA 4OAVB 1U5RA 2I0VA 4YUQA 5A4LA 2C0OA 1GY3A 1OM1A 2W4OA 3IO7A 3II5A 3U6IA 4UZHA 4NM5A 3R83A 4O2PA 4RQKA 1J7UA 1YOLA 3FV8A 3FZPA 1RJBA 4R3RA 1UA2A 3E5AA 3F3WA 3HV4A 4GL9A 4QP3A 4ZZMA 3D7ZA 2BDFA 4OTIA 2GNLA 3Q4CA 4L7SA 4LRJA 4A4OA 4DFBA 4EWHA 1R78A 2R2PA 2HCKA 3OWLA 3U9CA 1OIRA 4ORKA 2IO6A 2IPXA 2B9JA 5AP2A 5B7VA 4ZLZA 2YIYA 4FTCA 4A9YA 5C4LA 5JEBA 5T3QA 4Z16A 3VVHA 2PY3A 3G5DA 3W2OA 5IISA 2IVUA 4TYEA 3BCEA 4HYUA 3QQGA 5HNBA 5I3OA 3VUMA 3RM7A 4O7RA 4EL9A 3T9IA 2VTIA 3EQBA 3SDJA 4M7IA 3KVWA 2XM9A 5ANOA 3ZXTA 4EHGA 2CHLA 1GZKA 4OT5A 3HV3A 5CYIA 4LGDA 4X2FA 4F64A 5BPYA 2WMRA 3HV6A 4FSRA 1ND4A 3UDBA 5E7RA 2X4FA 3OTUA 1RQQA 1NVRA 2RL5A 3ZSGA 2C47A 1G5SA 3ZRMA 2OICA 2OBJA 4IJPA 4K11A 4GT3A 3UIBA 4G31A 3GEQA 4XG8A 1X8BA 2R3OA 2OJFE 3QD0A 4FKLA 2CN5A 1YXXA 4USDA 3HKOA 4JI9A 4JX7A 4F1OA 4BYIA 3DBEA 3R7UA 3W2CA 3O2MA 4HVDA 3ZCLA 4CZYB 3LHJA 3C4WA 4EJNA 5C8NA 1KE5A 1AD5A 1ZYSA 2ZMCA 4KKEA 4NK9A 4QT1A 2VTSA 5EW8A 3D4QA 3E64A 1H07A 1JSUA 2GTMA 3ORZA 4BWKA 4O82A 1ZMVA 4YJTA 3F3VA 4GIHA 5CF5A 3EN9A 2C5XA 3VRYA 3EQDA 3LXNA 4BTFA 2XK3A 2VV9A 3I6WA 4FIJA 3LQ5A 1NA7A 4G6NA 4C2VA 5CAOA 2GNHA 5IKWA 3FMDA 3ZXZA 4AW5A 4OGRA 4U5JA 4RIYB 3R02A 3ZSIA 5IH6A 5ANDA 2PVHA 1XBCA 2Z02A 5E8WA 2C3LA 3R1YA 4F0GA 4GJ2A 4EHZA 2CKPA 3U6JA 3O51A 2OIBA 2HELA 2R7IA 4TT7A 3TKHA 3PG1A 4YMJA 4USEA 2R3JA 4QP2A 3UOHA 4PL5A 4QMLA 2WMQA 5DH3A 4DE4A 3C1XA 3OZ6A 4D28A 3RPOA 3VBTA 3NS9A 2VN9A 4HGLA 4ZZNA 2XS0A 3LJ1A 3T9TA 3FLYA 4D4RA 3L8PA 3VQUA 4KRCA 2HXLA 4K9YA 1SVHA 4AA5A 4F1TA 2OJJA 4C4HA 3S95A 2QONA 3DB6A 4TWNA 3JVRA 4UYNA 3R01A 3H0YA 2PMNX 4IZYA 1IA8A 2WEVA 2R5TA 4QTDA 4O0TA 2CLXA 5HO7A 3EQRA 4DA5A 2R3MA 4S32A 4TNBA 2WQBA 3KULB 5L3AA 2R3QA 4FEVA 4L43A 4A07A 4ZK5A 4Y95A 5JSMA 3FHIA 3TZ8A 2WTKC 3FMMA 3DFAA 5DVRA 4BDEA 4EH2A 1NW1A 4NUSA 5HE0A 3UNJA 4F6UA 3LZBA 4DG2E 4CZUA 5IEXA 2YITA 1L8TA 3MFRA 4ASZA 2PVLA 1NY3A 4GK3A 3UGCA 3ZRLA 4UN0C 2VWUA 4WRGA 4E4MA 3LM0A 4FUXA 2HXQA 2PVNA 3LCOA 1GIIA 4HJOA 3EN6A 4XG4A 5A6OA 3OEFX 1P2AA 3FYKX 4E7WA 4X3FC 1R0EA 4EUUA 4PRJA 1QCFA 3RPVA 4FG7A 4DFZE 5DYJA 5BMSA 4GG7A 3KF4A 2X1NA 5EI6A 3CLYA 4QYEA 4BCHA 4IAKA 5EKNA 1UVRA 3CQEA 3DZQA 3RAWA 4F70A 3KY2A 4U3ZA 3EFKA 3F61A 4JVGA 1SMHA 4L44A 3WYXA 3PXKA 3MBLA 5B0XA 4A4LA 4S2ZA 3NUSA 1YWVA 4MK0A 2YCQA 3G51A 4QMWA 4D1ZA 2I1MA 2WMVA 4LGHA 3R7OA 2XB7A 1OGUA 2GDOA 3CQWA 3Q6UA 4FKTA 2VUWA 2XYUA 3A7GA 5CS6A 4DYMA 5AUXA 5AV4A 2XJ1A 3QC4A 3FKNA 3NSZA 2JIUA 2UZOA 4RFMA 1A06A 4YJNA 5DN3A 3SV0A 3QC9A 4BDKA 4EOOA 3LFQA 4AF3A 3SG9A 4K2RA 3ORMA 4FTTA 4U80A 4XG3A 4Z55A 2ACXA 1BL7A 2ETRA 2YISA 4CFUA 4EH9A 2WTDA 4RJ3A 4AGCA 4QQTA 5K9IA 1WBPA 4MWHA 3SW4A 2R3NA 2BVAA 3SOAA 4FNZA 4NJ3A 4K1BA 5E8UA 3VIDA 3CCNA 4JDKA 3R2BA 3G9NA 4GT5A 3UP7A 4CT1A 3G2FA 3EMGA 4O7NA 3DK3A 3I5ZA 3UYSA 1U5QA 3SW7A 4BHNA 2Y6OA 2YN8A 4BGGA 3ORXA 4GW8A 3ZM9A 2UZNA 5D12A 5KMNA 4PMSA 3SRVB 3SGCA 5CVHA 4CG8A 1PJKA 3BBTB 4AWIA 4I0TA 4AQCA 4B4LA 5CEMA 4UXQA 4OAUC 2UZEA 5KNJA 2WZJA 2UW7A 3KC3A 4LL5A 3LLAA 1U54B 3HLLA 3GC7A 3VWAA 3AC3A 2IG7A 4UYAA 4YZMA 4ZJVA 5H8EA 2BPMA 1H4LA 5BVDA 3V8WA 4XEYA 4D4SA 3FMEA 1YDRE 2VZ6A 3MA6A 3BGQA 5AP4A 4ACMA 4F63A 4ERKA 2C4GA 4ACHA 4EH5A 1M7NA 3D14A 4WD5A 2ETMA 1H1WA 3KGAA 4IX3A 3W1FA 4X6RA 4RRVA 4G5JA 4LRMA 1XH7A 4UV0A 4WG5A 2JKMA 4AACA 2BROA 5L2QA 4M3QA 4C4IA 4EK8A 2PE1A 3I81A 4K18A 3NPCA 4A9TA 4I6FA 2IW6A 4IMYA 4V0GA 2PUNA 4TZRA 3OXZA 2C0TA 3P23A 5EHOA 3O8TA 5EM5A 1ZYJA 1IRKA 2RFDA 4I21A 3V5QA 5BYYA 3BLQA 5BNJA 1CM8A 4FYOA 2V55A 4RIWB 3QZIA 1UKHA 1VEBA 3R9RA 2QQ7A 2XZSA 1HCKA 3FY0A 3GU4A 5HLNA 2W1EA 3MDYA 5CXZA 3PP1A 2W9FB 4JL9A 3ZFXA 3PSDA 3KN6A 4I23A 4KA3A 3QWKA 5AAEA 3WYYA 5TT7A 4Z7GA 4R7IA 3JVSA 4UMTA 4E26A 3FI8A 3R21A 4A9SA 3C0IA 4G9CA 5AV1A 3OC1A 1JVPP 1PF8A 2I6LA 3UOLA 2QG7A 1IR3A 1TQPA 1Z9XA 4KABA 4A9RA 2WU6A 1YWNA 3NYOA 2V0DA 5C03A 2FA2A 3QBNA 4RIWA 2B55A 3QRJA 1Q8UA 3DLZA 3TG1A 2X8DA 4BTMA 5HU9A 3C5UA 4YHFA 4E4LA 2V62A 4ZS0A 4QMUA 4I5HA 5LVPA 1B39A 4IDTA 2VWWA 2ZDTA 5TR6A 4BI2A 1ZWSA 4QP9A 2YDIA 3M11A 4BICA 1QPDA 4AFEA 2VWZA 3CPBA 4AA0A 2PMIA 2HWOA 3QTXA 5EYMA 2VX1A 3U8WA 3HAVA 5I9VA 4I4EA 3OWKA 4BDDA 2GPHA 3ZEWA 1E9HA 3MVMA 3HV7A 2GNJA 2ITXA 4U43A 2J90A 3DK6A 3QRTA 5TF9A 4B0GA 3NYXA 3EZVA 4RT7A 3F3ZA 1P4FA 2BAJA 5EYKA 3E8DA 5A9UA 5IQEA 3EIDA 4IANA 4BC6A 3KRJA 1J1CA 3OBGA 3BX5A 4FSWA 5A4CA 3PWDA 5H8BA 3A7HA 4X2KA 5EG3A 4BGQA 4TW9A 4BYJA 3R28A 3ULIA 3VO3A 5KMMA 1H01A 1WMKA 2EU9A 4YLLA 5I9WA 2PTKA 2YM8A 2UW6A 3VNTA 2J51A 2C3IB 2CLQA 1WZYA 2J7TA 2QLUA 5FG8A 4CGAA 4E5AX 1BL6A 2O0UA 2VWIA 2YCRA 4GFMA 2FH9A 4IHPA 3DS6A 3PA3A 5ACKA 2R3RA 2GS7A 1H0VA 3QQHA 4BZOA 2X7OA 4FSUA 4AZFA 1TQMA 2VD5A 3QCXA 4N70A 4F7NA 2PU8A 3CPCA 4G1WA 4L00A 3R73A 1PXPA 2B9FA 2QCSA 2VO0A 1H1QA 3ZUVA 4BVUA 5L6PA 4O7YA 4B9DA 4XJ0A 4JBVA 3BEAA 3C9WA 3P4KA 3W2SA 1P14A 4F7SA 4ZMEA 2CMWA 1KWPA 2XRUA 2ZDUA 3R2YA 5HO6A 3HDNA 3HZTA 4WO5A 2A0CX 1UU3A 3E3BX 2PMLX 3KRLA 5L4QA 1STCE 5CASA 4CSVA 1W8CA 4FI1A 3LW0A 4XHKB 3N4UA 3CTJA 3WOWA 5ICPA 4XUFA 5CU0A 3NUYA 3UZRA 4WNOA 2OKRA 5J7HA 4Y5HA 2C1BA 4BCPA 5DA3A 4F9WA 2W9ZB 3UIXA 4QMPA 2QOLA 3ACJA 4FOCA 2PWLA 5CU2A 3O23A 2IZUA 3TNIA 1KV2A 1UNLA 2CN8A 3D9VA 2ZVAA 3EKNA 3DOGA 5HORA 4K8AA 3K5UA 1H27A 3QA8A 4FIIA 3LJ2A 5CU4A 4ITIA 4DF3A 4F6WA 4PDPA 5BVFA 4RZWA 1H8FA 2VTJA 3F7WA 1RDQE 3HGKA 4W4XA 4DGOA 5KE0A 5AA9A 2QOKA 5F1ZA 4CKIA 4OTQA 4YURA 4N0SA 4LV5A 5A54A 3F88A 2BFXA 3NDMA 3DAKA 2GMXA 2XNGA 2YLEA 2EB3A 2HZIA 4KB8A 2Z7LA 3KKVA 3Q04A 3ERKA 3ORPA 4H39A 3RJCA 2GFCA 5HHWA 4L3JA 4XBUA 2UVYA 4DH5A 5DT4A 3JXWA 2WO6A 4CNHA 2VU3A 3IGGA 2W96B 3R7GA 2WAJA 1RE8A 4F08A 2UW5A 3BGPA 3BYUA 4HCVA 3ALNA 1GNGA 5EYDA 2OJGA 2HIWA 2BHEA 3L8VA 1H25A 3D83A 3NUUA 3QGYA 5AV3A 1IASA 5HQ0A 2QKRA 4X6QC 1YVJA 2Y6MA 4GSBA 3QGWA 4JQ8A 4QTCA 3U51A 4C3RA 2X7GA 4MQ1A 3QLFA 1XBBA 4L6QA 4BIBA 4QQ5A 4RWJA 3WILA 4YLJA 2EXMA 4OTDA 2CGVA 4DEBA 2YM3A 3AOXA 3JY0A 2IVVA 3DBCA 4RBLA 1FINA 1K3AA 2OH0E 2X6DA 2ZB0A 4Q5HA 4BCQA 5EH0A 4PL3A 4EZ5A 4USFA 3MYGA 4G6LA 1Q8YA 3BHUA 3BHYA 4OTFA 3FY2A 4RWKA 3H10A 5AX9A 2OJIA 4KBKA 3S1HA 4FR4A 5IEVA 3ORLA 1M2PA 3DQXA 4ZTLA 2OWBA 2X6EA 4IZ7A 1BUHA 4J8MA 3D5XA 5GZ9A 4QPAA 3MA3A 4DFXE 5IU2A 2GTNA 1ZLTA 2ZM3A 4FKJA 4RX7A 3JS2A 5CWZA 5DIAA 3GC8A 4DCEA 4YJRA 4EQMA 1Q97A 1JSVA 2PZIA 2HZNA 4FVPA 1G8AA 3OW3A 5FM2A 4AXAA 4EQUA 2GS2A 1I09A 1UWJA 4PNKA 2QVSE 3FMKA 4TYJA 3ITZA 3QCYA 4EORA 2XH5A 2PZ5A 4P7EA 1T46A 5I4NA 3MH2A 4V05A 4YNEA 3BV3A 4ZY6A 3ULZA 3S2PA 2W7XA 3LCTA 1PMVA 5D10A 3KFAA 5K0KA 5E8SA 3ZFYA 4LUEA 4QMQA 5JZJA 2NPQA 3BU6A 3BLHA 3PTGA 1KV1A 3PXZA 4C4GA 3FLZA 4I24A 4H05A 4UZDA 4FNWA 2C6OA 3LFCA 3S0OA 3D2IA 3GU8A 4LL0A 5DWRA 4C4FA 2PVKA 3EQIA 3NNXA 2OG8A 4GK2A 1KUTA 1GAGA 3ANRA 1T45A 4FL1A 4GRBA 4AP7A 3TTIA 2BRGA 4YO4A 4N57A 4QNAA 3DPKA 1ZMWA 3LIJA 2BTRA 4GU6A 4AW2A 4BHZA 3S00A 3ORIA 3FL5A 3PRFA 4O86A 4O96A 1YHWA 5CQWA 2F9GA 4FK3A 4R7HA 5D7VA 4LOOA 4J95A 5AUVA 3VRZA 5TKDA 1YI3A 3QFVA 4O0RA 5H9BA 4ZY5A 3AD5A 1OL7A 1A9UA 1J7LA 3FXXA 5F4NA 4F0FA 1P5EA 1WVXA 2RFEA 3DLSA 4YZNA 1XH9A 3GCUA 1Y57A 3FMNA 4QQJA 5FWKK 1FVTA 3GC9A 5DPVA 4ANBA 3IW4A 4OBQA 5HX8A 4BBMA 5LVNA 3TJDA 3B2WA 3EH9A 3TZMA 3PFQA 1OIQA 1YW2A 3UG1A 4AZSA 1DAYA 2JBPA 3AT4A 4HCUA 4UWYA 5D41A 4DTKA 3GU6A 1V0BA 1JBPE 3K3JA 2VTOA 3R7YA 3E3PA 5CANA 4WG4A 2G15A 3CJFA 4YTHA 4EI4A 5CAQA 2E9PA 4KINA 5EM8A 2W4JA 3UC3A 2YIRA 2IVSA 4TN6A 3OTVA 1AQ1A 1H1RA 4HZRA 3FZRA 4RJ4A 5DRDA 4ACGA 4B99A 5BVOA 4CV8A 4EOJA 3NWWA 2JFLA 4AG8A 4FKUA 2Y4IB 5J79A 1F5QA 2C6KA 3LFEA 4CFXA 4D0WA 4M69A 4EOMA 3E7OA 4PTEA 2XMYA 5IQGA 5HOAA 3CGOA 1BMKA 4EUTA 4BB4A 3SVVA 4WNKA 5IQDA 1TKIA 2V22A 1CKJA 1OL5A 3TDVA 1TVOA 2E9UA 5H8GA 3EOCA 4Z7HA 3P79A 4JAJA 4KRDA 4JQEA 2PK9A 2W1DA 3Q9YA 4FV5A 4QYFA 4FIHA 4F9BA 2YAKA 4FGRA 3QHRA 2C6IA 2QU6A 4QOXA 3VS2A 5C1QB 2W1CA 3DQWA 1YDTE 3OVVA 4M67A 1CMKE 4IFGA 3GGFA 3UOJA 4RA4A 5AV2A 2YEXA 4E6DA 3QALE 2FYSA 5HIBA 3V04A 4RWLA 5CSVA 2YAAA 3NYNA 4YC6A 3PDTA 3VN9A 4O0SA 3MPTA 4GYGA 2XRWA 4YJSA 2P0CA 5BVNA 2FSMX 3UMXA 3LQ3A 4PL4A 1URWA 4LM5A 2Z2WA 4Y83A 3FZ1A 2YA9A 2OI4X 2RSVA 3GT8A 4RLLA 4YU2A 3WARA 3WIGA 2OXYA 5C9CA 3W18A 5LVOA 3SRVA 4FTRA 4E73A 3QKLA 4CKRA 3BU5A 4AGDA 3NCZA 4AX8A 5K3YA 5HESA 2OXDA 4DINA 4E6CA 5J1WA 3KULA 2R3IA 3GENA 5HGIA 3F5PA 3UQFA 4ALWA 3FPMA 2UZBA 4C7TA 4D1XA 5KMIA 2VTAA 3B8QA 3CD3A 2Z60A 3PVBA 1BKXA 5M4IA 2BILB 2WXVA 2VWVA 4U8ZA 3UE4A 3V3VA 3VUHA 1PHKA 1S9IA 3U9NA 4I5MA 4CFMA 3BYOA 1Q24A 2UZLA 5D1JA 4BCOA 4GKIA 3FXWA 3MS9A 3ID6C 2RFNA 5L8KA 1TQIA 1SZMA 4FZ7A 3NCGA 4YGAA 3ZO2A 4GVJA 2W99B 2B7AA 3QYZA 4I5CA 4WHZA 4O0VA 4NFNA 3K5VA 1DAWA 1H00A 3WF8A 2B9HA 1A48A 3QUEA 3NUXA 5H3QA 2X2LA 3PPJA 2R3KA 2WQEA 5LOHA 3HEGA 4AFJA 4MXXA 5IA1A 2GHMA 3PY1A 4FOBA 5DT3A 5CI7A 4AOJA 3MVHA 4XV2A 2R64A 3RCJA 2HOGA 2QOCA 5KBRA 5CZHA 4DEHA 2LAVA 2E9OA 3ZHPC 3IKAA 4AOTA 5HVKA 2QOBA 4FTOA 4XLIA 5JFWA 4UXLA 1UKIA 2IZRA 3E7VA 1MRYA 1YHSA 2JITA 3MTFA 1VYWA 3P5KA 4QNYA 5DRBA 4CT2A 1LPUA 2X4ZA 3SD0A 4F9CA 4UB7A 4I93A 2QO9A 4UMQA 5J5TA 2ZV2A 4OBOA 1V0OA 3PE2A 1PYXA 2QKWB 5J95A 3FSFA 1YXVA 2W1FA 3HYHA 5HVJA 5I9XA 2CSNA 4G3FA 2X2KA 5KHWA 5KHXA 2CNUA 5GJGA 2Z8CA 3KF7A 1Q3DA 4P90A 4IB0A 2XEYA 1WFCA 4QYYA 1ZYLA 1KE6A 3GCPA 2FUMA 4AGWA 1NT2A 2PYWA 4M97A 5JT2A 5LCJA 4FNYA 3DAJA 3PIXA 4GIIA 5CAPA 2B53A 3Q6WA 5HTIA 1UU7A 3UQGA 2VTRA 3GVUA 2AC3A 2UW8A 4PPBA 4C4JA 4C57A 3ELJA 4WNMA 5TE0A 5BVKA 3UODA 4JX3A 4TL0A 5CSPA 4NL0A 4L42A 3C4EA 3I60A 1UU9A 2WTIA 4RIXA 4RGJA 4B8MA 4BIDA 4EHVA 3KXZA 4D58A 2XM8A 4JR3A 2DYLA 4YZ9A 3DNDA 3QQJA 3TNWA 3MH1A 2P3GX 2UZWE 2Y4IC 5M4CA 2VAGA 5IMEA 4D2WA 2WPAA 2BRNA 5M55A 4DLIA 2OSCA 3E8NA 4NIFA 4AZEA 3HX4A 4HPUE 4C58A 3EJ1A 4AZWA 3PP0A 4NCTA 3G0EA 4M12A 3R9NA 3E87A 3AXWA 2G1TA 4YHTA 2G9XA 2YZAA 5ETAA 4M84A 3RWQA 5HD4A 4ZTMA 4JBQA 4NTSA 3QX2A 4PTGA 2F7EE 1AGWA 3MJ2A 3DT1A 4PV0A 4YC3A 5AUZA 2A4LA 4FKWA 3IDBA 3PJ3A 3QKMA 4XP3A 3R8VA 1REKA 5IPJA 2ZYBA 4HPTE 3IW7A 3Q60A 4KKGA 1XH6A 3VBXA 2GHGA 1IG1A 4FIGA 4ZMFA 2JD5A 4IVCA 4JG6A 4CTBA 1H0WA 1FGKA 2VWBA 2GCDA 3DBQA 4XRJA 4RQVA 4FG8A 1ZXEA 5I0BA 4O0UA 1OBDA 3L8SA 1J1BA 2Z7SA 4I92A 3AGMA 3JUHA 2P4IA 2F2CB 3NMUF 3N9XA 3EB0A 4G9RA 5JRQA 1FOTA 3P9JA 3PG3A 3HA8A 4U40A 3BYMA 3MVLA 1JPAA 3TV4A 4R77A 3R9OA 3QD4A 4CG9A 3IS5A 5E1EA 3IDCA 3E8EA 4UY9A 4DH7A 4FNXA 4JDJA 4A06A 2HENA 4MF1A 2VO7A 4NT4A 4QP4A 4F7LA 4MQ2A 5DBXA 3UZPA 3CY2A 1M17A 2FSOX 3TDWA 4D2RA 3BU3A 3GUBA 2WTVA 2ONLA 4EH8A 4R7BA 5DR9A 3R22A 5KMLA 4I0RA 5JFXA 3HRCA 4OBPA 3E62A 2X0GA 4G5PA 4BKZA 4DEIA 4ANOA 3V5JA 5M57A 5GHVA 2VTQA 5CU3A 3CC6A 4WNPA 4QMMA 2WQNA 5IQHA 3DY7A 4I4FA 4PMPA 3H9OA 5CVGA 3FEGA 4G3CA 4BIEA 2G2IA 4BFMA 4EKKA 3BV2A 2YCSA 5IG1A 5DLSA 4QP8A 2WMXA 3QQLA 3A99A 4F0IA 2A2AA 4YTFA 3CY3A 4O7LA 4GCJA 5ETIA 4U7ZA 5K5XA 4HVGA 5L6WL 5GNKA 3VBQA 3ZS5A 1ZOGA 4L52A 4NEUA 2HW6A 1EH4A 4UMRA 3UG2A 3ENMA 2RG6A 5M06A 4FTLA 4ANNA 2JIVA 4IAFA 2B9IA 1S9JA 3FI4A 4YP8A 4ASEA 2EXEA 2O65A 3I6UA 3KXXA 3QTIA 5J8IA 3WBLA 1HCLA 3ZH8A 3TN8A 4D0XA 3RM6A 1PXJA 4IDVA 2QURA 4O7VA 2B4SB 1XH4A 5A46A 1BI8A 3TT0A 3BBWA 3NIZA 4N4SA 3UIUA 3NNWA 4EZ3A 3F5GA 4J8NA 2FSLX 5E90A 5LVMA 4MX9A 4A9UA 2I0HA 4X7QA 1FBNA 2WFYA 3PRIA 4CRLA 3GB2A 3IK3A 3NGAA 4XX9A 3QA0A 2UW3A 3RCDA 5I5ZA 3G0FA 4RC2A 5CEPA 4PP9A 4PP7A 4QQCA 3Q5IA 4FF8A 3VS1A 4K77A 1E1XA 4WG3A 2PMOX 2R3FA 4RWIA 3KMUA 4FT0A 5CENA 5ANGA 3Q32A 4CRSA 4E6AA 3BRBA 3RPYA 4IWOA 3L9PA 2X81A 3ZLWA 2WMSA 3WZKA 4KD1A 3M42A 4O91A 5EOBA 1PW2A 4V04A 3WF9A 3U54A 3UMWA 5BVWA 4RVKA 2PUUA 3OUKA 4MVFA 4ENXA 4I20A 3PLSA 3F82A 1MRVA 3QQUA 4W9XA 3AMAA 2QNJA 4RG0A 3SA0A 1K2PA 3W33A 4ID7A 3Q9ZA 3QQFA 3CD8A 3HV5A 3COIA 1GJOA 3VUKA 5CF4A 2CKEA 3U4UA 5IA2A 2VGPA 4GUEA 3MW1A 4FZ6A 3BYSA 4M66A 4QMXA 5F20A 4AAAA 2WU7A 2IVTA 3FLSA 5AR5A 3NUPA 5M08A 4UEUA 5CT7A 3FYJX 3VBYA 3DJ6A 5HZNA 3QTSA 2JAMA 4OLIA 1O6YA 3C4FA 3R8UA 4ACDA 3MY5A 3QTRA 2VWYA 1KE8A 1PYEA 3IPHA 3ZM4A 3ZONA 5AUUA 5ETFA 3F7ZA 2BIKB 3SKCA 3UC4A 4KSPA 3IG7A 5LWMA 1YRPA 3SX9A 4C33A 3R1NA 5CAUA 3CKXA 3G6GA 4Y46A 4EK4A 3EN7A 3BPRA 4D2SA 1ZOHA 3DZOA 1SVEA 4NH1A 5AR8A 2F2UA 5JK3A 4XRLA 3FZOA 4IVDA 4EK5A 3ODZX 4Q9ZA 3KXMA 5FGKA 3AT3A 2YCFA 3HUBA 3W55A 4A4XA 4HYHA 4FSNA 4ANMA 5JQ8A 5HU3A 3HMNA 5C4KA 2I0YA 3LOKA 2V7OA 3D5UA 1M52A 4PUZA 4RJ8A 4QMZA 4IAZA 1YOJA 2VTTA 3EQGA 4FK6A 1MQBA 2QD9A 2HAKA 3ZDIA 1OKVA 1PY5A 3FKOA 4R5SA 2AC5A 4Y85A 3RPRA 3QCSA 3MFTA 4R3PA 5AIRA 3FLQA 2J6MA 3GFEA 3RNYA 3OOMA 4DG0E 4TYHB 3QZHA 4HW7A 4P5QA 2C3JA 2J0IA 2R3HA 4IE9A 4IWQA 5GZ8A 3PIZA 5K4IA 4QMSA 3RWPA 4EH4A 4G6OA 3ATSA 3EYGA 2JC6A 1OZ1A 4EOIA 3GCSA 3O0GA 3Q3BA 3JR1A 4C02A 3P1AA 5FP6A 3A62A 2LGCA 1R39A 3G6HA 5LXMA 3NX8A 4XG9A 4N6ZA 3DV3A 3DDPA 3R30A 4XOZA 5JFVA 3BQRA 4EOLA 5LJJA 3ZTXA 3FDNA 3OHTA 3KK9A 4MTAA 2QHNA 3ROCA 3EFLA 4BN1A 4JNWA 2HYYA 2W1GA 5M51A 3TUDA 3WZDA 2NNWB 4C34A 5J9LA 5IEYA 2V7AA 4PDSA 2PSQA 2WB8A 2CNQA 2ZV9A 1K9AA 3DBFA 3LVPA 3ZFMA 3LAUA 3DJ7A 4JIKA 4FVQA 4IZ5A 4MD9E 1OIYA 5CY3A 4UMPA 4DBNA 1G8SA 3F2RA 3SXSA 3VF9A 2ITPA 2YIXA 4LYNA 5HG8A 3HL7A 5E4HA 3V6SA 2J5FA 1QPEA 3NW6A 2XNNA 4DC2A 2XK9A 4W4YA 4P2KA 5IMXA 4D9UA 4C0TA 1OVEA 2OFVA 2PHKA 4H3BA 4OTGA 3TKUA 1URCA 1ZOEA 2KTYA 4J1RA 4FEUA 3HRBA 1ZY5A 3PXYA 5LMBA 2P2IA 2EUFB 1YI4A 3W32A 3ZYAA 4DCAA 3V51A 2IZSA 3CXWA 2I0EA 4NWMA 5EQPA 4Q9SA 3QU0A 4CCBA 3K2LA 4D5HA 2YERA 1FMKA 4G2FA 2UW4A 4UALA 4B8LA 2F7ZE 3T3VA 3IGOA 4DEGA 5JQ5A 2BRBA 5FUTA 4ZY4A 3F5UA 4F4PA 4FC0A 3ZRKA 5M07A 3TEIA 4FV0A 2HY0A 2QODA 4QMYA 3IDPA 4S30A 5EQYA 1CTPE 3FQEA 2WNTA 4E8AA 2YDJA 2O64A 5IDPA 4PNIA 1PMEA 1WAKA 3GOPA 4OTPA 1GZOA 4L3PA 2VX3A 4ZSAA 2ZM1A 4U97A 3HMMA 5HNGA 3DKCA 4BBFA 4EH3A 4O84A 4H58A 5T6KA 2SRCA 2PE2A 4MXCA 2BRHA 4EOKA 5B2LA 4AN9A 5HICA 3IQ7A 5EFQA 3D15A 3R8PA 2IW9A 4MD7E 3FPQA 4C8BA 2YM4A 3KEXA 5AFVA 3QTQA 3KU2A 3QXPA 4KIKA 3EQCA 4M15A 2QHMA 3MB6A 3FZTA 4FKOA 4CQEA 4KAOA 5M09A 2PPQA 2RIOA 2P2HA 4X3FA 4X3FB 4IBMA 4EWQA 3PE1A 3PPZA 2WQMA 4CMUA 4OT6A 2XNEA 2XF0A 3WZEA 4YR8A 2PUIA 5JZNA 3GQIA 3T3UA 2RKUA 4CZTA 4FX3A 4GYIA 4WUNA 4R1YA 2J0LA 5CTPA 1Y91A 1JKTA 4O6EA 3RK5A 4WT6A 4TXCA 2FVDA 3VS0A 1I44A 2FO0A 1XKKA 1Q5KA 2O63A 3R7IA 1DI9A 2JIIA 3M1SA 4BRXA 1PKGA 4IX6A 2EXCX 3E8CA 1GOLA 1OUYA 2BCJA 4IC8A 5JGAA 3PZHA 1OPJA 2H96A 3LFFA 4BKJA 2BIYA 4U79A 4D2PA 5E8TA 1KOAA 5FXQA 3VBWA 3ZMMA 1Q4LA 4GVAA 1PXNA 2WTCA 2ZOQA 2YFXA 3B2TA 4HYSA 4MD8E 3TI1A 3TNPC 3AMBA 3QRIA 5AIKA 4ASDA 3QQKA 3MSSA 3FWQA 4OW8A 4BCNA 4O6LA 3AD4A 3C4ZA 3PZEA 4IH8A 4S34A 5GJFA 3QUPA 4RFYA 3DXQA 4BDGA 5ETCA 4JDHA 3QD2B 4M8TA 2ITUA 2X39A 2XNMA 3GQLA 4M69B 4OUCA 3L9MA 4BCMA 3EN5A 5ANJA 4AUAA 5A6NA 3CE3A 4EOSA 5CEOA 2GS6A 2UZTA 1L3RE 3LLTA 5CF6A 2E9NA 4NCTC 3AC1A 3KRRA 3VW6A 4QTBA 4FEXA 4FTKA 5IA0A 1ZZLA 1OIUA 4C61A 2JFMA 3KA0A 3HMOA 3RINA 5JFSA 4G3DA 4YBKA 1OI9A 2OZAA 5BVEA 2CKQA 2Y0AA 3R00A 4IM0A 3CR0A 3D5WA 3LCDA 5ACBC 1YXUA 4TYGA 3CQUA 4DGMA 5A4EA 5CEKA 2W1IA 4I22A 1R3CA 3O96A 4YJQA 3ZUTA 4I6HA 1YDSE 1FVVA 5E8VA 4PTCA 4Y8DA 5C8KA 3CEKA 5HBJA 5IA4A 5LMKC 3JPVA 4FKQA 5FEQA 4I1ZA 4W4WA 4U6RA 5JGDA 4IB5A 3BLRA 5EHYA 5CVFA 4BDFA 4EZ7A 3KMWA 2WD1A 2C6TA 4J98A 2P33A 2ZV7A 4R78A 1HOWA 3MFSA 4AW1A 3WE4A 4RX9A 4XV9A 4EK6A 3LXPA 1W83A 3QTWA 3SLSA 2YZLA 3UYTA 3R8MA 1U46A 3DCVA 4F9YA 2B52A 4E20A 2C5YA 4PF4A 2OGVA 3EKKA 4CV9A 4Q2AA 4FKIA 3PVGA 3LMGA 3I0OA 5AEPA 4AGUA 4W4VA 2WTKB 5M53A 3VC4A 2BHHA 5AUWA 4XV3A 3VBVA 4HVSA 3PY3A 3ETAA 4N6YA 4PY1A 3GFWA 5E91A 2ZM4A 5AWMA 2C30A 2GQRA 1NXKA 1ZARA 5AP7A 3O50A 1DI8A 2CGXA 5KMJA 1O9UA 4FE2A 1LUFA 5BMMA 3V8TA 2ITYA 4R6VA 4GU9A 3C13A 4YNOA 3G15A 2C1AA 3QF9A 4XH6A 1WBVA 4YJVA 4YPSA 4O7WA 2CDZA 3D7TA 2BFYA 3W16A 2JDRA 3N4TA 2UZDA 3FE3A 4XP2A 4F65A 3KCKA 3DTWA 4FSZA 4RZVA 3UJGA 2O2UA 3TM0A 2EVAA 5CSXA 4QYHA 4J96A 3WZJA 3Q2MA 2VGOA 2XNOA 4O0XA 4OTHA 5L2TA 5CSWA 2CPKE 3TTJA 3DKOA 5FBNC 5FTGA 3UQCA 2IZTA 2B0QA 3PJ8A 3F9NA 4FV3A 3ORNA 4HZSA 2OF2A 4KIOA 5D7AA 3RHKA 3UIMA 4AN3A 5I3RA 4J71A 3BYVA 4KS7A 2X2MA 1WVYA 1Q61A 2QOFA 4EYMA 3CGFA 5IQBA 4QP6A 4NKSA 4KUJA 3OCGA 4JDIA 2W17A 5CI6A 5AADA 5KCVA 4TRLA 2PVFA 4L67A 4CXAA 5HG5A 1ZY4A 2G2FA 1XHAA 2X9FA 3FMLA 2DUVA 4MXOA 4TPTA 1ZMUA 3ZZEA 2WTWA 4FMQA 5CEQA 2Y7JA 4IC7A 5CZIA 5EM6A 2J5EA 2ERKA 3R9DA 3BELA 5HCZA 3OY3A 3O17A 2PZPA 5C01A 5AX3A 2WMWA 4DGGA 4QTEA 4IZAA 3PA4A 2XNBA 3U87A 4EOPA 3A4OX 2A27A 4V01A 4C3FA 1FGIA 3P0MA 4GV1A 1MUOA 1Q8TA 1YXSA 2AYPA 4HVIA 4MXYA 4HNIA 3RK7A 4AE9A 3C51A 3VS7A 4K0YA 3SG8A 4L9IA 1M7QA 3E88A 2HZ0A 2BMCA 4O21A 3LXLA 4S33A 3SQQA 4O83A 5KMOA 2XP2A 3F2AA 3DGKA 2WKMA 4FTMA 3BHHA 4RMZA 4KWPA 4CMOA 4EC8A 2REIA 5EDRA 4XS2A 1NVQA 2R4BA 3ZLXA 3AT2A 3IOPA 3Q53A 2R7BA 5A4QA 5DGZA 2NRYA 1W98A 4ZSEA 1LP4A 4ARKA 4TY1A 4ANLA 4RA5A 3VUGA 5IUGA 2X7FA 3TACA 4HGEA 4IACA 4MNFA 5KBQA 5I9YA 3MIYA 3OW4A 3LPBA 4RVMA 4L68A 5LQFA 1H28A 4ASXA 3PJCA 3PY0A 5HIEA 4ZAUA 1H1SA 5JGBA 4QMNA 1YOMA 3PUPA 4FVRA 4U42A 2GU8A 3LXKA 4RJ5A 3CIKA 4AN2A 4APPA 5EDPA 1JSTA 3KXNA 4YC8A 5AAGA 5GINE 3BKBA 3LFSA 1JQHA 3LE6A 3RVGA 2JKOA 4QD6A 4O2ZA 3OXIA 2C69A 3ZLYA 4DTBA 3LCKA 3QTUA 2DS1A 5DE2A 3H30A 3FHRA 5M4UA 3RZFA 4U41A 3CS9A 1MRUA 1SNXA 2F4JA 1Q41A 3FL4A 4MXAA 3ZC6A 3ZBXA 5JKGA 3H0ZA 4GMYA 4CFVA 3QRKA 4F99A 4DLJA 5AAFA 4KNBA 2XKFA 1NVSA 2AUHA 2ZJWA 3NYVA 3TZ7A 2RF9A 2OJ9A 3GOKA 4H1JA 4IADA 2ITQA 3AQVA 3FC2A 3A7JA 3NRMA 4FODA 4D55A 2UVZA 4BWPA 3DFCB 3F3TA 4FKRA 5EQEA 4M13A 3L8XA 5D9HA 5ANIA 3UP2A 3QCQA 1Q8ZA 2XVDA 4ZTQA 5L6OA 5KKRB 4EYJA 1PMUA 2YIWA 1CSNA 3BWJA 4RLKA 5L2WA 5EW3A 4FV7A 4AOIA 5AP3A 4YJUA 4BTJA 1O6LA 4BDCA 4XP0A 5M44A 5CT0A 3UZTA 3H4JA 1H08A 2OW3A 4IWDA 4IM2A 4JLCA 5IA3A 2E2BA 5K4JA 1BYGA 4HNFA 4K33A 4GT4A 2YM7A 5AP5A 5LMKA 5KUPA 4DTAA 4FKPA 5A14A 1UNHA 3PIYA 3NUAA 1CDKA 1KE7A 1ZZ2A 1R0PA 2PVRA 4M68A 2UV2A 3FLNC 1FQ1B 3OMVA 5CNNA 4YHJA 3R63A 5FDXA 4ACCA 2JBOA 4CCUA 4D1SA 4J53A 2IN6A 4E5BA 2O3PA 3HA6A 4GEOA 4NTTA 4CTCA 1H26A 1UU8A 4I41A 3NW5A 4FUYA 4CFFA 3Q52A 3RKBA 4FV6A 2OIQA 4J52A 5AR7A 3GP0A 1Q8WA 3MVJA 3BHVA 4YZCA 3RMFA 4FBXA 3VJNA 3Q9XA 4ONAA 4EQCA 4H1MA 3LMHA 2QOQA 4RX8A 4HGSA 4O1PA 4WUAA 1ZYDA 4C3PA 4CFNA 5A4TA 5HVYA 4BI1A 3CSVA 3VF8A 2OIDA 3S3IA 3SXFA 1PXLA 4KIKB 4NM0A 3COKA 2BR1A 2JKKA 4XG7A 4FIEA 3RI1A 4FV9A 2F7XE 3HAMA 4GS6A 4AT4A 3VUIA 3A2CA 3W8LA 3OF0A 1QPJA 4C37A 1F3MC 3PJ1A 4UWBA 4IX5A 5IH5A 5JMSA 2QOOA 5HLPA 5KMKA 4DBXA 3DNEA 4FKVA 5GIPE 2PZRA 4WIHA 4X21A 3O7LB 1YWRA 5E92A 2B1PA 2VTNA 4O22A 4FSQA 4FL2A 1ERKA 5HEZA 2CJMA 3OCSA 4MXZA 2C6EA 4FTIA 1JNKA 2Q83A 3KRWA 5CALA 4FEWA 1OPLA 4IAAA 3NEWA 2WHBA 2J0JA 4FTNA 4R3CA 3ALOA 3KXHA 4BBEA 2XKEA 4TYHA 3FQSA 4DITA 3G90X 5HLWA 4IJ9A 4M14A 3RHXA 2ZMDA 2VTMA 2Y9QA 5BUEA 3H3CA 3LQ8A 4ZXTA 1IA9A 2OH4A 3A7FA 3CTHA 3DKGA 1W0XC 5DHJA 3O8PA 4ZSJA 3VHEA 1JKKA 2ESMA 2XCKA 2XKDA 3KXGA 5J87A 4D4VA 2XIYA 1UV5A 2JDVA 4BI0A 4ANQA 2QG5A 5AP0A 2UZUE 2Z7QA 2XKCA 4KSQA 3N4VA 3ZZWA 2BZKB 2VO6A 3DJ5A 4P5ZA 2GQSA 3ET7A 1B6CB 4U81A 4O7TA 5EI2A 2YHVA 3C50A 4IIRA 3V6RA 4BKYA 2YABA 3OUNB 3UNKA 2OZOA 2WMAA 3MY0A 1Y8GA 4FT5A 2PE0A 1Z57A 4ITHA 3F5XA 2WMBA 2DQ7X 5KZ0A 3W2PA 4MCVA 1U4DA 4ZJIA 3ZO4A 1PXOA 1J91A 1GZNA 4QP1A 5DG5A 3BHTA 4O81A 4D4YA 1R1WA 3BWFA 4MNEB 4UBAA 3VS5A 4X2NA 2UW9A 2VTPA 4LG4A 3QZGA 4DG3E 1WBNA 3TKIA 4GH2A 1YKRA 4DT9A 3VJOA 1ATPE 4BCJA 4EC9A 3L9LA 4FSMA 4LMNA 4F6SA 4AT5A 4GKHA 4XG6A 3RPSA 3PA5A 1OBGA 3HECA 3GCQA 4KIPA 4RX5A 5HCXA 3KB7A 3LFNA 5IH4A 4PQNA 1BX6A 2R3LA 4DFLA 4CLIA 2H8HA 2VX0A 2R0IA 3FLWA 1OUKA 4CVAA 5F94A 1QL6A 4O0YA 3Q96A 1XJDA 2FB8A 2GFSA 4MH7A 4X2GA 5HD7A 3QYWA 2XIRA 3TZ9A 3LFBA 3SHEA 3I4BA 1YQJA 3HNGA 5FXRA 2CNVA 1O6KA 4FV1A 4NW6A 4BZDA 3OEZA 2XYNA 2OU7A 1M2RA 5AUYA 4Y72A 2BDWA 2HK5A 4DFYA 2JDTA 4GUBA 4I0SA 3WF7A 3VULA 3FSKA 5DEYA 3POZA 2WIPA 4ALUA 3R7VA 4BR3A 3GCVA 3W10A 3R04A 4CEGA 3BI6A 3E92A 2BTSA 3VUDA 2FGIA 5L2SA 5LWNA 2ZV8A 1DS5A 3IW6A 3B8RA 3TUBA 4AS0A 3BEGA 4RIXB 3IONA 3FMHA 5EI8A 4E6QA 4EJ7A 1OL6A 2BALA 4JOAA 3AG9A 4X2JA 4BDBA 4Z9LA 4HOKA 5I9ZA 5CF8A 3R9HA 3O7LD 5FEDA 3UVQA 2GSFA 1V1KA 4Y73A 4XNEA 4YJPA 3WF6A 5H2UA 4EK3A 3ANQA 3TV6A 3BE9A 4J99A 4YSMA 5IZFA 5T68A 1UNGA 4U0IA 3LMIA 2WMUA 3K54A 2ITVA 4IAYA 2R9SA 3FAAA 4LRKA 4FIFA 2JEDA 4XLVA 5KO1A 1XO2B 2XIKA 3QUDA 4CD0A 1JKSA 2H34A 5AP1A 4JQ7A 2BZIB 2VNYA 1GIHA 1ZYCA 4EHEA 4DAWA 4U44A 5E8ZA 4NFMA 4WBBB 4FZAB 3DXPA 1IAJA 4E5WA 3D94A 3MH3A 3JYAA 3MTLA 3PVUA 4MBLA 3EL8A 2QO7A 4AU8A 2XK8A 2XCHA 1WBTA 2VWXA 3LKMA 1KE9A 2UZVA 4WSQA 3ACKA 5AM6A 5FP5A 4Z3VA 3AC2A 4BF2A 4Y5QA 5FQDC 4IW0A 4DEDA 5M56A 2QU5A 3ZU7A 2ITOA 3V8SA 4XV1A 2GNIA 2XIXA 5B2KA 4BCGA 4CMTA 1XBAA 2GNFA 2XEZA 4JRNA 3L1SA 5BX0A 4FICA 5AR2A 4QYGA 2WOTA 4Q5EA 3NZ0A 3RP9A 4DH8A 1FPUA 4LI5A 1QPCA 5BYLA 2YIQA 4S31A 3VQHA 4BGHA 3C5IA 3DU8A 4CYJA 2BUJA 5J7BA 3NNVA 3P86A 3MESA 4I3ZA 3WIKA 3I5NA 3ODYX 3OD6X 5HIDA 4J97A 4LGGA 5KZIA 2BKZA 5C27A 3GC0A 3F6XA 2PVYA 2XNPA 3HP5A 1J3HA 3OT8A 4MKCA 4RPVA 4QMOA 4QO9A 3VAPA 3NUNA 2C6LA 4HYIA 4IX4A 2A19B 4L7FA 4M0ZA 2ERZE 4FTAA 4FT9A 4IAIA 4QPSA 4EEVA 4ZEGA 4C59A 5J9ZA 1WBOA 3P7BA 3QHWA 4ITJA 4V0GB 5DI1A 3E63A 2PULA 3EQHA 5CX9A 4AZTA 4KBAA 4ZIMA 4UMUA 4ZLOA 3NW7A 3PXQA 4X0MA 4IB3A 3O71A 5AV0A 2Y8OA 3RNIA 1OPKA 4BL1A 2XBAA 3FBVA 4LFIA 4R5YA 3OROA 4ALVA 4IVBA 4WOVA 4FA2A 2YLFA 3FUPA 4JBPA 3MH0A 3ORTA 1FMOE 4ZLYA 3RGFA 3TXOA 4L8MA 4WSYA 4ZSGA 5FLFA 3UO4A 5HBHA 3NNUA 1W82A 2YWVA 3UO6A 5J5SA 4F1MA 1GZ8A 3ROYA 3TIZA 3TWJA 1JKLA 4DEAA 2ITTA 2J50A 3BGZA 5IA5A 3FQHA 3QX4A 2XUUA 4G3GA 4E93A 5IUHA 3RAIA 3MV5A 4BCFA 3EWHA 3QZFA 3PJ2A 4IXPA 4K6ZA 3VS4A 5IDNA 2XBJA 3G33A 3G9LX 5DNRA 2QI8A 2ZAZA 5DR6A 3U55A 3BIZA 3GXLA 3H9RA 4MBJA 4P4CA 5K0XA 2WGJA 3QWJA 4L53A 3JY9A 5IF1A 2XK4A 4WKQA 5TOZA 3OY1A 4RIOA 3FI2A 5CNOA 3IW8A 5J1VA 2WELA 4XYFA 3OWJA 5EM7A 5BYZA 4CYIA 2VTLA 2O8YA 2WMTA 4ENYA 3I79A 2IWIA 1XH8A 4YZDA 5AR3A 2WEIA 5FD2A 3R1QA 4FL3A 4PWNA 4AE6A 5JN2A 3HUCA 2XK6A 3O8UA 2J0KA 3RK9A 5IQCA 2X9EA 4ZSLA 2YWPA 5AMNA 3UPZA 4FG9A 2J4ZA 2OF4A 3SXRA 2C0IA 5AJQA 4J7BA 2CCHA 2YJSA 4FSYA 3MIAA 1WBWA 3PXRA 3V5LA 4BDHA 2BAKA 4TWPA 4F7JA 5DFPA 3LCSA 3UOKA 5JRSA 5ANKA 4BDAA 3KL8A 2I7QA 5IQFA 3L9NA 4DGLC 4TYIA 4EH7A 3TNHA 3QAME 4YJOA 3R0TA 4MNEA 5HTBA 4BDIA 3AC4A 3D2KA 2YM6A 1MQ4A 4FZDB 4IEBA 4RSSA 4NM7A 3SOCA 3H9FA 4YTCA 1M2QA 3R71A 4JXFA 3R8LA 5C26A 2E9VA 1OKZA 4D2TA 2W05A 3EFJA 2UVXA 2X8IA
chains in the Genus database with same CATH superfamily
1PKDA 1Z5MA 2NRUA 3QL8A 4AA4A 5HX6A 3DXNA 2HZ4A 1ZRZA 2WTJA 1GIJA 3FI3A 3RALA 3WI6A 3D0EA 5HG9A 3TV7A 2YM5A 3Q9WA 4QMVA 3ZBFA 3DB8A 1VZOA 2IW8A 3TNQB 1IEPA 1G3NA 2JLDA 1QMZA 2XIZA 4WRSA 5EDQA 3PPKA 2ONLC 4U45A 3Q2JA 2QLQA 3MI9A 3GU7A 4G34A 1YXTA 2OXXA 4IWPA 5CQUA 2G2HA 4LQMA 3DTCA 4NZWB 1XR1A 3BQCA 4EONA 5E9EA 2NP8A 3FMJA 4RC4A 3RTPA 3VS3A 4A7CA 3OBJA 4RJ6A 4TKSA 3MN3A 4I6QA 4O27B 3I7BA 3NLBA 2X0OA 1VR2A 3AMYA 3F3UA 4GJ3A 5ANEA 3VW8A 2YACA 3OCBA 2H6DA 1VLRA 3AKJA 4R8QA 1IAHA 2R3PA 3MFUA 2Y4PA 3LFDA 2OO8X 5DT0A 5BQ0A 1Q62A 1VJYA 2EWAA 4MF0A 4BY9E 4PPCA 3ZDUA 2H9VA 2W5BA 5HBEA 3DBDA 5C8MA 5HTCA 1H1PA 4GFGA 3R7EA 4TNDA 2XJ2A 4APCA 4ZTSA 3P78A 3A60A 3EYHA 3QRUA 3BE2A 4QPMA 1U59A 5EKOA 2XANA 5CXHA 3THBA 3P7CA 4UWCA 5AR4A 1SVGA 1XH5A 4KS8A 4DH1A 1OITA 2F49A 4MAOA 1P4OA 3CJGA 2B54A 3EHAA 3CP9A 2JDOA 4ZTRA 1OKWA 5FTOA 4ZJJA 4E4XA 4NW5A 4DH3A 4KBCA 4CKJA 3Q4TA 3UVPA 4AZVA 3KVXA 1WVWA 4O0WA 4RVLA 4W8DA 1Y8YA 2NO3A 4XG2A 1MP8A 4O1OA 3C0GA 2R3GA 4HVHA 3P08A 4TWCA 3GI3A 4UX9A 1OECA 2GQGA 1PXKA 5JH6A 3DAEA 2P55A 5F9EA 3MPMA 4BCIA 4FTUA 3EQFA 5EW9A 1VYZA 4DGNA 3TMOA 3MB7A 5D11A 5M4FA 3GNIB 3FJQE 3QTZA 1U54A 2I40A 2W4KA 4C4EA 4BCKA 3S4QA 5CLPA 3ZUUA 2QR7A 1JAMA 3R8ZA 4NJDA 4H3QA 5HE2A 4I94A 3UO5A 3OG7A 4MYGA 3OXTA 4H3PA 5HG7A 3MY1A 4C36A 4D5KA 1JOWB 3E93A 5E8XA 3CKWA 3LJ0A 5KX8A 3EN4A 3D5VA 3ZSHA 4RFZA 3PSBA 5AM7A 5G6VA 3NAYA 3VUTA 4I6BA 2J2IB 3POOA 3HRFA 3GU5A 3LM5A 3PVWA 4LV8A 5L2IA 2A1AB 1WCCA 1M14A 2OK1A 3MWUA 4XCUA 3V5PA 3FC1X 4IVAA 3PWYA 3EZRA 3CBLA 3WE8A 4C2WA 1KOBA 2J9MA 1PRYA 5E1SA 4JT3A 4QP7A 1XWSA 4O7ZA 5LVLA 4F9AA 5EHLA 1SYKA 5TO8A 3GBZA 3CTQA 3R1SA 2W0JA 4NYEA 3AC5A 2HWPA 4X3JA 3SAYA 3W2QA 3MPAA 1ST0A 4TTHB 4C62A 4XOYA 5K5NA 2WQOA 4O4FA 2CKOA 1Y6BA 1CKPA 3C4CA 3VHKA 2VTHA 4AW0A 2JDSA 3V5WA 5CAVA 5FEEA 3NR9A 5FRIA 1SNUA 2YDKA 3AD6A 4JG8A 4YLKA 2QC6A 5E8YA 4NU1A 4YPDA 1PXIA 5HE3A 3TCPA 3VS6A 1OKYA 4LOQA 3Q4ZA 1ZAOA 2DWBA 4YSJA 3COMA 4PDYA 3ORKA 3UNZA 4DN5A 2GHLA 4NSTA 3SC1A 4BDJA 4FKGA 3W2RA 3OT3A 2XA4A 4C38A 2C5OA 3TUCA 2PUPA 5A3XA 3EL7A 2X8EA 4ZP5A 4LOPA 3RZBA 3HP2A 3R6XA 3UTOA 3WF5A 3F2NA 5G1XA 3EQPA 4BZNA 4DFUA 4QMTA 5AUTA 4GK4A 2CCIA 4L45A 4M0YA 4I6LA 3UVRA 4FT3A 5BUIA 5CU6A 4L01A 2W1HA 3V5TA 4AT3A 3A8WA 1SM2A 3A8XA 1OB3A 3FKLA 1KSWA 5B2MA 3I7CA 4FT7A 4D2VA 1OL2A 1XQZA 5HO8A 3U6HA 1APME 2BRMA 4DEEA 2QR8A 4MEDA 4YZBA 3T8OA 3UPXA 5DR2A 4PMMA 3M2WA 5FTQA 3A4PA 4FV2A 4EH6A 4GG5A 3DDQA 4LMUA 2V5QA 4G17A 3ZO1A 4DFNA 2ITZA 5GZAA 4NM3A 4DT8A 2R0UA 3QKKA 2HY81 3WZUA 2HW7A 2UW0A 2QOHA 4FEQA 4JS8A 5HI2A 2PVJA 5DOSA 4RC3A 2YJRA 5EK7A 2BDJA 4H36A 3OFMA 3ZOSA 5LMAA 4RIYA 3ZC5A 5FBOA 2C5VA 3OWPA 4IB1A 2JAVA 2W5AA 1LEWA 3K3IA 4G16A 4NKAA 5FDPA 1J7IA 3I1AA 2IEWA 3ENHA 4FTJA 3REPA 2GNGA 4B6LA 4II5A 3COHA 4IQ6A 2BZHB 4EBVA 4EKLA 4G3EA 3OS3A 4IM3A 4B7TA 3C4XA 2XJ0A 4FSTA 5EYCA 5LARA 4JAIA 3OP5A 2Q0BA 3LFAA 1W7HA 4PX6A 5IQAA 1BLXA 4FZFB 4JJRA 2ETKA 1F0QA 1Q99A 3F66A 3ZLSA 1JWHA 3ATTA 2PVMA 5L8LA 2OLCA 3IECA 2G01A 3DKFA 4WBOA 4ANSA 5FM3A 4FV8A 4RJ7A 4YTIA 4IFCA 4L3LA 5DEWA 1RW8A 4BWXA 4O7SA 3ZO3A 1FVRA 3AC8A 4ZOGA 1UWHA 4MBIA 5GIOE 2ITNA 4TWOA 4FTQA 5HE1A 3KRXA 5EOLA 4FKSA 3TIYA 3N51A 3FXZA 5HKMA 4PMTA 2Q0NA 4MHAA 4OTRA 4PPAA 2IJMA 4JG7A 3W8QA 3TJCA 1YHVA 4FGBA 1BI7A 4BTKA 3RAHA 1Y6AA 3I0QA 4ZTHA 3QXOA 4LUDA 2W1ZA 4ERWA 4JR7A 3DA6A 5KKRC 3KQ7A 4W8EA 1B38A 4OTWA 2BAQA 1DM2A 4HGTA 3NAXA 5I9UA 4QRCA 4QTAA 2C3KA 4EOQA 2ITWA 3IOKA 3HDMA 1E1VA 4GFOA 2VRXA 4MWIA 3MJ1A 4JIAA 1OMWA 5L8JA 3HMPA 3A61A 2C68A 3ZEPA 4F09A 3PLAE 3KN5A 1JLUE 3MGYA 2RG5A 4E1ZA 5AP6A 3RAKA 2XK7A 4D9TA 1OL1A 2PZYA 3C7QA 2Z7RA 4CLJA 2F57A 5AA8A 2WIHA 1TZDA 3F69A 5J9YA 5CEIA 3UBDA 3HVCA 1Q3WA 3NIEA 5F95A 3NVMB 4I5PA 1LEZA 3U4WA 4KKHA 3A7IA 3KREA 1LR4A 2W06A 4E4NA 2QO2A 4PDOA 3HMIA 4HCTA 2EB2A 5IQIA 1W84A 2J0MB 4CFWA 5ITAA 4FYNA 2KULA 2PL0A 4XBRA 3PYYA 4YO6A 3P7AA 4KIQA 3V01A 3PSCA 5BUJA 2RGPA 3IW5A 5GJDA 4ZS4A 4YBJA 3TL8A 4RVTA 4NIFB 2C5NA 4OR5A 5HCYA 2CGWA 1REJA 4QEBA 4C35A 3OOGA 3Q4UA 2OZAB 2RFSA 2BKKA 3QLGA 2WOUA 3EFWA 4L46A 3QD3A 4FV4A 4U9AA 3Q5ZA 3KMMA 4WA9A 2VO3A 4U3YA 3RBWA 5IUIA 5LCKA 4DHFA 2C6MA 2ZB1A 2FSTX 4JRVA 5FXSA 2CGUA 1H24A 2VNWA 1CKIA 4R1VA 1V0PA 4W9WA 4XMOA 3FZSA 4AQKA 2C6DA 4O38A 2O5KA 3BZ3A 3OCTA 3DK7A 5DMZA 4JBOA 1WBSA 1PMNA 5CSHA 3C0HA 4ZTNA 1YI6A 4CQGA 2JKQA 1PXMA 3KK8A 3D7TB 4EBWA 5BV3A 2OFUA 2QOIA 3AGLA 2BZJA 3KCFA 4ZZOA 5HNIX 2XALA 2UUEA 3PXFA 2W5HA 4E3CA 2JGZA 4OAVB 1U5RA 2I0VA 4YUQA 3BL7A 5A4LA 2C0OA 1GY3A 1OM1A 2W4OA 3IO7A 3II5A 3U6IA 4UZHA 4NM5A 4O4CA 3R83A 4O2PA 4RQKA 1J7UA 4QDEA 1YOLA 3FV8A 3FZPA 1RJBA 4R3RA 1UA2A 3E5AA 3F3WA 3HV4A 4GL9A 4QP3A 4ZZMA 3D7ZA 2BDFA 4OTIA 2GNLA 3Q4CA 4L7SA 4LRJA 4A4OA 4DFBA 4EWHA 1R78A 2R2PA 2HCKA 3OWLA 3U9CA 1OIRA 4ORKA 3W0QA 2IO6A 4AXDA 2IPXA 2B9JA 5AP2A 5B7VA 4ZLZA 2YIYA 4FTCA 4A9YA 5C4LA 5JEBA 5T3QA 4Z16A 3VVHA 2PY3A 3G5DA 3W2OA 5IISA 2IVUA 4TYEA 3BCEA 4HYUA 3QQGA 5HNBA 5I3OA 3VUMA 3RM7A 4O7RA 4EL9A 3T9IA 2VTIA 3EQBA 3SDJA 4M7IA 3KVWA 2XM9A 5ANOA 3ZXTA 4EHGA 2CHLA 1GZKA 4OT5A 3HV3A 5CYIA 4LGDA 4X2FA 4F64A 5BPYA 2WMRA 3HV6A 4FSRA 1ND4A 3UDBA 5E7RA 2X4FA 3OTUA 1RQQA 1NVRA 2RL5A 3ZSGA 2C47A 1G5SA 3ZRMA 2OICA 2OBJA 4IJPA 4K11A 4GT3A 3UIBA 4G31A 3GEQA 4XG8A 1X8BA 2R3OA 2OJFE 3QD0A 4FKLA 2CN5A 1YXXA 4USDA 3HKOA 4JI9A 4JX7A 4F1OA 4BYIA 3DBEA 3R7UA 3W2CA 3O2MA 4HVDA 3ZCLA 4CZYB 3LHJA 3C4WA 4EJNA 5C8NA 1KE5A 1AD5A 1ZYSA 2ZMCA 4KKEA 4NK9A 4QT1A 2VTSA 5EW8A 3D4QA 3E64A 1H07A 1JSUA 2GTMA 3ORZA 4BWKA 4O82A 1ZMVA 4YJTA 3F3VA 4GIHA 5CF5A 3EN9A 2C5XA 3VRYA 3EQDA 3LXNA 4BTFA 2XK3A 2VV9A 3I6WA 4FIJA 3LQ5A 1NA7A 4G6NA 4C2VA 5CAOA 2GNHA 5IKWA 3FMDA 3ZXZA 4AW5A 4OGRA 4U5JA 4RIYB 3R02A 3ZSIA 5IH6A 5ANDA 2PVHA 1XBCA 2Z02A 5E8WA 2C3LA 3R1YA 4F0GA 4GJ2A 4EHZA 2CKPA 3U6JA 3O51A 2OIBA 2HELA 2R7IA 4TT7A 3TKHA 3PG1A 4YMJA 4USEA 2R3JA 4QP2A 3UOHA 4PL5A 4QMLA 2WMQA 5DH3A 4DE4A 3C1XA 3OZ6A 4D28A 3RPOA 3VBTA 3NS9A 2VN9A 4HGLA 4ZZNA 2XS0A 3LJ1A 3T9TA 3FLYA 4D4RA 3L8PA 3VQUA 4KRCA 2HXLA 4K9YA 1SVHA 4AA5A 4F1TA 2OJJA 4C4HA 3S95A 2QONA 3DB6A 4TWNA 3JVRA 4UYNA 3R01A 1G8KA 3H0YA 2PMNX 4IZYA 1IA8A 2WEVA 2R5TA 4QTDA 4O0TA 2CLXA 5HO7A 3EQRA 4DA5A 2R3MA 4S32A 4TNBA 2WQBA 3KULB 5L3AA 2R3QA 4FEVA 4L43A 4A07A 4ZK5A 4Y95A 5JSMA 3FHIA 3TZ8A 2WTKC 3FMMA 3DFAA 5DVRA 4BDEA 4EH2A 1NW1A 4NUSA 5HE0A 3UNJA 4F6UA 3LZBA 4DG2E 4CZUA 5IEXA 2YITA 1L8TA 3MFRA 4ASZA 2PVLA 1NY3A 4GK3A 3UGCA 3ZRLA 4UN0C 2VWUA 4WRGA 4E4MA 3LM0A 4FUXA 2HXQA 2PVNA 3LCOA 1GIIA 4HJOA 3EN6A 4XG4A 5A6OA 3OEFX 1P2AA 3FYKX 4E7WA 4X3FC 1R0EA 4EUUA 4PRJA 1QCFA 3RPVA 4FG7A 4DFZE 5DYJA 5BMSA 4GG7A 3KF4A 2X1NA 5EI6A 3CLYA 4QYEA 4BCHA 4IAKA 5EKNA 1UVRA 3CQEA 3DZQA 3RAWA 4F70A 3KY2A 4U3ZA 3EFKA 3F61A 4JVGA 1SMHA 4L44A 3WYXA 3PXKA 3MBLA 5B0XA 4A4LA 4S2ZA 3NUSA 1YWVA 4MK0A 2YCQA 3G51A 4QMWA 4D1ZA 2I1MA 2WMVA 4LGHA 3R7OA 2XB7A 1OGUA 2GDOA 3CQWA 3Q6UA 4FKTA 2VUWA 2XYUA 3A7GA 5CS6A 4DYMA 5AUXA 5AV4A 2XJ1A 3QC4A 3FKNA 3NSZA 2JIUA 2UZOA 4RFMA 1A06A 4YJNA 5DN3A 3SV0A 3QC9A 4BDKA 4EOOA 3LFQA 4AF3A 3SG9A 4K2RA 3ORMA 4FTTA 4U80A 4XG3A 4Z55A 2ACXA 1BL7A 2ETRA 2YISA 4CFUA 4EH9A 2WTDA 4RJ3A 4AGCA 4QQTA 5K9IA 1WBPA 4MWHA 3SW4A 2R3NA 2BVAA 3SOAA 4FJVA 4FNZA 4NJ3A 4K1BA 5E8UA 3VIDA 3CCNA 4JDKA 3R2BA 3G9NA 4GT5A 3UP7A 4CT1A 3G2FA 3EMGA 4O7NA 3DK3A 3I5ZA 3UYSA 1U5QA 3SW7A 4BHNA 2Y6OA 2YN8A 4BGGA 3ORXA 4GW8A 3ZM9A 2UZNA 5D12A 5KMNA 4PMSA 3SRVB 3SGCA 5CVHA 4CG8A 1PJKA 3BBTB 4AWIA 4I0TA 4AQCA 4B4LA 5CEMA 4UXQA 4OAUC 2UZEA 3W0SA 5KNJA 2WZJA 2UW7A 3KC3A 2XARA 4LL5A 3LLAA 1U54B 3HLLA 3GC7A 3VWAA 3AC3A 2IG7A 4UYAA 4YZMA 4ZJVA 5H8EA 2BPMA 1H4LA 5BVDA 3V8WA 4XEYA 4D4SA 3FMEA 1YDRE 2VZ6A 3MA6A 3BGQA 5AP4A 4ACMA 4F63A 4ERKA 2C4GA 4ACHA 4EH5A 1M7NA 3D14A 4WD5A 2ETMA 1H1WA 3KGAA 4IX3A 3W1FA 4X6RA 4RRVA 4G5JA 4LRMA 1XH7A 4UV0A 4WG5A 2JKMA 4AACA 2BROA 5L2QA 4M3QA 4C4IA 4EK8A 2PE1A 3I81A 4K18A 3NPCA 4A9TA 4I6FA 2IW6A 4IMYA 4V0GA 2PUNA 4TZRA 3OXZA 2C0TA 3P23A 5EHOA 3O8TA 5EM5A 1ZYJA 1IRKA 2RFDA 4I21A 3W0MA 3V5QA 5BYYA 3BLQA 5BNJA 1CM8A 4FYOA 2V55A 4RIWB 3QZIA 1UKHA 1VEBA 3R9RA 2QQ7A 2XZSA 1HCKA 3FY0A 4DDIA 3GU4A 5HLNA 2W1EA 3MDYA 5CXZA 3PP1A 2W9FB 4JL9A 3ZFXA 3PSDA 3KN6A 4I23A 4KA3A 3QWKA 5AAEA 3WYYA 5TT7A 4Z7GA 4R7IA 2IF8A 3JVSA 4UMTA 4E26A 3FI8A 3R21A 4A9SA 3C0IA 4G9CA 5AV1A 3OC1A 1JVPP 1PF8A 2I6LA 3UOLA 2QG7A 1IR3A 1TQPA 1Z9XA 4KABA 4A9RA 2WU6A 1YWNA 3NYOA 2V0DA 5C03A 2FA2A 3QBNA 4RIWA 2B55A 3QRJA 1Q8UA 3DLZA 3TG1A 2X8DA 4BTMA 5HU9A 3C5UA 4YHFA 4E4LA 2V62A 4FRFA 4ZS0A 2NYAA 4QMUA 4I5HA 5LVPA 1B39A 4IDTA 2VWWA 2ZDTA 5TR6A 4BI2A 1ZWSA 4QP9A 2YDIA 3M11A 4BICA 1QPDA 4AFEA 2VWZA 3CPBA 4AA0A 2PMIA 2HWOA 3QTXA 5EYMA 2VX1A 3U8WA 3HAVA 5I9VA 4I4EA 2ZFYA 3OWKA 4BDDA 2GPHA 3ZEWA 1E9HA 3MVMA 3HV7A 2GNJA 2ITXA 4U43A 2J90A 3DK6A 3QRTA 5TF9A 4B0GA 3NYXA 3EZVA 4RT7A 3F3ZA 1P4FA 2BAJA 5EYKA 3E8DA 5A9UA 5IQEA 3EIDA 4IANA 4BC6A 3KRJA 1J1CA 3OBGA 3BX5A 4FSWA 5A4CA 3PWDA 5H8BA 3A7HA 4X2KA 5EG3A 4BGQA 4TW9A 4BYJA 3R28A 3ULIA 3VO3A 5KMMA 1H01A 1WMKA 2EU9A 4YLLA 5I9WA 2PTKA 2YM8A 2UW6A 3VNTA 2J51A 2C3IB 2CLQA 1WZYA 2J7TA 2QLUA 5FG8A 4CGAA 4E5AX 1BL6A 2O0UA 2VWIA 2YCRA 4GFMA 2FH9A 4IHPA 3DS6A 3PA3A 5ACKA 2R3RA 2GS7A 1H0VA 3QQHA 4BZOA 2X7OA 4FSUA 4AZFA 1TQMA 2VD5A 3QCXA 4N70A 4F7NA 2PU8A 3CPCA 4G1WA 4L00A 3R73A 1PXPA 2B9FA 2QCSA 2VO0A 1H1QA 3ZUVA 4BVUA 5L6PA 4O7YA 4B9DA 4XJ0A 4JBVA 3BEAA 3C9WA 3P4KA 3W2SA 1P14A 1W2FA 4F7SA 4ZMEA 2CMWA 1KWPA 2XRUA 2ZDUA 3R2YA 5HO6A 3HDNA 3HZTA 4WO5A 2A0CX 3P5JC 1UU3A 3E3BX 2PMLX 3KRLA 5L4QA 1STCE 5CASA 4CSVA 1W8CA 4FI1A 3LW0A 4XHKB 3N4UA 3CTJA 3WOWA 5ICPA 4XUFA 5CU0A 3NUYA 3UZRA 4WNOA 2OKRA 5J7HA 4Y5HA 2C1BA 4BCPA 5DA3A 4F9WA 2W9ZB 3UIXA 4QMPA 2QOLA 3ACJA 4FOCA 2PWLA 5CU2A 3O23A 2IZUA 3TNIA 1KV2A 1UNLA 2CN8A 3D9VA 2ZVAA 3EKNA 3DOGA 5HORA 4K8AA 1W2CA 3K5UA 1H27A 3QA8A 4FIIA 3LJ2A 5CU4A 4ITIA 4DF3A 4F6WA 4PDPA 5BVFA 4RZWA 1H8FA 2VTJA 1RDQE 3F7WA 3HGKA 4W4XA 4DGOA 5KE0A 5AA9A 2QOKA 5F1ZA 4CKIA 4OTQA 4YURA 4N0SA 4LV5A 5A54A 3F88A 2BFXA 3NDMA 3DAKA 2GMXA 2XNGA 2YLEA 2EB3A 2HZIA 4KB8A 2Z7LA 3KKVA 3Q04A 3ERKA 3ORPA 4H39A 3W0PA 3RJCA 2GFCA 5HHWA 4L3JA 4XBUA 2UVYA 4DH5A 5DT4A 3JXWA 2WO6A 4CNHA 2VU3A 3IGGA 2W96B 3R7GA 2WAJA 1RE8A 4F08A 2UW5A 3BGPA 3BYUA 4HCVA 3ALNA 1GNGA 5EYDA 2OJGA 2HIWA 2BHEA 3L8VA 1H25A 3D83A 3NUUA 3QGYA 5AV3A 1IASA 5HQ0A 2QKRA 4X6QC 1YVJA 2Y6MA 4GSBA 3QGWA 4JQ8A 4QTCA 3U51A 4C3RA 2X7GA 4MQ1A 3QLFA 1XBBA 4L6QA 4BIBA 4QQ5A 4RWJA 3WILA 4YLJA 2EXMA 4OTDA 2CGVA 4DEBA 2YM3A 3AOXA 3JY0A 2IVVA 4O4BB 3DBCA 4RBLA 1FINA 1K3AA 2OH0E 2X6DA 2ZB0A 4Q5HA 4BCQA 5EH0A 4PL3A 4EZ5A 4USFA 3MYGA 4G6LA 1Q8YA 3BHUA 3BHYA 4OTFA 3FY2A 4RWKA 3H10A 5AX9A 2OJIA 4KBKA 3S1HA 4FR4A 5IEVA 3ORLA 1M2PA 3DQXA 4ZTLA 2OWBA 2X6EA 4IZ7A 1BUHA 1XMLA 4J8MA 3D5XA 5GZ9A 4QPAA 3MA3A 4DFXE 5IU2A 2GTNA 1ZLTA 2ZM3A 4FKJA 4RX7A 3JS2A 5CWZA 5DIAA 3GC8A 4DCEA 4YJRA 4EQMA 1Q97A 1JSVA 2PZIA 2HZNA 4FVPA 1G8AA 3OW3A 5FM2A 4AXAA 4EQUA 2GS2A 1I09A 1UWJA 4PNKA 2QVSE 3FMKA 4TYJA 3ITZA 3QCYA 4EORA 2XH5A 2PZ5A 4P7EA 1T46A 5I4NA 3MH2A 4V05A 4YNEA 3BV3A 4ZY6A 3ULZA 3S2PA 2W7XA 3LCTA 1PMVA 5D10A 3KFAA 5K0KA 5E8SA 3ZFYA 4LUEA 4QMQA 5JZJA 2NPQA 3BU6A 3BLHA 3PTGA 1KV1A 3PXZA 4C4GA 3FLZA 4I24A 4H05A 4UZDA 4FNWA 4DHIB 2C6OA 3LFCA 3S0OA 3D2IA 3GU8A 4LL0A 5DWRA 4C4FA 2PVKA 3EQIA 3NNXA 2OG8A 4GK2A 1KUTA 4BJJB 1GAGA 3ANRA 1T45A 4FL1A 4GRBA 4AP7A 3TTIA 2BRGA 4YO4A 4N57A 4QNAA 3DPKA 1ZMWA 3LIJA 2BTRA 4GU6A 4AW2A 4BHZA 3S00A 2AQXA 3ORIA 3FL5A 3PRFA 4O86A 4O96A 1YHWA 5CQWA 2F9GA 4FK3A 4R7HA 5D7VA 4LOOA 4J95A 5AUVA 3VRZA 5TKDA 1YI3A 3QFVA 4O0RA 5H9BA 4ZY5A 3UDZA 3AD5A 1OL7A 1A9UA 1J7LA 3FXXA 5F4NA 4F0FA 1P5EA 1WVXA 2RFEA 3DLSA 4YZNA 1XH9A 3GCUA 1Y57A 3FMNA 4QQJA 5FWKK 3PUFC 1FVTA 3GC9A 5DPVA 4ANBA 3IW4A 4OBQA 5HX8A 4BBMA 5LVNA 3TJDA 3B2WA 3EH9A 3TZMA 3PFQA 1OIQA 1YW2A 3UG1A 4AZSA 1DAYA 2JBPA 3AT4A 4HCUA 4UWYA 5D41A 4DTKA 3GU6A 1V0BA 1JBPE 3K3JA 2VTOA 3R7YA 3E3PA 5CANA 4WG4A 2G15A 3CJFA 4YTHA 4EI4A 5CAQA 2E9PA 4KINA 5EM8A 2W4JA 3UC3A 2YIRA 2IVSA 4TN6A 3OTVA 1AQ1A 1H1RA 4HZRA 3FZRA 4RJ4A 5DRDA 4ACGA 4B99A 5BVOA 4CV8A 4EOJA 3NWWA 2JFLA 4AG8A 4FKUA 2Y4IB 5J79A 1F5QA 2C6KA 3LFEA 4CFXA 4D0WA 4M69A 4EOMA 3E7OA 4PTEA 2XMYA 5IQGA 5HOAA 3CGOA 1BMKA 4EUTA 4BB4A 3SVVA 4WNKA 5IQDA 1TKIA 2V22A 1CKJA 1OL5A 3TDVA 3W0OA 1TVOA 2E9UA 5H8GA 3EOCA 4Z7HA 3P79A 4JAJA 4KRDA 4JQEA 2PK9A 2W1DA 3Q9YA 4FV5A 4QYFA 4FIHA 4F9BA 2YAKA 4FGRA 3QHRA 2C6IA 2QU6A 4QOXA 3VS2A 5C1QB 2W1CA 3DQWA 1YDTE 3OVVA 4M67A 1CMKE 4IFGA 3GGFA 3UOJA 4RA4A 5AV2A 2YEXA 4E6DA 3QALE 2FYSA 5HIBA 3V04A 4RWLA 4MUQA 5CSVA 2YAAA 3NYNA 4YC6A 3PDTA 3VN9A 4O0SA 3MPTA 4GYGA 2XRWA 4AXFA 4YJSA 2P0CA 5BVNA 2FSMX 3UMXA 3LQ3A 4PL4A 1URWA 4LM5A 2Z2WA 4Y83A 3FZ1A 2YA9A 2OI4X 2RSVA 3GT8A 4RLLA 4YU2A 3WARA 3WIGA 2OXYA 5C9CA 3W18A 5LVOA 3SRVA 4FTRA 4E73A 3QKLA 4CKRA 3BU5A 4AGDA 3NCZA 4AX8A 5K3YA 5HESA 2OXDA 4DINA 4E6CA 5J1WA 3KULA 2R3IA 3GENA 5HGIA 3F5PA 3UQFA 4ALWA 3FPMA 2UZBA 4C7TA 4D1XA 5KMIA 2VTAA 3B8QA 3CD3A 2Z60A 3PVBA 1BKXA 5M4IA 2BILB 2WXVA 2VWVA 4U8ZA 3UE4A 3V3VA 3VUHA 1PHKA 1S9IA 3U9NA 4I5MA 4CFMA 3BYOA 1Q24A 2UZLA 5D1JA 4BCOA 4GKIA 3FXWA 3MS9A 3ID6C 2RFNA 5L8KA 1TQIA 1SZMA 4FZ7A 3NCGA 4YGAA 3ZO2A 4GVJA 2W99B 2B7AA 3QYZA 4I5CA 4WHZA 4O0VA 4NFNA 3K5VA 1DAWA 1H00A 3WF8A 2B9HA 1A48A 3QUEA 3NUXA 5H3QA 2X2LA 3PPJA 2R3KA 2WQEA 5LOHA 3HEGA 4AFJA 4MXXA 5IA1A 2GHMA 3PY1A 4FOBA 5DT3A 5CI7A 4AOJA 3MVHA 4XV2A 2R64A 3RCJA 2HOGA 2QOCA 5KBRA 5CZHA 4DEHA 3BLAA 2LAVA 2E9OA 3ZHPC 3IKAA 4AOTA 5HVKA 2QOBA 4FTOA 4XLIA 5JFWA 4UXLA 1UKIA 2IZRA 3E7VA 1MRYA 1YHSA 2JITA 3MTFA 1VYWA 3P5KA 4QNYA 5DRBA 4CT2A 1LPUA 2X4ZA 3SD0A 4F9CA 4UB7A 4I93A 2QO9A 4UMQA 5J5TA 2ZV2A 4OBOA 4AAYA 1V0OA 3PE2A 1PYXA 2QKWB 5J95A 3FSFA 1YXVA 2W1FA 3HYHA 5HVJA 5I9XA 2CSNA 4G3FA 2X2KA 5KHWA 5KHXA 2CNUA 5GJGA 2Z8CA 3KF7A 1Q3DA 4P90A 4IB0A 2XEYA 1WFCA 4QYYA 1ZYLA 1KE6A 3GCPA 2FUMA 4AGWA 1NT2A