3E6HA

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pi10, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'SHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEGPEYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESDGRLLRGYWQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPARDGTFQKWASVVVPLGKEQKYTCHVEHEGLPEPLTLRWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e6hA01
3FO9A 1FZOB 2EIZB 3O8XA 4PRDA 4BQ8A 3G5XA 3MCLH 2XXMB 3RWEB 5HGHA 3LRHA 3QIWC 3GBNH 2N7BA 3ZL4L 3OKNB 4EVNB 2EE3A 4FZEL 3SDYL 1PVHA 1PZ5B 2IC2A 4KWUA 4OZIE 5DYOB 2XWJA 5FDWA 3KPOA 4HIHA 5D2NB 3FT3B 4M6NL 4Q9CA 1RPQA 3FO1A 3C8HA 2OQJA 2Z0BA 4HC1L 5F8QC 4JDZA 4HS6B 1P4LB 5EUOF 3IDMB 3VFOB 3PQYA 4M7LH 5D7IE 5F7HA 3H9SB 1N3NB 2GTZA 1S7VA 3MRBA 4I77H 3TP4A 1SEBA 5J1SC 2F5AL 1K2DA 1YYLH 4OLVL 32C2B 3HZYB 4QTIL 1G7IA 4XP1H 3RFZC 5I2IA 3LS4H 3T0EB 2IQAA 3A67L 3FQNA 2A6JB 2FHFA 4YNYA 3VH8G 2A77H 5IR1B 1QUNA 2X6MA 2GK0B 4TVPL 1BBDH 3GSOB 5CEYB 1Q1JH 1QRKA 3T3MF 3QIBA 5L6YH 3PUCA 1BVLB 4OV6F 3QIWD 2NXYC 4P3DB 3GSXA 1IBGH 1QFOA 5D1ZA 1A1NB 3MBXH 2JJTC 4JFDB 4JGUA 3MA9H 5I1EH 4Z76B 3DV4A 1OY3B 3CFIC 4J4PD 3MRMB 5I0DA 2P42B 4EDWL 2AQ3A 3O11B 4XP4H 2C26A 3VFPA 5F21B 3GUTA 1GOFA 4PRNB 4BQ6A 4PJEE 1CFNA 5KN5B 3PWPE 1BFOA 5IUSA 5HI3D 5FIEA 4GKZA 5FCUL 3QG6A 2WUCH 1KIRB 3KYKL 3H7BA 2DI7A 3WSQL 4HKZB 5A2KH 3LKPA 1FVDA 3WNLA 3RAJL 1KN2H 5DRXB 4QRPE 5B3NA 1A1MA 1YJDC 4L4TB 4MB3A 4WHTB 5D1QA 4OLYH 5D6DA 2UVEA 1SYVA 5MEQB 2XNAA 2LVCA 2DJSA 3IKCB 4AEFA 3TO2B 1H3GA 4HZLB 1J5OH 4MNGE 5EOQL 3IJSB 5CUSL 2RQ8A 4U1SB 3MPCA 2CGRL 2OJZH 5DEFB 1QFWH 3WFZA 3E6HB 1JF1B 43C9A 2BVQB 5H94B 1A6TA 4GQPH 1X5YA 5JZ7D 3PWLA 3IFNH 5C92A 4D0BA 2NY1D 1CLZH 3P9MA 2YA2A 4YHOH 1IT9H 1XFPA 2Y7QA 4FQ1H 4P23C 2PCPB 1ZT1B 1D6VL 1ZKAA 4IRZH 3ARDA 1DN2A 3OB8A 4Z7WB 4ZSOB 2A9NH 1MQKH 4HKJB 3O45B 3UBXI 1A6AA 1X5ZA 4P5TD 5C8JA 5DZLA 3GRWH 5SX4H 4JLRA 4BSWB 2DD8H 5BS0B 5J4MA 1RUQH 3TCLB 5J8OA 1UM4L 2J1KA 5A16A 4NYLB 3F7VA 2CO6B 3GNML 3K46A 4XNMA 3FN9A 1T89C 1QLEH 3MREA 4ENEC 2QQNH 1D9KA 1I1YB 3GSRA 2GYSA 2O26U 3UTTB 3NGBB 1JFQH 2YD2A 3KDMA 3IVKB 4WY7H 3HA0A 4HKBB 5I1JH 5EZIH 2VAJA 5C09B 5D7LA 5BO1H 2XFXB 2OR9L 2UWEF 2W38A 1J1XL 1BZQK 5LCVH 2VSCA 3V5KB 2Y6SC 4JY4A 3MBEB 4WI9A 3O41A 1T04B 3EOTL 2WWKT 4HXAL 1Z2KA 3BDBA 3QCUH 2QBWA 4YHIA 5DS8B 4XI5C 4BSJA 2FO4A 4GAYA 3VXNA 2DLFL 1Y0LA 1FPTL 2QTEA 2CO7B 3MGOA 2VR5A 3UJTL 3FOLA 4UQ2A 4XZUA 5DK3A 3BQUC 1VFUA 2ZCHH 2XZZA 3D2UD 2WQ8A 3BGMB 1MCWW 3MCKA 5CAYB 4HMDA 4XBPA 3UROR 4MNQB 2X7LB 2NY6C 4WTXA 1AKJA 1IGIL 3N85L 2PR4H 4ENED 1OAXH 4DZ8A 3S3JA 3U0WH 1A5FL 3QFDB 1VGKA 1L9MA 3ARRA 1PGRB 2WIIB 2OSLB 5L9DL 2V2TA 4N0FA 4DCQB 3QQ3B 4FMFA 4MYWB 4MMXC 4XVJL 1RIVH 3BGFC 4NO2B 5EO1B 1FORH 4ZQKA 3D0LB 4K94L 1HWGB 5DK2B 4UIKL 2ATPB 3WD5H 3UJJH 1G7LA 2HJFB 4Y4FA 4JFOB 5BOZG 3QXAB 4J3VA 4JO1H 5FO9B 1RK1A 2VAAA 4R7NA 1VEOA 5DC0A 3DURB 4TNVK 3MUGA 2MSPA 1KNOB 5AUMB 4XI5D 5DRNA 2E7LC 5DD6B 1S9YA 3KXFD 3RUGB 2JCCA 3VMOA 3LH2L 3Q5TA 5T3ZL 4NWUL 1AXSB 4HCRL 5KTEL 1H3PH 4KQ3H 1ZAGA 2ZPKH 3DUUB 3KS0J 4PGEB 3VD9A 5DRZA 3MV11 4S1RL 1OAQL 5DJYA 4AY0A 2AQ1A 1I7RA 3IFLH 4G42B 1QBML 1R24A 3N06B 1AC0A 1SJVA 5CWSA 3RWCA 4OZHB 5F8RC 4E41B 4PTUA 1KCRH 1RK0B 4A6YH 4HGWA 5IVXF 1N0XH 3CDCA 2VLKE 1AHWB 4C57C 1A3QA 3AY4C 5H37H 1K8DA 2UUDK 1WBZB 1NGZB 4NQEB 4MQSB 4XX1E 2R39A 1HHGA 1X44A 4JY5L 3WUZA 2VDPH 2B0SH 2RFXA 5FA3A 1LDPL 3B8SA 3RIFF 1QHOA 3L5HA 1KJ2L 5EBMB 1WFOA 1QFWI 1BX2B 5IFJB 3DX8B 2HVJB 3JTCA 1JVKA 1KBGH 5EOCH 5IVZA 4M6ML 3HNTL 4YEFA 4NKDB 4QEGA 3K74B 3EYUH 5C0BA 4GXUM 5DUPH 2ZUXA 3R06A 5DJ0B 2X1OA 3QNZB 5JW4R 3JV6B 3RWIA 3L7FB 4Z7UF 1B4JL 4TTDC 3TN0D 1I3RA 3SBWC 4U3XA 4I2XE 4PY8I 4U2ZA 1A14H 4W4OC 1OT1A 3ME0A 1UWGH 3NIGE 5M94B 3IKKA 3HC3L 4O4YH 3QFJB 5GHWH 1JRHH 2CMRH 2OX5A 1JE6A 4RFEA 1FN4B 3T8XA 5BV7L 4JO3H 2GJ6A 1UADC 1HXYB 4LOUD 1QRND 5JUEL 3O6LH 1INDH 4JRXE 2XA3A 3C6LA 5KZCD 4OGXL 5I1CH 2FSEB 1HN1A 2HT2D 3FB5B 3OJMB 4U6HA 5F71A 2E7BA 5CZVL 1FYTE 1RZ7H 3RVWC 2CDGB 2I24N 5JNYB 2X1PA 4JKPL 5TQ2L 5D7KD 3RPIA 1K3IA 3O3EB 1LEKA 3GMPA 4HJJL 1ZV5A 4HWEL 4WU5B 1HYSC 2ZZUT 4P9ML 2J8UA 3F7RA 2Y1VA 3VWKC 1N5AB 4N5ED 4POYA 1NSNL 4WW2B 5TH2B 3MRJA 4PJ7E 3F7YA 3I84A 4LHQB 1NEUA 1X5KA 2ID5A 2WP3O 4PUBH 5DJZB 4MXQA 5KW9L 2VABB 1UQSA 1TZIA 2D7PA 4AQ1B 4JAMB 4KK8C 2BVEA 4ODWA 4PV9B 2PF6A 5SWSE 1I1RA 3QIUC 4TTDD 4FOMA 1G6RL 3PF2A 1M7DB 5L0QB 1X3DA 3R0NA 4JM2D 5DEZA 4U1JB 3IGAB 1MCBA 3FTGA 4XB7A 5IMLA 1T22A 3DI2B 5FYJL 3QJFA 4KROC 4U1MB 3W9EA 2GTWA 2WMPA 3D18B 1RZJH 3RZCB 4S1QH 3LV3B 3DMMB 1DN0B 1YEJL 4QT5A 4NCDA 2FIKA 2F54B 4HS8H 4Y19D 1U36A 1QSEB 1I8KA 3OAYK 5F97E 5IIEA 3EJZC 2DTMH 1W0VA 1UB5B 1CD1A 3B2UC 3RVWD 2DL9A 1TVDA 3GSVA 4B5EA 5BV7B 1QO3B 3CFBB 1V7MH 4XMPL 5HPOA 1S7RA 1S7XB 2GCYA 4MDJB 4RWYH 5E6IA 5INCB 3WXVL 5FKPB 2ZG1A 1XGQA 4NKMB 2MQ0A 2KQMA 3QUZC 4KJYB 3M8OH 3T65B 1UVQB 3O2DL 3O4LE 4PRPD 1LP9B 3NH7L 4FQ2H 1ODAA 1WITA 2FJFA 1IAIH 4KK8D 1WIOA 3W39A 3OGCB 4NZTL 2NYYD 5LQBL 4UOW1 2ITCA 2VLRD 5I1AB 3QDMA 2IPTL 4NZRH 1T1WB 4NRZB 5I9QC 1CGVA 3O6FB 2FBJL 4M48H 1HQ4B 5CP7A 1AR2A 3AC0A 1P7KB 4XCEA 1G6RB 4N0YH 4JPWH 5E5RB 4NNPH 4ODBD 3Q6GL 2JK5B 2YSSB 2CJUL 3IAPA 4GAGH 4H26B 3QXDA 1MREL 3CSBA 4RSVA 4UB0L 5C6TH 3ZYOA 4F2MA 1U8KB 3I6LD 5JORA 4CN6A 4YO0A 2D2OA 1XZ0A 1NFKA 1S5HA 3S97C 2W91A 3DBXA 3OKEB 4LLYA 3LAFA 4YXHL 3H3PH 2PYFB 4GFTB 1XF4A 2W92A 3BPOB 2Y07L 1SM3L 5EH1A 5I8EA 5JHDB 3JWOL 5F96H 1LEGA 2NPLX 1WZ1L 2X4QA 1A6ZB 3QWOB 3SE3C 3FN0L 5IMMB 1CFVH 1AQKL 4XMLH 3B9KA 2AAVA 3TBVB 4HAGA 1J1OL 4JREB 4M1DL 1SJEB 3OTTA 3THML 5IJKC 4LEOA 1RZKL 3O3BB 3RVXD 3VGDA 2FATL 1QD0A 3OXSA 4Y5YA 1ZWIA 5F7DA 9CGTA 3P4OA 3QDGB 4HJ0D 2P8PA 3QI9D 1XF5A 5E5MB 4M7ZB 4XNXL 3ZKNC 5JW4Q 2Y9RT 2XWBA 4MQTB 5L2KE 1KXQE 3BW9A 5IMOB 4P9HH 3ULVD 4Y4KB 5JDSA 2BRRH 5I1KH 2ORBH 1H5BB 1TVHB 5TE6L 1MIMH 2FLBT 1KCVL 3MFFB 5HYSA 1F90L 3TVMC 1XGPA 3WIHH 3L3JB 3CVHH 1AD0A 1OW0C 2Y72A 1T1YA 2FNBA 4XTRC 4UQ3A 3WMSA 1U93B 4XVTL 5C0AB 4EUPH 1UJTA 3CLFH 3B2VH 5CP3A 4CVXA 2FX7H 5ISZE 2W9LA 3UTSB 3AREB 5I75B 1LHZA 2VR4A 3TNMA 2A6DA 1FFPA 1JNLH 5JTWA 3MR9B 1MHPL 1MUJB 1GGBL 3GMOA 5CKGA 1CFTB 1IM9A 1NC4D 4DOHE 1RZIA 4CDGC 3IU4H 1CT8A 3GSQB 4I48B 4NQXB 3V7AE 3QDHA 3O9WD 4L8SB 2D7TL 3HZVA 2MPAL 5DMGD 5HVHC 4EOWH 4PBWD 4GJTB 1MJ7H 4EIZC 5CLWA 1UZ8A 5LWYH 3OPZH 3BKML 1RZJC 3QJHA 4BH8B 3K8KA 4U6YB 1LO2L 2BNQA 1ZLVK 3DTXB 3HFMH 3H9HB 2DIBA 4TSAL 5GGSY 5HGDB 2R1WB 2GFBB 5CD3A 1FVCA 4WTZG 4L4VA 4F7TB 7FABH 1DQDL 1NEZA 3VXRB 5BZWB 5ETUA 4LCUA 3TBSB 2IPKA 4S1DC 1ZA3B 3EJYC 3U1SL 1FNSL 5LGHH 3OKMA 1MJJB 2YD5A 1FAIL 2VXTH 5MEOA 2PTVA 4J4PA 5E9DE 3RA7H 4ZO9A 1CF8H 3DGCR 4LLQB 5TE7L 4ODVL 2IADB 2C7UB 4LVOB 5CJOH 2R0LL 5IB3A 3SGJC 1P5UA 5KVFL 4QTHA 2HLAB 3ULUD 1JHLH 2PYEE 2EDRA 4U2YA 2NY4B 4C58B 1R3LA 1YDPB 4KJWD 4Z7QF 2UYLB 1U41A 4KPHH 4XT1C 3WIFB 1HINH 3W0WB 2ZSVB 1FC1A 3DUHA 4EUPG 1CLOH 4X4ZA 3MA7A 4QLRA 4OM0L 3BSZH 3HE6B 4WUKL 2DQDH 2WUBL 4OFDA 3CH8A 1MPAL 1EHLL 1A9BB 5JR1H 2MCPH 4YHPB 4MA8L 2R9HD 4EI5D 4XVSH 2NY0B 1T1XB 2R56H 3LN4B 1X6NA 3EZ8A 1EFQA 3BN9C 4XBGA 1TQCC 2Q3AA 3HG1B 5IWLC 1TDQA 4TSBH 5E8DL 4YUEL 4Y0GA 4Z5RB 2BHYA 1F97A 4AT6A 1TFHA 4OZIF 2P47B 3JV4A 3CH1A 1OSZA 1SJXA 3VXMD 3BHBA 4NSKA 4ZUTB 4UINL 2Y23A 5C07E 4ZFGL 5A3IC 4JFFB 3ZE0E 4DGVL 4PY8J 3C5ZD 1OM3L 4IMKC 3CFKB 1ZT7A 2J12B 3SDXA 3OR7B 4H20L 1URLA 5ILTL 2DIAA 1CDCA 3AXLB 5KBNC 3WS6C 2PXYA 4TQEH 1VB9A 1TMCA 1GGCL 4NCC2 5FHAL 3UZQA 3O3UN 4XNQA 5KSBA 3EO9H 2VDOH 3GMNB 4NBXB 1U8LB 5D2LA 3S34L 1Q72H 2OL3A 4GKOA 3OXRA 4HDIB 4LLAA 3C09C 1F8TL 2ZUQB 3LD8C 4H5SA 5FK9B 1I3UA 3MRLB 4P9HC 2W9EH 3BPNC 4CN1A 1EV2E 4NO0A 3RKDC 4HGMA 1JI2A 2DWEB 4RCAA 5E1AA 1XR9A 1I3GH 5DJ8A 3TA3D 4OAWA 4DTGH 4GRLB 3O81A 2ILLA 3TPKA 1XIWA 4ESKA 1ORQB 3AB0B 5F9OH 2AERT 3DVGA 4PJEF 4ZUWB 4I9WE 3ISWA 3MLYL 4K71B 1UWEH 3HNVL 3MV9A 4JZJC 3SKMA 5GRUL 2ICWB 4P46B 2PUQT 3UPRB 2IWGA 1JNNH 3P0GB 4NM4L 4R7DA 1JWSB 5FF6A 3LKSA 3L6FB 5HBBA 2FR4A 5MERA 1GJIA 2FB4H 1BIIA 4WHDA 3I50L 1LO0H 2HFFB 4ETYA 3GSNB 4Y1AB 4MDIB 3UCRA 4X5WB 4GMSH 1GIGL 1WBXB 3P11H 4U1HB 4C59B 4QRQB 4AENA 2ADGA 2DM2A 3K0WA 4R26H 4ZAKD 1IZKA 4RRPA 3RL2A 3O4OC 3WJLC 4S1SL 2XQYK 4NRXB 1DVFC 1ZE3C 3RJDA 4CDHA 4G43A 5TF1L 3LEVH 1RD6A 4H88H 5ECJE 2YR3A 2F53E 3QIWB 3DYMA 4I5BB 5CZXC 5DLML 4WO4C 3WO3B 2KPNA 2PW1A 4PJ5A 4HULB 5A2JH 1YJDL 2GJZB 3WEXA 5GZOD 4CMHC 4OT1H 4XAWH 1I9JL 1A6WL 1QLFA 2BY2A 2EZ0D 3EJJX 4PGCA 1BJ8A 4M6OL 1AP2A 1AC6A 1AO7E 2ZJSL 4KKLC 3JTTB 4ZOCA 5IK3B 4XPGH 3ZHDA 5IQ7L 3DOSA 4HWBL 5DF0A 4BQBA 3STLB 5L8KB 2EXYD 2RB8A 3MMEB 4IJ3B 4QHUA 3MLVL 1QVOA 4DAGL 1IEHA 1R5WA 5C0IB 3EGSB 1KXVC 3V0VB 1AGBA 3EOAA 2X1WL 2EH8H 3FB6A 3F65A 3G6JA 2B5IB 2VZ3A 4L9LC 1WJ3A 2AXFB 4U1LA 3TH4T 1B6UA 2IPUK 5FUOH 2NY1B 3FMGL 3FL7A 4X99B 3K2UH 5DMKA 3ZDXE 3D69B 2L7UA 1U3HA 3P4NB 1T0MB 5E7BA 3TFKD 1VFBA 1YQVH 3MLTA 2NXYB 2MHAB 4RBPH 3UEZA 5C2UB 3C8KB 3ZDZE 4GSDL 4O58L 3RWEA 1F3RB 4H1LB 1S7WB 1LILA 3EDFA 1IAMA 1NCTA 2Y4SA 4F33B 4A2LA 1CLCA 2NY3D 1S8DB 4HAFA 1X9QA 3C5SB 5B22A 2AK4B 2RCSH 2DWDB 4JN1H 1M6OB 1YN6B 4HHAB 4J2XA 1NAMA 3LIZH 2LQRA 4NT6A 4ZPTB 1GAFH 5EOCJ 5DR5H 3S5LB 4UV4L 4HS6A 5KSAA 4KVCH 4APQA 3VFOA 4Q0XL 1N3NA 2O61B 2O5YH 2AKRB 3NCJL 4GRMA 1WEJH 2J2ZA 3GHEH 3NFSH 3MV8E 1RUMH 3T77B 4NO5A 32C2A 3HZYA 2LU7A 3MCLL 1CR9H 1FNGB 3S8WA 2GSGB 2H8PA 1BGXH 3LZFH 3GBNL 3FRPG 5DVMA 3VXQA 4XNZC 2W0FA 3BP7B 1VSCA 1CGTA 1MCEA 2R23B 3FCTB 2GK0A 4O5LL 4URTB 3GSOA 1TCRA 5BCAA 1NCWH 4FQIH 2X4TA 1QQDA 4F9LC 3CUPA 3WYRA 4OLZH 4QGYA 5EOTB 3VG0H 4Z76A 5ANMB 3MRMA 2CR6A 1MFBL 4M7LL 4X6FA 3IXTA 5T3XD 3D2UB 3EW3B 5IB4B 4I77L 4HUXA 4NQSB 2YS4A 5KANI 2YXMA 3ZO0A 1YYLL 5IB5A 1YMMB 2B2XH 4XP1L 5EN2A 5HVGB 1N4XH 1UEMA 2EEDA 1U8NA 3LS4L 5SX5H 3FQXB 3HLAA 1UENA 1IEAB 3EIFA 3GEWB 3T04D 2QADC 4PG9B 4Q6YA 1KIQB 3UTPD 2A77L 1JWMA 3VH8B 1QR4A 4WHTA 1WT5C 2BSSB 4MJ5B 1BBDL 4BFIB 1Q1JL 3G5VA 4YFEA 1EEZA 1LE9A 1LWRA 3QYCA 5L6YL 3PHSA 2VQTA 2Q6WB 2IALA 5FUZH 3SCMC 1HH9B 4IRJC 1NUNB 1IBGL 4XAKE 1M05B 1CN4A 3MBXL 4G7VH 5I1EL 3MA9L 1ADQA 1JTPA 5DEFA 2Z8VC 4EQ2A 1DANU 2IH3A 4XP4L 1CGSH 4HWUA 5IM7B 2AEQH 1WTLA 3LKRA 2FZ3B 3LEXA 3V6OC 3BZFB 3OR6A 5F1SA 3VI3F 5J3HC 2PCPA 2NTFB 1ZSDB 1KJVB 4FQJH 4DN4H 1YY9D 4HEME 1KN2L 4NZUH 1AY1H 3TBTA 4X0KB 5JXAH 4ZSOA 2Z9TA 3BQUB 2Q3ZA 3RIFK 3KWWB 2ED9A 5ICXA 4W6XB 1RAMA 4OLYL 3RWGB 4LFHD 3KR3H 2NY6B 5C6PB 1LNUA 3FFDB 4ZYKA 1OPGH 2FGWH 5L2JB 2OJZL 1EHAA 1JGEB 1QFWL 1JYXA 1HSBA 2C3HA 3H2WA 3MV7D 4EBQH 1MI5B 5FGCE 2R2EB 3UTTA 3IFNL 1CLZL 1NH6A 1J8HE 3CXHJ 4YHOL 4PJGA 1TZHA 1IT9L 5E2TH 1OAKH 4FQ1L 1U8QA 1P2CB 1PX4A 4OM1H 2IAMA 3WHXB 4IRZL 3VXOB 4P4RB 2CUMA 4K3HA 5T1KB 1L6XA 4XB8A 3MJ9H 2A9NL 3F58L 1MQKL 1TLKA 4L8CB 3MBEA 5EU6B 3ZKXB 3SKUD 5DA4A 3TZVC 5A2IH 1EX0A 3GRWL 2DD8L 2EICA 3B9EA 1FGNH 1RUQL 1FHGA 4NHUA 3SDAD 4Y2DC 3TIDB 4L29A 3SGDH 5IBUG 1T2QL 3TN0B 2E8ZA 4JFED 2WY3A 1QLEL 4PJ7F 4J12A 4QXUH 1AQDB 5DA0B 2QQNL 5EIIA 2BVOB 1QFHA 3IDUA 4JZOA 5FV1L 5FXCH 3U6RA 1EGJL 1OF2A 4CU7A 3NCFB 3FO0H 5C0CA 1WISA 4WY7L 2IANE 5I1JL 5EZIL 3BP4B 3HRZA 5BO1L 4F7PA 1FFNA 1QRNB 2DBLH 1T7ZA 4L8DB 5LCVL 5GS1C 4W6YB 5KZCB 2XKUA 2W0KA 4CNIB 2EYSB 3A6BH 1F45A 1OGTA 4QY8A 1XF1A 1MIEH 3QCUL 2X4RB 4LKXA 3U48A 3QXTA 4PJIB 4JPVH 3FAXA 4MA3A 2VXSH 4PJCA 3I75B 4PD4J 5F1OB 5ESQB 4W6WB 4OJFH 4DVBA 4LNVA 2CIIA 1ZGLB 5IFHH 4X5XA 3QXAA 5AG9A 5HYJD 5FO9A 5F1IB 4ZMAT 2ZCHL 4JJHA 2F58H 3P4MB 4Y2DD 3S6CA 5AUMA 3STZB 4RQQB 1JPFA 3QHFH 3MROA 5F89A 3MUZ1 3NZ8B 1AXSA 2N56A 2PR4L 5LGJA 2DQHH 1OAXL 3QUMH 4P2QE 4JM2B 3U0WL 4FQPA 5MENA 1Q0YH 3HCVA 1KC5H 4MXVE 3M17A 3RGVC 1MLCB 5E0QA 2APTA 4OQ1A 4QF1B 3PP3K 3KPRE 1RIVL 4CADB 3IDJB 3CX2A 4X6CB 3PNWA 5CBAA 1FORL 3E6FB 2EIDA 3SJVD 1E0OB 4Y19B 1DR9A 3EYFA 5IVNA 2LV4A 5IHZA 4M6AA 4PJDB 3VXSD 3WD5L 3DX7A 2VR9A 4E41A 3UJJL 2GT9A 5JOEA 1RK0A 1DL7H 1VA9A 2COQA 4JO1L 1AHWA 1HOCB 4ODTH 5FYKD 3QPQC 1FE8H 4HPYH 1FNEB 3HUJF 1NGZA 1J8KA 3FKUS 2PO6C 4ORGB 3D3VD 2XPGB 4NKOB 3MRFB 4FQLH 3RDTD 4YIQA 3TO4C 5I19L 3VWKB 1K8IA 4M1CD 2VL5B 1H3PL 4KQ3L 1SBBA 2ZPKL 5K9OA 3DX8A 4IRSD 4JANA 4ZUVA 4YE4H 4X9GA 4HLZH 3VGBA 3IFLL 1EAPB 4E5XA 5HHPA 4I18A 4ZXBA 1CVRA 3BIKA 2EKSB 4TOYH 2JJSC 3DXAE 3FOMB 1S7UB 1RJYB 1KCRL 5EO9A 4FQCH 1A47A 1N0XL 3NFPB 4KROB 4AH2A 2MKLC 4OZFH 1PD6A 4QRRD 4WEBH 3IJHB 4HQQH 1OTUC 1X4XA 3F62A 2AJVH 4RISL 2VDPL 2B0SL 4HCRA 2Z35A 3IAQA 5D71H 5JOFB 1C16A 3GK8H 4ONHB 3OSKA 5DQJB 1XMWA 2FEDD 4NO3B 3V79C 2QSTA 1KBGL 4B50A 3UYRH 5EOCL 3HZMB 5I74C 3D39E 5TE4H 1MHHB 1LO3H 4K3GA 4Y16C 3E3QE 3S7GA 3EYUL 2QQQA 3W82A 5DUPL 2R8SH 1YEDB 3UTZA 5JNYA 4MJIA 1U8JB 5DHVA 3O3EA 3GMMA 3QO0B 4WU5A 5GZND 4F3FB 4BKLB 1A14L 5J13B 2WBJD 1UWGL 3RWFA 2IBZX 4ODSH 5GS0H 1J87A 1QEWA 1KJMB 4O4YL 1QYGH 5GHWL 1JRHL 3QWRA 1FC2D 3RGHA 2CMRL 4JO3L 1U58B 3RWJB 4ZTOH 4DFHA 4EDXA 4M5ZH 2CXKA 3CMOH 3SGDI 1KJ2A 3O6LL 1INDL 4UDTB 5JO5A 4MA7H 2YD4A 5I1CL 1IE5A 5SWZE 4GKNA 4U1JA 4GG6A 1HYRC 3C5ZA 2YC1B 4L3ED 1PEZA 1RZ7L 2MFNA 5C0RH 1FGVH 1ETZB 5HHME 4F7MB 3QI9B 1INQB 1KENH 4OB5H 1VFOA 2VRAA 2P5WD 1HH6B 1Y6KR 5T5NG 3SO3B 5C2BH 4OGYH 1MFAH 4A6YB 4K7PH 2F54A 4OZFG 2AXJA 3CFEB 3TYFA 1BQLL 3DUSA 4BQ9A 1OGAA 4PUBL 1OP3H 3WN5C 3KYOB 3D6GA 2R4RH 1W72H 3NACH 3I3BA 4MAYD 3HI1A 5DZNA 2YK1H 4EXPX 3FFCD 1S7XA 5F6HI 4MDJA 1ZS8B 3OB0H 1I85C 1UXWA 4WEMB 4PJFB 4KJYA 4FFWC 5JMRA 4QHLB 2V9QA 3C60C 2ZUWA 4PBXA 4Q9QH 4GAFB 1JZ2A 3TA3A 1T66C 3ARFA 3SGKA 1RZJL 4S1QL 2DJ4A 4QOKB 5IEHA 1NC4B 2VLMD 4YDVB 3QT2A 1WICA 4U3HA 2XZQH 2VDLH 3KPNB 3K2MC 4HS8L 5ID0B 4YHYB 4M4PA 1T1WA 2DTML 2ERJC 2MOVA 1JGDB 4N9GA 4PREB 2OJEA 4ZD3H 2BMKB 4X6BB 1KN4H 4Y8DC 1HKFA 1V7ML 5AZEH 4RWYL 1OP9A 1G6RA 1KIPB 4RFOH 5DGQA 2ARJQ 2NR6D 2XTLA 4J7RA 5J1AB 1JZ8A 1HHJB 1A9EA 4OQTL 1E4JA 2JK5A 5JXEC 1JTOA 1KYOJ 3M8OL 2AGJH 1AI1H 1PLGH 1RHHA 5EUOA 5I1LA 2NCMA 3SY0A 4ZOAA 4U6VH 1A7PH 4KKCC 2DB8A 4WENB 4FQ2L 4JM4H 1IAIL 2Y5TA 5GGRA 4V1DA 4HWZB 4G8GD 1ND0A 1DBAH 1UWXH 4NZRL 1CGUA 3C87A 4TTGA 3CPLB 4NQUA 1EERB 4M48L 2JJWA 3ROLA 2AJ3B 5JHDA 4PRIB 3NZHH 4B7IA 5CGYD 1KTRL 4KRLB 1GGTA 4JPWL 4N0YL 4NNPL 4MX7B 2OLDA 3GZKA 2GUOB 3Q6FB 4O2FB 3ZE0F 5I1IH 5IMMA 1BECA 3QAZC 5HVHB 2BCKA 4LRIC 3MRQB 4GAGL 1XF2B 1SJEA 1KEGH 5C6TL 4G9DA 5HPMB 4NCC1 2EDQA 1S7TA 4MQ7B 2X4OB 1MQ8A 4MNHB 4J3WA 4XNUH 1BVKB 4HUVB 5E5MA 1I7TA 4FG6D 4EI5B 3MRDA 4OD3H 5IMOA 5DMYA 1V8HA 1MJ8H 5D7JC 1H5BA 1TVHA 3QEQE 4OI9A 5DC9B 3LVEA 5DJ6B 2VZTA 5EU4B 2IBGA 4NN5C 3I6KB 5F9WB 1HSAA 1GPOH 4POZC 4XCYB 1OARH 1O7VA 1CFSA 5DHYA 5F96L 3TPUA 4Z78B 3S35X 3QQ9C 5EO0A 1EEQA 2BP3A 2VITA 1ZHBA 2A0LC 1CFVL 4XMLL 4PG2A 4LPCA 2YUVA 5HHOE 4QXTA 2DI8A 3TJHD 4H8WH 1BJ1H 5GS0C 3QDJA 3KGRA 4Z8FL 5CIPA 5L88H 3OKYA 4M4RA 1WQVT 3WO4B 1C8PA 2P8LB 1EHXA 1CFTA 1EO8H 4P9HL 1BD2D 4CVZB 4I48A 2BRRL 5I1KL 2ZWLT 2ORBL 1NCDH 3SGEI 1MIML 1N5YH 2JLLA 4YXKH 2R15A 1CDBA 2WQRA 4LAQH 2WSKA 1F6AB 3WIHL 1DFBH 4PGJA 3CVHL 4BH8A 4MHHG 3QULA 2BVPA 3VGAC 2R2BB 3M1BB 2IG2H 1T21B 2ITDA 3OF6A 2YZ8A 4HD9A 2R1WA 3V6FB 3EFFB 3CLFL 3CFJB 1OT2A 3B2VL 4E9LA 4WUUE 1BIHA 2FX7L 4G9FA 1T4KB 3KPSD 1FZMA 4KUCD 3TBSA 1NGPH 1JNLL 4POZD 3VXUD 1Q0XL 4I0PA 3DVIA 2UWEA 5GS2D 3STBA 4RZCB 1W0YT 1FP5A 1GYAA 1MVFA 1P4IH 3HI6H 4DQOH 3IU4L 2BSTB 2HH0H 5FOBA 4JHAH 2BK8A 4EOWL 2A6IB 1MJ7L 2FBOJ 2X4PA 2HLAA 4R3SB 5LWYL 2DLGA 3OPZL 5D8JH 5CHNB 1YDPA 1JZ7A 1L0QA 4E0RB 2FHBA 3HFML 5D2NE 4UT6H 4X9IA 2P5ED 1MFDH 4ZAKB 4L3CB 4PJ9D 3WE6B 4FXGA 1PYWA 3DNKA 3TCXA 3L3HB 4WFEE 5DC4B 7FABL 3QUXD 3HE6A 1W0WB 1HHHB 2XN9D 3H9SE 4ODXB 4JG0H 3N1QC 5LGHL 3QO1A 4ZOEA 2R69H 4BZ1H 2WLYA 2VXTL 3V6ZA 5I1GL 3RA7L 2ZUTA 3ZDXF 5JW3H 1CF8L 4JDVB 2E6QA 3DRTA 2R2CA 5CJOL 4L5FH 3T0EE 1H0DB 3UTQA 3O6MH 1NGWB 1T1XA 1DEEA 2BNUB 4XCNA 2Y25A 2LTQC 3ZDZF 1JHLL 5T33H 2FH6A 3CVHB 1DUZB 3HG1A 4U1GC 2CLZB 4KPHL 4AIZB 4NQDD 1HINL 2H32A 4JZJB 1EVTC 3FB7B 2DMCA 2F74B 1CLOL 5A40E 4EUPB 4TN9A 1R5VB 1QBLH 2H2SD 4JFDE 1ZANH 4NGHH 3BSZL 4DEPC 4KTYA 4WV1B 4NBYB 5C08D 4LP4A 2DQDL 2GEEA 3BEVB 2VOTA 3W9DA 4B0MM 5TDNB 5JR1L 4XWOC 4Y4HC 2MCPL 3OR7A 4KGJA 4EEEA 2J6EA 2BSED 4M3JA 1T80A 2CDEB 4QHMB 4F15C 3AXLA 3BUYA 3P0VH 1MWAH 3O4OB 4YBLB 5GGTA 4KJPC 4XVSL 2EDBA 2XI9A 2R56L 3GBMH 4L4TE 5C0EB 1DBJH 2MQCA 3MRPB 4WO4B 5BMFH 3WIIH 2AQ2A 4P4KD 1NDMB 3VA6A 2QKIA 4TSBL 5EFIA 3ZT6A 4CMHB 1CDIA 4ETQA 4PDCE 1SVZA 2NY3B 4LRNH 1HI6A 3MRLA 1JWUB 5IVXA 1A2YB 3DPBA 1S7SB 5I76B 5HD8C 5FM4A 1QFWM 3L3IB 2RIKA 3HUJB 2AJUH 1L6ZA 4QHNB 1R3JA 2MMXA 4KK5D 1PW3A 1ZGLM 1ORQA 4ZPVA 4NWTL 4F37F 4ZUWA 4HV8B 2VLJD 3BYTA 2XKNB 3ULSB 2NW2A 4Z7WE 1UCBH 3QG7H 4TQEL 2YD9A 4H8WC 4BA8A 2HTLD 1BEYH 2WWMD 4C54A 5I16B 3EO9L 2VDOL 2VDRH 1EK3A 4L9LB 1IGTA 5BS0E 4FFVC 2YD8A 4HFWB 1Q72L 5HI5C 3IYLW 3WFHB 3EO1B 5LBSH 1T0NB 4Y1AA 5F7LB 2WWKO 4Z7UA 5J6GB 4IMLB 4U1HA 4QRQA 4HFUH 2XT1B 4BUHA 1MCOH 4M03A 4WI3A 4F9PC 5FYJU 1I3GL 3EYVA 2DQFA 1SY6H 3EZJB 1Z6JT 2EO1A 4QXWA 5CZKA 4DTGL 1LEIA 5C09E 3RVTC 5F9OL 3NFNB 4JEGB 4PJBB 4MJ6A 3ARXA 4EXKA 1VGEH 5BRZA 5T1LA 1UWEL 1I7UB 1CG9A 4CMMB 2V7NB 3DROA 4NN6B 5F6HJ 2EC8A 4P2OC 4OGAD 1JNNL 3NCYP 3LKOB 4YPJA 5A43C 4FXKA 3MODH 2FB4L 5IHLB 3ROOA 3VJ6A 5AAWA 3IFOB 1DUYA 5F1KC 1PKQA 4TUJB 2H45A 4GMSL 5DT1H 3CDGB 1RULH 5FO8A 3P11L 3C5JB 1DQQA 1EBAA 1OLZA 5CILH 3RTQD 1FL6B 3ARTA 4R26L 3EGSA 1KF9B 2CPCA 2Z92B 2XG4A 5F88B 5FDYA 3G6AA 3QXWA 3LEVL 4H88L 5FYLH 3SJVA 5F7WC 5DSCA 4XNZB 2AXFA 4FQXA 4HUWA 3GIZH 4MNQE 2YRLA 5I18H 1OTTC 4RAUB 4OT1L 1AIFA 1HHKB 2VXUH 4LLVA 4XAWL 1CBVH 3MCG1 1SEQH 4X99A 5DURB 4OFVA 3QBTB 3I6GB 3H3KA 2EE6A 3BZ4A 2JJTA 1JNJA 2HP4A 2P8MB 3RVTD 2EDLA 3C8KA 3VFNB 1BZ7B 1H15A 2APFA 4FN0A 1CDHA 4JRYB 4XPGL 2NXZD 2BJMH 3L7EB 3IETB 4G7YH 3DETD 4F33A 3MV01 3R0MA 1K85A 3CZFB 5HSFA 1S8DA 2CKBH 3TNNB 3KLHD 2AK4A 2FYYA 1NC2D 3G08B 1ZVYA 4LCIL 1Y6MR 5EZOH 4D9RE 2EH8L 1M6OA 1CICA 1B9ZA 1U6AH 3RUGE 3MV7B 5F7EH 1BQHG 3UDWC 3S5LA 5FUOL 2X44D 3K2UL 3U4BH 1FCCA 4OF8A 1UH4A 4JKWA 1YQVL 1CIUA 2ADFH 2VH5H 4YQXL 3GSUB 3LDBC 1S9WB 2AJSH 4HWBA 3S9DB 5D5MF 3D25B 3S4SA 3VFTA 2YEZA 4P59H 4MS8C 2PYEB 4ZFFB 4OZHE 3BP7A 4NQTA 4Z7OE 3D9AH 4E41E 5E94A 3SDAB 1CDJA 1Y18A 3FCTA 4LHUG 4P23A 1NLDH 1V7NH 1H3XA 2RCSL 1MCCA 5F1NA 2GSIB 4JN1L 3PE9A 1P7QB 2QQLH 4JFEB 2OI9C 3U4EB 4NQEE 3G5ZB 3LIZL 3BO8B 1KB5A 3RZWA 5ICZA 3UBXA 2JTDA 5I71B 1GAFL 4JRXD 3KPMB 3AAZB 5DR5L 5JHLH 3ARBD 3WNMA 5IEKB 4KVCL 4EI6A 1V3MA 1FFOA 2VQ1B 5IB4A 1WEJL 5GIRB 2J8OA 3GHEL 3NFSL 4GKSA 2BOCB 1RUML 2DDQH 5IQ9B 4G6AD 4MD4B 1T89A 4MXVF 1CR9L 1A1OB 1YNTA 3UJIH 3C6SA 4KK9C 1IGYB 1BGXL 3LZFL 4FQQB 4YC2C 2QEJA 5AAMA 3BGAA 3DX9A 5LVEA 3DO7B 4YBQC 1KIQA 1EHNA 4QRUB 3U83A 1ZHLB 2P1YA 3CSYB 4NQCD 3HS0A 3NABH 5C0DB 3FONA 4IIQC 1D5BA 3ILQD 4DGYH 3T0AA 1NCWL 3MLZH 1BOYA 4ZNCD 1EDQA 3RY4A 3PP4H 4FQIL 5DD1H 2IBZY 3QFJE 3QQ4B 3TZVB 4OLZL 1M05A 1FJ1A 1YUHA 4LPUA 4PB9H 3VG0L 5IJVA 3B3IA 5HYJB 4WWKD 4R96A 4L1DA 4PV8B 4Y2DB 1XCTB 2JIXB 3VFRA 4QRSA 1AR1D 1EUTA 2FZ3A 5IG7B 1QR1A 3WV0A 2YZ1A 3MOAH 1N4XL 2YXFA 3HB3C 1KLGA 5FKAB 2YN5A 1A7QH 5IBLC 5T1DH 3BQUA 1F4XH 4XP9H 4KV5E 1O5DT 4PRHD 3AU1A 5GS1B 2HMIC 3IDIB 5J1TC 4JJ5A 5FUZL 3VXSB 3FFDA 3DYPA 4KK9D 1F3DJ 1P1ZA 2GIYA 3T0EC 1KFAH 4J3SA 4LARH 1CGSL 1MI5A 1UYWL 3WS3B 2EO9A 2R2EA 2HLFC 4RMUA 2AEQL 3KYNB 1NBYB 3S96A 2I5YH 4JFXA 4M8VA 1JPTH 4KI5D 3D3VB 3IJYA 5HHXH 3RDTB 4D94A 2R1XA 4P2RD 5IMKB 2V9TA 4FQJL 4D2NA 4DN4L 4Y5XB 4GQ9H 4NZUL 1AY1L 5CINH 1B0GA 5JXAL 1YECH 4L8CA 3D5OF 3L95B 5EU6A 5GRVL 4K2UH 2PNDA 4IRSB 4B7LA 3NTCL 1QSEE 2E7LA 4ELMB 2SEBA 1A0QH 3HE7C 3ZHLA 3KR3L 3V4UH 1UEYA 4PP1D 3SDCD 1ZOXA 4LAJH 3IRPX 1E27B 5LKNA 1OPGL 2AV1B 2FGWL 4P0DA 2VZ1A 2EYRB 4R8WH 1AQDA 5IESH 2VKXA 2QQKH 1MAJA 1TPXB 4EBQL 4QRRB 3FQRB 5ABDE 4OTXH 3JTSB 1UKSA 4HIXH 4X7TB 1RV6X 3R8BB 2F53B 3F6IA 2VISA 1XGTB 2ZUSA 5E2TL 5D1XC 1OAKL 5CJXC 1LP9E 4D3CH 3ARPA 3C08H 3QXVA 4OM1L 1A4KB 3TM6A 4YHZH 4LK4A 15C8H 3B4NA 1EMTH 1MF2H 3MJ9L 4XRCA 3M45A 4X9BA 3T4AB 3AY4A 1IAIM 3KYMB 4UIMA 4I13B 1VACB 3OQ3B 5IFAH 1KPRB 5IV2B 1FGNL 3QH3B 3QA3B 1J0JA 1RJLA 2HT4C 3OJDA 5FYLD 5BQ7A 4LHUD 1RZ8B 2XOTA 3N1FC 3MLSH 4WGVB 2JB6B 2NX5D 4D0DB 5IBUB 3N1GC 3REWA 1FIGH 2WBJB 3OG4B 3I75A 2BSRA 3BN3B 3VCLA 5E99H 4LCWB 3FO0L 4WFHD 5DJCB 2M1KA 2P45B 5FYJE 1JF5A 4R4ND 4MQXC 4BJLA 4NQVA 2DBLL 2VDMH 4YR6B 3RVVC 4JG1H 3NZ8A 3SBWA 5EU3A 3KNBA 1KPUB 3U46B 4W4OA 3CC5B 4O2EB 2PW2B 4KTEH 4ZDHB 3A6BL 4X6DF 1X5HA 2EDFA 3T0VA 4GBXC 2Y36L 1G9MH 4XXCC 4L3EB 5CEXB 1MIEL 4BUGA 1OB1A 3NGBC 5I8OH 2G5BB 3DV6B 3O2VH 5KSVA 3V5HA 3L3GA 4YPGA 1WCBA 1F6FB 5F7MC 4NDMB 2P5WB 4JPVL 5KAQF 1JFMA 3V0WH 3E6FA 1KYOK 5AEAA 5KOMC 1NL0H 3O8XC 4JKMA 3GJFK 1AGDA 4NNYA 1CVSC 2X89D 2VXSL 3K4DA 4NPYA 1LK3H 5ALCH 1EGJA 4QGTA 1S9VA 4OJFL 5JQHC 2YBRB 5ESVB 5IFHL 4OZIA 4Y16B 5JLZB 4MAYB 5JPNA 1J0KA 1QSFD 2F58L 3ECBB 1FNEA 4WU7A 3FFCB 5EZLA 1BJMA 5K9KA 3FRUB 1XT5A 3QHFL 1H8NA 2NW3B 1PFCA 3Q1SH 2VN4A 1FBIH 3VWKA 4H25B 2DQHL 4KU1A 3QUML 5D7IA 3LQZA 1Q0YL 3QDGE 1EXUB 1KC5L 5CFHA 3SDDC 1M7IB 4HK0B 4N0CC 3PHQA 3P77B 1G9NH 4S11A 5DQ9B 3T0DA 1TZGH 1Z5LB 2YN3A 2GY7B 1K4DA 4CW1A 5J7CC 5TFSL 2C9AA 1ZGLP 1EAPA 2ESVD 1HE7A 1JHTB 3QIUA 4XPTH 4AEHH 4PJHE 1EPFA 2EKSA 1NCCH 4OUUB 1T20B 4RDQG 1RJYA 4JFQB 1DL7L 2ZCKH 5E00B 5DO2D 2FRGP 4ODTL 1FE8L 4HPYL 4YHNA 1KPVA 4OCWH 5C0AE 5ITBH 5C9JB 3CSGA 3TIEB 3UTSE 5E9DD 4FQLL 5AD0A 2B1HH 5JOFA 4CKVX 5BW7C 4IDLA 5DQJA 4PJEA 3MJ6A 2DYPA 5D1ZC 3PWPA 4MVBC 1EJ6A 1YPZB 4HIEA 3WN5B 2QV2A 4JFPA 3JXAA 3TH2T 1T2XA 1MHHA 3BPCA 4HG4J 3GJEA 5CJQH 5I66A 2VZSA 3MRGB 1Q9OA 3OX8B 5DEGB 3QZWG 1E6JH 4QRPA 3MRCA 4G8GB 4RBPK 5EC2A 3QUZA 4TOYL 1SBSH 4LLDB 3WUWG 4F3FA 3K1DA 4FQCL 4YX2H 3VU2A 5DD0H 3PQYD 3U7AA 4RIRB 4WEBL 5CSBA 1QP1A 4HQQL 4MNGA 5FV2A 5D1QC 4FA8A 2AJVL 2H2PC 1IC5H 1B0RB 1YY8B 2EECA 4Z7VB 1J0HA 1LO5B 3VXRE 5IHBA 5GGVH 1DCLA 2FL5B 5D71L 4ALAH 3GK8L 4K23H 3BWAA 4FTVE 4UDTA 1YEKH 5KS9B 4Z77B 4EN3A 3ALXA 1ZHNB 4XCFH 5B21A 3UYRL 1KCGC 2VIRA 3QEHA 4TUOB 5TE4L 4M8QA 1LO3L 5E2VH 4YFDB 2X09A 4XCCH 1INQA 1NCBH 3P9WB 1TNNA 2GW5A 3QIBD 4J3TA 1XF3A 3PABB 5D1ZD 2VERN 3W0WE 5C07D 5GS0L 4ODSL 2VWEE 1WSST 5E2WH 2NMSA 5SV3A 2WINB 1QYGL 3KYOA 4MSWB 2FGZA 4ZTOL 4YDLB 4M5ZL 3CMOL 4GW1B 1ZS8A 1TIUA 3MFGB 4MA7L 1J8HB 3P2TA 3D0VA 1SJHA 1LVEA 3BDXA 3FHAA 4AIXA 1KCSH 1YNKH 3ESUF 5D1QD 1WWBX 5LJYH 3JSSA 1FGVL 2BRQA 4Q2ZB 1HEZB 4O2CB 4DWHA 4WVRA 1KENL 3QRGH 4OB5L 5LAXA 3RP1A 5C2BL 4OGYL 3BP6B 3G6DH 3HG1E 1MFAL 1BD2B 4GLRH 3KPNA 4K7PL 3FQTA 2FIRT 3SPVA 4OZFB 5IJKA 5IF0B 3IAGC 3W5NA 2CUIA 2W65B 1G9MC 5HDLA 2YA1A 1LD9B 4PREA 2RAMA 2R4RL 1W72L 2ZOKB 3NACL 3W81A 5J6HB 5BXFB 2YK1L 3OAUH 1NJ9B 5GRWA 1WF5A 4JFFE 4YDJB 2AW2A 1JNHB 4WJ5B 1Q9WA 2V17H 3ARDD 3MJ7B 1DQLH 4AK1A 1HHJA 5F70A 5D7JB 3HPJB 1BM3H 3KPSB 4Q9QL 3KYAA 5KG9A 3TVMA 3VXUB 4BELD 4PLJC 5E6YA 2VDQH 1OW0A 1R3KA 4GH7B 4Q6IB 2Z91B 2P7TB 4EJ1C 5E6ZA 2XZQL 2AXGB 2VDLL 4P3CH 2ADIA 2OYPA 5D5MB 3ZKQD 3IU3B 1D9KD 1VADB 4NM8H 3MRKB 3BD4A 1G0YR 1G9NC 3KPQB 2GITA 4ZD3L 2E5EA 5DDHA 3VFSB 1KN4L 3VE0A 4WW1B 4UDUB 5AZEL 4Y8AA 1PSKH 4RFOL 3RZCC 4JGMA 1ZT4B 3S36X 2BNRB 3DMMC 4F57H 2P5EB 4PJ9B 3VFGL 3RTQA 1FSKC 4LCYB 3LQMA 5FA4A 3QUXB 2AGJL 1OP5K 1AI1L 1PLGL 3GB7B 3EYSH 3QCVH 5I6XB 4U6VL 4XMKH 1A7PL 4XHJD 2ICEB 3KJ4C 3MNZA 5HPMA 5IP4A 2EE2A 3RQ3A 4P2QB 4JM4L 4MQ7A 1CD8A 43CAA 3BXNB 5ENWA 4MCYB 1IRAY 2A2QT 3UX9B 5HI4C 2JJVA 1DBAL 1UGNA 2JELH 3KPRB 3GMLB 4L8BB 1M7XA 2HFEB 1X7QB 1W72B 4S2SB 3VDAA 3BD5A 5DJ6A 2VE6B 2Z93B 8FABB 4NQDB 3NZHL 1HQRA 2C5DC 3H42H 3IXAB 1MRFH 3U4AA 3VFVB 5DK0B 2VLKA 4OQTA 4L1HA 1AKJD 1MCRA 5I1IL 1R3HA 1U8OA 3GBLA 5C08B 1I8IB 2G75A 2EIBA 4LLWB 1KEGL 1N8ZA 5HDOA 4NC0B 3O6FC 1NBVH 4V2CB 2QR0B 1G7JA 3KLDA 5ICYB 1TTFA 3D1MC 1AGFA 4XNUL 4Z7WF 2AEIT 1FH5H 2DQGH 5TDOA 4OD3L 4HS3A 1PQZA 2IGFH 1MJ8L 1KOAA 4Y4FD 4YHMH 4F37K 3BJ91 5DUMH 4P4KB 5JW5B 3LEYH 1GPOL 3PWJB 2YMXH 1OARL 4I2XA 4PIRF 1ZA6A 2M26A 1T21A 3VFMA 1DBMH 2R4SH 3RL1A 1HKLL 4H8WL 5ADOH 3CFJA 2QL1A 3BPOC 1VENA 1T4KA 5IWLA 3D85A 5L88L 4LP5A 4JRXA 1ZVSA 2NTSP 4WNQB 3G9AB 3OKLB 4LVHC 1B88A 2VLJB 1AFVL 1EO8L 1IQDB 2WAHA 4DEPB 2BY3A 2G2RA 2BSTA 5D6CB 1FYTA 3C6LC 4K7PX 2VMFA 1NCDL 3A0OA 3VD3A 2C4FT 3VFWA 1N5YL 4JREC 4YXKL 3PL6C 5BVJB 3LKQB 2EC9U 4LAQL 5EWIH 1PEWA 2DN7A 1DFBL 4ISVB 5GGQH 3ZE2E 1IQWH 1MHEA 1T5WB 2IG2L 2XWTB 3WS6A 4F7CB 4PJ7A 5HHVH 1MEXH 4GLRI 3WNNA 1R3IH 4P5MB 2EEAA 4PJ8C 1MVUA 3BMWA 4WI6A 4JQVC 5MEPB 2VDNH 1HHHA 5CP3H 4XXDA 4OFPA 4ODXA 1NGPL 5SWSA 3LN5B 4WHYH 5C0BD 4MD5B 2APWA 1P4IL 3HI6L 4LMQE 2N4IA 4HH9B 2EDOA 4IOIA 2F9BT 1H0DA 3SE9L 1CE6B 4JHAL 5HHMB 5ESAA 3T3PE 4DN3H 5J12B 2AV7A 3MO1B 3DJ9A 5D8JL 3VFUB 3CVHA 2Z4QA 3FJTA 1WLHA 3AREC 2CLZA 4MCZA 2GJ6D 2F74A 3WL9A 3GKZA 4LLUA 4UT6L 3GSNH 1MFDL 3C6LD 1N26A 1OQOA 5JW4M 3O3DA 3FB8B 5ANME 1U8HB 5DFVD 1QA9B 1R6VA 2WIMA 4W81A 1MY7A 1A3LH 3BEVA 4JG0L 2YA0A 3U36A 3EAKA 3FQWB 2R69L 5FOJA 4BZ1L 3EO0B 4LSDA 5CBEA 2GQHA 3AFLA 2GHWB 1YMME 1GVIA 1JZ4A 5JW3L 2VL4A 4JFYB 1MRCH 3CK0L 2WBKA 3O4LA 4LSQH 5HY9B 3WJLA 4L5FL 4OD1H 5ERWB 3O6ML 4X6DB 4RAHA 1DVFA 4OUOA 2J5LB 5AWNH 2HWZH 4N8VG 2RBLA 1UG9A 1RZKC 5T33L 4MXQD 4WO4A 2DQJH 4CVUA 4OZHF 3BKCH 4Z7OF 5E95B 2HKHL 2NXZB 2FDBP 5DGRA 4WDIB 4L3AA 5HHQA 3BPLC 5C0GA 4MZ2A 4J1UB 3EOBA 1QBLL 3LB6C 2EH7H 4X4YA 1ZANL 4NGHL 1JJUA 4HBQA 4P5KA 2IQ9H 1A2YA 2ZOLA 4RAVA 1S7SA 4WHYG 1FVEA 4UU9B 3L3IA 2D9QB 3CFDB 3HPLB 4X80H 3KXFE 4HUUB 5ACZB 3MNVB 1U92B 3S88H 3E0GA 4KTDH 1M71B 1VDGA 1WBYB 1KT2A 2JJUA 3P0VL 1MWAL 1FV1B 4C83A 2Z31A 5TPWH 3SKOA 3U0TA 3ULSA 4PR5B 2VWEC 2YD7A 4M5YH 3GBML 4IHOB 3NPSC 2VLLA 5H35B 1DBJL 3KAAA 5BMFL 4LSUH 3KPPA 5FO7B 3WIIL 4MD0B 3MRIA 2X4UB 3ZKMD 4LASH 4C56B 5E6ID 3WLWD 4OLEA 4LRNL 1ROWA 2BC4B 4OCMC 5J6GA 4UT9H 1NCNA 4JRWA 1NEZG 3DSFH 5EC1B 1C5BH 5CSZB 5C0ND 3SOBH 1Q9KB 5DJAB 3MUJA 3VI4E 4XPHH 1OP3K 4HGKC 1XH3B 3T0XA 5DUBB 3KPTA 2AJUL 4PJAB 5B39G 4ZNEE 4LHJB 1MJUH 4FQHA 4NZJA 4TVSa 3F12A 3LPGA 3PG2A 3ARBB 2GJJA 1WUNT 4KI1A 3OB0K 4NJAL 3GMRB 1ZK9A 5TQ0H 3Q5OA 3JWNC 3AGVA 2V7NA 1UCBL 2HG5B 3QDMD 1N2RA 3QG7L 4XC3H 3B9KC 4U1IB 1BEYL 2W60B 2H3NB 4N0UE 3AS0A 2VDRL 4D9LH 1MAKA 3RVUC 1OWRM 1WC7B 1W8OA 5L2KA 4LSPH 4QWWD 4KV5F 5LBSL 2OL3H 3P30H 2OTPA 5HJ3A 4NQCB 1E28B 4K3JH 4M1GH 4HFUL 5DTFB 2AS5M 1MCOL 1I4FA 4QYOB 4N8CH 4ZO6A 4JB9H 2A73B 5F88A 1SY6L 3QCTL 4PBVC 3U7YH 1UKTA 4FZ8H 4PP2B 3OGOE 1GZPB 3PJSB 3DECA 1MWAB 3GMQA 1QRNE 1VGEL 3MLUH 4JFZH 1K5NB 4YWGL 5ISZA 2Q7YA 3ZSSA 2ZUQC 4MJ4A 1F00I 2V2XB 3KPLA 4OD2B 1PJ9A 4KUZH 2OI9B 3BH8B 3MODL 2NLJA 1JV5A 5T1MB 4NNXA 3ES6B 3OKDB 4KJQC 2B39A 1ZVHA 4LEXH 3ZLQC 5D7KE 3PV6A 4PJIE 4UAOB 3NAAH 3MJ8B 3U2SB 1BZ7A 4JRYA 3AB0C 5DT1L 1RULL 4Z7QE 2ICES 4IOFC 3L7EA 5HGBB 5CILL 1YEEH 3B9KD 4PRHB 2D7MA 3FQUB 2HN7A 2ICWI 3DRQA 1UH2A 5FYLL 3G08A 2VXVH 3GGWA 2D31B 2H26B 2J4WH 4YC2B 5DRWA 5IOPA 3GIZL 4HMEA 1BOGB 5I18L 3P73B 3C9NA 1LP9F 1WT5A 4M61A 1CBVL 4IIQB 1SEQL 3I3EA 1I1CA 1HIMH 2W1NA 4LPYA 4U33A 4FRWA 4BZYA 4P2RB 3PHOB 5E9DA 3SCMA 4IRJA 4X6EA 4D8PA 3GJFA 1IL1B 4X6CE 1NFIA 1RUAH 3FO2B 3EYOA 3PGCB 4JZNB 1AGEB 5GGUB 2CRMA 4D9QD 4J4PC 1A6UH 2BJML 4Y19E 3BKYH 1XGUA 2PYEA 4G7YL 1BZ9B 4HIIA 1I9RH 4PJDE 1FL5A 3U0PB 4QRTA 3SDCB 2CKBL 3CFCH 4PRAB 1G7QB 5AYUH 5HI3C 4KJQD 1P7QA 1YMHA 3GI8H 3G5ZA 2XA8L 1U6AL 3BO8A 1K3ZA 1IVLA 1BFSA 3DLQR 5F7EL 1IM9D 4C4KT 2CK0H 1BQHB 4IOFD 1XGRB 5IEKA 2ZNXA 3REVB 3HMXA 3HC4H 3F7PC 3VDCA 2OP4H 4IJ3C 4PRPE 4B41A 3Q2CA 4R2GD 3SKJH 3ZKSD 1EO5A 2ADFL 2VH5L 5C0JA 3IS0X 3UO1H 3BVNA 1F2QA 2CLVB 2BNQD 3BZDA 3HC0B 4GUPB 4RA0C 2X4SA 2B5IC 4G8EB 3BT2H 4P59L 3L9RB 2VLRE 4HZAA 3D9AL 5JZ7C 4YHLH 4QXGH 2NY1C 3N9GL 5ID1B 3WJJA 1V7NL 4L4VD 4LHUB 5C0DA 5FEBA 4OKVA 5DWUL 3ALPA 2NX5B 1MY5A 1K4CB 2QQLL 4LQFH 5CKAA 2OCFD 1KTDA 3QQ4A 5EUKA 2V2WA 5JHLL 4JFHD 3TZVA 1KTLA 3TBWA 5F72S 5SWZD 5C07A 4ERSH 2O5XL 3LN9A 3MGTB 5EBWB 4P5TC 3HE7B 4ODUB 1DQJB 2FECL 2DDQL 2ARJB 5T5FH 1I1FB 3I6LE 1FZKA 3UJIL 2R29H 3SQOH 2MWCA 4J3UA 3BWUC 3BH9B 4ELKB 2G9HB 2VTFA 2Y06H 4Y89A 3IF1B 3QPXH 3WDIA 2CKBB 3DVNA 4M02A 4E42B 5D1XB 3NABL 4M43H 4PJHF 1IC1A 3N50A 1CZ8H 4DGYL 4IBLT 3MLZL 3OKKB 3X13B 4XH2B 3PP4L 5DD1L 1MRDH 3QNYB 3IDXH 4PB9L 4HG4K 4LMQI 5TDPB 4DZBB 1U8MB 4U4BA 3MZTA 1QSFB 5IW3A 2CR3A 4KKBD 1BLNB 2P4AB 4R4BA 3X11A 4GS7C 3MOQA 2UV3A 1N64H 2X70A 3MOAL 1A6VH 2NNAB 4OIIH 1RIUH 4IOSD 1A7QL 1R5IA 5T1DL 1F4XL 4XP9L 5IB1B 3ULVE 3DGGA 4HJGB 1JPGB 1OCWH 1YEIH 2ESVB 1LK2B 1NGYB 5FGRA 4BH7A 1T1ZB 4LNRA 2E9JA 2A83B 3RWDB 1IGFH 3BE1H 1RQ5A 2EYRA 4GBXB 3RGVA 2AABH 4WI4A 5CEZD 1ADQH 2H9GA 4ZS6D 1KFAL 4JHWH 4LARL 3BDYH 3FQRA 4Y5VB 2OZ4H 4OZ4B 4PJFE 4X7TA 2F53A 2PXYD 2OR8A 2I5YL 3DIFB 1JPTL 3FO9B 1U91B 5HHXL 3O8XB 4OIBA 2EDJA 1IGJA 3MRNA 5HGHB 1NBZA 1NUDA 4GQ9L 1T0PB 4QOKE 1BPVA 1YECL 4K2UL 2X05A 1JGLH 1RIHH 1IJ9A 1VACA 2YD6A 1A0QL 1JMZA 4NO0D 3V4UL 2PO6A 2YPLB 1AO7A 3QH3A 4R0LC 3TO4A 2XWJB 1RZ8A 3KPOB 5LXGH 4O02H 4XC1H 5KSUA 3SDDB 3FO1B 2OQJB 4U05A 1XIWD 4R8WL 5CMAA 4JDZB 5IESL 4Y2OA 2QQKL 3KLAA 3PQYB 4OTXL 4LCWA 3MV9D 1PKOA 1S5IH 1S7VB 3MRBB 5JIHA 5I8KH 4GRWB 4WRLA 4YDIH 1K2DB 5K59E 4D3CL 1G7IB 3C08L 2FX9H 2JJSA 5I2IB 3QWQB 4X7SH 4YHZL 5ADPH 15C8L 2IQAB 3FQNB 3HNSH 1EMTL 1MF2L 1P53A 4YNYB 2C1PA 4PLKC 3OAYH 1WFUA 2PW2A 4I3GA 1QLRA 8CGTA 3PDOA 1HILA 3QEQD 4GW5A 5IFAL 1ITCA 3DV6A 1C12A 4PY7B 3VWJD 3ARQA 3ULUE 5KVDH 3MLSL 2FO1A 1E4WH 1F4YH 1NUGA 5D1ZB 3R8QA 3TEUA 1FIGL 4PRIE 3DV4B 5DJ2A 4HK3J 3CAFA 6CGTA 4PJ5D 3H3BC 5E99L 3VFPB 1XCQB 1F3JA 3GUTB 4N68A 3EDDA 3ZKXC 3EDJA 5F9JA 1CFNB 1BFOB 2K3TA 2OBGA 1P5VA 5IT2H 3FRUA 3QG6B 3IDGA 3H7BB 2VDML 2XICA 4H0IA 3LKPB 1FVDB 3HAEH 4JG1L 1WGOA 4NP4L 4LU5H 4X83A 4LDLB 3TN0C 3OV6A 1EXUA 2R2HA 1JPST 4I4WB 5HGAB 1F4WH 4HK0A 3MV8A 1G9ML 4I1NB 5D1QB 5FB8A 1GZQA 1WIUA 3O2VL 2CXGA 3X3GH 1SYVB 3BYYA 2QSQA 3ZDYE 3V0WL 4RNRB 2DMKA 4LOUC 3MNWA 1NL0L 1LK3L 5C9KA 5ALCL 4PLKD 43C9B 3ULVH 3RNQB 3C2AH 2BDNH 2ZNWA 3PWLB 3VG9B 2HT2C 4WUUD 5C0FB 4D0BB 1CI5A 3VXME 3P9MB 4OSUH 3VGFA 4XVUD 2Y7QB 4V3EB 1U3HD 3JZ7A 2NY2D 4LQ1A 3ARDB 3Q1SL 1FBIL 4KK6C 1B3JA 1D6EA 1T3FA 3RIAF 4JR9H 3VI3E 1NDGA 1A6AB 4N5EC 3HTLX 4LSRH 5C8JB 1G9NL 1I75A 1TZGL 5EU7E 3WBDA 3ARGA 2NY5H 1A4JA 1JHKH 3F7VB 3MX0A 4K7PY 4XPTL 4XNMB 2D4DA 4AEHL 3MREB 1NCCL 3GSRB 4LVNC 2ZCKL 4JM2C 3UJTH 3C60A 5KSAD 4APQD 3KDMB 5SX4I 4K8RD 4RIRA 5A1AA 4OCWL 1NANH 5ITBL 4O51A 5D7LB 3HAEG 1FYHB 4XGZA 1S9XA 1B0RA 3S35H 1RURH 2ADJA 1YEGH 2B1HL 2Q86A 3QUMA 1H8OA 1EFXA 1IGIH 2ICWJ 3VDBA 4JY4B 3TJEH 1KGCE 1X5LA 3O41B 4Z77A 3NPZB 1D5ZA 2CSPA 3QISA 3PDDA 1J7VR 4YHIB 1QNZH 5CJQL 1FO0A 2FO4B 4GAYB 3VXNB 1E6JL 6FABH 3QZWB 4KK6D 4ZUUB 1Y0LB 2VZUA 4WFFE 1NCUA 4TPRH 1SBSL 4LGSB 2ZP0T 3WUWB 4X8JA 1IM3B 2AJXL 4YX2L 1UC6A 4UQ2B 4NOBA 4XZUB 5DD0L 4NRYB 2E6PA 2E9BA 3ULUH 2WV3A 3MCKB 1IC5L 3C8DA 5GGVL 2QSCH 4ALAL 1AKJB 4PTTA 2NYYC 4DZ8B 4YH6A 1YEKL 1C08A 2O5ZH 1J8HA 4G80A 1UCTA 2V2TB 4XCFL 2DQUH 1DBBH 2IMNA 4LF3A 5E2VL 3S37X 2ZCLH 4FMKA 1EBPA 4Q2ZA 3G9VA 4Z0XA 3ZZ1A 4P57A 4ZQKB 4BFBD 1NCBL 4ZFZA 3T1FA 3VGEA 3VXPA 5ALBH 4K9EH 1FSKB 5K9JH 3E2HA 2LAGB 4EQ3A 1LMKA 1C1EH 2HAZA 3Q5YA 4OZFA 1RK1B 3KJ4B 4R7NB 3ABZA 3MUGB 5E2WL 4KVNH 5FYKU 3ZE2F 5EIQA 3ARVA 5DRNB 5BXFA 1S9YB 2JCCB 4P2YA 3MRHA 1HHIA 1MCPH 2X1QA 4YDJA 1V05A 4ZFOL 1BWMA 2DQCL 1D5MA 2AJZA 3VRJB 3L5WB 5D7JA 3QUYA 1I1AA 2IANA 4L4JA 2CLRA 5DRZB 2E27H 2ATKA 3TGXA 5J13C 4NUGH 5DJYB 3HNTH 1KCSL 1YNKL 4TVPD 3X14A 3U7WH 4UT7H 2CH8A 1R24B 3QRGL 2FJHA 5IW6B 2I9LB 5HHNA 5D9SA 3RWCB 4KHTH 3T3PF 3G6DL 4OZGE 3A6OA 3JV0A 4PTUB 4HGWB 4J8RA 4LSVH 5E8EA 3SEPA 3BZEA 3RX5A 4YGVA 1K8DB 3UTTD 3RVXC 5BZDA 4U31A 1HHGB 3VFSA 3OAUL 4F7EB 2RFXB 5FA3B 4HJ0C 3RWHA 1AD9A 3QI9C 3HUJE 2IAMD 3OBAA 1RZFL 2V17L 1DQLL 3SO3C 5F9AC 3ULVC 3EYQD 3G04A 4R97C 3MBED 5E08H 1TVBA 3U30C 5K9QG 1BM3L 5IVZB 3CX5J 1GL4B 5C0BB 2VDQL 3L3KB 1L9NA 3RY5A 2D4FA 4P2QA 1ZLWK 3R06B 3JUZA 3RWIB 1I3RB 4P3CL 1RJZA 3WXWH 5JIPA 1NKRA 2HT3D 3KPRA 4NM8L 4L8BA 3PIQA 2HFEA 3BUTA 3LCYA 5IBTH 3K81A 1W72A 5C0CD 2NY5C 4LVHB 5DJDA 4AMKH 4RFEB 2GJ6B 4ZFOB 4AM0A 1PSKL 1P9MC 4JY6A 5DK0A 4F57L 3C6LB 3B5TA 1KEMH 4ZUSB 2D9CA 1J12A 4PJBE 4U6HB 4YHYC 3EYSL 3QCVL 3PL6B 5D7SH 3O9WC 5DMGC 3ZTNH 5T3XE 4XMKL 1G9EA 4RGND 4BM7A 4U6XA 1NANI 2QR0A 1S78D 1JRHI 3EHBD 3RPIB 3V2AR 5ICYA 1QTYT 5I8CA 1LEKB 2Q87A 3GMPB 3Q3GB 3OKOA 2C4XA 1ITBB 1VFAA 4PJ8B 3ET9F 2JELL 1MNUH 1G1YA 3UTPE 3F7YB 2APVA 1IGMH 3E8UH 2HFGH 1B2WH 1UQSB 1TZIB 4PJHB 4KH2A 3L3DA 5C70A 4LLMA 3DXAA 1E4KC 4W70A 4ODWB 1IC7L 3H42L 1MRFL 4TULH 5TGBA 3VI4F 1IZJA 4UILH 5MEND 3FTGB 5IMLB 1T22B 3QJFB 5IW1B 3ORJA 3ULUC 3BESR 3KHQA 2GTWB 3W9EB 2QHRH 1NBVL 5EPMB 1XGYH 2OTWA 3BMVA 3FT2A 4KJWC 3BAEH 1MCDA 3OKLA 2FIKB 1FH5L 1NGXA 2DQGL 3CCHB 1NFDF 1I8KB 1MAMH 1AJ7H 1PG7H 2IGFL 3D39A 5IIEB 4E41D 3O0RH 1P6FA 3E3QA 4YHML 4JRYE 1CD1B 5DUML 1JN6A 3L3OA 5D72H 5DVKA 2FJGA 5B8CC 3GSVB 2GKIA 3LEYL 3PWVA 2X9YA 4Y4HA 5DVLA 2OXHA 2YMXL 2GK2A 2GCYB 4ISVA 5E6IB 2BOBA 1XGQB 3N1PC 3GM0A 2A6KB 2R4SL 1L7TH 2R9HC 3MV7E 4EI5C 5MI0B 3SE4C 5ADOL 4OKDA 5ELIA 4JPIB 3EKCA 3LKNB 5IKCA 2FJFB 3LN5A 5CIPH 2X42A 4FTVB 3W39B 4ZXBD 5F9WC 3BPLB 4XWGH 3RNKA 5SWZA 2BVTA 3TBYA 1UA6H 4PGDA 3IDYB 5FM5O 3QDMB 1KJ3H 3VGGA 3MXWH 2C3XA 5HHMA 5ACLA 4PGZA 3MO1A 4PJIF 5CP7B 3C5ZC 4FS0A 4YFLI 3V6OE 4XCEB 5T3ZD 1IAII 1INEH 5GGQL 1IQWL 3T08A 4JFEE 1KXTB 4G8FA 3WO4C 3P9LA 5HHVL 1MEXL 3QQNA 1QFPA 1R3IL 3NPSB 3QXDB 1J1OH 5EU7C 3OHXB 3MLXH 4F2MB 1U8HA 1X5FA 1PBYA 1QA9A 1FIEA 2DBJA 5JORB 4YO0B 1S5HB 4P99A 3DBXB 4JM2F 4HEPG 4UBDD 4MJID 1F58H 1QPXA 4JGJA 1EEYA 1XF4B 3CLEH 2XQYG 5DJXB 5T3XH 1OTSD 4F9PA 4KZDH 4DN3L 4X6CF 2D03H 1XR8A 1U9KA 5SWQA 1YN7A 1KCVH 5I8EB 2GY5A 1IKNA 3IFPB 4HKXA 3TA3C 3QWRD 2B4CH 1LEGB 4PJDF 4X9FA 1D5XA 4G8IA 4PP8C 1H3TA 2IFGA 5F3HB 3GSNL 1BAFH 3B9KB 3MRRA 4P2OA 4KXZH 4J1UA 2VKWA 2I9TA 5HYJE 4LDOB 1A3LL 4Y5YB 1ZWIB 5F7DB 2VUYA 2FCBA 3HPLA 1FG9C 3P4OB 2HJKB 2P8PB 5ACZA 1XF5B 1BBJB 4WFGD 2XWBB 3UPAA 3LSOA 2OTUA 2VDKH 3BW9B 3WFBH 1MRCL 4PB0H 4LSQL 4MWFB 4CL7A 2F54D 5JDSB 4OD1L 4FP8H 5LGKA 2KUTA 4ZAKC 2HWZL 5DI8A 5AWNL 1WZLA 2ENSA 4N8VB 2W9DH 1OGAD 2BY0A 1Q8MA 2DQJL 4G6MH 2RR3A 3RY6C 1KLUA 3ZSTA 1AD0B 2IPUG 3BKCL 3NMEA 4UQ3B 2HRPH 4C56A 4CBPA 2X9WA 2H32H 2P44B 3VXSE 5GZOC 4HT1H 2BC4A 1RZGA 2EH7L 2IQ9L 4CVXB 5FYKE 5DJAA 5B38A 2EZ0C 2NQCA 2M2DA 4GMTH 3TNMB 2A6DB 3EUUA 1FNSH 3ARFD 4X80L 3GMOB 2EXWD 1OD7A 3D3VE 1IM9B 3S88L 1RZIB 1MCSA 1AGCB 2FD6H 4KTDL 2E9WA 3F6LA 1CT8B 1A3RH 2DS4A 2J6EH 5TE7H 3MTRA 5TPWL 2EXYC 1T7XA 7CGTA 2HG5A 1G7PB 5GGTH 4M5YL 1OHQA 2K7PA 2H3NA 2DMBA 4WV1C 1UZ8B 4LSUL 3QJHB 4F80A 2CKNA 4ELME 1WIPA 2C3GA 2BNQB 1WC7A 2KH2B 4LASL 4N0RA 3UAJD 3UDWA 1ED3A 4BSVA 2BFVH 5B4MC 3QEQA 5GGSA 3LPFA 3DYOA 3DSFL 4L4VB 1C5BL 1NEZB 3VWJA 4YBLC 3SOBL 5ETUB 4QRRE 4LCUB 2XTJD 2EYTA 4XPHL 4A2MA 2EDKA 2IPKB 4FHBD 2CRYA 4KDTC 1FZJB 3TFKC 3OKMB 5B39B 1MJUL 3VXTB 3NIDE 1PX3A 5E2UH 1CL7H 1DEDA 1NCAH 4V1DD 5HHOA 3FZUD 4MS8A 1MWAA 3T4YB 2H1PH 1HDMA 4LBEA 5TQ0L 3CMGA 1MCIA 2NY3C 3RHWF 4PG2C 4XC3L 4N90D 4NJ9H 2V2XA 2ED7A 4OD2A 3NA4A 3S3PA 3BH8A 3JVGC 2OI9A 4K7FA 4D9LL 1HNFA 3VW3H 3ULVF 5INDA 5JHDD 4LSPL 2Z8SA 1CCZA 4GG8A 4ODHH 3MA7B 4M3KB 3O2WH 1KTKE 3MACH 3V7MA 4K3JL 4LFHG 2VZVA 1S9KC 5GSVB 4X7FC 4N8CL 4LCWE 4JB9L 1U8IA 3MOBH 3U7YL 4FZ8L 1CFQA 3P0YH 3GI9H 2DQEH 1VESA 4PJFF 3MLUL 4JFZL 1J18A 5B4MD 1BOGA 4WUUA 4UNUA 3P73A 3KJ6H 1BFVH 4IIQA 1DQTA 3FN3A 4Y4KD 3LRSA 1WTGT 4KUZL 1T5XA 4XBGB 4L3EE 1FZOA 2EIZA 4LEXL 3O3AB 4KKAD 1EAJA 3CU7A 4CRPA 1MCKA 2P5WE 3FO2A 2YHGA 1A7NH 1FNAA 4P5TB 3NAAL 4AT6B 3OKNA 3JV4B 4EVNA 3CH1B 1OSZB 2DF3A 4NSKB 4K07A 3AS3A 1YEEL 4YHKH 2NZ9D 1B4RA 1PZ5A 4NN6C 1J05B 1SY6A 1JGUH 3QDJD 5DYOA 1ZT7B 1TETH 4P49A 2J4WL 3ILPB 3SDXB 2B4CC 3FFCE 5D2NA 3QHZH 3FT3A 3W11C 3V8CA 2Q76B 2EDEA 1ONQB 1CD0A 4UV7H 1P4LA 12E8H 1BQHA 3IDMA 5K59F 1DQMH 1XGRA 2PXYB 3H9SA 5FYKH 1YYMH 3REVA 1TMCB 1HIML 3HI5H 1OD9A 2F5BL 3QDAA 4XNQB 5KSBB 2HFTA 5D2LB 3AROA 3I50H 1RUAL 2OL3B 3VRIB 2I27N 3OXRB 3T0EA 4BFGA 2A6JA 2CLVA 4GUPA 4DUWA 4H5SB 4G8EA 1A6UL 3ULUF 3BKYL 1I9RL 3OF6D 4S0SD 5CLTA 5IR1A 4NO0B 4KRMB 1P6AB 4GS7B 5E1AB 1XR9B 3CFCL 5CEYA 4G9FD 3OJVC 5AYUL 2B20A 4R4FH 4OAWB 1BVLA 3GI8L 3OJ2C 4I0PD 3QUKB 3DVGB 4P3DA 2MNUA 5CGMA 1YY9C 1A1NA 5C1MB 4JFDA 3L5XH 1WAAE 1A6PA 1C7SA 2CK0L 4OCSH 3SKMB 3O11A 3HE7A 4PRNA 3HC4L 4R7DB 2AXHA 3T2PA 5FF6B 3LKSB 2OP4L 5KN5A 2FR4B 1YPZE 3SKJL 1V5JA 4JO4H 2D7OA 3ZHKA 4XPAH 1KIRA 4HKZA 4JVPA 2ZJSH 3UO1L 4ZG1A 3W11D 2YWYA 3ARUA 2X10A 5DRXA 4G8GE 3BT2L 4HWBH 2G9HA 4L4TA 3ZDYF 3IF1A 3RL2B 4YHLL 2CKBA 4JDTH 1ACYH 4QXGL 5CJXA 1VEPA 5MEQA 3HE6D 1QBBA 3IKCA 1RHFA 4LQFL 3TO2A 4HZLA 1SHMA 3IJSA 4U1SA 4HC1A 3QNYA 1RU9H 4Z7VE 1KB5H 2PW1B 1ACZA 3E6HA 1JF1A 3WEXB 4PJXF 5TDPA 2BVQA 4ERSL 5H94A 4YFLF 1EH9A 1U8MA 2JE8A 1NMCC 5KS9E 3IS1X 4R0LB 2NY0D 3KXFB 3SDAC 5T5FL 4RMWA 4U7MA 1ZT1A 2WUCL 2Q20A 2R29L 3HG1D 4Z7WA 1CL7I 5I71C 4HKJA 2M8XA 3O45A 35C8H 2Y06L 2BERA 1QVOB 3RIAK 3QPXL 1R5WB 1S3KH 4BSWA 4M43L 1JUFB 5BS0A 2KQNA 4KRPD 3TCLA 1AGBB 4NYLA 1CZ8L 3EOAB 4JCLA 1J5OL 3FB6B 1VKXB 3G6JB 3FT4B 2D7NA 3T1WA 1MRDL 4U1LB 1YC7A 1I1YA 4XXCA 4LCCC 3MQIA 5CGTA 2ENYA 3QEGH 5DMKB 5HYQB 3IVKA 4K3EH 4OZ4A 4QNPE 1U3HB 4HKBA 1A22B 2NY2B 5F6IC 5C09A 4G3YH 1DDHB 1VFBB 3MLTB 1U91A 2XFXA 2YPVH 4WI7A 1N64L 1A6VL 3H8NA 5GISH 3S4SG 3V5KA 4OIIL 3JV5A 1RIUL 1EEUA 2XG5A 1BHGA 5E8NB 5GRJH 4N0UB 5HDBE 1T04A 1NFDB 4U6TA 1BD2E 2C3WA 1I8LC 1OCWL 1YEIL 2GI7A 5DVOA 1HCVA 4O5LH 2XRAH 5DS8A 2YRZA 2YPLA 1NAMB 3UBXG 4NT6B 4OF3A 1DSFH 1IGFL 4GRLD 3SDDA 3BE1L 4N0CA 3MYJB 1DJSA 2AABL 3RX7A 1G7MB 1ADQL 5KSAB 4APQB 4JHWL 1MFBH 1JFQL 1FFRA 3BDYL 5E4IA 5D93B 1X5JA 5E56A 2OZ4L 4GRMB 4P46D 1I9IH 25C8H 1QFUH 1T6VN 3NN8B 3BGMA 4NO5B 3KPSE 3X3FH 1E4XH 2PTUA 2DICA 3VXUE 4MNQA 2X7LA 4M93B 2H8PB 1OL0A 4U0QB 3P3YA 1MFCH 1H8SA 3TYGH 4DGIH 2IFFH 3QFDA 4GT7A 3VXQB 2WIIA 4Y1AD 2OSLA 2W0FB 1CXIA 4FQXC 3WNPA 5EBGA 1JGLL 1RIHL 3QQ3A 4DCQA 5D5ME 1OQXA 3N0PB 4J3OC 3HHRB 4IDJH 4PY7A 1TCRB 4KHXH 4NO2A 5EO1A 1CXKA 5BW7A 4X7DC 5LXGL 3D0LA 4O02L 4XC1L 3RDTC 2X4TB 1QQDB 3CUPB 3U9UB 4M1CC 4MVBA 5DK2A 2ATPA 4Y5XC 1SYSB 2HJFA 2I60H 4JFOA 3ARSA 2BNRE 4X6FB 3IXTB 5BRZD 1XCQA 5T1LD 2P5EE 1S5IL 3DURA 1NMBH 4HUXB 5I8KL 4YDIL 4IRSC 1ZMYA 1KNOA 2FX8H 2XN9E 5IB5B 5DD6A 5KVGH 3RUGA 4RMTA 2FX9L 4X98B 5EN2B 4X7SL 1U8NB 5ADPL 4LVNB 3HNSL 3HLAB 1CICC 1JCKA 5F44A 4NFBA 3BFOA 1DE4B 5HGAA 4I4WA 1JWMB 2YUXA 4RMQA 3DUUA 5J06A 2E7MA 4PGEA 1TPXC 4DVRH 1MHCB 3G5VB 3CVIH 4OZGF 1EEZB 1LE9B 5KVDL 4G42A 1H3WM 3TWCH 4RNRA 2IALB 5EG6C 1E4WL 1F4YL 4LSSH 3CX5K 4OZHA 4NQDE 4KKNA 2FEDC 1A02N 3ELAT 2IH3B 4FQXD 4WWID 2QJDA 3RNQA 5C0FA 3IRZA 3LKRB 1JZ6A 4OFYD 4D0CB 1WBZA 5GGVY 4NQEA 5C08E 3LEXB 5IT2L 3DHMA 3OR6B 3UTOA 3S36H 4S0UC 2NXYD 4LU5L 3TBTB 3F58H 5GZNC 5EBMA 4PRPB 1BX2A 1F4WL 2WBJC 2YUZA 5IFJA 1UM6H 2HVJA 4ONFH 5ICXB 4U0RB 3MZGB 4NKDA 3X3GL 1GSMA 1LNUB 2AK4D 4M7JH 4WTWA 1T2QH 4ZYKB 2VLRB 5DJ0A 3QNZA 3O6KH 3JV6A 1CICD 1RSFA 3L7FA 1HSBB 3ULVL 4A6YL 1ZEAH 3C2AL 2B7DT 2BDNL 1EGJH 2PETA 4TYUA 4OSUL 1VPOH 4PJGB 1TZHB 3QFJA 3CZJA 1U8QB 1FN4A 2IAMB 3B8YA 1HXYA 4PJBF 5CCKH 1MSPA 1DANT 1T6WA 2WNGA 3BEWB 3MLWH 4I0KA 4JR9L 3T2NH 1NPUA 3DO3A 2VLJE 4LSRL 2FSEA 4MLIA 3FB5A 1U95B 2B1AH 1IAKB 4NHUB 2NY5L 3B83A 4MAYC 1JHKL 4L29B 4P23D 3LHPH 4O9HH 2CDGA 1MH5B 5JA9A 3QZWA 1J1PH 4XPBH 5GS2H 4KMTH 4ZUUA 1OAZH 1DLFH 1A7RH 4U7SA 5C3LD 1W8NA 5EIIB 1TTGA 4ZTPH 4JZOB 1KLFA 3WUWA 3U6RB 1N5AA 4W68A 1OF2B 4WW2A 1IM3A 4XPFH 5TH2A 5C0CB 4NRYA 5DJZA 2VABA 3HRZB 4DKEH 4F7PB 1GC1H 3AM8C 3HAEB 1FFNB 3S35L 1RURL 1TJIH 4JAMA 4KZEH 4PV9A 1YMMD 1YEGL 2KZWA 4L9DA 1IEBB 1M7DA 3TJEL 1OGTB 4HWNA 4QY8B 3IGAA 4RGNB 3F5WB 3LRGA 4U1MA 4LKXB 1QNZL 3A6CH 5F7UA 3D18A 4FABH 2BX5A 3RZCA 3WFCH 3LV3A 6FABL 3DMMA 1DN0A 2L4OA 1JGVH 1I8MB 1E4XI 4TPRL 1H3VA 2Y6SD 3H6JA 2NR6C 4MA3B 4R97B 4PJCB 1CXFA 4WI8A 3U30B 1HXMB 1QSEA 4DVBB 4LKCB 2CIIB 4X5XB 3V95A 1BF2A 4OCYH 1UB5A 3OAZH 3ZE1E 1QOKA 3ULUL 2YD1A 1VCAA 1K6QH 2V5TA 5L8LB 4MB4A 1JPFB 4Z0BH 3MROB 1QO3A 3CFBA 5F89B 2QSCL 5I19H 5INCA 5FKPA 5LGJB 2VC2H 4NKMA 3MLRH 5MENB 3HCVB 3ZTJH 2O5ZL 3VRJA 5IB2B 3M17B 3L5WA 4CVWA 3T65A 4RGMB 2DQUL 1UVQA 1DBBL 1LP9A 3BQUD 3T2QA 4JCMA 3PNWB 3MJGX 5CBAB 1ZLUH 4X6DE 2ZCLL 3UXFA 2XY1A 4PGBB 5CGYC 2NY6D 5IW6A 1CTOA 1II4E 2I9LA 1Z9MA 3EYFB 3TT3H 5ALBL 3OGCA 4K9EL 5IHZB 5K9JL 2OMNA 3DX7B 5I1AA 2GT9B 3PWUB 4UOJA 3O9WB 1C1EL 5I0ZA 4NRZA 1MI5D 2D7QA 3O6FA 1JZ3A 4KVNL 1IARB 1HQ4A 1ZHKB 1P7KA 4J3XA 1JMXA 4RISH 4F7EA 1MCPL 4UUJB 4YIQB 5D96C 1T83A 5HYFA 1Z0MA 1K8IB 4Q9RH 4FG6C 5T1KD 2YSSA 3BOVA 5K9OB 1XEDA 4H26A 2E27L 5EU6D 4NUGL 1G1CA 2LU4A 4JANB 4ZUVB 2VQUA 5HHPB 1U8KA 4E5XB 4DK3A 3L3KA 4HXBH 4I18B 4UT7L 4ZXBB 3U7WL 3BIKB 3OKEA 4RFNB 4KHTL 4OLUH 2DQIH 4AEIH 4YDLC 2PYFA 5EO9B 4LSVL 4AH2B 4C56E 3RBGA 1U8PB 3TJHC 2MCG1 3LMJH 4FNLH 2Z35B 4ZFOA 1CQYA 1C16B 3ZTJG 4PJAE 1A6ZA 3QWOA 4S10A 5GJTH 1IKFH 4ZUSA 3O2DA 5L8JB 3TBVA 5E08L 5B8CB 1L7IH 3PL6A 5GQBA 3O3BA 1QKZH 4ZODA 5K93A 1NGQH 3UTZB 3QDGA 4MJIB 5DHVB 1KUMA 1U3YA 3GMMB 3H3PL 3Q3GA 3WXWL 4OIAA 1G0DA 2APBA 4PJ8A