3E6HA

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pi10, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
SHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEGPEYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESDGRLLRGYWQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPARDGTFQKWASVVVPLGKEQKYTCHVEHEGLPEPLTLRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3e6hA01
5LGHL 1FNSL 3EO0A 2W9DL 3G5VB 5E99H 5EUOE 2FHFA 3IETA 4XVSH 2A83B 3F58L 4FABL 4PD4J 2ITCB 1G84A 4C59B 3VMPA 4EXPX 3AU1A 1RZJL 3NFNB 1S7WA 5C0CE 2VISB 4ZD3H 1G7LB 1IT9L 1I9RH 5K9QI 1J0HA 1T66C 2PCPB 2F5BL 3S34H 1JPGA 3A6CL 1OP9A 1URLA 4JFEB 4HGMA 3T0AA 5I8KL 1YEIL 4V1DE 3BIKB 2C3VB 4JR9L 1QSZA 2W65B 5C08E 3NIDE 3FFDA 4M5ZH 1A02N 4P5TA 5KN5B 1S7UA 3QDAA 2KZ1B 1JWSA 1CDCA 4U6VL 5FECA 1MAML 4FQIH 4U2YA 4IOIB 4D0CB 4R97C 5GGRB 5IQ9A 4LLWB 3FT2B 3TBVB 4I3RL 4G8GE 5MEQA 4UOW1 2GAZB 1D7FA 5DHYA 4DUXA 3MJGX 4KXZI 1LEKA 4PGEB 1WZKA 4JDZB 4H1LG 1IZJA 4N0YH 1RI8A 4WFGE 4XC3L 4DQOH 1ZT4B 1CN4A 5C0BD 4GSDL 2IALA 2I60H 4XCYB 3L3JB 1FAIL 1OSPH 3MACL 1TJHH 4NN6C 2A2QT 2MQCA 1PSKL 3MLXH 5SX4I 1U95B 4KVCL 3FO9B 4LBEA 2FR4B 2DMBA 4X9FA 5JIPA 3RNQA 1GCFA 1IC7L 1LE5B 3G9AB 4CDHA 2DLGA 3H2WA 1MVUB 4Y8AA 3S6CA 3NFPA 4KUZL 2CO6B 4KJYA 4WHCA 4AEHL 4QT5B 5EN2B 1MREL 4U6XB 5A2KH 2PW2A 3RBGA 3C2SA 1QA9A 3OJDB 4UQ3A 2DQDH 3IDIA 2WWMD 5FXCH 1RJYA 1ZS8A 5DQDH 1I4FB 1CLCA 4XP4H 3TNNB 4XP5H 1HH9B 4UIKH 4IRJC 1SVCP 4CU6A 5I6XC 3UTPD 2AXGA 2HTKD 2V7HB 1PZ5B 1VACA 5A2FA 2EIZB 3BZDA 5HGBB 2R0KL 3PL6B 3SGDH 4RAVA 1TQCB 3BZFB 4C4KO 3GUTB 1A6WH 4OGAC 5DRWB 4LCWB 4PJEE 3HR5B 3HA0A 3VD5A 3ZT7A 3P4NB 4Z7VB 3FHQA 1NLBL 3ARDC 4X7FC 3ZL4H 1WFTA 3QAZB 7FABL 3FN0H 3JWOH 4JB9L 2BDNL 1EEZA 1NUFA 1HILB 2HT4C 1UZ8A 4JHAH 3IXTA 5KSBF 3D3VA 2BSED 2FX7H 1B6DA 3WO4B 2XFXB 1QVOB 1GHFL 2XWTA 3LRSB 3P0VL 5BW7C 2YD2A 1GAFL 3MCLH 1YMMB 3U30C 4WW2C 3SDDA 2OP4H 5CBAB 3E3QE 3PWPD 1OT2A 4YBQD 5IVXA 4C57C 4Y5XA 2FJGB 3EW3B 2UWEA 3BQUB 4F33B 2BNQE 1KTDB 1T89C 3ROLB 3U1SH 2LTQC 3AS0A 5IBLD 1FL5A 1WIOA 2IH3A 4O02L 4CW1A 3RUGE 3WUWA 2MMXA 4WWKD 1KENH 3K0WA 3VWKC 5C6TL 4X6FA 3TM6A 3ZKXC 5DLML 4XZUA 3JBG7 3LKOB 2WBJC 3FQUB 3NA9H 4R7DB 3L3IB 1KULA 1IGMH 4JFDE 3SGKC 3S5LA 1BJ8A 1DEEA 3S88H 3RL1A 2AJXL 4M93C 1FZKB 3S36H 4KMTH 4JFXB 4HK0A 1RSFA 3BP4A 2NY7H 1I1FA 4UU9B 1KCGC 1UWEH 4PB9H 2KKQA 1LO0H 4ELMF 3UZEA 3T8XB 1Q1JH 1HDMA 4JKPH 3OZ9L 5E6ID 2R2CA 2CIKB 1UC6A 2DLHA 5FEBA 1OP5K 1F6LL 2W0PA 4PJ7A 3TN0B 2YMXL 3HC0B 2XT1B 3IRZA 1KCVH 1S8DA 2JK5A 4G8FA 1A14L 3WD5H 4TRPH 4PJFA 2I9LA 4H8WH 3DVIA 2FJFB 5J11B 4YC2B 2NY2B 4XCCL 3WFHB 2P8PA 5IQ7L 4MXQA 5MERA 1WV7T 5ACZA 4LASL 3MROA 4QCIB 2FD6L 4A6YL 5TPWL 1AGBB 3VXRA 43CAA 5IV2A 4WUUE 4EDXA 4OCSL 1I3GL 1VADB 4HKBB 3F7YB 5BV7C 1WCBB 4XBGB 3GRWH 4KJQD 3OSKA 3RVTC 3LN4B 4ZXBA 2ZWLT 3EOAB 3EDKA 5MHSE 3TA3A 1Z0MA 1MIML 3HUJE 5FYJU 4PGZA 3SDAA 3DV6A 1UXSA 5J89A 3FB8B 2P8LB 1Z9MA 2YA1A 2V5MA 3RWDB 2O61A 3X3GH 5C0EB 1I9EA 4BFGA 2QADD 4ELKB 1BQHB 4M1DH 3I6KA 3B9AA 2WSKA 2FX9H 4ODXA 2DM7A 5SWSA 4AT6A 4TVPL 3TIEB 1SJXA 2OZ4H 1MF2L 2L7UA 2EDNA 3TF7A 5ADOL 5CEYA 2A9NL 4KTDL 2A38A 4XVJL 4KK5D 3OAYK 1DTUA 4OZFG 4CL7A 3WE6B 4FQ1L 1JZ6A 5D96C 2X09A 3QDHA 4LRIC 3ROOB 3U48A 5DJ8A 4OLXH 5EFIA 3VCLB 3K2UH 3GM8A 1MELA 3OX8B 1OT1A 5IB2B 1JNJA 1OWWA 2NX5D 3IF1A 4ZODA 3AGVA 1HHIA 4G5ZH 4PG9A 1UH4A 3UJJL 1IARB 3N85L 1CYGA 5A3IC 1QSEE 1XGRA 3MOBH 3OF6D 1U8NA 4LHUD 1WC7B 3V5HB 2J8UF 4O4YL 2DJSA 1U3ZA 1FYTE 3EJYC 5L7XH 3L95A 3BMVA 4ZS7H 5ACLA 1VKXB 2P1YA 3QXAA 43C9B 5IB1B 3ALWA 4CMMB 2FB4L 3PXHA 3S98A 1NL0H 4GW5B 3C6LB 5CJXC 5ISZA 4MYWB 1W0VB 2YUVA 4C56E 2AGJH 1AGDA 5FCSH 2LU7A 3O3BB 5E5RB 4H88L 1NQBA 2RFXB 3DIFA 4TSCL 3JSSA 4FG6C 4CDGC 3ULVL 4S1SH 4ZS6D 5FV2A 2QKIB 5EOTB 1CICB 3HNTH 4NC2B 1LO3H 2BSRB 4Q58C 4O51A 4JPVH 3MA9H 4RFNB 1T6WA 4TPRH 1F3RB 2R1XB 3SKUD 5F96L 2YPVL 5EA0H 3LN5B 4M7KH 4JRWA 1A9BB 3GEWB 3VXSA 4E0RB 4ZYKA 4S2SB 1RURL 1B4JL 5DT1L 2E6JA 1IFHL 5EIIA 4XP1L 4PJ9B 3QULA 3FB5B 4XNUH 1HYRC 3SKJH 5TGBA 3DX8A 5HDBF 2NY0B 3BIAX 3HAEH 4QHNA 3VXUD 3QDJE 1AR2A 2FEDD 3ZDXE 1QLFB 15C8H 4TVPD 1N6VA 5J3HD 1MUJB 1S9KC 12E8L 1QOKA 4UILH 2P24B 4OTXL 4JM2C 5E6YA 2ADGB 1U8QB 1YDPB 4XCNA 4PJAE 4ZFOB 3ILPA 3BD3A 4HWEH 4PUBH 3IVKA 4M6AA 4RA0C 2R2BA 1UCBH 1CFQB 5ICZB 3U83A 1KJVA 5TH2B 1AKJA 3MFFA 1VSCA 4EI5C 3UJIH 4YDLC 1A9EA 1EDQA 1JNHB 1VPOH 4KAQL 5BZDB 2HT2D 4FQ2L 4NDMA 3HHRB 4BH8B 4L3EA 3GMNA 1VFMA 5FYJH 1F4YL 3VFVA 4S10A 4J4PA 5JPNA 3QZWB 4PGBA 5D5MA 4UDTB 2CGRH 3VFNB 2MNUA 3D39E 3UTTA 3ARXA 5E03A 1BBDH 4HWBL 4ZG1A 5JR1H 2D4DA 4K8RL 1MQKL 3O2DL 1IC1A 4LGSB 1IAIL 2CRIA 1YYLH 2Q76A 3ULVD 4DVBA 2JB5H 1YQVH 5ALBH 4GG6B 1T2QH 1HKLH 3L3KA 4GLRH 5D2NB 1V7ML 2IANA 3G5XA 5DEGB 4CUCA 1S78C 3HCVB 1JWUB 4KRPC 3G08A 3MBXL 3KYNA 3S96B 1J05B 4OT1L 4MXVE 1RMFL 2VR9A 4OUOA 1MIEL 3PDGA 4KV5F 4JRXE 5F70A 4DGIH 1EEQA 1T22A 3OR6A 5C2BH 4DN4L 3GGWB 1YC7A 3AB0C 1F4HA 4GKZB 3I50H 4PRIA 5I1JH 2Y9RT 4EVNB 3IU3A 2BFVH 3QT2A 4WDIA 3KYKL 1A7RH 4OZ4A 1A7OH 1EGJH 5C7XH 4WHTA 1K4DA 4JRYE 5CZVH 2IQ9H 5F88B 5JNYB 5BJTB 2PUQT 4Y4HB 4N90D 3KPNB 1NH6A 4QXWA 3L5XH 2V17H 1XMWA 2VOTA 4MNQD 1U3HC 4OI9A 4DEPB 1CLOH 1G9EA 1J1XL 2J4WL 3L3DA 3BEVB 5AG9A 4IMLA 2G9HB 1TMCA 3GO1L 3W81A 3W2DL 4MS8A 2FEEL 5EU4B 5GIRB 3TBWB 1C08A 1WAAE 4F8QA 2YBRB 5E2UL 1S9WA 3SE3A 4YPGA 3IFNH 3NIFF 2P8MB 5FKAA 4MNHA 3OGCB 3U9PH 1TZHB 4KPHL 4BQ6A 4IRZL 2Q3AA 2VXTH 4YZFE 2PKDA 5DD0L 1J8HB 1DSFL 5TE6L 2CDGB 2VWEE 3TVMA 1I1AA 5D9SB 3T4AA 2D7MA 2PYEB 3TO4B 1F2QA 4KVNL 2ESVB 5KSVA 4JFQB 2A77L 4WFFD 3PJSA 3QXUA 3CDGA 4X9IA 3T3MF 4NJ9L 5EUKA 1R3KB 5DJCA 2GYSA 4Y1AB 3TBTB 1T66D 3CX2A 3OKNB 5F1NB 1JN6A 1EZVY 4F9LA 4DGVH 1EO8L 2YUWA 4OKDA 4FTVB 1H0DB 4HUNB 1JNNL 4CU8A 5FYKU 3TJHC 1RIVL 3GK8H 2WINA 1EAPB 2BK8A 4MGXA 3HS0B 5IB3B 3DI3B 3NH7L 5AYQA 5IROC 3CFBB 1D5MB 1EK3A 3DYMA 4FQPA 4H1LH 4LKCA 1BD2B 2W65A 3U4BL 1MSPA 1CLYL 1M05B 5CCKL 3MUGB 4MQ7B 4BZ2H 2H2SC 3V5DA 4NCC1 3E6HA 4BZ1H 2DI9A 2SEBB 3CVIH 3QI9C 3NACL 1S7VA 4LLWA 4POYA 3VGAC 3R0MA 1UJ3C 3DRQA 4YX2L 3ARRA 5D93C 3WDHA 3BAEH 3FB7A 2BY1A 3CFEA 5HJ3A 2NXYC 3KNBB 4ODWB 2PXYD 4JDZA 5CZXC 3FRUA 5IBTH 2JJWA 4WVRA 4DOHE 4LEOB 1KB9K 1ZT4A 2CSPA 4MJIE 2HMID 5BZWB 3L3JA 1BFTA 4LHUG 4CGTA 4Z0BL 1F4AA 4Z7WB 4HV8A 5MEND 1IKFH 2FHBA 2W60A 1YN7A 5KTEL 2I26N 2FGWL 4LCCB 4G80A 3MRHA 2CDFB 4BH7B 5JXAL 4GFTB 1MVUA 4K3JH 2FO4B 1T83C 5KVFH 2N56A 3IDMB 4Z6AT 3WHXB 2E9BA 1GC1C 2X4TB 4QT5A 5ID1B 4U6XA 5FO9A 4EDWL 1MFEL 2BNRB 4U6YA 3SE9H 2XWJB 4P49A 1LP9F 2HAZA 4KROB 4L5FL 5F7KC 3WL9B 4G9FD 2YRZA 5D6DC 2NCMA 1JMZA 5HHMB 3QRGL 1VFBA 2R23A 5I8EB 3QHTC 5I30L 3KPRD 4PP8C 2VL4A 2DJ4A 3PWNB 2V7HA 1PZ5A 2FH8A 2EIZA 3LRHA 5BRZE 1N64H 5BV7L 5HGBA 2HT4D 5FUCC 5ESQB 3GUTA 1LEIB 5TF1L 4GRWB 1AHWA 2VL5B 5DRWA 1Q9KB 1Z3GH 4QY8A 2D3VA 3HR5A 4D3CL 3VI3E 3P4NA 5AUMA 1SBSL 5DD5L 4ZUUA 3KPMB 3D2UD 4CVUA 4I48A 3P0YH 1EMTH 3WFZA 4TN9A 4XPTL 3IGAB 4HUMB 3MV8B 2EDXA 1ITCA 3BEWB 2XFXA 1QVOA 3UTSB 5JPMB 1CDJA 2XG4A 1QHOA 5C09A 4Z78B 5EOCH 2ICEA 1KXVC 2Y36L 5BQ7A 1MI5B 5CBAA 1AO7D 5KOMC 4OZHA 3SOBL 3LY6A 5D7LB 3BQUA 4F33A 3QUXC 4JFZH 4XPBL 1E4WL 1KTDA 1IAOB 2AEQH 5HHXL 2AQ3A 1XGPB 5FYKH 3RY6C 1KUMA 3IT8D 1BZQK 4F3FB 3Q1SH 5IFAH 3LD8B 1F4XH 4PJXF 4YDVB 5KANG 1VFOA 1MJ8H 1NCUA 3OXSB 4Q74A 5IFHL 4XPHH 3VH8B 1JE6A 1NCCH 4HXAH 3ULUC 1Q0YL 4PRNA 25C8H 3QEQE 5ESVA 5JO5B 2WAHA 4AJ0A 3VW3L 5IMMB 1W0YT 2C3GA 3ARGC 5AWNL 3KPSD 2EYSB 4PJHB 3RDTB 4KKLC 2ID5A 1QRNA 4YAQB 3T8XA 5GISL 2AW2A 3QXVA 2DQHL 5TE4H 2CIKA 4K7FA 1ORSB 1QSFE 5FYKE 1LGVA 3TN0A 3ULUF 1JGLL 4CMHB 1KB5H 4XNQA 1U8LB 1S3KL 2FBOJ 4I4WB 2FJFA 1GL4B 2XZQL 3PABA 5B39B 1UVQB 1BIHA 3QXTA 4YLQT 1TNNA 4XWOC 3Q2CA 4PRHE 5E2VH 1JYNA 1K6QH 1X5KA 4QCIA 5L2KD 1AGBA 5DEFA 3DX7B 4JKWA 2VXUH 5GGTH 5F9JB 2DMKA 1OGAD 4HKBA 1J10A 5CLTA 4L4TD 4N5EC 4JHBA 1REIA 3LN4A 3EOAA 5DMJB 4NJAL 3N0PB 5I1IH 5GZND 2OTWB 4CVXB 2C1PB 1CF8H 3GM0A 3O8XB 3FB8A 1R24A 4HWZA 3DXAD 3CFCH 5I74C 3O3AB 1CLZL 1KJ2H 4P4KB 4ETYA 5IKCA 1F13A 1JGEB 3MRKA 4TTDC 1KT2B 3C2AL 3P0GB 4R0LA 3GKZA 2VKWA 4QLRA 4V1DB 4LK4A 3SDDD 4UIMB 1FVEB 3X3FH 3C5SB 3DPBA 1MHEA 2PETA 2A0LC 5F3HA 4IRSB 1YPZB 4OF0A 1OAQH 1CT8A 3WE6A 3QEGL 3CSBA 4Z77B 1UA6L 2OXGA 4JZOB 1N5YL 1U8OA 5F6IB 3IAQA 3TWCL 3VCLA 1HINL 1I85A 1IAMA 4YDIH 2DBLL 4NRYB 4KH2A 5IJVB 3T08A 2DICA 1KTLB 4AY0A 4QRTB 1NEUA 4G8GB 5M95B 4QRRD 4R3SB 3OKDA 4ESKA 1CK0L 4URTB 4OCWL 4EQ3A 4PV9B 5JW4N 5SWZB 5IESH 3ECBA 2FBJL 1WC7A 3VGBA 2W92A 3V5HA 4Y2DA 3B2UD 4XH2A 1H8NA 2YD7A 1NAMH 4FQQA 1Q94A 3C5ZC 3QUKA 4FG6D 2HVKB 3DI2B 1OSZB 43C9A 2AEPH 1CL7I 3FZUC 3K1DA 4ZAKC 5JA8B 5IB1A 4S1RL 1I7UB 4GW5A 1J12A 5DJDB 1PW3A 4JN2B 2XPGB 1W0VA 1P7KA 3H3BC 2YS4A 1JGUH 2B8OT 4K55A 1A1MB 2HWZH 5JDSB 4MVBC 1JPSL 2RFXA 5DJYA 3I2CH 3GIVB 2QKIA 5DWUL 3FO1B 5I8OL 3MBEC 1RZFH 3INUL 3L5JA 2BSRA 3VXMD 2FJHB 1H3PH 2AJVH 3SKMA 4DKFH 4N1EA 2LVEA 1I8KB 4X9GA 3Q5TA 2VZSA 1OTTC 1F42A 4JFYA 2QQNL 4E0RA 1B6UA 2OK0H 4S2SA 5KS9E 5ICXA 2OTUB 3F5WB 3AREB 2A1WL 4PJ9A 4PGJA 4X80L 2KL6A 4HF5H 2VDOL 5INCA 5I66A 4G8EB 2J8OA 4FFZL 4MHHI 1MUJA 2NQCA 3QG6B 2AJSL 2V2XA 2JIXD 1R5WB 2AJYL 2ZPKH 3LDBC 4OZGA 3BPNC 5ADPH 4EI5D 1F45A 5LGHH 1FNSH 2YXMA 4V3DB 1S7SB 2W9DH 4I1NB 4KKNA 4ZFOA 2BNUA 4LQ1A 4XX1E 3NZ8B 4FFWD 4OKVB 3F58H 3R8QA 4FABH 5C0BE 1J88A 1RZJH 5TH2A 1IT9H 3PWVA 3FAWA 2F5BH 3A6CH 1FNFA 4JO3L 5D7IA 3S3JA 5I8KH 2AV1B 4CN6A 1YEIH 4BH8A 4UT6L 3AXLA 2AV7B 2JCCF 1Z0NA 4QKXB 4XNMB 4IMKA 5LGJA 1NC4B 5CIPA 4U1GC 3QIUA 3GMOB 3GSUA 5DZLA 1WIPA 4U0RB 3RUGB 4OZIB 3BH9A 4K9EC 4L1DA 4U6VH 1MAMH 4DCQA 3B9KC 3ZTNH 1T1XB 2DQCL 1PY4A 5J4MA 4KRPD 4NO3A 3KPPA 1P6AB 2DM2A 4I3RH 2E7LC 3F7VB 3REVB 4KRNA 4KC3B 5ETUB 4Y4FC 1FCCA 4WY7L 5EBLB 3F12B 3HPLB 4JY4A 4NQDE 4XGZB 1MH5B 3FO0L 2EKJA 2P49B 2EDQA 2KPNA 4XC3H 4JG1L 4YJZL 4Z7NE 1JWUA 3QR2A 4GSDH 5H94B 1J05A 1BVKB 3MGOA 3ZDZF 5E8EB 3WN5A 4KQ4L 1FAIH 3MACH 1MNUL 2V9QA 1QFHA 4LRNL 3T0XA 5FOBB 4GS7B 5DRXB 4KVCH 2OJEA 2EH7L 2ERJC 4M7JL 1IC7H 4PD4K 1MCQA 3TJEH 3VXSD 2IFFH 2VDKL 4OLZL 2BSTB 5K9OB 3HE7A 4KUZH 3CZFB 2AEIT 3H7BB 5F88A 4AEHH 1NBZA 1MREH 1EFXB 2EDYA 4Y4HA 3KPNA 3V7AG 2QSTA 3PWPE 1NDMB 5CSZB 3UBXI 1QACA 1CBVL 2WWKT 3BEVA 2HTLC 2ED7A 3HI6L 3HKFA 4MD0A 2YPKB 3VXPB 1ZK9A 3F7PC 4U1NA 2G9HA 3LMJL 4XNYH 5BS0B 4M02A 2IPUG 1ZXQA 3V6OE 5KW9L 1IJ9A 1S7XA 5EU4A 2R0KH 1N3NB 5GIRA 3TBWA 2YD8A 2V5TA 2YBRA 4JQXA 4MJ6A 5DD6B 4MX7B 3M17B 2XKSA 5D7JA 2DYPA 5HGAB 2EXWC 3OGCA 1NLBH 4ZOBA 1JZ2A 1XF4A 4JB9H 5TJWK 2XQYG 4J4PD 2BY3A 4Q6YA 3QFJE 1FNEA 5D9SA 3BVNB 4ENEC 3TO4A 3SGDI 1OWRM 1NMBL 3P0VH 2FZ3A 5I18L 1GAFH 1IM9A 1V3LA 5LWYL 1NUDA 1MCWW 1A8JH 1QFOA 4JFQA 5L0QB 3T1WA 1I1YA 4KTEL 4MCZB 1Z5LA 1MRCL 4JHZA 3RTQD 3QWRA 1NC2D 3TGXA 4RQQA 3GMRA 1QSEB 4NM4L 1WWAX 5CEXB 3MLUL 5DFVC 1G6RB 2A6IB 3EO9L 3TFKD 4UQ2B 2RIKA 4O02H 3FCTA 4XXDB 3VDBA 1X5GA 5DC4B 5ESAB 3WS3A 1WFOA 3MLVL 2DQTL 2D31B 3AFLA 1M6OB 5DLMH 4I2XE 1GOHA 1EAPA 1HN1A 2OI9C 1J0YA 3LS5L 5IB3A 4G43B 4HFWB 3ABZA 5EU6E 2VXSL 4TOYL 2H2SD 1CQKA 1WEJL 2A6DB 4X6DB 3CFBA 2X9WA 1T1WB 3QI9D 1WT5C 1C12A 3L3GA 1YECL 5I15L 1BD2A 1HXYB 3UC0L 4MNGE 4NN7B 5HPMB 1M05A 1X4ZA 4RAHA 3MUGA 2F19L 2K1MA 3OZ9H 4Y5VC 5B21A 4DFIA 1A6ZB 4HIHB 4S11A 4DJMA 1MFBL 2YMXH 2YWZA 5CZXD 2SEBA 2MFNA 2DQGL 1J1OH 3RRQA 1NCDL 4YDKL 1A14H 1X5LA 2L0DA 3LKNA 5ID0A 2XNAB 4XCCH 4YR6B 2VE6B 1PEWA 4KK9C 1ED3A 5IQ7H 4LASH 1DUYB 1HXMB 3KNBA 3OKKB 1OGTA 4NQSA 5IHLB 2G75A 4EN3B 5EU7C 3KYOB 2FD6H 4A6YH 5TPWH 3KPTA 2NX5E 3LEVL 2GTWB 1QLRA 2EZ0C 5ITFB 4LEXL 1P69B 2VLJA 1U6AL 3ULUL 1NGWA 1M7XA 3O9WC 4PJAB 3MV7A 4PJIE 1MIMH 1CGYA 2XQBL 3DMMB 3SDXE 2FL5B 2OL3L 3WHE0 3RPIB 5SX5H 2UZIL 2B0SL 2CR6A 5HGDA 5HY9A 1TJGH 2CDFA 2AJZB 3OKOB 5GGVL 1F02I 5TQ2H 2R4SL 3TT1H 3AAZA 2DLFL 4HUXA 2BOBB 2X4TA 5ID1A 3FN3A 1RFDL 4HCRL 3CXDH 3H3PL 4QHMB 4TVPH 2BNRA 3GSVB 1MF2H 5ADOH 2A9NH 4KTDH 4XVJH 4OCXL 3L3HB 4OBSA 4HUUB 4P59L 5D2LA 3WL9A 4FQ1H 4OQTA 3KLAA 3DUSB 1XGQB 5D1XC 1ES0B 1XF5A 3TO2A 4HKJA 1UXWA 3QSKB 5LVEA 4NQUA 3S7GA 4LLVA 5CP7B 2WUBL 4OV5B 3D18A 3B6SB 3HN3A 1MCDA 5FO7A 5IWLC 4P2QE 3UJJH 4X7SL 1Q9KA 1PGRB 1ULVA 3QDMA 3NN8B 2EDFA 3WIHA 4GMTL 3EYSH 4L8SB 5E00B 3W9DA 4G7VL 5EOCJ 5K59E 4O4YH 3SE8L 3VE0B 4TVPE 4YXLL 3JVGA 1DQQB 1U58B 4OI7A 1CG9A 1ZA3A 2HFEA 3QUXD 3BEWA 2FB4H 3ULSB 5JPMA 2OS7A 3MRFB 2E27H 1A6UL 1MI5A 2H9GB 3T65A 3RGVC 1T0MA 3JV4A 4H88H 4TSCH 4LGRB 1AD9A 3FONA 1FV1A 4JRYB 5C9KA 3ZHKA 1A7PL 1CGXA 3ULUD 1XGPA 1JHLH 2W9LA 3IKCB 3LSOA 5EPMB 2CIIB 4X4XB 2HRPL 4F3FA 1GH7A 3L6FB 2YPVH 4YDVA 3SCMB 5J1SC 5J6GB 5E8OB 3OXSA 4NWTL 3BZ4A 1L7IH 1RURH 1B4JH 5DT1H 2H32A 3RU8H 4XP1H 4LAJH 4O00A 5JO5A 4PFEA 1U36A 4P5TC 5D1ZD 3B9VA 4F15C 3QWQB 2DRUA 4ORGA 6FABL 3GSRB 4NWUH 4YHYC 2APVA 4PJHA 3RDTA 4OIBA 3ULVE 4OTXH 3I84A 3VXNA 3V6ZA 4XWOD 1ORSA 2LAGB 2ZUQB 5EO9B 1HSBA 1YEKH 2HH0L 1MCSA 4KUCF 4KGJA 1GZQB 1G7HA 1NGYA 2R0LL 2ZKHH 4I4WA 5B39A 1UVQA 4MZ3A 1PFCA 3QXDB 4N5ED 3OBAA 1WFUA 1T21B 4KAQH 5FGBC 1NFDB 4EZMA 3RL2B 4FQ2H 5ENWB 1DQLL 1H3GA 3PP3H 2DS4A 4U1JA 4QXUL 4PJCF 5F9JA 5I9QC 1G1CA 2LV4A 1YJDC 1F4YH 4BFIB 4TTDD 5DUPL 5TE7L 3W0WB 1IE5A 1NMCB 4Q9BA 1EO5A 2OTWA 5EUOA 2F5AH 2DQEL 2C1PA 2WUCL 4N90E 4ZTPL 2NY3B 3O8XA 1PG7W 3RNKB 4NUGL 1FG2B 4NQXA 4HWBH 3GKWL 5C0CA 1EBPA 1X44A 4K8RH 3K7UA 1JGEA 1MQKH 3G5ZA 3O2DH 4MNQE 5F7HA 1IAIH 1KT2A 5D72L 1EXUB 3KWWB 2E7HA 4MA3A 4KKBD 3GSXB 3P4MA 4LVHB 4V1DA 4J3WA 3RWFB 1A3LL 5ABDE 2ITDB 4UNUA 5C08A 1VEOA 5IIEA 4IRSA 3DBXB 3MBXH 3VD7A 1JV5B 3TC9A 2BVTA 4OT1H 1KYOK 1RMFH 3BP6B 1N2RB 1IBGL 1K8IA 2FECL 1MIEH 3EJZC 3B3IA 3BZEA 3MRRA 4YDJB 3PHOB 3ZYJA 4LFHD 4DN4H 5IJVA 3DURB 5E5MB 4G8GA 4GLRI 3OHXB 5T5FL 4OUUB 4ZAKD 1BVLA 3WFEL 1NPUA 4K9EL 4WW1B 1BJMA 3LIZL 1DCLA 1D5XB 4WFFE 4DOHB 1OARL 2R2EB 4MJIB 2X1WL 1T1ZB 1LE9B 3O81A 5D1QD 3T09A 2JJVA 4RZCB 1OSZA 1PVHA 1DQTA 1N8ZA 4M8QB 5C9JA 1YEGL 3QISA 4F9PA 3MBED 4Y5XC 1I7UA 5I16A 4JN2A 4OF3A 4WO4B 3GO1H 4PY8J 3W2DH 2XYCA 3GB7B 4LLDA 2DQIL 2Y07L 5FV1L 4HMDA 4AL8L 1LHZA 5E2UH 1NBVL 1WICA 1KCKA 4YEEA 1CGWA 3QNZB 2OYPA 4KPHH 3U0PB 4IRZH 4U1MB 1J8KA 1VGKB 5DD0H 5GS1C 3LVEA 1SJEB 4HWUA 1I8KA 1DSFH 2A6KA 4PJBE 1RUPL 1NCBL 4JGJA 2RJMA 5GZOD 2UV3A 2VDLL 4NO5A 4HUWB 4GAJL 4LVOB 4FRWA 1CQYA 2J5LC 3F5WA 1U8HB 3WIFA 5BVJB 1L6XA 4KVNH 3MRLA 4LQFL 5BRZB 2A77H 1MCNA 2VIRB 3V6FB 1CE1L 4G8EA 4OBRA 2Q87A 2R4RH 4ZFZB 5GGQL 4NBYB 4HJJL 3TBYB 4NJ9H 4PYGA 4PJEA 1JHTA 3FT4B 2HVJA 2H6PB 1E28B 5KZCD 1S7SA 4JPKL 1FORL 4NKQB 4EI6B 1W72L 2VAAB 2PN5A 1EO8H 1W0WB 4OKVA 2BRQA 2DL2A 4X6CB 1GSMA 1LO5A 1JNNH 1T1YB 1RIVH 3QUZA 5T5NG 5JHDD 2GJZA 4NO0D 2R9HD 2CRMA 3NH7H 5MENE 3E3QA 3SDCA 4N0CD 2VB5A 4ZXBC 2AV1A 1E27A 3B9KD 3TA3C 4PG2A 2BNQA 4MJ2A 4KWUA 3BYYA 5LQBL 2MQ0A 3U4BH 4XNMA 3SDAC 1NC4A 3ARFB 1CLYH 4L1HA 1UQSB 3EUUA 1CGSL 5CCKH 3U4EB 4JO2L 5HHQA 5E9DD 1RUQL 1YEJL 4Y4FD 3RUGA 1NCAL 2K7PA 5HVWA 3NCEB 1FFOB 4OCNC 5KSBE 4E9LA 4O5LL 3S4SG 1ZWIB 4PJ8B 3ARZA 1T1XA 3NACH 3WXWH 3LS4L 1NUNB 3VD3A 2DB8A 4JFDA 4FZEL 2BHYA 2ZSVA 4G9FE 4L29A 5ETUA 1UYWL 3VXOB 2JJTA 4QGTA 4XGZA 3KPRE 3C9NB 1N5AB 3GSNL 5IW6B 3ARBC 1TCRA 1G0DA 4Q9RL 4K7PL 1LNUB 3BXNB 4X8JB 1UB6A 2YA2A 5H94A 4HMEA 5E8EA 2D0HA 4NZDA 4Z0BH 5GRZA 3MC0A 5J12C 5JZ7C 2G60L 3MGTB 4G6KL 3O4OB 5KTEH 3CLFL 2VH5L 3GJFH 2FGWH 1ZLWK 5HHPB 5JXAH 4XRCB 1DVFB 5IMLA 2WQRA 3H7BA 2HTLD 2FIKB 3L3OA 4MAYB 3MJ9L 4WUUA 1RZGB 4EDWH 4ELME 1MFEH 2ADJB 4F7TB 1R5VB 1AO7E 1NDMA 5CSZA 2BXYA 4R4FL 3V7AE 2DI7A 3LQZB 1I8MB 4L5FH 1NAKL 3T0EC 3HUJA 3QNXB 3WUZA 2YPKA 3VXPA 5I30H 4BUHA 3VXTA 3BGFC 3STLA 5CP3H 4XNZB 1KC5L 1FZJB 4X0KB 5IEHA 4D9LL 1G0XA 2DIJA 5BV7H 1N3NA 4W4OA 5TF1H 5I73C 5DJZB 1JGDB 9CGTA 3T0DA 5DD6A 1VFAB 4D3CH 1G9ML 3DTXB 2AQ1A 1FO0L 1SBSH 5DD5H 3BMWA 1P84J 5GSRA 3WLBA 4J12A 3WFCL 3KPSE 1RJLB 3ET9F 1QTYT 4XPTH 2XACC 2ARJQ 4NT6B 3VGEA 5KOVC 2XZCL 2MJWA 4NN5B 1RK1B 1FH5L 4N8CL 2AK4E 4JN1L 1MWAB 1G0YR 2Y36H 2RHEA 1MHPL 5JW5B 3RVVC 3SOBH 5E2WL 3KYMA 5EZIL 1JUFA 4XPBH 1E4WH 3U36B 1QSEA 5CEXA 2X40A 2R0WL 5LCVL 4POZC 3NVQA 4P46B 5L2KE 2O93L 1H5BA 1FYTA 2YRPA 2OZ4A 4JANB 5C0NC 4ONFL 3LEYL 2D31A 2EKSB 1OGAE 3UZVB 3S8WA 4L4TE 5IFHH 5C6WH 4DZ8B 2PYFB 1Q0YH 2VABA 1HHJA 4HFWA 5DA0B 2C1OB 2A6DA 2NYYC 4X6DA 3WV0A 3VW3H 2Y25A 3DXAE 4GJTB 3MRBB 2W1NA 5AWNH 5MEOB 3O3EB 3FO2B 1OF2A 3TNMA 5HPMA 3HE7D 5GISH 4N0FB 1RUKL 2J8UE 1TZIB 4M48L 2DQHH 4KK9D 4HIXL 4WJ5B 3UZQA 5HHOD 2BX5A 4XT1C 3EGSB 3VWJB 1SBBA 2UYLB 5F9DC 3C6SA 4JLRB 1JGLH 3QJFB 2EZ0D 1S3KH 5KS9B 2XZQH 3UYRH 3O9WD 1D6VL 2PO6B 4LFHG 3TESA 1M1SA 3O6FD 4U1LB 3O4LD 5DK3A 4R90L 5DDHB 3QXWA 4JY6B 3IJYA 2NLJB 3MUY1 2VNCA 4QRRE 4UB0L 2CK0L 1RZKC 3PQYB 1KG0B 2DWEB 4PJAA 1TLKA 3O41B 1LDPL 2IBBA 2BJMH 5KVMC 2FL5A 2FGZA 1JP5A 1QEWA 3MQIA 4NCDA 4X8XA 4DKEL 5KG9A 3RWGB 3I6LE 3FQTB 2F53B 4M6NL 3RWJA 2QQKL 1DJSA 3OKOA 5HDBE 5L8JB 2B1HL 1UEMA 1FDLL 1KACB 1TXKA 2BOBA 2J6EH 3HAEA 5D1XD 3CMGA 4PRDB 3EHBD 4P2RE 4QHMA 4LLYA 2NY4C 1IC4L 3GSVA 4Z76B 4HUUA 3IDGB 1GZPB 4L9LB 5I1DB 3D0LB 3QEGH 5HBBA 3QIWA 4MS8C 4M43L 1UA6H 3VXME 3DUSA 3D39A 1XGQA 1HWGB 1N5YH 5DQJA 3T1FB 1G9NC 3V52L 3H0TB 4BUGA 3TWCH 1HINH 2DBLH 4IM8A 2H8PB 3QCTH 2DWDB 5CP7A 2IH1A 4I3SL 3OKLA 1CK0H 3QIBD 4EIZC 1X6LA 2EE3A 3TH4T 1FLTX 3MYJB 2WNGA 3TVMC 1KIQA 2Z35B 4QXGL 5LBSL 4LVNC 1GOGA 1U58A 3RGVD 4Z7QF 5GGSB 1SY6L 1X6NA 4NNPL 4UTBL 3TYFB 4S1RH 5C6PB 4P23D 5FGCB 2LU3A 4Y16B 2CQVA 3ARGB 3K1KC 1JPSH 1KLGA 2X1XR 4E5XB 4YQXL 4JRYA 5DWUH 5I8OH 1RK0B 1OB1B 3INUH 4KUCD 4ORZC 1QR1A 2CIIA 4PBXA 4QHLB 4Z5RA 3GMQB 3X14B 5KVGH 4KV5E 3CFJB 2VLJD 4AEIL 5J6GA 4OLWL 5E8OA 2QQNH 4NC1C 2GTZB 5EZLA 5ILTL 1P7QB 2A1WH 4F7MB 3VRLE 5DK0B 2XN9D 1QLEL 4X80H 5F7EL 2JKXA 2VDOH 2DQFB 4U1HA 1KN2L 3VA6A 4FFZH 1WAAA 4ODTL 3HRZA 4NQCD 2AJSH 4PY8I 4EXKA 5CLWA 1RHHA 4XTRC 1SM3L 1X7QB 4PREA 4HIEB 5HI3C 2AJYH 3VJ6B 3H7LA 4K2UL 1S9YB 3HZMA 1CDHA 4U7MA 3ZYOA 3ZDXF 4NNXA 3MV9B 1S9VB 2YC1B 5DA4A 3K2MC 5T1DL 5HYQA 1EV2E 2H2PC 4NGHH 3V0VA 1DR9A 1G7MA 1T20B 4JO3H 4YHOL 4ZQKA 5ENWA 1M7DB 2F54B 2X1QA 2JB6B 4HBCL 4UT6H 4NM8L 4IIQB 4D8PA 3M1BB 1DE4A 4XWGL 3NIFE 4QHKJ 4MD4A 5I1KH 4KU1A 4MQTB 3UPCA 3KVQA 1A4KA 4G9DA 4PJDF 1P4IL 5F7DA 1CFNA 1HNGA 1EJ6A 3C5JA 5E8DH 3QUYA 3RNKA 1UB5B 3L7EB 4ODUB 1CD1A 3VD4A 1RAMA 4RRPG 2CLVB 4R4ND 5DJ2B 4APQA 3GSXA 1ZVSA 4WY7H 3MJ8B 1T3FB 1HI6A 3CVHH 5IT2L 3HMXA 4PP2A 3T3ME 2CK2A 1N6QL 2QADB 1UENA 1PKQB 4GBXA 4AEFA 2X89A 4JG1H 4J2XA 1IC5L 1OLZA 5SV3A 3LCYA 1S7QA 1N2RA 4KQ4H 4OLUL 4XVUC 3CCHB 1MNUH 3IS0X 3RI5F 4E41D 3PL6C 1TQCC 3QFDB 4YDJA 2F15A 4OJFL 3QQNA 4U3CA 3RZCA 1D3CA 5F89B 4M7JH 4J1UA 4QOKB 2CRZA 2ZJSH 3PDOB 2ZCKL 5DF0A 3QAZC 5FDYA 4PP1C 3PGFL 4WTWA 1J0KA 1GPOL 2ZUXA 3WO4C 3MZTA 5KJRL 3CXHJ 2VZUA 4H1LA 1MJJB 3WS6C 4MJIA 4HH8A 1V3KA 4L8CB 1T1ZA 1LE9A 1P4LB 2R15A 4WU5A 1CBVH 2DL9A 3MMEA 5H35A 4Z7VF 3PWLA 3RGHA 3HI6H 1FN4A 3BQUC 5GS2H 4WO4A 4FFYL 3BH8B 2V7NB 3LMJH 2VLKD 5KW9H 2YA0A 1ZHNA 2D9CA 3C60B 4FQIL 5KAQF 4NHUB 1S5HB 3UTZB 3QNZA 5HYFA 4Y5YB 3HG1D 2XRAL 4Y88A 5EU3B 1OP3K 5AZEL 1VGKA 3EOBB 2A73B 5T1LD 2YWYA 5C0GA 2YD1A 2YPLE 1CI5A 1NLDL 4GAYB 1GC1H 1NMBH 1U8HA 3OAZH 5I18H 5BVJA 4MB4A 2EDOA 4X4ZA 3MCG1 5LWYH 5BRZA 3V6FA 5C0CD 4KTEH 3KLSA 1MRCH 3MLXL 2EIEA 4ODVL 3TN0C 5T33H 5LXGL 4NM4H 3FT4A 1CFSB 4JZJB 3EO9H 3MRDB 1C1EH 3VXUB 3MYZA 3WNMA 1YUHB 5J11C 3W39B 2B4CC 4WV1B 4EI6A 2DI8A 4HIIB 2NY2C 4YC2C 4ZOCA 3SN6N 4IJ3B 3MLVH 2E9JA 2DQTH 5F6HJ 1SEQL 1KCRH 5A1AA 2NW2B 3ALXA 2NTFA 2EO9A 4JJ5B 2HT3C 1PDKA 2C7UB 3LS5H 4OCYL 5I2IB 2DQDL 2V2TB 3I75B 3PIQB 1KNOA 1QKZL 2VXSH 1WBXA 3EO1A 4FQXD 1FAKT 4K3DL 4TOYH 1WEJH 3H9ZA 4KZEL 3ZE1E 2AABH 1Y18B 3GFUA 3D85B 2ZCLL 3D69B 4UT9L 4NRZB 1YECH 1YEEL 3H3KA 5I15H 3UC0H 3G6DH 5T1KD 3NCBB 1HSAB 4ONHB 2F19H 1C5DB 1FFOA 1EVUA 4M03A 1MRFL 3V8OA 1MFBH 4PJ8A 4MD5A 3SJVD 4R0LC 4KHTL 2DQGH 1NCDH 4YDKH 5I0DA 1WLHA 3KDMA 4Y19B 3BD4A 4NKOB 3QEQA 4KDWA 3RBSA 1A2YA 3JV0A 2EXYC 3VXOA 4WNQA 3RKDD 4RAUB 2WP3O 3FMGH 3MO1B 3C9NA 1M7IB 4XPFL 5IW6A 2VZVA 4ZUTB 3K8LA 3EFFA 3N1QC 1KPVA 4PTUB 1LNUA 3BXNA 1I85C 4LEXH 4X8JA 4LOUD 1U6AH 3ULUH 3FQNA 3QEHB 1IMHC 2IAMB 1QSFA 2OP4L 4PJXE 2AEWA 4RBPK 2RCSH 1WIUA 4AZ8A 4JM4L 2OL3H 2E5EA 2UZIH 4I18B 2B0SH 1ORQB 5L8LB 4H0IA 3U1SL 3DROB 4F7CB 4AIZB 2CLZB 4IHOB 5GGVH 1KENL 2R4SH 4XRCA 3TT3L 1DVFA 3ILQC 4C4KT 2DLFH 1LO2L 2ARJB 4MAYA 1RFDH 1RZGA 2EYRB 4HCRH 3H3PH 3MRGB 2ADJA 1G7IB 5B8CB 3SHSA 1R5VA 3NFSL 5A16A 5DUBB 1OOAA 4YO0A 4OCXH 3C8DA 5C07D 1OVZA 4P59H 1I8MA 3ULUE 4I0PD 3TZVA 3QNXA 3H9SB 4U1SA 3OPZL 1T6VN 1UKTA 3LAFA 1CICC 1JZ4A 2CMRH 1Q1JL 4YHPA 2HYMA 4HX1B 3GSOA 4HS8L 1FZJA 1IQDA 4FQJL 4MNQB 4X0KA 4ETQA 5JXEA 2E7BA 1RZKL 2WUBH 3LRGA 4RFNC 1JCKA 5DQ9A 1JGDA 4X7SH 1F6FB 3T0VA 3GIZL 1KEGH 4GMTH 4X5XB 4Z9KB 4G7VH 2Z31A 4GMSL 4MB3A 1LEGB 1P1ZB 3G6JB 4FQCL 3SE8H 3DO7B 3ZYIA 4YXLH 3CD4A 4PJ9C 3H6JA 4HULB 5LG1A 3PNWA 2NY0C 2P5ED 1FQ9C 3HTLX 1RK1A 4OZFA 1MY7A 2K7QA 2XY1A 4PJGB 2CXKA 4QXTB 1MWAA 1A6UH 1J0JA 3GRWL 1GGBL 5JORB 5C0ND 4G6AC 4JFDD 2X7LB 2AXJA 5I76B 1SQ2N 5K9JL 3IU4H 1A7PH 4LLAA 4QGYA 4P5KB 1G9NL 5KANI 2A6JB 5GSVA 1F8TL 2HRPH 4M1DL 3Q5YA 4YHLL 3CUPB 4EJ1C 4Z0XA 5F7NC 3X13B 2Y1VA 4NWTH 4QTHB 4DZ8A 2GK2A 4IMKC 2A74A 5IMOA 4WU7B 2Y5TB 3AM8A 5DD3H 5L2JA 5E95B 3MRBA 6FABH 3FO2A 5SWQA 1Q9LB 5FGRA 3ES6B 4LKXB 4JFFD 4NO2B 4PRBB 4JHWL 1TZIA 5KSAD 4HS3B 4WJ5A 4MLSA 2GJ6B 3EGSA 3QO1A 2HH0H 2UYLA 3NGBB 1NAMA 1I3VA 1H15B 5CKGA 1AFVL 5HXMA 3QJFA 1EPFA 2R0LH 5KS9A 3MOBL 3QPXL 3WDJA 5IEKB 3CAFA 1PG7X 4L3CA 5D2NC 2ZOLA 1X9QA 1JZ8A 4QO1A 2JELL 1G7QB 3WNPA 4U1LA 2ICES 3BPOB 4BFBD 4M6ML 5DDHA 1DQLH 2AERT 1S9XA 2NLJA 4PGDA 4QXUH 1AY1L 1VHPA 1F3JA 5TE7H 1O7VA 2DWEA 4FXKA 3ZMRA 2PXYB 5GS3A 4GG6F 4GUPB 3HZKA 3O41A 1PLGL 2DQEH 2WUCH 5IW1B 3RWHA 4ZTPH 4NNYB 5C0BA 1H9VA 4NUGH 3UTOA 3RWGA 4DZBB 3GKWH 3WNKA 3JTTA 4HDIB 4Y4HC 3OJ2C 2VXVL 5DRZB 2FWOB 5D72H 5EA0L 1IGYB 1FL3B 2OQJB 5DK2A 3S5LG 4P2YA 3R4DA 5TQ0L 4DEPC 3F7RA 4LP4A 1A3LH 1D9KA 5CFHA 1XCQA 2NR6C 2GUOA 3VI4E 2IQAB 4Z76A 1U42A 4L9LA 5I1DA 1IBGH 3P2TA 5TDNA 1DUZB 4M6OL 4QHKI 2V5YA 3T1FA 1FYTD 1IAII 3MOAL 3H0TA 1EHLH 4UILL 2H8PA 3JTSB 4U3XA 2LQRA 4M1CD 4N0UB 3QPQC 1J87A 1U8IA 3VFUA 1R3JB 4C56D 4C83A 4WIQA 5FYLL 1U8KA 3KXFD 3E6FA 3WFEH 2QQLL 1UM5H 2JCCE 3QQ3A 4K9EH 3MYJA 3AU1B 3LIZH 3MSPA 2Z35A 2X4SA 1OARH 3RIAK 3TO4C 2R8SL 5KVDL 2EEDA 1JPGB 2UVEA 1NKOA 2AXHA 2OR8A 1YEGH 3D9AH 2UUDH 5EB9A 4FZ8L 5EWIL 3H9HB 3JZ7A 2NZIA 4P3WA 4R6UA 3O0RL 1MCEA 2CO7B 4L9DA 3FFDB 2X1PA 5JHDE 2DQIH 2Y07H 4JFED 4AL8H 3K3QA 5FECB 3ZSTA 3VRJA 4LPTA 3BO8B 3QDJD 3VG0L 1RK0A 5IQ9B 2CLRB 5JR1L 1R0AL 1BFSA 3PWPA 2W91A 4QHLA 3WJJC 3ZDZE 5MEQB 1OHQA 3DGGB 1K85A 1IZKA 2E7LE 1HKLL 4WEMB 2VDLH 3MRJA 2KZWA 5E9DE 4Z8FL 4GAJH 2FEEI 4WWKA 4F37K 1AE6L 1ZE3C 1U91B 3V6OA 1Q9OB 3MV11 2QBWA 3EOTL 4OFKA 5GGQH 4LBEB 4HJJH 2UZXB 3PXJA 3RNQB 3GSQA 5ERWA 5I19L 1KEML 4M61A 3I50L 1Z9OA 1QZ1A 1RHFA 4PLKC 2NY6D 5D7KD 1FORH 3D0VA 1A7OL 3Q0HA 3NFPB 1S9VA 5CZVL 2C3WA 3E8UL 2NXZD 1OQOA 5E6IA 2JJUA 2PW2B 3D39D 1QA9B 3VGGA 3IDIB 1HWHB 2D7NA 5FYLD 5GRVK 2A9ML 5HYIA 4IIQA 3M1BA 2EDKA 1BQUA 4JQVA 4LCUA 1KN4H 1CGSH 2AXGB 2FDBP 4JO2H 1RUQH 1YEJH 4LCCC 5L2KB 1NCAH 4RAVB 4O5LH 4QRUB 5FYJD 4FFEX 5FKPA 1OW0A 4I2XA 4L4TB 3EDEA 1J1PH 2AJUL 2VQ1B 4H0GA 4JRXD 5I8CA 3L7EA 4ODUA 4FZEH 3U9PL 1A22B 1PKOA 2CLVA 2QLVB 3GSWA 4J23A 4RISL 3BP5A 3WNOA 1UYWH 5DJ2A 1EEZB 1JIBA 2B4CL 3DXAB 3IXTB 2OTPA 4GRLA 4KROC 3NCYS 1TETH 4Q9RH 3BOVA 1UACL 1BVZA 1TPXB 1A6AB 1PKQA 4WWID 4K7PH 3CK0L 2DLIA 1TVBB 4MNGA 1SEBA 5C0AD 3B4NA 1WWBX 1HYSD 4PP1D 3CCHA 3SDDB 1XF3A 3U46B 5FA4B 5BCAA 5FM5O 1INQB 5FB8B 3B5GA 2C3XA 3WBDA 1DBAL 3NTCL 5F89A 3CLFH 2VH5H 4JGMA 4CW1B 1B0GA 1YMMD 3DETC 3I9GL 2MCG1 1MCFA 2R1WA 3WUWB 3LHPL 5HTSA 2HFGL 3W11C 2UY7A 4X6FB 3EBAA 4XZUB 1CDGA 2NX5A 4RA3A 3WHE1 3MJ9H 2NW3A 3PV6A 4L8CA 1TIUA 1DEEB 3Q5OA 1JHKL 2EYTB 4GRWF 3FTGA 1P4LA 4P57A 4R4FH 5DHXB 3RL1B 3OXRB 2ADIB 1NAKH 3OF6A 1RUAL 4LHUA 3SDXA 3BP4B 3JV6B 4FN0A 1JFMA 3CNKA 2CH8A 2V7NA 1HDMB 3O6KH 1KC5H 4H0HB 4D9LH 2DMCA 5M7QA 3LD8C 1K2DA 1FRGL 3UTZA 1S8DB 4G8FB 1N59B 2ZUSA 4PJFB 1FO0H 4A6YA 5EU3A 3WFCH 2CJUL 3CZJA 5T3XL 2P8PB 3V7MA 2A73A 1K5NA 3MROB 2XZCH 3SGEH 3AVEA 4HPYL 4Y7MA 3VXRB 4GAYA 1FH5H 2Z93B 4N8CH 4EDXB 5IV2B 3RDTC 4L4JA 5HHOE 3U79A 2EC9T 1NEZB 4JN1H 5EU7E 4PTTA 2NY2D 5B3NA 3Q6FA 3P40A 1MHPH 2AAVA 4POUB 5EZIH 2WLZA 2P47B 1ZHBA 3DV6B 1UXSB 4APQD 4CMHC 2HT3D 1CFSA 2R0WH 2O61B 3MRDA 3VXUA 1CXLA 5LCVH 1YUHA 4LSVL 3UYPA 3OL2A 4RMUA 1GIGL 4ONFH 3I6KB 3LEYH 5KVFL 1WVZA 4ODXB 2VJXA 2NW2A 5SWSB 4JJ5A 5EU5A 2V2TA 3ARVA 3PIQA 4BELD 3DRTA 3DSFL 5E2JA 1JGVL 3G5YA 1FYHB 1Y18A 2XY2A 1ADQA 4NRZA 1C5BL 5DJ8B 4U3HA 5EFIB 3O8XC 5HGGS 2Y72A 4MJ4A 3DX9A 4CVZB 4UTAL 1HSAA 4ONHA 3VFSA 1RUKH 2EXYD 4P4KC 4M48H 3IF1B 4HIXH 4PG9B 4EUPG 1P84K 1B9ZA 3HE6D 1FL6A 5IJKA 1R3IH 1XH3B 3FN9A 4TSAL 4R8WL 1XGRB 3FL7A 4WHDA 3WXVL 1TQBB 1U8NB 3IDYB 3ZKQD 1DANT 2APTA 2MTPA 4IRSC 3P0YL 1D6VH 3CDCA 3L95B 4KK8C 1W2KT 3MO1A 4QRPD 1M7IA 3QXAB 4ZUTA 2IBGA 5CJ8A 1D6EB 3EDDA 4ODBD 5F6IC 1QFWM 4UB0H 5ISZB 2CK0H 3SDYL 1AGDB 4S0SD 3W5NA 4AM0B 4V3EB 4UOJA 1LDPH 4HWNA 4KKCC 2P7TB 5FIEA 1YPZF 3BI9X 3IAPA 3DROA 3C6LD 4O51B 1G7PA 4AIZA 4GKSA 2QQKH 1PJ9A 3R06B 3MODL 5IFAL 2B1HH 1F4XL 2VC2L 3IFPA 4PJIF 3HC4L 1WZLA 4TTGA 3VXSB 4ZYKB 1OP5H 5EIIB 5HVHB 1IC4H 3QULB 3GZKA 3EAKA 4PGCA 5TGBB 3DX8B 5C0DB 4QHNB 4LGPB 4M43H 1VENA 1QBML 3UDWC 2D7TL 4OGXL 5B38A 4MNQA 1YJDH 4XCNB 4I3SH 1WWCA 2IPTL 4NSKB 2PF6A 2O5XL 5IVZA 3CGTA 3ILPB 1BECA 1FHGA 4U4BA 1H3TA 2R2BB 3G04B 4PJCE 2XN9E 5GJSL 2EDTA 1X5ZA 4ISVB 4QXGH 5LBSH 2G2RB 4ZOAA 5SX5K 1LEGA 3TPUE 3KLHC 3AREC 2NZ9C 4NQCE 4B0MM 1SY6H 1QD0A 4NDMB 2YSSB 4NNPH 3QHZL 2VXUL 4EKXA 2APWA 3CU1A 5GGTL 3UXFA 4ZFGL 4UOW0 4QXTA 5F72S 4HWBA 3VFVB 5JPNB 2BVEA 4K07A 2D2OA 3N1GC 3O2DA 5D5MB 2X7LA 4DN3L 5I76A 5IFJA 4YQXH 5FGSA 3R0NA 5F97E 2P4AB 4P5KA 3OB0K 2A6JA 4UINL 2YD3A 3T2QA 4OD1H 1JZ3A 3RTQB 4OLEA 2Q76B 1NC2B 3SKNA 4DVBB 5DYOB 4YXKL 4AEIH 3E3QC 4OLWH 1AGEB 3CH1A 3L3KB 4PG2C 3G5XB 2XICA 3G08B 1RJCA 3KYNB 1YEHL 1QLEH 4JPWL 3O45A 4WU7A 2BVOA 4U0RC 1KN2H 2YD5A 1U8MB 2XTJB 4ODTH 1Q9LA 4PRHD 1T22B 3ES6A 5D7SL 4YDIL 1SM3H 4PRBA 1NBYB 4K2UH 4OFYA 3VDAA 4NQEE 2F74B 4AH2B 4FXGA 3X11A 3W9EA 4PY7A 3GMLB 4PJBA 4ZPVB 5JTWA 5E1HB 1Y6NR 8FABB 5HD8C 4I5BA 5IESL 3TZVD 5LKNA 4QEGA 4HC1A 1MAJA 3ESVF 1MCJA 4OZIF 2BY0A 4E41E 3D3VE 2AP2A 1IILE 3ZKMC 2GK0A 3RHWK 1OTUC 4YHOH 2Z8VC 1JI1A 1T7VA 3CC5A 1GYAA 4GS7C 4NM8H 5C3LD 3L3DB 4C58B 1JNLL 4XWGH 1XGYL 1JGUL 2R0ZL 4J3XA 1TMCB 1FNAA 3NZHL 1LP9B 2PXYA 5IVXE 2LVCA 4GUPA 1BIIB 2DDQL 2UWEE 1C08B 1OTSD 1JTTA 4YPGB 3F62A 1IAKA 1KPRB 5FKAB 2NR6D 4MNHB 1XCTA 3JXAA 1HH6A 4K94C 5MENA 4P5MB 1FL3A 2OQJA 3QHFL 1FZOB 5IT2H 4PRPE 1N6QH 2AQ2A 1I1AB 3T4AB 2VLKE 4TNWK 3VRIA 1EHXA 4AEEA 2WBKA 5D8JL 4JO4L 1IC5H 4L3AA 2PTUA 4OLUH 5KSVB 4RFOL 4MQSB 2J1KA 5KSBA 4XXCC 2J88L 3HG1E 1J8HD 4H20H 5CMAA 4ERSL 3UPAA 4HEME 4OJFH 3WFDL 2PYED 4HG4K 4G9FA 2HKFL 2ZCKH 2LAAA 2ESVD 1R3JA 1JN6B 4GO6B 3PGFH 2IEPA 3RA7L 4HLJA 3KPRA 1GPOH 4DW2L 4P2OD 2WINB 5KJRH 4JDTL 4LHJB 4ZUWA 4Y1AD 2Z4QB 2R29L 3VGDA 3V2AR 3MRMA 5F9OL 5L0QC 4XHQA 5BW7A 4KRLB 3D2UA 3H9HA 1A1OB 1F3DH 1QP1A 4WW2A 4LKCB 4FFYH 3WJLC 3ELAT 2DIAA 1FVDA 2VDML 4M4PA 3UO1L 2ZUYA 2I27N 1CXFA 3V5DB 3E6HB 1BQHG 3BO8A 3ZTNL 1S7VB 1WF5A 4X7CC 4ELMA 2CLRA 4ACPA 2G5BB 2XRAH 4N68A 5DVKA 1AO7A 3UAJD 3VWKA 3DRQB 5AZEH 4K7PX 1OAKL 2WBJA 3DGGA 5FDWA 2BERA 3FB7B 4G6ML 3NBNA 3CFEB 2ZNXA 5HJ3B 3SGKA 1N0XL 1ZLUK 3T0WA 3FRUB 1NLDH 1JMXA 2E3VA 4G42B 1I7RB 4G6JL 2QL1A 1U91A 4NN7C 3BGAA 3SJVE 1Q9OA 2HJKB 3GJFA 1PAMA 4ODVH 4PJBF 5HI4C 4HV8B 5LXGH 2W60B 4NBZB 4IS6A 1YN7B 2ORBL 4G59A 3TJEL 1D9KD 3LKPB 3KPSA 3MRHB 4G80B 1QBLL 4HJGA 1QYGL 2IFFL 1R3LA 1SEQH 4FQLL 2DM4A 5T3ZL 2Y06H 3BKML 4EN3C 4DWHA 5FO9B 3ZHDA 2AK4A 4OCYH 3ZYZA 2CXGA 4U6YB 1QKZH 4K3DH 3RY4A 3SKOA 4KZEH 2IPKB 3MLSL 4JO1H 2ZCLH 4UT9H 3DMMC 1YEEH 1WZ1H 3MNVA 1VFBB 3IFOB 2R23B 4NQDD 1J11A 3T0EE 4XNYL 5L2KA 4QRUA 1MRFH 4KROD 1AHWB 1OGAA 4KHTH 4L4TA 4QY8B 5HHMD 2VQ1A 5AUMB 5C07E 5C1MB 4QTIL 1Q8MA 3PF2A 4ZUUB 1I8LA 3IRPX 5H37G 5GXBB 1KCSL 4I48B 5IB4A 3DXAA 2PNDA 2YHGA 1PZUB 4XPFH 1G1YA 4QWWD 1A6AA 5IP4A 3HZVA 1TVBA 1KXQE 2J8UA 4LRIA 5C09B 2ICEB 3MJ7A 5BQ7B 3U46A 5FA4A 5A2LH 1IEAA 1INQA 4OZHB 5FB8A 3N1MC 4JM4H 3MV8D 5DURB 3UTSD 3KYAA 4L8SC 4JAMB 2P5EE 4ODSL 2EE2A 2I9TB 3WSQL 3TT3H 5HYJD 1LO2H 5BMFL 5D7LD 3UROR 2N1KA 4QRRA 4WW2F 3NFSH 4PRNB 3TIDB 4YIQA 3PWJA 5ESVB 2EYTA 5E7FA 3OXRA 2ADIA 3DVGB 3HZYA 5CJXA 3CFKA 2EEAA 3OMZA 2KQNA 3JV6A 3QZWG 5GPRA 3P9LA 3OPZH 1QRNB 5D1QB 3QFJD 4HS8H 4FQJH 1AXSA 1RZKH 2RR3A 4K7FB 3FFCD 2I25N 5IM7A 1QNZL 3SCMC 1J1OL 2C4XA 4XNQB 3GIZH 1N59A 4P2RA 4N8VB 2OJZL 2XV6B 3BPCB 3PABB 4GMSH 2QR0A 3QCVL 4FQCH 3PWUA 4ZOEA 3GJFK 1XR9B 3KS0H 2D03L 1F6AB 3I3BA 2IPUK 4JFFE 3VXMA 2XG5A 5DEFB 5CBEA 1XR8A 4JREB 1FLRL 2AJ3B 2Z93A 5DD1L 3LKSA 4XBPA 1NEZA 3QDGE 5F3BA 3KPQA 1J18A 1GGBH 4XI5C 2X10A 2ZUQC 5IMKA 5EU6D 1C16B 4QRQA 5K9JH 1TVHA 5DFTA 3UP1A 4PRIE 1R24B 4HWZB 2ENSA 3MUHL 4GRLD 1G9NH 5IKCB 4YEFA 1TJGL 2KH2B 4Y4KD 1F8TH 3MRKB 5TQ2L 4YHLH 4EUPH 3TT1L 2Q7YB 4LARL 4R0LB 5IGXH 5BO1L 2JIXA 3MLTB 3LZFL 3T4YA 4EI5A 4GKNA 4OIAA 3CXDL 1II4E 5KZCB 1NANH 5F3HB 4UI2A 1MHEB 3D1MC 4P4KD 1EERB 1CT8B 1XIWD 1NMCC 2R2HB 5JHDB 4X6EA 1A5FH 3GMMB 1U8OB 3SEPA 2NY3C 2ZUUA 5JMOC 4KKAC 4CVZA 1R6VA 4JHWH 3O3DB 1NFDF 3KJ4B 5IR1B 1MPAL 2W38A 4Z7QE 3OKDB 4KJPC 1BZ9A 4LLQA 4G3YL 3AS3A 3A67L 1AFVH 1OAUL 4LVHC 1XH3A 1NUGA 5E9DB 3EYSL 4AYFA 3QPXH 2XKUA 3ECBB 4GBXC 2O26U 3MNZA 4Y2DB 4XH2B 2JELH 2ZCHH 4FQQB 4O2EA 4M6MH 4MB5A 1Q94B 1NMAL 2Z8WC 3QUKB 4KKCD 3V6BR 1OQXA 1HQRA 2VLRD 1D6EA 4O2CB 5SWZD 1AY1H 1AR1D 5CZKA 1P7KB 2E27L 1K9TA 4UUJA 5FHBL 4MJ5A 4RGNB 1I9IL 4GOSA 3KXFE 4AM0A 1PLGH 5DJYB 4M7LT 1T04A 2P7TA 5DS8A 4C54A 4LU5L 1JHLL 3HB3C 1RQ5A 2EDHA 2VXVH 3R06A 3SKMB 4XPGH 2WIIA 5DJAA 4WCYL 1KFAL 4JFYB 5TQ0H 4JE4B 1NCTA 3S37L 1L7IL 3SO3B 4P2QD 3SY0A 5ICXB 4LLMA 3RU8L 2EDEA 1U3HA 4WO4C 4JFEE 2Y5EA 5HYEA 1HHKA 5C0DA 3V0WH 2W59A 4NC1E 3QP3A 5INCB 5I66B 3OJVC 4M6OH 4NWUL 5I0ZA 4LPYA 3MOAH 1W72B 2V2XB 1C7TA 1SJVA 1YEFH 5CGMA 1UZ6E 3IYLW 4OZGB 3ARED 2NZ9D 2Y4SA 1X3DA 4NSKA 1YEKL 5JDJA 2BNUB 3QNYA 5FYLH 1N7MH 2QQLH 3G04A 1L9MA 2ZKHL 5DRNB 3FRPA 2FECI 4ISVA 2G2RA 4LVOC 2VZ1A 3NCYP 3PWVB 3BKJL 4PJDE 1ACZA 2R8SH 5KVDH 4OF6A 1K4CB 1LWRA 1DZBA 4K94L 2VSCA 3CFIC 5D7IB 5FFLA 2YSSA 4GAFB 3F8UB 3PDDA 4JM2F 3RY5A 5EWIH 3E2HB 4FZ8H 3AXLB 3S97C 2UVFA 5D7KE 2BRRL 5LGJB 3O0RH 4WHYG 5CIPB 3QIUB 2W9EL 1T03L 1OAZL 4Z7OF 3GSUB 1IKNA 2F5AL 3CDFA 5E4IA 3BH9B 1BAFL 4KY1L 3TPKA 4DCQB 4DFHA 1ZLSH 1CDBA 3VG0H 1YY9C 5FYLE 1R0AH 2LU4A 3GSNB 4A2MA 4NO3B 4RX4A 3KPPB 3RTQA 1NC2A 5C86A 3NCMA 5IB5A 5DYOA 1VESA 2W0FB 3R1GL 1AGEA 4JY4B 4TUOB 3TFKA 5EG6C 2CKBB 3WLWD 4Z8FH 1BGXL 1QSVA 1A4JA 5IROA 1AE6H 5JQ6L 3ARFC 5FYJE 4X6CF 3MGOB 3WKML 2N7AA 4M5YL 3WN5B 3EOTH 1T7YA 3U9UB 3D25A 1U8MA 4ZUSB 1AQDA 3VFWA 4FHBD 4PJ8C 5HD8D 2OJEB 5AAMA 3P9MA 5DO2C 2XWBB 3RX5A 3EYVB 4KDTA 4Q6IA 5AYUH 1SHMA 1NBYA 5I19H 1KEMH 3ZKNC 5CD5D 4MWFB 3VRLF 2F74A 3ZKMD 4AH2A 3QI9A 1ND0A 3DVFA 3RWIB 1G6RL 1T5WA 2BZDA 3GMLA 4LCWE 4ZPVA 1UJ3A 4UDUA 5C0AE 3I02A 3HE7B 1X4XA 2YPLA 3E8UH 3F65A 4Z7VE 8FABA 3UPRB 2NY1D 1NBZB 4QHUB 1A47A 1NGPL 3STZB 1LD9A 5HHOB 3PGDA 3BW9B 1JF5A 3U0TA 1TENA 2JJSC 2ATPB 3NPSB 4OCRL 3RZWA 3TV3L 2A9MH 2DF3A 4XP9L 1YMME 1O5DT 1U8PB 4MD0B 1EFXD 4M7LH 4OSUH 3O6FB 4U1NB 3O4LB 1JPTL 3O4OC 4UBDC 2D0FA 1FFPA 3CU7A 1LP9A 1BIIA 1S7XB 3REWA 3D6GA 1WISA 4KHXL 1DVFC 4LSSL 4MJ6B 4RGOL 3NIGF 2AJUH 1HEZA 1KPRA 1UH2A 4M00A 1YNLL 4MAYC 2DYPB 5D7JB 4D94A 5GRUL 3FT3A 5A40E 5LAXA 4ZNEA 1K3IA 4RISH 3VH8G 4LAQL 1BBJA 1XF4B 4P5MA 5DVMA 3BHBA 4P48A 2B4CH 1FZOA 3CPLB 3MGAA 3MTRA 1K3ZA 1UACH 4K8RD 1FNEB 3EDJA 3VMNA 3CK0H 5DHVB 2V5RA 2FZ3B 1FZMA 3VXQB 1IM9B 4OV6F 5D6DA 4XNZC 2APFA 1I1YB 5JXEC 3P77B 1Z5LB 2R4RL 3FOLB 5CHNA 32C2B 1DBAH 4RQQB 1IGJA 3GMRB 2NTSP 3NTCH 5CUSL 5GHWL 3U82B 3FCTB 1MJ7L 4HKZB 3I9GH 4JCMA 3WS3B 3LHPH 4V2CB 2HFGH 5B39G 1NJ9B 5FO8B 1NGQL 1F3DJ 4BM7A 4NN5C 4LCIL 1ZEAL 2GI7A 2Z4QA 4XMPH 1R5IB 1DLHA 1FE8L 1I3RB 1JHKH 3QIBB 1EH9A 3NPZB 4PJXA 5DR5L 4W81A 4OFYD 3G6AA 1RUAH 1C12B 1A1OA 2HJFB 3L3GB 4LDLB 2MCPL 2X70B 1CXHA 1MCPH 5EIVA 4HS6A 1OAXH 3QUXA 4P46C 1DL7L 2I24N 1NKRA 4P23B 5EBWA 3JV5A 4G6FB 1EUUA 1FRGH 1IL1A 3WXWL 3LKNB 2G5BA 5MP6L 5ID0B 3FB6A 4EQ2A 4L8DA 2CJUH 5T3XH 1ED3B 4U1IB 1OGTB 4NQSB 3AM8C 2G75B 2VITA 4HPYH 1BWMA 5JOEA 3SGJC 4G42A 1I7RA 1QLRB 2OL3A 2GT9A 2VLJB 3VFTA 1NGWB 2HJKA 4IOFC 2W07A 3MV7B 3VWJC 4EN3D 5LGKA 1T0NB 2XN9B 3BWUC 2GSGA 5D1ZA 3NOIA 5HGDB 1YN6B 5HY9B 3SGEI 3LKPA 4HCRA 4LSVH 4QRPE 1GIGH 3BJ91 4IRJD 2PO6C 3P73A 3AAZB 3DECA 3S35L 4HUXB 1QFWL 3DMMD 3S36X 1QO3A 1PX4A 5H37H 3IFLL 3DSFH 2IPKA 2IG2L 5D2LB 1JGVH 4OGAD 3EYFA 5BVPH 2D7PA 3KLAB 1C5BH 1CDYA 4N5EA 2L7JA 1XF5B 3TO2B 4HKJB 3IFOA 1UXWB 3NCJL 4UTAH 3ARDD 5T5NF 1KTKE 4LLVB 4MCYA 1BP3B 3D18B 3V8CA 3ZE1F 2Q7NA 1SYSA 5FO7B 4NKDA 4AIXA 4BK4A 1AGFB 2ZG2A 1E6JL 3QDMB 4QNPF 4TSAH 4R8WH 3W9DB 2H3NA 3WXVH 2CKNA 4X7TA 4R4BA 2JTDA 1CG9B 2EC8A 3IDJA 1ZA3B 4L9LC 2HFEB 1IVLA 4Z18A 4N9OB 4WI8A 4X4YA 1EVTC 2WWMC 4D2NA 2PTVA 3SDYH 5ACMA 2ICWJ 4U1KA 3MRNA 2QV2A 1RVFH 2BOCB 3VWKD 3T65B 1T0MB 3JV4B 4HW6A 1AD9B 1AC0A 3FONB 4HUKB 1FV1B 2WBJD 3EFDL 1MCOL 1XF2A 2G5RA 1V05A 2X44D 4JAMA 3LSOB 5JOFB 4CNIA 5JW4Q 4N0RA 3MODH 4KFZC 2I9TA 2VC2H 3ZKSD 4EOWL 2QQQA 1VA9A 5D6CB 3HC4H 1BPVA 3N9GL 4OIIL 4X4ME 3WEXB 3BZ4B 4JPIA 3TIDA 4BQCA 2H32B 3HMXL 4HAFA 2MWCA 2WK2A 2FLRT 4ZAKA 4Y16C 4DGYL 3DVGA 4G7YL 4ORGB 3SCMD 1QBMH 3DYPA 2D7TH 3I85A 4OGXH 3RJQB 4MVBA 4GT7A 2ATKB 5D1QA 1N26A 3VXNB 3V6ZB 3KS0J 4YBQC 2IPTH 3MBEA 5HGHA 1HSBB 2AK4D 2O5XH 4WFHD 1KJ3H 4LCYA 4OB5L 1G7HB 3WFBL 1NGYB 1WTGT 5IBLC 4N8VA 2OLDA 5GJSH 4PYHA 1DQDH 5DMYA 3BPCA 4R2GB 3UYRL 2Y23A 4WWKC 4LHQB 3RVTD 3RFZC 4GG6E 1XR9A 1F6AA 3V6OC 3HC3H 5D2NE 3Q3GA 3HG1B 4PV8B 1CGVA 4U1JB 4YXHL 2AJ3A 1FCGA 3QHZH 4ZFGH 1CDUA 1XAUA 1KJMB 3S3SA 5DGRA 1RZIB 4XVTL 5EUOB 5I1GL 2BJML 4DN3H 1C16A 1ZHLB 2JCCA 4NQXB 1GOFA 5C0CB 5E6IC 3QUMB 4UINH 1WTLA 3G5ZB 3W0WD 2Q7YA 4MA3B 4YXKH 3NCCB 5CINH 1F90L 1MAKA 1X4YA 3MLTA 2J6EL 3P4MB 2N4IA 2NY3D 1DQML 4D9QD 4IIQC 1I7TA 5C08B 3TH3T 5IIEB 3BE1H 4JQVC 1YEHH 3CDYA 4JPWH 3BX7C 2R2HA 1K8IB 5JHDA 2Y7QA 1EX0A 3B3IB 3GMMA 5A3ID 3BZEB 3MRRB 4NO0A 5D7SH 1LQVA 3BT2H 4FQXB 4KJQC 3QCTL 3O3DA 4N0CA 3I3EA 3HFMH 3B9KA 3EJYD 4Z7UF 5IR1A 1JK8B 1L4IA 5C0FB 4OD3L 2DQUL 4TUJB 4NFBA 5DVLA 1ZOXA 1CXKA 1LK2B 2E7LA 3P30L 1BVLB 5EO0B 5HDQL 5E9DA 4Y4FA 2QADC 2QTEA 2J8HA 1NGXB 5DGQA 1MCWM 3MLZL 1J8HE 1CR9L 3I6LD 3I6GB 4K7PY 3K80A 1N8ZB 2PYEE 5C9JB 5M94B 1VEMA 4O2CA 1JNLH 4K71B 5I16B 2ESVE 5HDOA 1HE7A 1XGYH 2R0ZH 4KK5C 5EH1A 4YE4L 3NZHH 4P2RD 3MRQB 3LKQB 5LJYH 1VGEL 3UJTL 2YOCA 5JW3L 2DDQH 4LLDB 1ZSDA 4Y1AE 4Q9CA 3BDBA 4PRAA 1X5IA 4A2LA 4K3HA 4FTVE 5KVGL 4OFDA 2NNAB 1MY5A 1X5FA 2D4FA 5F1OB 3QHFH 3VFMA 2A6KB 4NO5B 4JM2D 2C9AA 3WIFB 3UBXB 5CWSB 1ZLVH 1U93A 5D8JH 4JO4H 4GRMA 3MRLB 2VLME 5AG8A 4RFOH 1MFDL 4QF1A 4XP6L 3L9RA 2J88H 2BC4A 4ONGH 1W72A 4ERSH 3BD5A 3C60C 3WFDH 2EO1A 4PJEB 5JIKA 1JHTB 1U2CA 4LLUB 5C07B 2HVJB 4QYOB 3EZ8A 5CJBA 4WHYH 4Y5YC 5BOPA 3VI4F 2HKFH 5HHNA 4WGVB 3RA7H 1HKFA 2GKIA 5C71A 5KBNC 1LO5B 3U7WH 1OM3L 5DRNA 4DW2H 3QUZB 1Q9WA 1L9NA 3FJTA 2MPAL 4JDTH 4PLOB 2R29H 4NGHL 2GJZB 1K4CA 3SDCB 5F9OH 3HNSL 2GSIA 4G8IA 2ZUWA 1E27B 2MQ3A 3E2HA 2BNQB 4CBPA 1JWMB 2XXCB 1LDSA 4JZJC 5I1KL 2VDMH 5HHQB 3UO1H 1M4KA 1S5IL 4Z7WE 5EBMB 4WV1C 1UEYA 4IJ3C 5E8DL 2HP4A 1X5JA 3VDCA 5MEPA 4GRWH 1S78D 3GSNA 4R96A 4NOFA 1CXEA 4JFDB 5GRWA 3ARFD 2ZSVB 1B2WL 3GBLA 4L29B 1OAKH 4P9HC 3DV4A 2HLAA 4G6MH 2BHZA 5DJXA 3OR7A 2W0FA 2Q86A 2GHWB 2OI9A 3CVHL 4MA1B 4TUOA 5F93C 1N0XH 1BOYA 2GEEA 2BNRE 2CKBA 1TCRB 5DO2D 4WI4A 4UV7L 1ZA6A 4G6JH 3EYUL 4ZUVB 4YWGH 3DYOA 3ZKND 3CSGA 1J0ZA 1UB6B 3B8SA 4YGVA 1ZTXL 2HT2C 3FOMB 3SPVA 5ELIA 2DKUA 4F2MA 2P5WD 5E2TL 3U9UA 5HHME 2X4PA 4ZUSA 1MWAL 4OLVH 3KPOB 3GI8L 5IJKC 2XWBA 4Y5VA 4CN4A 3EYVA 5AZ2L 1V5JA 2ZG3A 3LPWA 2ORBH 4MWFA 2ZJSL 1ZANL 2GQHA 3MJ9A 4P3DA 4GRWE 3RWIA 1QBLH 1QYGH 4NKMA 1U3HD 4GAGL 4JEGB 4N9GA 1HZHL 1KIUA 5CJ5A 5IMLB 1UKQA 4FQLH 5T3ZH 3BKMH 2HFFB 3RIFF 4DK6A 5KSAB 3L3OB 3UPRA 4QHUA 4WUUB 1IGTA 3STZA 5HHOA 4GKOA 4UBDD 3BW9A 4U6HB 3ULVC 2BVQB 3ETBF 1GGUA 1U3YA 1U41A 5E94B 4OQ1A 4LMQI 3MV8E 2ATPA 2IAMC 3MLSH 4ZO6A 3UTSE 3HUJB 2ADFL 5I1LB 3O9WA 4ZMAT 2CUMA 1U8PA 3KG5A 1RZ7L 3O6FA 4I18C 3O4LA 5EO1A 3VXTB 5HYJE 3STLB 1FO0A 2VLLA 4XHJC 5IEHB 5D7LE 1I7ZA 1BJ1H 2Z0BA 4WI7A 5EC1A 1VERA 4L4VD 5BOZG 4AQOA 5D4QA 1KTRL 4MDIA 4R7NA 4TNVF 1EHAA 5T3ZE 1MLCB 4QTIH 5B8CC 3L5IA 5GSRB 1LO4L 3WLBB 1TCMA 5DJ0A 1KCSH 4BKLA 5I1EL 3CPLA 2P46B 3HR6A 4LSDA 1YY8A 4TYUA 1U8JB 5DHVA 3JUZA 4NBXB 1GC1L 2DKMA 2X9YA 4WI9A 3FFCE 3VXQA 5D1XA 2IFGA 2Q8BL 3P77A 4OGZA 1F00I 4RX4D 3FOLA 4PJHE 1G7JA 32C2A 3KYMB 3TJHD 1JUFB 1E4XH 3RWEA 5F1KC 5T33L 3EOYG 4OM0H 5GRVL 4KDVA 1C1EL 4XAKD 5C0IB 5IWLA 4HKZA 2VUOA 4ODSH 2B1AL 1H5BB 2NY5C 1FYTB 2EDJA 3WSQH 1NJ9A 5FO8A 3QO0A 1KCRL 2PR4L 5BMFH 3QG7L 1EUTA 1GXEA 2P48B 2VABB 4C56B 1HHJB 3HI1A 1R5IA 3B2VL 1I3RA 3NMEA 3QIBA 4P46D 3UCRA 3KXFB 1JTPA 2AABL 3TNMB 1OF2B 2HJFA 2ICWI 3G6DL 2X70A 3G6JF 4P9ML 2ZP0T 3RGVA 2YPLD 5F7UA 5IG7A 3L5WA 2ED8A 5EOQL 2NXYD 4P23A 5GS2D 1QNZH 3C6SB 4PJGF 2N7BA 1DBKL 1QQDB 1V3JA 4TUKL 3QQ9C 1RZ8B 2OJZH 4XMLL 1PEZA 5TDOA 3QCVH 4WUKL 4IOFD 4U1IA 2D03H 1FP5A 3QDJB 4HPOL 3FMGL 3VWJD 4JFHE 5CAYB 3IJYB 1ZLWH 2FIRT 2HRLA 1FLRH 5DD1H 1YPZE 1UWGL 2RGSA 3B8YA 4GQ9L 1E4KC 1FBIL 2QEJA 4PJ5D 2PO6D 2RCSL 1QFUL 5HPOA 1P5UA 1T0NA 5E5UB 3NGBC 1QEWB 4PJCA 2XN9A 3O2WL 4QRSA 5KG9B 3M07A 1YN6A 4HH9B 3RWJB 3TPUA 3BP7A 1OL0A 1BZ7A 4PJDB 3BRGC 3PQYD 1BX2A 4NQCA 4PB0L 2VLRE 5I17B 3BPOC 2HKHL 4LARH 5SWZE 5J1AA 5BO1H 3ZE2E 3FAXA 3HAEB 3LN9A 3LZFH 3TCLA 2GCYA 4HD9A 4HBQA 2NY6B 5FGBA 4LLYB 2IMMA 1J7VR 2F53D 4YHML 3V5KA 3EDFA 2IJ0C 4NUJA 2NXZB 5IBUB 2PXYC 3ZE0E 2WP3T 5K93A 2DD8L 3QIWB 4W70A 2MHAA 2OSLA 3D39B 4NPYA 1CGTA 5DQJB 4LSQL 2CMRL 2HMIC 4AMKL 3UTQB 4TVSa 5FF6B 5I71B 2IH1B 1MPAH 4CADB 3PV7A 2J2ZA 3OKLB 1NANI 3BRFA 4G3YH 1AGFA 1HHHA 3U7YL 3A67H 1JBJA 1WUNT 1OAUH 3V9FA 1KEGL 1SY6A 1KIQB 1P2CB 5F8RC 4BQBA 1TJIL 5DMGC 3O6LL 1NMAH 4JRXB 1H3VA 2X4QA 1A0QH 2Q6WA 5FM4A 1DDHA 2DBJA 2BVYA 4KZDL 4WTZA 5EC2B 5FHBH 1U2HA 4NQEA 1I9IH 1DP0A 2BOCA 4YUEL 1KLGB 2V2WA 4HK3N 5C0AB 2XIDA 3IU4L 1Q0XL 2DTML 4LU5H 2ICCA 5JOFA 1QR1B 2R1YB 5FAAA 4E41A 4Y16D 4Z5RB 3ARGD 3KAAA 3EYOA 5D6CA 4WCYH 1KFAH 3T2NL 4M9OA 3IDXL 3WEXA 4KKLD 3S37H 3T77B 5J56B 5EZLB 4AENA 4NRXB 2D7OA 1CFTA 2BMKA 4Q7DA 5DD3L 4YHZH 3QH3B 4U1HB 4M62L 3HRZB 2ATKA 1RHHB 1BF8A 3HNVL 4PREB 4AG4L 4NIKB 1A6VL 1P7QD 4OZIE 4JVUA 3VA2C 1YNTA 3HZMB 1XGUB 2HN7A 4ZPTB 5T1MA 1CIUA 4NNXB 4PRPA 1KCUL 4KGLA 2VLKA 4GW4B 4J8RA 5GS1A 1TTGA 5I75C 3K4AA 5HYQB 3V0VB 3BKJH 2C26A 1G7MB 3D87B 4HSQA 4RCAA 1CD8A 5CJQL 1JRHL 4K94H 4ZQKB 3HG1A 5GRJL 1UM6H 2C4FT 2QSVA 4PV8A 4M8VA 5A43C 3MV9D 2C4FU 4D8PB 5FOJA 3MZGB 1DE4B 2EDLA 4HK3J 2BRRH 4MD4B 1KJMA 2W9EH 5T1LA 1T03H 1A4KB 4G9DB 1OAZH 5F7DB 1RZIA 4J7RA 1F2XK 1CFNB 3P4OB 3HLAA 1BAFH 4KY1H 3C5JB 2F54D 1ZHLA 3QUYB 1IQWL 3TH2T 2A0LD 3V79C 1D5BB 4XPAL 3QUMA 3ZO0A 3LKRB 1CD1B 3THML 1MJUL 2VDRL 1FPTL 1T5XA 2AVGA 4APQB 1ZVSB 3R1GH 1HI6B 4PP2B 4NQVA 4GBXB 4YH6A 3J7HA 1BGXH 3A6BL 5IHZA 5JQ6H 3WKMH 4F7EA 4CKVX 3OV6A 4M5YH 1S7QB 5E08L 2P44B 4HIJB 2FHCA 2Q20A 1INDL 3AMLA 1ZAGA 1FGNL 1UH3A 4LP5A 3A6OA 2ZOKA 1EHLL 5BS0E 3RZCB 4FQXA 3T0BA 4J1UB 4JQIL 4YK4B 5GZNC 1JK8A 1I8LC 2VMFA 5C0FA 3WMSA 1DBML 1G6RH 3C5ZD 4FQHA 4TUJA 3FZUD 2I07B 1LK2A 5T1KA 5EO0A 1UM5L 4OM1L 3B43A 4NP4H 1TPXC 1NGPH 4H1LB 4K3EL 1NGXA 4QOKD 1A21A 3S9DB 4MVBD 3ARBA 3SJVA 3HE6B 1MOEA 3I6GA 3AROA 4P9HL 5F9WB 2X4UB 4OCRH 3SDDC 3TV3H 4WU5B 4U0QB 1Q72L 1HHGB 3D9AL 4RIRB 3MMEB 5H35B 4XP9H 4NZTL 3PWLB 1FN4B 4IOSD 3K8MA 2Q8AL 1ADQL 1JPTH 3MRQA 3LKQA 4QRPB 4B53A 3LPGA 5AEAA 1P53A 1ZHNB 2B5IB 1UGNA 2BVUA 1OTTD 4KHXH 2OXHA 4LSSH 1N6UA 4RGOH 3L7FA 1YNLH 5GRUH 2X6MA 3LH2H 3GI9H 4LAQH 5IVXF 1B0WA 3MRCA 3BGMA 2NNAA 1W8NA 2QHLA 2UWEF 1P4BL 1KLFA 1BEYH 3C60D 5C0GB 3OKYA 4ZTOL 1C5CH 3QEUA 3VD9A 2MSPA 3B2UC 3UBXA 3T0EA 4X6DE 5CWSA 5A2JH 4YBLB 3ARQA 1WK0A 2LFGA 3CMOL 1BF2A 1CE6A 5CUSH 4LLUA 5C07A 4QYOA 1M71A 5GHWH 4I0PA 1RIUL 1MJ7H 5F21B 1WBYA 4JZNA 4ZDHA 4MXQC 4HEPG 1NGQH 1ZGLA 1JF1A 1UJTA 1MCHA 2NTFB 4LCIH 1ZEAH 5DMKA 1UWXK 1FE8H 1KNOB 4RMVA 4PJ7F 4RFEA 1WBXB 2IGFL 3EO1B 5DR5H 2R39A 3QBTB 1IRAY 1KYOJ 4PJFF 2MCPH 4I3GA 3T2OA 1JWMA 4HZLA 4XX1G 4JDVA 1DBJL 1KN4L 2P5EA 3L1OL 3C08L 5F71A 3UYOD 4I9WD 4D0BA 1DL7H 5EBMA 2AXFB 4MA8H 4ZNCD 1AIFA 4MD5B 3D85D 3U2SA 1B0RA 3MFGB 1J1PL 1ETZA 4HFUL 3KDMB 1FFNA 4JKLA 2WQ8A 5MP6H 3QEQB 1XF1A 1A2YB 5DJ6A 4FFWC 4WNQB 3TF7C 3DJ9A 2NY5L 1BREA 1T7WA 1TETL 4HJ0C 1UM4H 3EFFB 4MSWB 1KPVB 4ZUVA 1LMKA 4Y19D 3FOMA 3FQNB 4X98A 1QSFB 3VG9C 4YBHA 1PYWA 2ICWA 3KPOA 3PHQA