3E6HA

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pi10, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
SHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEGPEYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESDGRLLRGYWQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPARDGTFQKWASVVVPLGKEQKYTCHVEHEGLPEPLTLRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e6hA01
3QUZC 1XCQB 1XZ0A 4RAUB 3D25A 4H1LH 2CKBB 5I1CH 3MGOA 1T6WA 3ZKSD 4HK3J 3WN5B 3ARVA 4HIXH 1XF1A 4KXZI 2I9TA 2OZ4H 3C8KB 4FMFA 4MNGE 1T6VN 2XXMB 5LG1A 5IR1B 1IEAA 5DMGC 4PJ9D 1WZLA 3DYMA 5F6IC 5FECB 4G3YH 2EXYD 3K2UH 3OJVC 2NLJA 3S96B 5DJ2A 1S7WA 4YDJA 4FNLH 3DUSA 3BP4B 5JPNA 4MNGB 3DTXB 1X5FA 3AS3A 5K9JL 2H32B 2CKNA 1A6ZA 1FVDA 1TZGH 4EDXA 3WNPA 4AJ0A 3N1MC 4JFHE 5H35B 1BJ1J 1UJ3C 1UM4H 3ARPA 1OAUL 1ED3B 3TFKD 3JWOC 1FFNA 2ZPKL 1OW0C 5CSBA 5J06A 1A21A 3DYOA 1YDPB 5J89A 4DAGH 2CK0H 3JZ7A 1N26A 5F1NB 1XZ0B 2V2WA 1IC4H 3CSBA 4GSDL 1ACZA 2BSRB 3Q6GH 4R4NC 3T1FA 1DJSA 3LKPA 3QUMB 2H3NA 1CFTA 3QIWB 2C3HA 4YHYC 2OR9H 3IRPX 3MSPA 3QI9A 5F70A 2AS5M 2BCKA 3UPAA 1N0XL 2F58L 1NGXB 2HH0H 1MCEA 3HLAB 2NXYC 5DJ2B 3HE6B 3VXQA 3AS0A 4HUWA 1TMCA 2ED7A 4XAKD 3IVKB 3Q2CA 4X7TB 1I7TA 2FGWL 3B9DA 3HAEB 4HFWA 4U1LA 4JZNB 4XVJL 4Y89A 4HUNB 1ACYH 3KPOA 4XVTH 1NC2B 1IRAY 3KNBB 3HC4H 2ADIB 1U8PB 1H8SA 1U92A 1BD2B 3R0NA 4KI5D 2JF1A 4A2MA 4GG8B 1AD0B 3T65A 3L95B 2WUCL 5AG9A 3IF1B 1R24A 5I74C 5LXGH 5DC0A 3N85L 1NAML 4AK1A 32C2B 4IMKA 3X11A 4ELKB 3VXUE 4EN3D 5EB9A 3IFNH 5KS9E 5FUOH 2FIKB 4XXCC 2EYTB 3T4YA 2YPKA 1S9WA 3ARDB 1CTNA 4HK0B 1OPGL 5F6HJ 3QXWA 3OGCA 1Z5LA 2A9NL 2BFVH 2H6PA 4P2QD 3VXUB 1CLZH 1G9NC 1I1YA 5MENB 4R26L 2DWDB 5GGVL 2R1WB 5KS9B 3E8UL 1A14L 4ONFL 1RJZA 3V7AG 4PREA 2FB4L 2XWJA 2I60L 4U1NB 3QJHA 2NY4D 2F5AH 3QH3B 3MQIA 1GGIL 3FONA 3W39A 3GSOA 1ZEAH 4X0KB 4OZFB 2OJZH 2IG2L 1X5LA 3K1DA 4KHXH 3LN4B 3EDDA 4H26B 4WW2A 4R7DA 2VL5A 5AEAA 3VFTB 4ODUB 3SDYH 2NY6C 3KG5A 2AJSL 1Q72L 3QPXL 4KUCF 3U1SH 3PQYE 1K4CB 1N8ZB 3JWOL 5HTSA 2FR4A 4JGUA 4NSKB 2YN5A 5E94A 3O4LD 5KSBE 3QIBC 5DFTA 3DGGB 3GBML 3O3DA 5F1SA 3D48R 1DQDH 2R0KL 3OKDB 5I1LB 2HKHL 3PQYB 3TM6A 1I9RH 2J8UE 2IALB 1FNGA 3HE7A 3OJMB 3V5DB 4JO2L 3N1FC 1UM6H 1NBZB 1Q9KB 1MFEH 1X4YA 2JTDA 5KSBB 3QYCA 1FBIL 3STLA 1DSFL 1QBML 3ARFC 3U9UB 3QCTH 2J8UB 3GHEH 2QQLL 5TH2B 1DQJA 5T3ZL 2ZUQC 3FTGA 4KKLC 4NFBA 3REVA 1VFBA 2OQJA 4KK8D 5DYOA 3VD7A 1BBDH 1K8DB 2YRLA 3VDCA 25C8H 3RU8H 3P30L 1LEKA 3MRGB 4K3DL 4RBPK 3BE1H 3O6FB 1NCUA 4OZGE 3WL9B 1ZTXL 5C0JA 1CFBA 4YXKL 1GSMA 4XXDB 3Q0HA 3MLVL 1OP3K 5K9QG 4P3DA 3MLTA 1HN1A 3FN0H 2W92A 4U6VL 5KSBF 5HYQB 4DGIH 3BRGC 3PJSA 4OF5A 2AK1H 5LGHH 4YBQC 4Q97A 2VSCA 2VABA 1HXMA 3LDBC 2IBZX 1CXHA 4OZGB 1MIMH 5HGDA 1WT5C 2J8UF 1EFXD 4U3XA 3H3BC 5EBWA 1VFUA 4JJ5A 3VFVB 4P3WA 4S1RH 5IB2A 1EHAA 5A2KH 5C07D 3D18A 3QDAA 1DBAL 4IEFB 4JZOB 3H9SA 4HKJA 5FGCE 1B6UA 4FFVD 2VITA 5EC2B 2YMXH 1G9NL 3EJYD 2C4FT 1T89A 1FHGA 3FQXB 4F9LC 2YRZA 4NHCL 3MJGX 4PRDA 3V7MA 1NCWH 2DLIA 4M7LL 5I30L 3T1WA 2XI9A 2GCYB 4QRPD 4JG0L 5FGCB 4PDCE 1UWGH 2VLMD 5GS1C 2C3VA 5HI4C 4H1LA 4JFPA 5E5UB 3UBXA 4HJ0D 2JJSA 4P4KB 5CGYD 4NQCE 1RMFL 4PRNB 4Z7UE 5DJ6B 2OZ4A 1FL6B 2C7UA 4G8IA 2DQFA 3PL6C 3WEXA 3PIQA 3CX2A 5KJRL 4N90E 2RCSL 2R9HD 2J12B 4NRXB 5F1KC 5KVEL 3SGKA 5BO1L 3PWLA 4NQCB 1IAMA 2CUMA 4Z7UB 2BNQA 2R39A 1UACH 1OAQH 1IQDB 4U4BA 4BZYA 2X41A 4UIKH 3SJVA 3QEUB 3N9GL 4JJ5B 2AJUH 1A7RL 4KTDL 5HGBA 5AUMB 1AIFA 2ICWJ 3ULUD 1W2KT 4QCIB 3HI6L 2QSVA 3TO2B 1Q0YL 3MLXH 5B38B 2HMIC 5FO7A 3QBTB 4F7MA 4LCIH 1D5IL 3MJ7A 4Y4FD 1ZT7B 5E08L 1IGIL 5FV2A 2CO6B 3VXOB 5TDNB 4Z7VA 3CMOH 5J13B 1F90L 5KVGH 5HYSG 3GGWA 1K8IB 1I85C 5HHMD 1F97A 1GGUA 1U93B 4LHJB 4YBLB 4RA0C 3DLQR 4YC2B 3P0YL 2AXGB 1JMZA 4LSQL 3ETBF 5HYJE 4ODHH 4HPOH 3UTQB 4LSPH 4Z7UF 1J5OH 3O6LH 3VGBA 4HH9A 3OXSA 1U8KA 5D7SH 4L5FL 1XH3A 1NANH 2O26U 3KPSD 2FCBA 4PGCA 3TIEA 4LIQH 5ESQB 4G7YH 5I75B 3L1OL 1E28A 3U0WL 5BXFA 5ICYA 5HYJB 4MXQC 3TJHC 2UVFA 2KL6A 2FHCA 3W5MA 5IW3A 2VZ1A 1I8KA 5DHXB 3DBXA 5FHBH 2PR4H 1G6RB 5D7JB 4ZAKC 4WU5B 1HXYA 1MRFL 3QEQA 4Z7VE 4MMZC 3UBXG 2GQHA 5AZEH 1RZ7L 5BVJA 1AIFB 1T2XA 5D1QC 1SMAA 3P0VL 4WWKB 4QRUB 4PJXE 1D7FA 3L3JA 5FM4A 3MRLA 1TJIL 3MREB 2VDRH 1BJ8A 2E7HA 2Z35B 2VSDA 4JRYD 4QEGA 2G60H 4UT6H 2EC8A 1KT2B 3EYOA 3VXMD 2VR9A 2YBRA 3FQWA 1ZGLB 5CJQH 1Q9OB 2ESVE 3HI5H 2WBJA 4AZ8A 1MHEB 2Y5EA 4WUKH 4K94C 4PJXB 3SKNB 4P3CH 4MAYC 4Q6IC 1PY4A 2ATPA 4HD9A 3MNVB 3HTLX 4CN4A 2NY2C 1Z0MA 3ARTA 4XI5C 4E41D 2DQEL 2CJUL 4LCCC 3C8DA 5KSAD 2ESVB 3T0EA 3SPVB 3VWKC 5CHNA 1UVQA 4H5SA 4K8RC 3FAXA 4ONGL 1J11A 1UC6A 4LP4A 3KLSA 1ADQA 3CFKB 4M93C 4DN4H 2X4QB 5CSGA 1JPST 4RGOL 1BPVA 2I07A 4UQ2A 3F7VA 4U1MA 3F7YA 1I1FB 4Z7VF 2GI7A 1OAXL 3S36X 1ZHLB 5DJZB 4K7PX 3GMPA 1RU9L 5FFLA 5GGRB 1BP3B 5KANI 3IFOA 4PJXF 5K9JH 2HLAB 3IJHA 1ZLWH 5C0BD 4RISH 5JIPA 4MJID 5F3HA 3IXAB 2VLKE 4PJAA 5FF6A 5BZWA 1VGKB 3IETA 3SKMB 4X7EC 1FLRL 2KZWA 3T0EE 3GRWA 1OAUH 2ADFL 1MH5A 2ZPKH 1KB5B 1KC5L 4IRJA 2XZCL 2D9CA 1X5JA 1X5AA 2VLKB 1MCJA 3BKJL 4G59A 4I2XE 3F7QA 2MKWA 1V05A 3WFBL 4GSDH 4J4PA 1KTRL 4PRHD 1CL7L 1RJYA 1IC7L 1IFHL 3DETD 4X5WB 1JF5A 1S7TB 3L9RA 4I2XB 4FQHA 3QFJD 4Y19B 5TQ2L 1N0XH 4O2FB 1PSKL 2W60B 2OTUB 4GRMB 4XBPA 3F7VB 4PJ9C 1P7QD 5DF0A 2NY3D 5EUKA 2BC4B 4GRWB 1RHHA 1OAYL 2EXYC 4GAJH 1EAJA 2DQUL 1FCCA 4LSSH 3E6HA 3BW9A 4F8TA 4MVBD 2FGWH 1XGUB 4ZOAA 3AB0C 4H0HB 3C5ZA 5FYLE 4YPGA 3TO4D 4XVJH 2R2HA 5IHZA 3SE4A 1IQWL 5H2BB 3WIFB 2MJWA 3J7HA 4G8GA 4R4BB 2SEBB 3BPOB 1L8JA 1G1YA 4IIQB 1LD9B 3MROA 43CAA 3BPCB 3C5SA 2GK2A 2X4NB 4I9WE 5T1MB 4M62L 4K94L 3A6OA 4XP4H 1NAMH 3TFKC 3KDMB 3I2CL 4OUUB 2V2XB 5HHQB 5K9OA 5F7KC 1U2CA 3TNMA 4HK3N 1FYTD 4LDEB 1A02N 4X4XA 3O3BB 1RJYB 2V7HA 4RSVA 1OPGH 4K8RL 1AXSA 1IZJA 2Q7YB 4ZUUB 4DZBA 2A9NH 3KYAA 2FECI 1NC4A 4DZ8B 3QJFB 5I1AA 3ALWA 4PJAF 4XBPB 2GAZB 4R26H 5GGVH 3E8UH 1A14H 4ONFH 2XWTA 5DRNB 1EX0A 3T4AB 2ZUTA 1MI5E 2I60H 4X7DC 1C16B 2YC1A 3MV9A 2NY1D 5ESVB 2R2EB 1U8OB 1GGIH 2X10A 1ONQA 1NEZA 5EU5A 2IG2H 3MXVL 3G6AB 5J11C 3WYRA 4LVOB 3W2DL 2VLRE 5IF0A 3EYUL 3QB7C 5C92A 4Z5RA 1S7QB 3X13B 3ES6A 1MI5B 2AJSH 2UVEA 1A5FH 1Q72H 3QPXH 5JQHC 1YECL 2JJTC 3JWOH 4KI5C 5C09B 4WDIA 2VLRB 5I73C 3VXNA 4HZAA 3P9WB 3QR2A 4LHUB 5JORA 2R0KH 2WSKA 3VXPA 2PYFB 4BZ1L 2OBGA 2HKHH 1FV1B 1U8JB 3CVHL 3DSNA 4PJEE 5IMKB 1YPZE 4TTGA 4JO2H 3C8HA 4EN3C 4XHQA 2H8PA 3MV9E 4ZUWA 5EU4B 3OAUL 1FFOA 5I71B 1VFAB 2BXZA 2IPKB 1FBIH 4L4TA 3DRTB 4F7CA 4JRWA 5I17A 1QBMH 3D0VB 1TVHB 3IDIA 1TZIB 4X9HA 3O6ML 4PJEB 3RVXD 3LQAH 2QQLH 1YPZB 3PNWB 1XMWA 3MOBL 3KR3L 4CBPA 1KTDB 5T3ZH 1IC5L 4O51A 4BFGA 4NO2A 1TZHA 2NY4C 2X4TA 4K3DH 2IH3B 4ETYA 4PG2C 2EDNA 1ZTXH 5IK3A 4YXKH 1FSKB 5FDWB 4JY5L 4U6VH 3NH7L 3RPIB 3LH2H 5JXEA 4YDKL 5GS2H 2IADB 4L4TE 2BNUA 3VG9C 5T3XH 1SYVA 1F5WA 1IAII 2WWKT 1S3KL 2APFA 1T22A 1YPZF 4Y4KD 3EYQD 5J9PA 5K9KB 3WD5L 4YAQB 4GRLA 1I7RB 4E5XA 2DI8A 1C8PA 2AQ1A 1WZKA 4XCEB 1R5VB 1U2HA 1Y6NR 4WWID 3PHSA 5L2JB 4K23L 1G9NH 2CDEB 4JANB 5LGJA 4L8BA 3X12A 4HWZB 3RWFA 4NHCH 5D1ZD 4NKIL 5KG9A 5SWSA 4M7LH 5I30H 4GW5B 1IGML 3WJJA 3D85B 3RVWD 4JG0H 1X5IA 1EEQA 4LK4A 4KK8C 1N2RB 2V7NA 4OKDA 1MUJA 5E5MA 5IK3B 2QHLA 4M43L 1RMFH 2WLYA 2P7TA 3DV4B 4WV1C 1M6OA 5EWIL 4HT1L 3BUYB 5KJRH 4HLJA 4FN0A 3FT2B 1NMBL 3VGHA 3A6CL 4QYOA 5CIPB 3KJ6L 4QHKJ 5JNYA 4NUJB 5BO1H 3E2HB 4EJ1C 2WLZA 2X2YA 4P4RA 2E7LA 4IRSA 5ICXA 4RFNC 1R5WB 3N9GH 3RTQD 3WS3A 1A7RH 4ZXBA 4KTDH 5KOMC 1SY6L 4JFYB 1IZKA 1JHTB 1QTYT 3HI6H 2QSCL 4UB0L 1Q0YH 1OWWA 3SBWC 1QYGL 3HUJE 4FOMA 4HF5L 1D5IH 1RAMA 1F6AB 5E08H 1NCNA 4O02L 5B3NA 1IGIH 4JHZA 1T03H 4FFVC 1QLRA 1F90H 2PXYD 3EJYC 2VZSA 1BVLA 1ZHNA 1IAKB 4LSQH 4NM8L 3HUJB 4ETQB 4A6YB 2FJFA 4YHPA 2Q76A 4YGVB 1CR9L 1FNEA 4HGWA 1U95A 1G7MB 1QRNE 2A6JA 3OKMA 4XCNB 4L5FH 4HJ0C 1KNOB 3L3KA 5CGYC 4FP8L 3VWJB 1P2CB 3L1OH 1JGEA 5JPMB 3U0WH 1IAIM 1NGYB 1QR1A 1DVFA 4E42B 5FO9A 3SE3C 2COQA 5B8CC 1AP2B 1QRNB 2R9HC 4CJ0A 3IU3B 1YEIL 1QQDA 1MRFH 5IWLA 1UKQA 5GSRA 2ID5A 5FO8A 2JB6A 4QGYA 4XP9L 1RZ7H 4YFDB 4Q9RL 1DUZA 3P0VH 5DJDB 5TPWL 1ND0B 1TJIH 1AGEB 1YY8B 1QFUL 1K4DB 1IEBA 4H88H 4G9FA 1QLFA 4HV8A 3ULUC 4N1EA 3ZO0A 1EEZA 1XF5B 2VXQL 4Y4FC 5I16A 4G43B 3ZKXC 1CG9A 1O7VA 2ZKHL 1BVLB 5D7IA 1DBML 3FOMA 1NAMA 1I3VA 3JV6A 1WICA 3QUZA 2MNUA 4L4JA 2CJUH 1H15A 4KDTC 4LPXA 2DLGA 4HDIA 4ZTPL 2IF7A 5CCKL 4NT6B 1RZ8B 5HVFB 1N6QL 4D2NA 1ZAGA 3ARWA 4ONGH 4P2OD 3RGVD 4JPIB 4RA3A 2M2DA 3FQUA 2AXFB 4RGOH 3BAEL 1KTLB 1U8MA 4X80L 1OAXH 1JV5A 3DHJA 4HWBL 1RU9H 2ZP0T 5FM5O 3WDIA 1MHHB 1KJ2B 4V2BA 1YYML 3AMLA 1LHZA 4RMTA 4L3EA 4RNRA 3ZE1E 5DA0B 1EBAA 3MV8A 5CWSA 2X4SA 3RI5K 2D3VA 1UH4A 5LAXA 1U8NA 4K71B 2GT9A 4JFZL 4PP1C 4TSAL 1FLRH 5C6PB 1UJ3A 3GO1L 1SVCP 2ADFH 1FG9C 3NCCB 3MC0A 2W65A 3L3GA 1KC5H 1OW0A 1CG9B 2XZCH 3UTPE 2XTJD 4WNQA 1NUDA 2CXGA 3LAFA 3T0VA 3GSXA 3BKJH 1A3LL 4QXWA 3AU1A 3WFBH 3VH8A 1LO5A 2ICWA 2Q87A 3UTTA 4XWOD 5C8JA 1CL7H 2X9WA 1CICD 5ABDE 3HB3D 3QT2A 1IC7H 1N7MH 1IFHH 3QEHA 5C0IB 5HDBE 3SGJA 5KSAC 1A4JA 5MEQB 1WFTA 1PZ5B 1EO8L 3BP5A 3D2UD 2AJYL 5IG7A 4L3EE 3EZJB 5DJ8A 4ACPA 1PSKH 1ZS8B 3HC3L 2CRMA 3V4PL 4YXLL 2A74B 1FO0L 3LKRA 4CNIA 4FHBD 4PY8J 1OAYH 5C0CA 2DQUH 4PTUB 1DN0B 3PGDA 5DTFB 3CJJA 3ZE1F 4TYUA 4Z7QE 2G9HB 4QTHA 1OQOA 2CLZA 1KCRL 4CVZB 1IQWH 2AEPL 3T0AA 1SQ2N 1A1MB 3KS0H 2Q6WA 3ULUL 2OI9C 1D6EB 5INCB 4LSDA 4NJ9L 3UTTE 2VXSL 1RUML 1T5WB 2BDNL 4M61A 3ZKMD 4WHTA 2HRLA 3TH2T 1FZJA 5JIKA 5T5NG 5SX4I 4M62H 5DMKA 1S9XA 1RZKC 2ZSWA 4K94H 5GRJL 2AEIT 3TYFA 2PN5A 2F15A 3RX7A 3I2CH 5JLZA 2ICWB 1MRDL 1K2DA 4JFED 3UTTB 5F7YC 5IMOB 2BOCB 5JDSB 1TVBA 4XXCA 5HDBF 4Q74A 3EFFB 4RMVA 4AH2A 3MV7A 12E8L 4GS7C 4HXAL 2APXA 4OSUL 4K8RH 1ZA3B 4MD5B 2EH7H 1VKXA 4LRIC 3KYNB 3CSYB 3QQ4A 2EIZB 4ZFZA 2OJEA 2R29L 4NHUA 4D0BA 3FRPG 2XKUA 1OF2B 2P5WA 2X70B 2FZ3A 1M05B 3MRIA 4MJ5B 3TCLA 4UU9A 2Y23A 3K4ZA 1RK0A 4F2MA 4FRWA 4Z7QF 3SDXA 3VH8G 2NY3C 4OCXH 1GZPA 4M1DL 4NO0D 4WTWA 3FFCA 5KAQF 3D39D 5GRZA 3MXVH 5CJBA 1XGRB 3UEZA 3W2DH 2HLFD 4MVBC 5DJYA 3EYUH 3FO1A 2XN9A 4KY1L 1A6VL 4XAWL 3TO4C 5IVXA 4P2RD 5E03A 2Y4SA 3PABB 4JFDA 1YECH 2NCMA 1HHGB 4WTXA 4NQSA 3UJTL 4EZMA 1ZGLM 5KSVA 4J3XA 4MA3A 3QIBA 1GOHA 1JN6A 1PQZA 3MJ8B 3VXRE 1CGTA 3MRMA 4B7IA 5E2VL 1MCBA 3HMXL 3VGEA 3T0DA 4YIQB 1MFBL 3BIAX 4LGPB 3O8XD 4BZ1H 1D5BA 3CVHH 2YA1A 3DX9B 2EECA 1HILA 1KPUB 1C5CL 5HGHB 3E6FA 3ZDYE 3C5JB 3OAUH 3VXRB 5DEGB 3FFCE 3QA3B 3G5VA 2BX5A 4ZFZB 3ARFA 4PRID 5SX5K 4XZUA 3O6MH 2NY5C 3DX7A 5DQDH 1TCRB 5L2KE 2UYLB 4HFUL 3KXFD 3MOBH 1MY5A 3KR3H 4D9LH 1IC5H 3RWHA 3P40A 2FRGP 3IDUA 5IP4A 1OSZB 2NY1C 5L2KB 3MRJA 3PWNB 4XBEL 2CMRL 2NY6B 2DQHL 3RIFK 5DVMA 4APQD 3UP1A 4JY5H 5TDOA 2APWA 1WF5A 4G8FB 3HG1D 3NH7H 4NNYA 4JN1L 1A4KB 4D0DA 1RZKL 4YDKH 1ORSB 1NJ9A 4HXBH 1T1XB 3MMEB 5GRXG 1UXWB 1K5NA 1MSPA 1WFOA 4LLVA 1WT5A 2HFGL 1S3KH 2DMBA 3U7YL 3W0WE 2P47B 4QOKD 3WD5H 5DD0L 3ZDYF 4KPHL 3R0MA 2JK5B 4XX1E 4NZTL 4WHYH 5L0QB 2F19L 2DBLL 3KVQA 5DJAB 4K23H 3W0WB 5BV7C 4QHMA 5GGUA 4MDIA 4F9LA 1P5UA 3U0TA 2J8HA 4G9DA 4NKIH 3I3DA 4MHHG 5E8NB 3RVXC 5EOCJ 1IGMH 3FO2A 2FX8L 3QDME 2XRAL 4JEGB 5GS1A 1QSFD 3NCEB 2D2OA 5EC1A 1TTUA 3B5GA 1M71B 4M43H 2WINB 4NOFA 2NY0D 4NQDD 3PL6A 2EDXA 4FFEX 5EWIH 3QDMB 1BZ9B 4L9LA 5FHAH 4FXGA 3V7AE 1NMBH 4WU7B 5DVLA 3A6CH 3BGFB 3KJ6H 3WO3B 3ECBA 4U6XA 5KSUB 3LDBB 4N8CL 1NKRA 2BHYA 1XGTB 4V1DA 1T1ZA 4GBXB 1H3WM 4R97C 1ITBB 2HFTA 4Y4KC 3EYQC 1SY6H 5FK9B 4J6RL 1HI6B 2QSCH 4UB0H 1QYGH 4JFXB 1CF8L 4GO6B 3RWIB 5HJ3A 3O45B 4OIBA 3BIKB 3E1F1 1NBYA 3LB6D 3MLRL 4O02H 3TWCL 3BH8A 4MA7L 2VDNH 2NY5L 3I6KA 4OLXL 5EOTB 2O61B 3TP4A 1CFSA 2C5DC 1JK8B 1JYWA 1I85A 3AAZA 2Q3AA 4RFEB 4XCYB 5E9DE 4Z76B 5JW4Q 5J3HD 4NM8H 3S5LG 2DTSA 1T0MA 3HZMA 2WAHA 1CR9H 3RVWC 5I76B 1IILE 1OGAA 4CW1A 1DQQB 5J6HB 2JELL 5DUPL 5C0RL 3U2SB 4KK6D 1DFBL 3RL2B 1H8OA 3CK0L 5JHDE 1MNUL 1TLKA 4FP8H 5E9DB 1B0GB 4MQTB 4LLWA 4PJHA 1OD7A 4QNPE 1LNUB 4HS3A 4MXQA 3TJHA 3GSVA 3B9EA 1CFNB 2DYPD 3SO3C 2VE6B 2MCPL 5EIQA 3EAKA 3FRUA 3IDNB 3CMGA 4LRNL 1YEIH 1FG2B 1HHJA 4ZAKA 4ISVA 5JHDB 3DRQB 4UDUB 4XP9H 1JZ4A 4RZCA 4L8CB 2YOCA 4Q9RH 1HH9B 1YMMB 3ZYOA 3MNZA 1Z9OA 5D1QA 5TPWH 3RTQC 3DMMB 1QFUH 3U30C 4C4KT 5GGQL 3CD4A 5F7DA 5JUEL 3JUYA 3LV3A 1G1CA 2ATKB 2VXQH 3GIVB 5F89B 3E3QA 1JPGB 5BS0A 3KHOA 4MAYA 4Q6IA 1A3QA 1DBMH 4Z7WA 5EFIB 2PXYC 2Z4QA 2XQYK 3OAZH 1JGDA 1AC6A 4WFHD 3S35X 1L7IL 2LTQC 2VMFA 1AGFA 3B9KA 5LGKA 3FHAA 5IFJB 3X17A 2AVGA 4ZTPH 5D7LD 3VWKA 5CCKH 4Q2ZA 5D7KD 4S11A 1QA9A 1N6QH 5F6HI 1MOEA 4QNPF 3QUKA 5DK2B 5ITFB 3BAEH 5H37G 4K7FA 3LZFL 3L3DA 1E4XI 3FRUB 4I3GA 4QXUL 4X80H 3VFRB 2N56A 3F7RA 4NZJA 3H7BA 1V7NL 4N68A 3NN8B 4FQQA 5BS0E 5DEZA 3HPLB 4U6YA 5GJSL 4XP5L 3C08L 2VXVL 3KHQA 4J3OC 4OFYD 3A67L 5E1HB 4LLQB 5I1JL 5CSZB 4D9RD 4JPVL 4LASL 4HBCL 4JFZH 4TSAH 4QHLB 2A6DB 2QSTA 3VFNB 3GO1H 1MJUL 4CDGC 2OMNA 4PJHF 1Z9MA 1YQ2A 3EDJA 5E1AA 3WUWA 1AHWB 4P99A 5DJ0B 2NY2B 5DGQA 1D5XB 4HS6A 3P11L 2OTWA 1M4KA 2DIJA 3GNMH 3G5YA 3CVHA 3PHOA 4JFHD 4LCCB 1JGVL 2HT3D 2Z93A 3DVGA 4PTTB 3ZSSA 4KHTL 3DX8A 3TIDB 3TZVC 5ISZB 3RHWK 3REWB 3PDOA 1AGDB 5DI8A 2WWKO 4M93B 2QSQA 4CMMA 4AIOA 3INUL 4OQTL 3D9AH 3QIWD 4NKMA 4I18B 3HC3H 4P2OC 4G6JL 2F53E 3V4PH 3RGVC 1JPSL 4YXLH 2FSEB 3EYFB 4YR6A 1FO0H 3I02A 4O2CB 4OFVA 2D31B 4Y5YC 4UV7L 3MRQA 1YEEL 3MLWL 4Z7WF 2HJLB 5IOPB 3GSNL 1KCRH 5HYSB 3G04B 1WFUA 3KPNA 2F53B 3I84A 4I77L 3VG0L 1XGYL 2AEPH 2CK2A 3AFLA 3VFSB 3TVMB 4S1QL 4HUXA 4BM7A 1F11A 4NJ9H 1VACA 1NCAL 2VXSH 1RUMH 4XC1L 1NC2D 2BDNH 1WUNT 1BD2D 4QWWD 5GRWA 5GRJH 4X6FA 1N59B 4LPYA 2DL2A 2BXYA 3TPUB 3DSFL 2FYYA 2OTWB 5FA4A 2XTJC 3JV4B 4J1UA 1UB6A 5JW4R 4NJAH 4LQ1A 4PJ7A 3V6FB 1QKZL 4CU7A 1GGTA 3WFEL 3QHZL 12E8H 4HXAH 4Y16B 4OSUH 4XWOC 1F2QA 4DGYL 1CICC 3HB3C 3ARDD 2IEPA 3QNXA 4FABL 2ADGA 5GHWL 4EUPG 2ZUXA 2R29H 4W4OC 4XCCL 4OKVA 4TNWK 3VRIA 4YE4L 4U1JB 4PJ9B 3UZEA 1WTLA 3LD8C 5MEND 2VH5L 1QPXA 1WC7B 1J86A 3I02B 3K7UA 4I48A 4GW1A 3MLZL 3OR6A 3BKYL 3SOBH 5L8LB 4M1DH 1CFQA 5IBUG 1FFPB 2HN7A 4HIHA 2QQQA 5DMJB 5SWZA 4LLYA 3VRLF 4KY1H 3WJLC 4XAWH 5DRWB 5HY9A 4PJBA 1HQ4B 3P4NB 3GMRB 5IB4A 1KJVB 1B4JL 2JJTA 5HPMA 2YA0A 3UJTH 2P8MB 2VDQL 5DXWA 5ACMA 3TN0B 5E8EA 5D2LA 1P4LA 1T66D 4RFOL 2R1XB 3ZKMC 1CGSL 4OF6A 4ONOA 1F4YL 5E2VH 3HMXH 3VGDA 1MFBH 3V9FA 5IFAL 1CGVA 2R0WL 4ZO9A 1OP5H 2X09A 3FO9B 4EN3A 1C5CH 3PQYD 2O5ZH 1SY6A 2E5EA 4XPHL 5AD0A 4OGAD 3KPQB 2ICWI 3RKPA 3GJFK 4GLRH 2P8LA 1TETL 2W91A 4HQQH 3GBLA 3OX8B 1UG9A 2IGFL 1UFUA 4P2QA 1KJ3L 1TITA 4HFUH 3PF2A 1CGWA 3NCYP 3IB4A 3KPMA 4XWGH 4Y8AA 3P4MA 2H26B 4NQXB 3S97C 4NUGL 2FWOA 5C7XH 2F5BH 3VRJB 1OT2A 4PG2A 2H41A 2HRPL 4XBEH 2CMRH 2DQHH 1B9ZA 4PJDA 3P77A 3O6FD 2HLFC 2XNAA 5C3TA 3OAYH 3CFDA 5L88L 3HR5A 1ZLUH 2NW2A 4JN1H 2M1KA 1RZKH 1YEKL 2P45B 4OCYL 3RIAK 5F3BB 3BZFB 2YS4A 4KTEL 2XZAL 3O4LA 2HFGH 2FO4A 3U7YH 4NN5C 2WWMD 2ZSVB 4N5EA 4LVNC 1A6UL 4RDQG 5DD0H 3O8XC 3EO9L 3PV6A 5DVOA 1F4AA 1GXEA 4WGWB 3GUTB 1EVTC 4NZTH 3AS2A 3EOTL 2V9TA 2F19H 4I5BB 4NZDA 5I1KL 4BSVB 4E9LA 3CDCA 4JFQB 3FL7A 1RULL 4OGZA 3BYTA 4LCWE 1S9YB 3L5WA 5K59F 2GSIA 1A1OB 2W0FB 2VL4A 4KI5F 2XRAH 3CFIC 4NNPL 4NZRL 3UJJL 4BH8A 3BOVA 5I1GL 4DW2L 4BSWB 2XYCA 1OB1B 4LKXB 1QFPA 1IE5A 3QZWA 5E8PB 4LCWB 2EDBA 4GAYA 2PW2A 5GGVY 4WV1A 1WAAE 2IFGA 4P4KD 3IDJB 4KAQL 5I8OL 5CJOL 4APQC 1E4WL 4OFDA 4N8VG 3CZJA 3EO1A 4G80B 3LKQB 4N8CH 5FOJA 9CGTA 4HWBA 2H2PD 5IV2B 5A16A 4N0YL 2XG5A 1T7WA 3TBTB 5F7FA 1EFXA 3VXTB 1H3XA 1PLGH 1CXEA 1G7JA 3IS0X 3CFJA 4J6RH 3TJEL 4N90D 3K3QA 5CBAB 1CF8H 3NTCL 4NO3B 5CFHA 5C9JA 4POZD 3TWCH 5CGTA 2AJ3A 1J1OL 5C07A 4MA7H 4U7SA 4PJDF 2NY5H 3EOAA 4OLXH 4PGBA 5SWQB 4FQIL 5MEPA 3GHBL 3UDWC 4W81A 5IB5B 4LSRL 4HUUA 2MOVA 43C9B 4YXHL 2CO7B 1EVUA 1EGJL 2A73B 1T0NA 1R6VA 8FABB 1ZSDB 2BOBB 5HGAB 3L3HA 2C1OA 4HUKB 4QRPA 4PRAA 4U1SB 5JO5B 3IXTB 2L4OA 1UWEL 2HKFL 2HFEA 2JELH 2G2RB 5IVZA 5C0RH 3O2WL 3CZFB 2HWZL 4KQ4L 1MNUH 1HSAB 3LEXB 1IM9B 4U2ZA 5HDOA 2QBWA 1SHMA 4MS8D 2NY0C 1CD1A 4KKCD 4YQXL 5F1IB 1A2YB 5EO1A 3SE3A 1JNJA 3GZKA 4F57L 5HYJD 3HZVB 2MCPH 5C0AD 4JHBA 5B8CA 4Y5VC 1KIUA 4OCLC 4LRNH 1FO0A 1JTTA 3B8YA 2ITCB 3PHQA 5CD3A 2WANA 2BMKB 2X1WL 5D7JD 4JY4A 3UTZA 4EOWL 3U83A 5E4EC 2OL3B 2ENSA 2C4FU 2X44D 4RGMB 3VFPB 1EEYA 1Y0LB 5FGBC 1JUFB 3H0TA 5GGQH 3R8QA 1AQKL 5JUEH 4HKZA 4WWKD 5SV4A 3U46B 2HT2D 3TT3L 3V0WL 4QRPE 4M4PA 1LE9A 2R23A 3STZB 4J3TA 1SJEA 1OD9A 3LB6C 4Y4FA 3T04D 4ORGB 2DLFL 5TE6L 4EDWL 1KIPA 4NRYA 2FX9L 1MCCA 1NDGA 2AJVL 1PKQA 1J18A 5HHMA 1V5JA 2AV7A 3FB7B 1L7IH 5MHSE 2LFGA 2UWEE 3P0GB 3B3IA 4FFYL 5J3HC 3RP1A 4XVSL 4F7TB 3MLYL 4KVNL 5DZLA 2FGZA 2ESVD 1OTTD 3VFMB 3UTOA 3KPSA 5TDPB 4F15B 3VJ6A 5HXMA 2I5YL 3MBEC 2UWEB 4XVUD 4IHOA 3LZFH 4JFFD 3G6DL 3O9WA 3ULUE 4WJ5B 1KV3A 4OIAA 1GC1C 1V7NH 4JY4B 4IS6A 1J12A 1R0AL 5GJSH 2ZG3A 4DN3L 3IJYB 5ILTL 5JW5A 2R69L 3RWGB 3C08H 2VXVH 3Q3GA 2QTEA 4IDJL 1XIWD 5BJTB 3A67H 5I1JH 1NMCC 1T1WA 4JPVH 1HHKB 4LASH 4HBCH 2XQYG 4OV5A 2C1PA 3ARBB 4ODXB 4Z77A 3MZGB 5L7XL 1MJUH 3V5HA 3VXMA 1E4KC 5BZDA 4GFTB 1INDL 4MA1B 4F37K 3CH1A 3HMXA 2UWEF 5CBEA 1RZGA 4FG6D 4ZUVB 3P11H 2VDOL 4R8WL 3G6JE 3GBNL 1JFQL 1JGVH 1ZANL 4KHTH 2HTLD 3SDDC 4E41A 4WRLA 3CFCL 5CEZD 4KJPD 1B6DA 2DI7A 1JWUB 1MAMH 5KSAA 1DL7L 5J6GA 1WV7T 1TJGL 5CEXB 2A0LD 5ANME 3INUH 3WN5C 4OQTH 2J6EL 4XH2A 5HPOA 3ULUF 2X7LB 2EDKA 4UV4L 3SY0A 4MJ6A 1OCWL 3G6JB 2WMPA 4JY6B 4Y19D 1JPSH 1F58L 1NDMB 2P24B 4DUWA 2MHAA 4UDTA 3ILPA 4GUPA 1V3MA 4OZIA 2OTPA 2GSGB 4JRYE 4UV7H 1YEEH 1P7KB 2D7QA 4PJ8B 4DKFL 1NBQA 3MLWH 3VXME 5ANMB 3VXSD 1T2QL 2Y5TB 3GSNH 4ELME 5EDXA 1CCZA 3HCVA 2IANE 2W59A 4RIRB 4I77H 3VG0H 1JE6A 1XGYH 2BHUA 5C0BA 2OI9A 1S8DB 4S1QH 3QXDB 1NCAH 1NFIB 4JRYB 1JNHA 4CN1A 4XC1H 1AQDB 1A9EA 3FOLB 3RNKB 4WHDA 4YFLF 5JOFA 1M7DA 1LP9E 4ELMB 3JTCA 1AGBA 2IANB 4PPTA 3CFBA 2EE9A 4RMRA 1CDCA 5I66A 5FYLD 4BK5A 3BEWB 3G6JF 3BRFA 1ROWA 1QBLL 1RIUH 1QKZH 3WFEH 3PP3H 3QHZH 1UYWL 1LP9B 4KXZH 4PRHA 1KPRB 4ZYKA 2HT3C 4DGYH 2B7DT 1NEUA 1QVOA 4LRIA 4I9WD 4Z0XA 4XCFL 4FABH 5GHWH 4HPYL 4PV8B 5M95B 4XCCH 2X89A 4LLUB 4YE4H 4LBEB 5C3LD 1VENA 3QFJA 4H8WC 4M4RA 4MJIE 3QIWC 2VH5H 3MNWB 4J23A 3MLZH 1P7QA 1GC1L 3CUPA 5MEOB 2X4UB 4NC1E 4X6BA 3FAWA 4ELMF 1XAUA 3DYPA 3DIFB 5EU3A 2LV4A 3BP7B 3VFWA 1UXSA 1Y6KR 4MVBA 2CDFB 3PDDA 2C3GA 2DQDL 3A6BL 4MJIB 1HDMB 5ETUB 3TO4A 1J8HA 5CJXC 5HVGB 1BIIA 1JIBA 3DVIA 4XBGA 1B4JH 1KN4L 3GMMA 3BDXA 2VDQH 1MI5D 3UPRA 3VCLA 1S7RA 2OXHA 3WS6C 3EHBD 4PRHE 4JGMA 1T04A 4RFOH 1ZHKB 2VISB 1CGSH 4QHKI 4Y5XA 1R3JA 1F4YH 5I1DB 4R2GB 4QWWC 5C09D 5IFAH 3BIBX 4BZ2L 2R0WH 1ZKAA 1A7NL 2A6KA 2Q8AL 1MRCH 1PEZA 4OZIF 3H9HA 4ZUSA 3MCKA 4GS7B 3KYOA 2GJZA 3FB6A 4XPHH 3GB7B 1AFVL 4TULL 1TETH 2VDML 1AO7B 2CKBL 2NY7H 1BLNB 2FBJL 2IGFH 3ARDC 1IGCL 4OZ4A 4BFEA 3BH9A 4N0FA 4I4WB 1KJ3H 5IB3B 5IW6B 1BOGA 5IM7B 1MFCL 5ID0B 4NUGH 3QUYB 1URLA 2YD7A 1MHCA 3ARED 1BBJB 3C60D 4X4YA 4Z7NF 2AJZA 1OP9A 3DVNB 4KV5F 1TTGA 3ABZA 2HRPH 1RUAL 5FEBA 1H0DB 3CC5A 5CILL 2DBJA 1R3LA 5DHYB 3GSRA 2RHEA 3ALXA 4NDMB 5L88H 3LQZA 1P84K 4Y88A 1FYTE 1FQ9C 1YEKH 4OCYH 5EZLB 4L8DB 4QRTB 4YDVB 2RAMA 3VDBA 4KTEH 2XZAH 4LEOA 4CRPA 3BXNB 1T66C 5HHOB 3V0VA 3DOSA 2AKRA 3BWAA 1S5HB 2IJ0C 1BAFL 1S7XB 3NCBB 4ZUSB 5GZND 1DUYA 3ZE2E 1NL0L 4QLRA 1KIQA 1KIRB 3EO9H 1FYTB 4HHAA 3GI8L 3EOTH 1C12A 1M7IA 2DQJL 2Z31B 2FECL 1RZFL 3HMWL 1TQCB 3O41A 4OGAC 1WEJL 2DKMA 5F88A 3LKOB 1D5ZA 4NFDA 1RULH 4U33A 5IQ9B 4OF8A 3QUML 1NMAL 4Z18A 1T7YA 2K7PA 3MUJA 4JM4L 4R96B 3SDCB 5IHUL 1N3NB 4NNPH 4NZRH 1S5IL 3UJJH 2H9GB 2NY1B 5D93B 4DW2H 3D85D 3MGTA 4UT7L 2CSPA 5INDB 3RFZC 1TXKA 3T77B 1ETZB 3S4SB 1F42A 4P5KB 3ULVD 4YHIB 1PVHA 1SBBA 3GSRB 3B6SA 4MWFA 4X6DB 4KAQH 5E4IA 4LCUB 5BVPL 5I8OH 3O6FC 5CJOH 1E4WH 2CGRL 1QZ1A 1CLCA 5T1KB 1PYWA 4DKDC 3EYVB 1TPXB 2F54D 4NWUL 5AAWA 3MUGB 3WFHA 4N0YH 2NQCA 4PJCB 5F9JA 1U3HA 3MA7A 1FAKT 5JR1L 4Y4KA 3NIFE 2R1YA 3BGMB 3FO0L 3TJEH 3M8OH 3M1BB 5I8CB 2DOCA 3NTCH 1H5BB 3O6KL 4LNRA 5T5NF 1J05A 5F9WB 1DLHB 2APBA 5BV7B 1MCNA 1T83A 1J1OH 4HS8H 4JM2A 4NNXB 3GHBH 2IAMA 2ICEB 4GJTB 4GOSA 4LSRH 4RQQB 1WK0A 4P57B 5CP7B 4YXHH 1EGJH 5DS8A 2AK4E 4AENB 4D0CB 4S1DD 1E27B 1IMHC 2X4OA 4OM1L 1LO3L 2E9BA 3T0XA 1CE1L 5CLTA 2CUHA 3L5JA 5TJWK 3I6LD 1UWEH 2HKFH 4RRPG 1X7QA 3VFGL 3O2WH 3HZKB 2BRRL 3L6FB 4W68A 4B0MM 4DJMA 4GKOA 4WIQA 4EVNB 2HWZH 2AK4B 4KQ4H 1KUMA 2W1NA 5E5RB 4BKLA 1ZT4A 2CDGB 4OQTA 4YQXH 3BP6A 4P4KC 3H3KA 5DEFB 1S7VB 4F57H 3RWCB 1MCDA 1RVFL 1VA9A 5ID1B 1MJ7L 3P4OA 1UB5B 1IAIL 4P23B 4PY8I 1MWAB 3GK8L 2Z8VC 3GJEB 3NIFF 3G08B 3MRHA 4KJYA 1E4JA 4L4VB 3RX8A 4EOWH 4YHMH 2H2PC 4ZMAT 5FUCE 3GSNA 4NQUA 3W82A 3RTQA 1BQHA 3X3FL 4FQ2L 4F33B 3ZHLA 1GHFL 3IGAB 4PRPA 1HH6A 3RKDD 4UQ3B 3TT3H 3V0WH 1ZHBB 1EA9C 2DM4A 4TOYL 3VFOB 3EO0B 5EZIL 5FA3B 1BX2A 3C6LB 1A6TB 4HUMB 5IMMB 4PV9B 4POZC 3SGDH 4MCZB 5TE6H 4P59L 2E6QA 4EDWH 5LWYL 3HN3A 4ERSL 2FX9H 5D1ZB 1A47A 3QQ3A 1GL4B 4HMDA 2AJVH 4M1GL 2X4OB 3I6GA 5I2IA 5T1LB 1DN2A 4R0LC 4ZOCA 5J13C 2OR7A 4F7EB 4OD2A 4FFYH 1HCVA 4JVPA 4XVSH 1WZMA 4YBLC 4OCMC 3OKLB 3B8SA 4YC2C 4CVXA 3MLYH 3D6GA 4KVNH 1CBVL 1T20A 1I4FA 2B39A 1FVEB 5JW3L 3D3VD 4JO4L 3OG4B 2I5YH 4ZOBA 2Q20A 3RNQB 4MS8C 2H45A 3G6DH 2VTFA 4KKCC 4P2YA 4LLDB 4PLKD 3G5ZA 4MZ3A 5E7FA 1PBYA 2BY1A 3WHXA 5I75C 1EAPB 3BN3B 5F7HA 4KJYB 3H9ZA 3B5TA 4IRZL 4XGZB 5ILTH 2R69H 3BZEB 5JDJA 2FH8A 5D7JC 2IPUK 1G7HB 2D7TL 1XF2B 4PGZA 1WFNA 5IJVB 2P5EB 2Y7QB 1SYSA 2WP3T 4WWKC 2B20A 5L7XH 2HT2C 3W9EA 1T7ZA 2HG5B 5KTEL 4OCWL 2VAAB 1RY7B 4AL8L 1INDH 2PXYB 1GIGL 3QXVA 1KCVL 2DQIL 2IBZY 5D71L 3RY6C 2VDOH 1QFHA 1MJJA 4R8WH 5IB1A 2DLTA 3WE6A 1C08B 1BZ7B 4HWUA 3GBNH 5J8OA 1JFQH 3DXAD 4QF1B 5C70A 1RURL 1ZANH 1FZKB 3Q5TA 4R7NB 4F7PA 5ICZA 1JYNA 1AE6L 3CFCH 3TZVA 3OB8A 3B4NA 1JF1B 2CQVA 1DL7H 4PLJD 1LILA 3GMLA 5AYUL 4MQXD 1TJGH 3UTPD 4DUVA 2J6EH 5FYKU 1DEEB 4UV4H 5BQ7B 1OCWH 4P2OA 3RGVA 3WSQL 1F58H 2LE9A 4XVUC 4EXPX 4M03A 3PGFL 4MQSB 4Y1AE 5CZXD 2GUOB 3B83A 3VE0B 4Y5YA 3DX6B 2YWYA 4NPYB 4DKFH 4UBDD 4L29A 4K3HA 2R0ZH 4M6OL 1C5DB 4C56D 3MFFA 1X5ZA 3SE9L 4RWYL 5TFSL 1N5AB 1XIWC 3S5LB 1WBXB 4GG6B 4Y1AB 4IM8A 4C58B 1F13A 2LU7A 2HTKD 1W72B 1JTPA 5JIIA 3L7EA 4OZHE 1G0YR 5JMRA 4NKDB 3TYGL 1C5BL 1VHPA 3LEVL 3BPNB 3L3IB 2HFFB 1T1YB 1QBLH 2PKDA 2C3XA 2HVJA 4FG6C 4PBWD 3ZL4L 2QKIA 1UYWH 2EH8L 4OZHB 4PGEA 5FV1L 1AC0A 4PRBA 1CICA 2Q86B 2HTLC 1FN4B 4LAJH 3F8UB 4KJPC 4XCFH 4HPYH 2DJSA 4X98B 3D69B 2X4PB 1R3KB 4W4OA 1S7UB 5ACZA 5DK0B 3D2UA 2A0LC 2J3SA 3BD4A 1I1AB 5EG6C 4XPFL 1IL1A 2ZJSL 1UZ8B 1YN6B 3U6RA 4GKSB 3JTTB 1GC1H 3H3PL 4QHUA 2EEDA 3N06B 2UV3A 2ZG1A 1PGRB 4CVWA 4GW4B 4RMSA 3MRKB 4F3FA 1G6RL 3QDHA 5D2NB 3OWEA 2MFNA 2DQDH 1FVCB 3A6BH 3BO8B 4OFKA 4U6HA 5A43C 1CS6A 2YN3A 2G75A 2EE2A 4P48A 4N0UA 1KN4H 4WY7L 3ISWA 4JDVB 3S37X 4OZHF 5IEHB 2Z8SA 3L3OB 2Y72A 4FXKA 3F12B 5GGSA 5AAMA 3U36B 3BPOC 3WLBA 1WCBB 3THML 4IIQC 1CIUA 1VERA 4CN6A 4BZ2H 4LF3A 4IMLA 1RUKL 1A7NH 2Q8AH 1TQBB 5E8OA 5C0FB 1MLBA 1TVDA 4LQFL 1I8MA 2IH1B 2ICES 3CDGB 5JXAL 3K80A 1AFVH 2GITB 4TULH 2VDMH 1J0HA 1ZK9A 2CKBH 2XPGB 1J0KA 4F80A 1T5XB 2B5IB 2FBJH 4N9GA 1IGCH 3D2UB 1FZOB 3PWJA 1NPUA 2BVYA 4XNMB 2UUDK 4IDLA 1KXTB 4FXLA 3P3YA 1MFCH 1EGJA 3CNKA 1R3HA 4TPRL 1NGZB 1B0RA 2VXTL 3RUGE 3GSUB 1IGFL 3MRNA 3D39A 5GISL 2ZNXA 4HKXA 1GGBL 1RUAH 4HJJL 2D7OA 5CILH 3QCVL 2H32H 4KK9C 1UM5L 2EYRA 4Q6YA 4JFEE 3QNZA 5ESAB 1IEHA 3RUGB 3B2UD 5DD6B 2MKLC 4OUOA 1BZQK 3OJDA 4WEBL 3KYMB 2DJ4A 3EHBC 3PWPE 1I1RA 1OY3B 4ZUTA 3NIGE 1KB5L 2IQAA 1BAFH 4OAWB 4UTAH 1NL0H 3O8XA 5HVHC 4JFEB 4LCYB 4TVPE 3QDGE 3GI8H 5B39B 4ZTOL 2XXCB 1RJLA 3PWVB 3ULSA 3VFUA 2B1AL 2C9AA 4G6KH 1IGTB 4YDLB 5CEZL 1RZFH 1P6FA 3PWPB 3HMWH 3NCFB 3HI1A 4P9HL 3CU7A 1JYXA 1WEJH 2PCPB 2VZTA 5CJ5A 3D39E 4HCRL 3QPQD 4ZSOE 5I71C 3QUMH 3W0WD 5HHPB 1HOCB 3QDGB 1T21A 5TF0A 3B9AA 3DUUB 5IHUH 3WCYA 3AS1A 3KXFA 5EORH 4P2RE 1S5IH 4L8SB 4KKAD 4X8JB 5E00B 4NO0B 1P1ZA 4GAGH 1HQRB 1EK3A 3AREC 3FT3B 4ZSOB 3C87A 4P5TB 4K3JL 3O2VL 2EC9T 2PO6B 2YKLL 4JDZB 3KWWB 1MVFA 1Y6MR 3MO1B 4NKOA 5IW1B 4P2RB 5BVPH 4QKXB 2OMBA 2CGRH 4APQA 1HSBB 1J0IA 3RI5F 2XZQL 1FP5A 1AKJB 1FSKC 2ADJA 4X6CB 4IBLT 4MAUL 4R90L 2LVEA 4NWUH 1S7SB 3OF6A 1OQXA 3O3EA 3ROLB 4EUPB 1NQBA 5FYLL 2CH8A 4WW1A 5DQJB 4PRIE 5JR1H 4PGDB 4HLZH 5DJCA 5D5ME 4QOKA 4S2SA 4NRZA 4GBXD 3ALPA 3FO0H 5GZNC 3EOBB 1H3TA 2G5BB 1KCKA 2FJGB 1NCBL 3O6KH 2CLVB 1DE4B 1AR2A 4PBXA 3OMZA 5IBUB 3LHPL 4OQ1A 4TTDD 3MRFB 3QDJB 5TE7L 2R0LL 4PRIB 2P1YA 2PNDA 5D5MB 1T3FA 3FB8A 3C2AL 4OM1H 1LO3H 4MGXA 2B2XL 2H1PL 1CE1H 3HG1E 1AGCA 3BVNA 5GS0D 4MD0B 2WK2A 3VFGH 5IIEB 1QSFA 2BRRH 4BYHA 4OZFH 4ZDHA 4PJFA 2NTSP 3ET9F 5FYKE 3ULVC 4HIJA 4YWGL 3CFEA 4NQDA 4QOKE 4X6EB 2J6EA 5E9DD 3HG1B 2R8SH 4BH7A 1RVFH 4Y5VA 5CLWA 2BVOB 4PYGA 1MJ7H 1IAIH 1ES0A 4QRQB 3GK8H 4LGRB 1PX3A 1G7LB 4TUJA 1YEDA 3KLAA 4LEXL 4M7ZC 5JHDD 1MJ8L 3E2HC 4Y2OA 5MI0B 2EDYA 4R3SB 4ENED 3X3FH 5FGBA 1YMMD 1NGQL 4FQ2H 2ITDA 1C1EL 1GHFH 1W0WB 3CSGA 3MYZA 1ZT1B 3WNOA 5IMLB 3BD5A 3DMMD 4TOYH 5EZIH 3FCTB 1D6VL 1QSFE 3BHBA 4P59H 5LWYH 5FKPB 4ERSH 4M1GH 1RZIB 3MCLL 4NQDE 4CU8A 4TUKL 3V4UL 2DWEB 5GSVA 4S1DC 2VOTA 2YD6A 4CL7A 3MRDB 4OLWH 1U0QA 5CS7A 4QXGL 3HNSL 5LJYH 2J7LA 4G8EA 4UILL 5JW3H 3TC9A 2ENYA 4HIIB 4JO4H 5FXCH 3MBEA 1KACB 3X14B 1XR9A 1ZVSB 1HIML 1RD6A 1KLGB 2DYPA 2PW1B 4K9EC 1PAMA 1XR8B 3IKKA 2ILLA 5DRZA 4PR5B 2N4IA 4IRZH 4LARL 1YUHB 1KJMB 2W9DL 3OB0K 1EEUA 3PP4L 3RZCB 3TCXA 1EXUA 3R06A 4MSWB 1Z3GL 1L9NA 4XMKL 1FGVL 2ITDB 3IJSB 2YSSA 1BMGA 1PX4A 1U3JA 3ARZA 5EBMB 2DAVA 3ME0A 4NZUL 4X5XB 4U31A 5B22A 3RKDC 5FYJU 3WNNA 5KTEH 4OCWH 1E4KA 3MPCA 4JE4B 4AL8H 3BISA 4UIMA 1GIGH 3Q6FB 1GH7A 3RWJA 3RWDA 3LKNA 3QO0A 1FZMA 1KCVH 2DQIH 5D71H 4ZPTB 4N8VB 3G5XB 4KC3B 1OWRM 1U8QA 1RURH 1F02I 3SDDA 1AE6H 1YZZA 4PJIA 5IKCB 5HHVL 5J57B 1XCQA 3RY4A 2A38A 4JAMB 4RAUA 5DO2D 2CKBA 5AYUH 3ULVL 1BGXL 5I8KH 2VLLB 5ISZD 3WN5A 4WENB 1FIEA 5M7QA 3RIFF 2Y1VA 5HI5D 3C09B 3OHXB 3C8KA 2IPUG 3WKNA 5IR1A 4M6NL 2VJXA 3PGFH 4MCYB 4CGTA 1RZJC 4PLKC 3MBXL 4WI8A 5FECA 2EDLA 4X9FA 3S96A 2BERA 4M6OH 4HH8A 3V8CA 5IT2L 1X9QA 1IBGL 4W6YB 1ZE3C 3BP4A 1L6XA 4RWYH 4MNGA 3SE9H 5TFSH 3DTXA 3TNNB 1O7SA 4OFYA 2F53D 2H32A 2K7QA 2WNGA 4TUOB 3IDYB 1QACA 2AEQL 3TVMD 4NQVB 4FQ1L 2VQ1B 5KVFL 3TYGH 4K71C 1C5BH 3JTSB 3LEVH 5D7LE 5H35A 3KLHD 3H9SD 4OLUL 4LFHG 5KANG 1ED3A 1OGTB 1YJDC 2X1XR 5J1AB 1U3ZA 3C9NB 5DZNA 5C0DB 3ZL4H 1YDPA 4LHQB 2EH8H 5F1NA 4A6YL 3BI9X 2RJMA 5D7LB 4Y16D 5IVNA 2BSRA 3HFML 1JPFB 2EXWD 1WWCA 4PLJC 1NSNL 2WQ8A 4MQXC 4DTGL 4O2EB 4QHNB 3VI4E 3QUMA 3QIWA 1E4XL 3W11D 3U0PB 2ZJSH 4KJQD 1LE5B 4K2UL 1P69B 3H3PH 3ZDZE 4D9RE 4HULB 4QRSB 3QO1B 3QIUB 1NGXA 1RFDL 1EUTA 1KPVB 3HLAA 5CZXC 3HE6A 1G6RH 4POYA 3BT2L 4UBDC 5DUML 3B2VL 3IVKA 5CJXA 4X7TA 3GSQB 1A7OL 4PJIF 4WY7H 3HAEA 1X4ZA 4JZNA 2BK8A 3P9MB 5A3ID 4KQ3L 1FFRA 1X3DA 2DL9A 3SJVD 2XY2A 3WS6A 2FEDD 2CUIA 1NC2A 3KNBA 4LNVA 2HTKC 3TN0D 2ADIA 4MYWB 1U8PA 3THMH 5FCSH 2XKNB 1BD2A 4GG8A 4MZ2A 1AD0A 4QY8B 3V2AR 4MX7B 3BZDA 1RUKH 3L95A 3IF1A 4LQFH 4CADB 4L1HA 2D0GA 4I0PD 3WIIL 2GK0B 4NP4L 5JXAH 32C2A 3WDJA 1U8HB 4ELKA 3O0RL 4IOFD 1DQLL 3Q1SL 2OS7A 4OT1L 3RY5A 1YNTB 4X7CC 2FIKA 2EYTA 4XPTL 3VI4F 3ARDA 2WIIB 4HK0A 3DUHA 3PWUB 3R8BB 1R3IL 2DM7A 1HE7A 4WFGD 4NO5B 3VXUA 3QXAB 4TPRH 1RZJL 5MENA 4AEHH 3NMEA 2DWDA 5KS9A 2R1WA 2VXTH 1GPOL 4JRXE 1GCFA 2YD4A 4BQ8A 1IGFH 4LVHB 5GISH 2GTZB 2VB5A 4U1NA 4XRCB 2Y9RT 1YN7B 5FGRA 1BD2E 3QH3A 1GGBH 4HJJH 3WV0A 3QCVH 1KJ2L 4OZFA 4X0KA 1W0VB 3LN4A 4AM0B 1UM5H 3NZ8B 4H26A 1AH1A 1WBYB 5GRVL 4JRXB 3VFTA 5SX4H 4ODUA 4WEBH 4PYHA 1P84J 4HZLB 1XT5A 1K4CA 4U3CA 2VNCA 4ODTL 4S0SD 1A1NB 1N8ZA 1YJDL 3ARGB 2IFFL 1KB5H 4NSKA 3S6CA 2YXMA 1ITCA 4OLYL 5IROC 3V8OA 3DGGA 1T4KB 3LEYL 1AXIB 1I9EA 2WBJD 4ZTOH 5MENE 3OKDA 3SKOB 4R4FL 2B1AH 4ZNEE 5I1LA 3T2PA 3PQYA 4WO4B 5CEZH 2IALA 2VZUA 4P9HH 3V5DA 1NBZA 1Q9KA 1U36A 5KSBA 1AI1L 3MTRA 1CVSC 5EZJB 3OR7B 2D03L 1ADQH 2YPLE 5DFWH 3SGEI 3U9UA 1INQB 3ZKND 2J8UA 2PTTB 4MXVE 5B4MC 2WP3O 5TH2A 4C54A 1K85A 4OLZL 4ZQKB 2XWBB 4R6UA 4K3JH 3O2VH 2YKLH 1A0QL 1K8DA 2YPLB 1OM3L 4JB9L 4TSCL 3WNMA 4LCWD 3MRGA 4NBZB 3VA2C 1P5VA 3O6FA 4X9BA 5FDYA 3ZSTA 3EFDL 4JO1L 2XZQH 3U4EB 4XNUL 3WL9A 4XXDA 1KN2L 2BNRE 3GIZL 4R90H 5C0EA 2LU3A 3UZQA 3B2UC 1CD9B 5MP6L 3N1PC 3QWOB 3GRWH 3TEUA 1FH5L 5HYQA 3MRBB 1EJOL 5FYLH 3T3ME 3SCMB 2UY6A 2FHBA 2OX5A 1MEXL 4OZGA 5BRZE 5KS9F 3RWEB 4IRJD 3IT8D 3H9YA 4LSTL 1NCBH 2BNRB 3VFVA 3LHPH 3RHWF 4J4PD 2VDKL 5L0QC 2R0LH 4ODSL 5F8RC 3IYLW 4JFOB 4JZOA 4UAOB 5BRZB 3QPQC 1SEQL 5EC2A 3C2AH 3HR6A 3SDAB 3EZ8A 5FIEA 1EJ6A 2OLDA 3FQXA 2B2XH 2H1PH 4KROD 3VD3A 3F5WB 4KKAC 2GCYA 2ED9A 5HI3D 3NGBB 5T33L 4J7RA 2EDDA 4HKBB 1UEMA 5LKNA 4YWGH 2ICCA 1FNAA 1CYGA 5I1IL 4P4KA 1IM9D 3C5ZD 4PRNA 5DJ6A 5C0EB 2VIRB 1GOFA 1FL6A 4G8GD 3T3MF 3OZ9L 3BGFC 2I9LB 4KZEL 1WIPA 4NRXA 3TPKA 1MJ8H 4NQCA 4Z7UA 4OTXL 3K0WA 1PW3A 4H0GA 3I3EA 1NGQH 1IQDA 1C1EH 3QQNA 4GBXC 3QEUA 1EO5A 4JHAL 1BJMA 5AUMA 3FFDB 4QCIA 3I3BA 3TO2A 3MYJB 2DQTL 4TTDC 5B38A 2XY1A 3OKOB 5HHXL 4BFBD 1ZT7A 3FHQA 4TNWF 1XF4B 2AP2A 3MCLH 3VXOA 5TDNA 5H94B 3SGDI 4TUKH 1NC4D 3V4UH 3N0PB 5I0DA 5HYEA 5BMFL 1K8IA 4ORZC 4QXGH 1U93A 1U3YA 3HNSH 1MVUB 5K33A 2AXGA 1IGJB 3GJFB 1MCKA 4JHWL 5GS0C 2F74B 2W38A 4UILH 4C83B 1MELA 2EDTA 1Q8MA 1SEBB 1SMOA 4OZGF 3UTQA 1KCUL 5C86A 4MS8A 2N1KA 2PYEB 5MHSD 5CJ8A 5ESQA 1HIMH 5C0GB 5B3JE 5HYJA 3EIFA 3T0BA 4YX2L 4LARH 5D1XB 4RGNB 2W9DH 1MPAH 3PP4H 1J1PL 1Z3GH 1G6RA 5D7JA 5ENWB 1EMTH 1II4E 4WU5A 4XMKH 4QTIL 2ZOLB 5GGSY 4F9PC 3U82B 4ENEC 4OJFH 1WBZB 2V17L 4MB4A 4NZUH 4WWKA 4QRUA 2JKXA 4RAVB 3MREA 2ED8A 3DMMC 1BJ1H 2Z35A 3ARBD 3L7FB 4HIEB 1CK0L 2DLHA 1KT2A 5EO9B 4B41A 4R0LB 3RY6A 1T7XA 2HYMA 4J3VA 1ZGLA 1Q9OA 1X5KA 4BFIB 3TH4T 1MHEA 3KPRE 3SQOL 4PJXA 3SKNA 4WI7A 2PTUA 1WSST 2AJXL 2R2BB 3MNVA 5C0AE 4U0RB 5HHVH 3NBNA 1ZXQA 4P49A 3UO1L 5F7UA 3ULVH 1BGXH 1YEHL 2KH2B 2ESVA 5SV3A 3SPVA 3TBVB 1G7IB 5J12B 1RHFA 5ITBL 2CPCA 3KPRB 2D0HA 1KBGL 1ZA6B 3VGAB 5B3JF 3GMQB 4M8VA 2JIXB 1X6NA 1ZLWK 4M6NH 2X42A 5C0AB 5DDHB 1MCFA 4DKAA 2Y06L 3CFKA 4G7VH 2X4QA 3MBXH 5MERB 3RIAF 4MQ7B 1CGYA 1CXKA 1I1FA 1KCSL 3HPJB 1ZHLA 5DJZA 4PJ8D 5IT2H 1QFWM 4H1LG 4FTVE 5GGRA 4J8RB 4YGAB 1XIWA 2AXHA 4PJ5E 2HLAA 2QHRL 4EI5B 3IDMB 1LEGB 2AEQH 3IXAA 4FQ1H 2GIYA 2YZ1A 4NBYB 4M5YL 5KVFH 1INEL 1IAOB 1VGKA 3SKMA 2DM3A 4YK4C 3MRRB 5E6ZA 2XFXB 5IBLD 4FTVB 4AIZB 2EDRA 2IAND 4OLUH 3JBG7 1S9KC 1CQKA 1EERB 4PJ5B 4OD3L 1KB5A 3HZYB 5EUOE 4M02A 5JOPD 2VLKA 1AHWC 1F3DJ 2CIKB 4JFFE 1N64L 1MCIA 5GS0L 4O00A 4A6YH 1MLCB 4KRPD 4M7LT 3HFMH 3NA9L 1I8IB 5D72L 5EIIB 5DO2C 1NSNH 4HCRA 1QBBA 4KGJA 3NFNB 2Z91B 4DTGH 5EUOB 3KLDA 4X5WA 2CIIB 4PB9L 1E4XH 1S7TA 3C2SA 2MQCA 5HI5C 4K2UH 4JFFB 3DURB 4I2XA 1F00I 3GM0A 4Y19A 3ZZ1A 2VDPL 3BKML 4O2FA 2W60A 2OTUA 4GRMA 4I18C 1RFDH 1I7ZB 2BC4A 3HRZB 3BT2H 1UH3A 5DUMH 4KJWD 3WFCL 1J0YA 1F6FB 3DARA 3B2VH 5IHLB 4NCDA 2R56L 3UMTA 1LEIB 1XIWB 5C9KA 3TBWB 3WHE1 1XGUA 1A7OH 3NPSC 5EBLB 3MZTA 4IRSD 3O3AB 4ZFFB 4KQ3H 3HHRB 5H2BA 3WIFA 1U41A 3NCYS 3PE9A 4R4BA 2W9EL 2SEBA 3TVMC 3IFPB 5CEZE 1VEPA 5DC4B 1Y18B 4IIQA 4J3WA 1LD9A 1JZ2A 5EUOF 1VADB 3BPCA 4GKZB 1C7TA 2X4NA 4R2GD 5T1MA 5LVEA 3KLHC 3UAJD 3SO5A 5IEKB 5CUSL 4ODVL 3WIIH 4NP4H 3P4LA 3KDMA 4OUUA 1T7VA 4Y19E 2V2XA 3O0RH 5HHQA 1JZ6A 1DQLH 3D0LB 3Q1SH 4NYLB 3I50L 4OT1H 3LN5B 4DEPB 1AJ7L 3CX5K 3O3BA 5F21B 4XPTH 3U7WL 4Y16C 1AO7D 5DSCA 4X83A 2X9YA 4GRWE 3VXSE 1BVKB 2EXWC 2Q7YA 4ZUUA 3PDGA 1R3IH 3LSOB 4DZ8A 3QJFA 4TQEL 2FJHB 2F58H 4U1GC 1X5XA 2GAZA 3W11C 4ODWB 2JJSC 1X5GA 2X6MA 4KJQC 1GPOH 4OGXL 5DRNA 3QUYD 3T4AA 1DP0A 2K1MA 1C16A 3VXSB 5ESVA 3NFSL 1OT1A 2R2EA 4KRLB 1U8OA 4LSVL 2NNAB 4GQPH 4BQCA 4JN2B 3T2NL 1KJ2H 4UNVA 5B21A 5A2JH 3UCRA 3G6AA 2L0DA 4DVRL 3MJ9L 1GZQB 1FL5B 2YWZA 4U05A 4JG1L 4MD4B 1S7QA 3X13A 1FPTL 1YYLL 1MI5A 5A3IC 2J1KA 3S3JA 4JLRB 1L0YA 2DM2A 2FEDC 3FB5B 1IM3B 3FQRB 4RMWA 3TN0C 1YJDH 2WUCH 5GS3A 2IFFH 5CKGA 1OTUD 1QO3B 4OLYH 4H0IA 5C09A 2VLRA 3GDBA 5HHOD 3N85H 3LRSB 4QXTB 3LEYH 2VN7A 4NQEB 4LHUA 4HMCA 2BRQA 1QP1A 4Q0XL 2PYFA 4R4FH 2CXKA 4I0PC 5DRXB 2DS4A 5CAYB 1FV1A 1U8JA 3KPPB 4G42B 5IMKA 4GRWF 4HUVB 2D0FA 4IOFC 1U91B 3QUZD 3WUZA 5DSCB 2Z31D 4JREB 2X40A 1AI1H 1HZHL 5EU4A 3UTSE 1VFAA 2IPKA 4WHCA 3DRTA 2D03H 2VWEE 4WI3A 3D0VA 3SQBA 1TVHA 2KQMA 5GIRB 2HVKB 1VEMA 4UOW0 1TZIA 4PJEA 3SDCD 1YPZA 2FB4H 3PNWA 5IHBA 4FA8A 5FKAB 4HC1L 2AEWA 2BSTB 1KTDA 1LQSR 1SJHB 4LPVA 3UTSB 2KUTA 3BJLA 1D3CA 1A0QH 4PG9B 1OM3H 4D94A 1LDPL 5F9AC 4JB9H 3LRHA 4TSCH 5C09E 1UWXH 2IH3A 1R5IB 3EFDH 2ARWA 4JO1H 4XNUH 4C55A 3FT4B 5FDWA 1CFVL 1KN2H 3GIZH 4PFEA 3C6SB 5MP6H 5T1KD 4PUBL 1FH5H 2V5SA 5KN5B 3HS0B 5EO0B 4U1HB 1EJOH 3RPIA 1JWMB 1BFOB 3GKZA 2IADA 5HVHB 3GBMH 1MEXH 4LSUL 2AI0L 4P5MA 4LSTH 4MNQE 5K9KA 1BF8A 4YAQA 4L3CB 3BQUB 1I7RA 4H25B 2VDKH 4XCEA 2V9QA 1R5VA 4ODSH 4WUUB 3NIDE 3N1GC 1DSFH 5L2JA 1SEQH 2CDEA 4JANA 1FNFA 4MNQB 4OGYL 5ERWB 1FL3B 5I8EB 4HWZA 1JWSB 2EEAA 3AREB 3ZKNC 3BEVB 1SM3L 4GW5A 3C60B 2VAJA 4XNQB 3D85A 4KH2A 5EN2B 3P30H 5DHVB 4N0RA 4ZO7A 3RA7L 5A2FA 5T3ZD 4ZFOB 3S34L 1N2RA 4U1KB 1U8IB 2AK4D 4LKCB 4I13B 4M1CD 1Z9SA 2BVQB 3DV4A 3MLVH 1UJTA 3AC0A 4TSBL 5DJXB 3VGFA 3BUYA 2FIRT 1MCSA 1I75A 3G9VA 3FT2A 3OZ9H 1D5MB 3QP3A 1A64A 5CIPA 1Q9LB 4KZEH 4NUJA 2YD3A 4P23D 5E2TL 3E2HA 4L4VD 1ZVHA 4PJEF 1NEZG 4P5MB 4MNHB 3EJZD 5GZOD 5A40E 5T3XD 1R5WA 1S9VB 3OKEA 4IRJC 3EYSL 4JHAH 3NIDF 4JFYA 2FLRT 4K3EL 1JHTA 2Q3ZA 2XOTA 1DBAH 3MLUL 4ZD3L 3C6LD 4J4PC 3BMWA 5HHXH 4FFZL 2FEEI 1EHXA 1F6AA 4ZPVB 5D96B 1IGYB 3ULVE 3RX5A 4KFZC 5BMFH 3P2TA 5T1LD 1CE6B 2D4DA 2P5WD 3DROB 2OSLB 2E27L 4HGMA 1IAKA 4KROC 1JRHI 4JHWH 4CMHB 3HUJA 4ETQA 4A6YA 2F54E 2DB8A 3I75B 4YGVA 5EZOL 5HI3C 4JKLA 2RFXB 5ELIA 5DMIL 4EIZC 1TNMA 1KCUH 2MQ3A 5F93C 1G7MA 2AV1B 3H8NA 4XCNA 15C8L 2NYYD 1KNOA 2XN9D 2WW8A 3VWJA 1NCTA 1P2CA 2GW5A 2VZ3A 5JPMA 2UY7A 1NGYA 2CRZA 2RCSH 2F54B 2NX5B 4E42A 4YX2H 5KVEH 4M7ZB 1J1PH 3ARSA 1AP2A 3OXRB 2R15A 1QRNA 2EDQA 1L0QA 4X9GA 3IU3A 3R4DA 3WDHA 5J1TC 4QTIH 3OKEB 3ZYZA 4FQCL 1RK1B 4Y4HB 2YUWA 2V17H 1H9VA 5DJDA 1ND0A 4RGMC 1L4IA 1AGEA 5FCUL 1YY8A 2P5ED 2E8YA 1K4DA 3ULVF 5HYFA 4XNZC 3I6LE 3RVUD 1CK0H 2VDLL 4TRPL 4CJ1A 1CLOL 3K4AA 1HCFX 4Y7MA 1XF5A 4OI9A 4YNYB 4G43A 3MUZ1 5JIHA 3SQOH 1N4XL 5F72S 3P0YH 1A9BB 2AJXH 1NLBL 3M17B 3P73A 5EOQL 3CPLB 2HJKB 2V5RA 1G6VK 3UO1H 1MF2L 4ZO6A 1L6ZA 1WTGT 1DDHB 1YEHH 2DQCL 1CD8A 1EHNA 4ZO8A 2DN7A 5ITBH 2QLVB 4NT6A 1RZ8A 1KBGH 4G6ML 4UUJB 4GMTL 4Z7OE 2Y06H 4JPIA 3MX0A 4TN9A 2ZCKL 4F15C 2AXFA 2V5MA 1LWRA 2PTVA 4LLMB 3WBDA 1KTLA 1KCSH 3U1SL 4NN6B 2EKSB 3HC0B 1MHHA 1KJ2A 4N0CA 1U58B 5KBNC 1XGPB 2QHRH 2BVPB 3QG6B 5HHNB 3NFPB 3HUJF 5EU6E 4Z78B 4Y1AD 4M5YH 4QRRE 2GFBB 3CXDL 5HDQL 3ARBC 4ODBD 4AT6B 3UYOD 4IOIB 3PG2A 4I0KA 3D3VE 4OD3H 1Q38A 3RDTB 3DV6B 4X99B 4MA1C 1HEZB 5EU6B 2Z92B 3QCTL 4M8QB 3P73B 4WI2A 5GS0H 3TF7C 3MACL 2DQEH 4QRRB 3MODL 3GHEL 2CRIA 5C2BL 35C8L 3NA9H 3Q5YA 5D72H 1X5YA 3D3VB 4A2LA 4EI6B 2P49B 3RBGA 1WZ1L 3NA4A 3FQTB 5C0IA 3T8XB 4Z7OF 4PB9H 4RWHA 1ORQB 5MEQA 1PZ5A 3AXLB 1I3RB 5C08B 5IQ7L 5JHLL 3IFLL 1HHHB 1I1AD 3H42L 2VDPH 3BKMH 2QQNL 1A6AB 3F6LA 1ZS8A 4D8PB 1X44A 4LPUA 4K55A 5A2LH 5E2UL 1ZWIB 4MB5A 2A74A 1BREA 2ZUWA 2EYSB 4UI2A 3WFCH 3FN0L 1U8LB 1LK2B 3QFDB 2R56H 4PTUA 1DN0A 1LGVA 5DTFA 2AK1L 4PJ8C 2G9HA 2OL3L 3PGCB 4CVZA 1QNZL 1UQSB 5I19L 3DXAE 1A1MA 2A83B 1D6EA 3TESA 5INCA 4U1IB 2NMSA 3MRCB 1I3GL 1T5WA 1VESA 4B50A 1G7QB 4FQXB 5IBLC 1XF3B 3F62A 4ODVH 1B2WL 5CUSH 3OKKB 5DQ9B 3W81A 2OK0L 3DXAB 2R4SL 6FABL 2NZIA 1YA5A 3V5KB 5GGTL 1XGQB 3I50H 5IMOA 2BOCA 1JZ7A 5JDSA 2LAAA 1AJ7H 2XV6B 5TGBB 3U7WH 4KRPC 3EFFA 1IARB 1YMHB 3V0AC 5DUBB 2GTWB 3VMNA 1ZVYA 2NW3B 3ORJA 1ZA3A 3P9LB 4MD5A 2RB8A 3BZ4B 2WIMA 3QUXB 3KYNA 3CSYA 5TQ2H 4TQEH 2EIZA 2HAZA 4C56E 1DBBL 3QRGL 2QR0B 3O11B 1OARL 1JI1A 1OF2A 4OGXH 3ZLQC 2X70A 1M05A 4MJ5A 3RVVD 1QSEE 3TBYB 3GMOB 3NFSH 3QULB 2DIAA 4X4ZA 4LSVH 3T2NH 3CXHK 4JQIL 3UZVB 4YDIL 1XGRA 3ROOB 4C56B 1HNFA 4DVRH 3MJ9H 3S36L 4K7PL 1JI2A 4JG1H 5ADOL 2DKUA 1I7UB 1DBJL 1WQVT 2E7LC 3VGGA 1FPTH 1QSEB 1YYLH 4QT5B 3STBA 2A6IB 3PABA 3TBSB 1HHGA 3GSWB 4NC1C 5CMAB 5GRYA 3EGSB 1UADC 4DCQB 5IROA 5TF1L 3MJ8A 3V6OE 5FOBB 4R2GC 4YIQA 5CEYA 4WFFE 3UAJC 4Q0XH 3VU2A 1F3JB 3DX9A 1QEWB 4S10A 3T2OA 5GJTL 5DT1L 4HJGB 5HGHA 1KPUA 1KGCD 3RL1B 3PWPD 1HZHH 3C5JA 2YEZB 4WI6A 3B9KD 3VXRA 5DEGA 5LQBL 3RRQA 3QA3A 3DETC 3MA9L 4TVPD 2JCCE 3QDGD 5EOCL 1TCRA 1FJ1A 1Q9WB 2UYLA 1E0OB 3QUYC 4HEME 1NGWB 3AVEA 1JMXA 1GGYA 1LDPH 1OSZA 4P5TD 2PO6D 4WCYL 2JCCB 3GMNB 5DD5L 5I6XC 5L2KA 3PWNA 4YHNB 1XEDA 4MDJB 1CFVH 1OSPL 2X4RB 1VEOA 1AKJD 4PUBH 5FB8B 2HJFB 4G8FA 1QR4A 1A4KA 3TA3B 1ORSA 2EO9A 1T1XA 3MMEA 2OYPA 2WY3A 1UXWA 2ARJB 2VLJE 4C57C 4LSUH 1OTUC 2GJ6B 5CEYB 5TE4L 2BSSB 4M00A 4WEMB 1D9KB 4Y2DB 2P46B 1DLFL 2JK5A 3LIZL 1AD9B 1WLHA 1EIBA 2VLJB 2Z31C 3QDJD 5DJAA 1Q94B 2VXUL 2JCCF 5EIVA 4BELD 1HHIB 1TQCC 1KELL 2LABA 1T80A 3W0WA 3DECA 4OGYH 4ZODA 3EKCA 3JV0A 1FJ1B 5I1HL 1FFQA 4LDLB 5E8NA 1SM3H 2FNBA 3SDCC 2I25N 4FMKA 4DN4L 3GKWL 3UJIL 2KBGA 1CT8B 5D93C 4PY7B 4TNVF 3RA7H 3S34H 3V6ZB 4P46B 3WLWD 4JQXC 2V2TB 3MR9B 1M71A 4LGSB 1ZLVH 5J4MA 4WTZA 2WINA 4TSBH 5J1SC 2KPNA 5CP3H 3QDMA 1BZ9A 4RISL 1PZUB 4ONHB 1BFTA 5E2WL 2ZOKA 4WU7A 5E6IB 4F58L 1CDIA 5GGRY 5KSUA 5E2TH 2LAGB 1TPXC 5FYKD 1KLUB 1BFSA 1XGTA 4GBXA 3IDGB 3EYSH 5D9SB 5D6CB 4LLAA 5FK9A 4K3EH 1HI6A 4XHJD 2W9LA 5BOPA 3MLUH 4JFXA 2N7BA 3D25B 3RWIA 4ZD3H 3SE8L 1H5BC 1B4RA 3O45A 3MGOB 4QO1A 4FFZH 3BIKA 5F9WC 2QJDA 2EC9U 2I9TB 2O61A 5EOTA 2M26A 3O81A 1JK8A 3MLPA 3SGJC 5CZVL 1IEAB 4RFEA 2EDJA 4XCYA 2E27H 4Z76A 3L5XL 1Q0XL 3WNLA 4EIGB 1TENA 3LQAC 2NLJB 5EZOH 1OLZA 1S7WB 3RJDA 4J12A 5I76A 5DMIH 5BCAA 1DQQA 2YK1L 4YDJB 5J6HA 3DUSB 4YHOL 3U2SA 5JPNB 4GAJL 3RL2A 4LSSL 15C8H 5SWZD 5DURB 4HT1H 1A6ZB 5E9DA 1FVDB 4M1CC 1B0GA 2YPVL 4EDXB 4J3UA 1LNUA 2ZOKB 1H8NA 4XX1G 1CFNA 3O2DL 1YNKL 1KCGC 2VE6A 3JWDC 3IDNA 1O0VA 1FG2A 3RZCD 4P23C 5JHDA 2FHFA 1FFNB 5J0BA 3DRQA 4UDUA 4F9PA 4L8CA 4FQCH 1HH9A 1YMMA 3EJZC 4N8PA 4S0TD 4YO0A 4XP4L 5GZOC 4WTZG 5DFVD 5FCUH 3OAZK 1IT9L 3KJ4B 3QHTC 3DMMA 2V2WB 1LO2L 4HF5H 1Z2KA 2VDLH 3D87B 4TRPH 5C1MB 5I9QB 1CLOH 3T1FB 3C6LC 3MJ6A 2ZUUA 2ATKA 3GIVA 3LKPB 5F89A 1JPGA 2H3NB 1CFTB 5E2JA 5FUCC 4HW6A 3S9DB 3QI9B 4OLEA 1N4XH 2BCKB 2Z8RA 5D1ZC 5EFIA 1NLBH 5EOQH 5DC9B 4AMKL 3IKCA 1MF2H 4DUXA 3VXQB 2DQCH 4HUWB 1YC7A 1TMCB 5IFJA 2BP3A 3D1MC 1I7TB 4HFWB 1DR9A 4G6MH 4U1LB 4GMTH 1BFVL 1YMME 1ZMYA 2NYYC 1F45A 5DK2A 2ZCKH 3QEGL 5ITFA 3KPOB 4X4MA 1A5FL 2Z8WC 1U92B 3VFRA 4XMPL 3T65B 3KAAA 3G9AB 3NN8A 2XZZA 3HPLA 4YEEA 1R24B 4YO0B 1V7ML 3MJ9A 4N5ED 2GHWB 1FNHA 3X11B 4LLQA 5CSZA 2QL1A 5BV7L 3CXDH 5HDQH 3SN6N 3T4YB 2YPKB 2X1OA 1S9WB 4QHLA 2A6DA 3KPTA 3VFNA 3RVUC 3OGCB 1Z5LB 2NTFA 2ZKHH 3QAZB 2H6PB 2FL5A 1I1YB 1MHPL 1LO0L 1AHWA 5DJ0A 1D5XA 1MAKA 3MACH 1WWAX 3IKCB 3UC0L 1RJZB 3LQAL 3MODH 4PREB 2WBKA 5C2BH 4X4ME 35C8H 4LCCA 2XWJB 3QQ9D 1N5YL 3QJHB 4JKMA 4PTTA 4M6ML 3TIDA 7CGTA 3FONB 3W39B 3GSOB 1WZ1H 5ISZA 1SVZA 3REWA 4KU1A 1AGDA 3K81A 4WW2B 4R7DB 5IQ7H 2VL5B 3IFLH 5JHLH 3H42H 2QQNH 4S0UC 3L5IA 1ODAA 4I18A 5D4QA 4Q9BA 1GRWA 3V79C 5E2UH 3JWDL 5J56B 1I3UA 2FSEA 3EYFA 3QIUD 4HWBH 4OF3A 4HC1A 3ZTJH 4O2CA 2D31A 1PY9A 2FR4B 1MWAL 1YYMH 3LH2L 5E94B 2YRPA 1QSZA 2HJLA 5IOPA 3O3DB 2OL3H 5HYSA 5T3XL 1QNZH 3G04A 5I19H 4URTB 2F53A 5E0QA 4YK4B 4PIRF 1FNGB 3HE7B 3VFSA 3TVMA 1I3GH 3OKNA 1KULA 2AW2A 4ZNCD 2QEJA 1PDKA 2NTFB 5ISZE 2FL5B 4L9DA 3STLB 4WW2F 1B2WH 1N59A 1NFDA 1H3PL 1CTOA 3BPNC 1A3LH 3TPUA 2OK0H 2R4SH 3DI2B 6FABH 3JV4A 2YXFA 5GGTH 4JO3L 3V6FA 1DQJB 2NXZB 1XFPA 4Y16A 3AM8C 3FTGB 1B0WA 5E70A 1VFBB 2OQJB 3OGOE 5DYOB 3REVB 4N1HB 3CX5J 1KFAL 1NGPL 4JKWA 1EO8H 1LEKB 2AJYH 3LS5L 4OFPA 1DBBH 3QRGH 1OARH 5C0JB 3MRPA 4U1JA 4PJ9A 5F7EL 2A1WL 1DANT 1REIA 1I1AC 2Q7NA 4S1SL 2G5RA 2WQRA 4P3DB 1PJ9A 1WC7A 1CQYA 3MLTB 3H6JA 1NKOA 4L9LC 4TVSa 3PJSB 2YHGA 3NPSB 4JQIH 4OD1L 5J7CC 1FFPA 4YDIH 4RBPH 1KB9K 2VABB 1HXMB 3S36H 3H9SE 4K7PH 5HGDB 5ADOH 1NFDE 3LS4L 5D2NC 1DBJH 3TPUE 4Q9CA 5DRWA 3ULUH 1HQ4A 1JGLL 3P4NA 3GMRA 5EBWB 1OP5K 1DBKL 4JRXD 1OP3H 3ZMRA 1KJVA 3OKNB 2GY5A 5CP3A 2P8MA 3TN0A 5IB2B 3D18B 3H9SB 4HKJB 5TF1H 1NFDB 2VITB 2R1XA 3TFKA 3QNYA 3ARGD 5DK3A 2FBOJ 1AR1D 1MCLA 3AGVA 1MRDH 1T03L 2MWCA 4I0PA 5HD8D 3HNVL 4PRDB 1TQBC 3FO9A 5CGMA 5GJTH 5DT1H 2DI9A 4MMXC 4WO4D 3KPQA 1P53A 4LPCA 4WI4A 2C3VB 5LQBH 3QWRD 4H1LB 3JWNC 4JFPB 4U1GB 3UBXB 3MA9H 3OX8A 3MRPB 2B5IC 5EOCH 2BNQE 4MXWL 2AXJA 2C7UB 3HKFA 4G8IB 2DQFB 2X1QA 3WUWG 1ZLSL 3OAYK 3WEXB 3PIQB 3SJVE 3GI9L 1NH6A 2H26A 3N50A 4NQXA 3O9WD 3RVVC 5D6DC 1ZLUK 3WFDL 1L7TL 1NFDF 3VRJA 3PWLB 4WCYH 3UYRL 4E0RA 5DD5H 4LMQE 2BNQB 3S88L 2YPLD 1A6VH 3SJVB 4BQ9A 1OSPH 5HGBB 1W72L 3MLSL 4PP1D 4H88L 1PG7X 5FO7B 4F7MB 3QNYB 3MJ7B 5F3BA 3BZFA 5TE4H 4Z7VB 3DJ9A 3SCMD 4I0PB 1AY1L 2ZSVA 4WFGE 3E3QC 5FAAA 3W9DA 3GGWB 2BNRD 4DWHA 1DLFH 3LIZH 3GUTA 4M7JL 4I5BA 3NABL 2VXUH 4YDLC 1H3UA 4FS0A 4BSVA 1KELH 3B9KC 1JTOA 4HH9B 4JFQA 5BRZD 3OXSB 1U8KB 5I1HH 4JVWA 1XH3B 4PGCB 3TIEB 3QEQE 4KK5D