3E6JA

Crystal structure of variable lymphocyte receptor (vlr) rbc36 in complex with h-trisaccharide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
219
Chain Sequence
b'AACPSQCSCSGTTVDCRSKRHASVPAGIPTNAQILYLHDNQITKLEPGVFDSLINLKELYLGSNQLGALPVGVFDSLTQLTVLDLGTNQLTVLPSAVFDRLVHLKELFMCCNKLTELPRGIERLTHLTHLALDQNQLKSIPHGAFDRLSSLTHAYLFGNPWDCECRDIMYLRNWVADHTSIAMRWDGKAVNDPDSAKCAGTNTPVRAVTEASTSPSKCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor diversity region
publication title Antigen recognition by variable lymphocyte receptors.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Immune system
total genus 67
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11921 DUF3439 Domain of unknown function (DUF3439)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3e6jA00
4AY9X 3E2JA 4ECNA 4R5CA 3O6NA 4GLPA 4ARRA 4U09A 3OGLB 1U0ND 4IM6A 4Z8GA 4CP6A 4NKHA 2P1QB 1XEUA 3RJ0A 3WPHA 2P1PB 4LSCA 3OJAA 4C2AB 4AW4A 5IJDA 1H6UA 1XKUA 4V2CA 4XOSA 4WYKA 3ULUA 5AWCA 3UN9A 1P8TA 1OTMA 4PERA 2OMWA 4FMZA 4R6GA 4MN8B 4OQTA 5B0NA 2OMYA 4GT6A 3M18A 1FS2A 4QBZA 1A9NA 3RIZA 2RR6A 4U08A 5AZ5A 3CIGA 2Y5QA 4EZGA 1W8AA 4LI1A 3RW6A 4CC4A 1KOOA 1P8VA 2XWTC 2P1NB 3VQ2A 4PEQB 3FXIA 1P9AG 1D0BA 3C6NB 4LXSA 2OMXA 4PSJA 4Z79A 2Z65A 3WPDA 4BSUA 3M19A 4KNGA 3ULAA 4G8AA 2V9SA 4B8CD 1O6SA 1DFJI 1K5DC 2O6QA 2Q4GW 4U7LA 3WN4A 1XCDA 1FO1A 3WPBA 2UZYA 4RWTC 4J0MA 1K5GC 5D3IA 4BV4R 1WWLA 4NKGA 5A5CA 3RFJA 4H09A 4Y61B 4FCGA 4R6JA 2BNHA 5CMNA 5IJBA 3CVRA 2CA6A 3RFEA 4V2EA 1M10B 2OMTA 5CMPA 1DCEA 2P1MB 4R5DA 4FS7A 3W3MA 2Z62A 3RFSA 1FQVA 4RCAB 5HZLB 1PGVA 3ZYJA 3OGMB 1A4YA 4LSXC 3W3LA 4R09A 3WPIA 3E6JA 4V2DA 2P1OB 4PKIG 1IO0A 3G3AA 2WQXA 3PMHG 1KOHA 3G3BA 2OMVA 4BSSA 4Q3GA 3W3KA 4CNMA 4PQ8A 4FHOA 2WQWA 4L3AA 3OJAB 4Z94G 2XOTA 2RA8A 1YRGA 3G06A 3ZYNA 2V9TB 3E4GA 1Z7XW 2ASTB 4Z61C 4FD0A 3C6OB 5FTTB 1JL5A 4R58A 4K17A 4Q62A 1ZIWA 1XECA 2FT3A 5GMHA 1OTOA 1OTNA 3C6PB 1OOKG 3UL9A 1OGQA 4CNCA 4BSRA 4MQWX 5GQRK 4KT1A 3W3GA 4LSXA 2Z63A 3OGKB 2JQDA 2UZXA 1O6VA 2JE0A 2O6SA 2Z82A 4P8SA 3UL8A 4RCWA 4L3FA 4UFRA 1GWBA 4ECOA 5HDHA 3W3JA 5AWAA 4M7EC 4J4LA 5LFNA 5B4PA 3ZYOA 4XGOA 4LI2A 2ID5A 3JB9j 4Q3IA 1M9SA 4P91A 4FDWA 2O6RA 2Z81A 2JE1A 5AWDA 2Z64A 4R6AA 3A79B 4R6FA 4I6JB 2OMZA 4LXRA 1H6TA 1M9LA 2Z7XA 4QC0A 4TZHA 2ASSB 2WFHA 4U06A 2R9UA 1QYYA 5GMGA 1LTXA 3UL7A 5IJCA 3VQ1A 1G9UA 3GOZA 3WPEA 4R07A 5GS2B 4C2BB 4HQ1A 5GS0A 3RW7A 5GMFA 3ULVA 2Z66A 3DZEA 4QXEA 4R08A 4WP6A 3WPGA 3REZA 1OZNA 1SQ0B 4XSQA 5AWBA 3W3NA 3SB4A 4KXFB 2IFGA 2ELLA 4M7EA 2Z7XB 5IYXC 5B0TA 4Z64C 1DS9A 3G39A 3RGXA 4CILA 1M0ZA 3CIYA 3RGZA 1XWDC 2OMUA 3KJ4A 3G04C 2WQUA 1FT8A 3WPFA 4R0AA 4LSAA 1O6TA 2BEXA 3BZ5A 2WQVA 3O53A 4YEBB 3TSRE 2A0ZA 3E3ZA 3WPCA 4ARNA 3P72A 2V70A 3ZYIA 4CC4C
chains in the Genus database with same CATH superfamily
4AY9X 3E2JA 4ECNA 4R5CA 3O6NA 4GLPA 4ARRA 4U09A 3OGLB 1U0ND 4IM6A 4Z8GA 4CP6A 4NKHA 2P1QB 1XEUA 3RJ0A 3WPHA 2P1PB 4LSCA 3OJAA 4C2AB 4AW4A 5IJDA 1H6UA 1XKUA 4V2CA 4XOSA 4WYKA 3ULUA 5AWCA 3UN9A 1P8TA 1OTMA 4PERA 2OMWA 4FMZA 4R6GA 4MN8B 4OQTA 5B0NA 2OMYA 4GT6A 3M18A 1FS2A 4QBZA 1A9NA 3RIZA 2RR6A 4U08A 5AZ5A 3CIGA 2Y5QA 4EZGA 1W8AA 4LI1A 3RW6A 4CC4A 1KOOA 1P8VA 2XWTC 2P1NB 3VQ2A 4PEQB 3FXIA 1P9AG 1D0BA 3C6NB 4LXSA 2OMXA 4PSJA 4Z79A 2Z65A 3WPDA 4BSUA 3M19A 4KNGA 3ULAA 4G8AA 2V9SA 4B8CD 1O6SA 1DFJI 1K5DC 2O6QA 2Q4GW 4U7LA 3WN4A 1XCDA 1FO1A 3WPBA 2UZYA 4RWTC 4J0MA 1K5GC 5D3IA 4BV4R 1WWLA 4NKGA 5A5CA 3RFJA 4H09A 4Y61B 4FCGA 4R6JA 2BNHA 5CMNA 5IJBA 3CVRA 4NZTM 2CA6A 3RFEA 4V2EA 1M10B 2OMTA 5CMPA 1DCEA 2P1MB 4R5DA 4FS7A 3W3MA 2Z62A 3RFSA 1FQVA 4RCAB 5HZLB 1PGVA 3ZYJA 3OGMB 1A4YA 4LSXC 3W3LA 4R09A 3WPIA 3E6JA 4V2DA 2P1OB 4PKIG 1IO0A 3G3AA 2WQXA 3PMHG 1KOHA 3G3BA 2OMVA 4BSSA 4Q3GA 3W3KA 4CNMA 4PQ8A 4FHOA 2WQWA 4L3AA 3OJAB 4Z94G 2XOTA 2RA8A 1YRGA 3G06A 3ZYNA 2V9TB 3E4GA 1Z7XW 2ASTB 4Z61C 4FD0A 3C6OB 5FTTB 1JL5A 4R58A 4K17A 4Q62A 1ZIWA 1XECA 2FT3A 5GMHA 1OTOA 1OTNA 3C6PB 4NZRM 1OOKG 3UL9A 1OGQA 4CNCA 4BSRA 4MQWX 5GQRK 4KT1A 3W3GA 4LSXA 2Z63A 3OGKB 2JQDA 2UZXA 1O6VA 2JE0A 2O6SA 2Z82A 4P8SA 3UL8A 4RCWA 4L3FA 4UFRA 1GWBA 4ECOA 5HDHA 3W3JA 5AWAA 4M7EC 4J4LA 5LFNA 5B4PA 3ZYOA 4XGOA 4LI2A 2ID5A 3JB9j 4Q3IA 1M9SA 4P91A 4FDWA 2O6RA 2Z81A 2JE1A 5AWDA 2Z64A 4R6AA 3A79B 4R6FA 4I6JB 2OMZA 4LXRA 1H6TA 1M9LA 2Z7XA 4QC0A 4TZHA 2ASSB 2WFHA 4U06A 2R9UA 1QYYA 5GMGA 1LTXA 3UL7A 5IJCA 3VQ1A 1G9UA 3GOZA 3WPEA 4R07A 5GS2B 4C2BB 4HQ1A 5GS0A 3RW7A 5GMFA 3ULVA 2Z66A 3DZEA 4QXEA 4R08A 4WP6A 3WPGA 3REZA 1OZNA 1SQ0B 4XSQA 5AWBA 3W3NA 3SB4A 4KXFB 2IFGA 2ELLA 4M7EA 2Z7XB 5IYXC 5B0TA 4Z64C 1DS9A 3G39A 3RGXA 4CILA 1M0ZA 3CIYA 3RGZA 1XWDC 2OMUA 3KJ4A 3G04C 2WQUA 1FT8A 3WPFA 4R0AA 4LSAA 1O6TA 2BEXA 3BZ5A 2WQVA 3O53A 4YEBB 3TSRE 2A0ZA 3E3ZA 3WPCA 4ARNA 3P72A 2V70A 3ZYIA 4CC4C
chains in the Genus database with same CATH topology
4AY9X 3E2JA 4ECNA 4R5CA 3O6NA 4GLPA 4ARRA 4U09A 3OGLB 1U0ND 4IM6A 4Z8GA 4CP6A 4NKHA 2P1QB 1XEUA 3RJ0A 3WPHA 2P1PB 4LSCA 3OJAA 4C2AB 4AW4A 5IJDA 1H6UA 1XKUA 4V2CA 4XOSA 4WYKA 3ULUA 5AWCA 3UN9A 1P8TA 1OTMA 4PERA 2OMWA 4FMZA 4R6GA 4MN8B 4OQTA 5B0NA 2OMYA 4GT6A 3M18A 1FS2A 4QBZA 1A9NA 3RIZA 2RR6A 4U08A 5AZ5A 3CIGA 2Y5QA 4EZGA 1W8AA 4LI1A 3RW6A 4CC4A 1KOOA 1P8VA 2XWTC 2P1NB 3VQ2A 4PEQB 3FXIA 1P9AG 1D0BA 3C6NB 4LXSA 2OMXA 4PSJA 4Z79A 2Z65A 3WPDA 4BSUA 3M19A 4KNGA 3ULAA 4G8AA 2V9SA 4B8CD 1O6SA 1DFJI 1K5DC 2O6QA 2Q4GW 4U7LA 3WN4A 1XCDA 1FO1A 3WPBA 2UZYA 4RWTC 4J0MA 1K5GC 5D3IA 4BV4R 1WWLA 4NKGA 5A5CA 3RFJA 4H09A 4Y61B 4FCGA 4R6JA 2BNHA 5CMNA 5IJBA 3CVRA 2CA6A 3RFEA 4V2EA 1M10B 2OMTA 5CMPA 1DCEA 2P1MB 4R5DA 4FS7A 3W3MA 2Z62A 3RFSA 1FQVA 4RCAB 5HZLB 1PGVA 3ZYJA 3OGMB 1A4YA 4LSXC 3W3LA 4R09A 3WPIA 3E6JA 4V2DA 2P1OB 4PKIG 1IO0A 3G3AA 2WQXA 3PMHG 1KOHA 3G3BA 2OMVA 4BSSA 4Q3GA 3W3KA 4CNMA 4PQ8A 4FHOA 2WQWA 4L3AA 3OJAB 4Z94G 2XOTA 2RA8A 1YRGA 3G06A 3ZYNA 2V9TB 3E4GA 1Z7XW 2ASTB 4Z61C 4FD0A 3C6OB 5FTTB 1JL5A 4R58A 4K17A 4Q62A 1ZIWA 1XECA 2FT3A 5GMHA 1OTOA 1OTNA 3C6PB 1OOKG 3UL9A 1OGQA 4CNCA 4BSRA 4MQWX 5GQRK 4KT1A 3W3GA 4LSXA 2Z63A 3OGKB 2JQDA 2UZXA 1O6VA 2JE0A 2O6SA 2Z82A 4P8SA 3UL8A 4RCWA 4L3FA 4UFRA 1GWBA 4ECOA 5HDHA 3W3JA 5AWAA 4M7EC 4J4LA 5LFNA 5B4PA 3ZYOA 4XGOA 4LI2A 2ID5A 3JB9j 4Q3IA 1M9SA 4P91A 4FDWA 2O6RA 2Z81A 2JE1A 5AWDA 2Z64A 4R6AA 3A79B 4R6FA 4I6JB 2OMZA 4LXRA 1H6TA 1M9LA 2Z7XA 4QC0A 4TZHA 2ASSB 2WFHA 4U06A 2R9UA 1QYYA 5GMGA 1LTXA 3UL7A 5IJCA 3VQ1A 1G9UA 3GOZA 3WPEA 4R07A 5GS2B 4C2BB 4HQ1A 5GS0A 3RW7A 5GMFA 3ULVA 2Z66A 3DZEA 4QXEA 4R08A 4WP6A 3WPGA 3REZA 1OZNA 1SQ0B 4XSQA 5AWBA 3W3NA 3SB4A 4KXFB 2IFGA 2ELLA 4M7EA 2Z7XB 5IYXC 5B0TA 4Z64C 1DS9A 3G39A 3RGXA 4CILA 1M0ZA 3CIYA 3RGZA 1XWDC 2OMUA 3KJ4A 3G04C 2WQUA 1FT8A 3WPFA 4R0AA 4LSAA 1O6TA 2BEXA 3BZ5A 2WQVA 3O53A 4YEBB 3TSRE 2A0ZA 3E3ZA 3WPCA 4ARNA 3P72A 2V70A 3ZYIA 4CC4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY9 X;  3E2J A;  4ECN A;  4R5C A;  3O6N A;  4GLP A;  4ARR A;  4U09 A;  3OGL B;  1U0N D;  4IM6 A;  4Z8G A;  4CP6 A;  4NKH A;  2P1Q B;  1XEU A;  3RJ0 A;  3WPH A;  2P1P B;  4LSC A;  3OJA A;  4C2A B;  4AW4 A;  5IJD A;  1H6U A;  1XKU A;  4V2C A;  4XOS A;  4WYK A;  3ULU A;  5AWC A;  3UN9 A;  1P8T A;  1OTM A;  4PER A;  2OMW A;  4FMZ A;  4R6G A;  4MN8 B;  4OQT A;  5B0N A;  2OMY A;  4GT6 A;  3M18 A;  1FS2 A;  4QBZ A;  1A9N A;  3RIZ A;  2RR6 A;  4U08 A;  5AZ5 A;  3CIG A;  2Y5Q A;  4EZG A;  1W8A A;  4LI1 A;  3RW6 A;  4CC4 A;  1KOO A;  1P8V A;  2XWT C;  2P1N B;  3VQ2 A;  4PEQ B;  3FXI A;  1P9A G;  1D0B A;  3C6N B;  4LXS A;  2OMX A;  4PSJ A;  4Z79 A;  2Z65 A;  3WPD A;  4BSU A;  3M19 A;  4KNG A;  3ULA A;  4G8A A;  2V9S A;  4B8C D;  1O6S A;  1DFJ I;  1K5D C;  2O6Q A;  2Q4G W;  4U7L A;  3WN4 A;  1XCD A;  1FO1 A;  3WPB A;  2UZY A;  4RWT C;  4J0M A;  1K5G C;  5D3I A;  4BV4 R;  1WWL A;  4NKG A;  5A5C A;  3RFJ A;  4H09 A;  4Y61 B;  4FCG A;  4R6J A;  2BNH A;  5CMN A;  5IJB A;  3CVR A;  2CA6 A;  3RFE A;  4V2E A;  1M10 B;  2OMT A;  5CMP A;  1DCE A;  2P1M B;  4R5D A;  4FS7 A;  3W3M A;  2Z62 A;  3RFS A;  1FQV A;  4RCA B;  5HZL B;  1PGV A;  3ZYJ A;  3OGM B;  1A4Y A;  4LSX C;  3W3L A;  4R09 A;  3WPI A;  3E6J A;  4V2D A;  2P1O B;  4PKI G;  1IO0 A;  3G3A A;  2WQX A;  3PMH G;  1KOH A;  3G3B A;  2OMV A;  4BSS A;  4Q3G A;  3W3K A;  4CNM A;  4PQ8 A;  4FHO A;  2WQW A;  4L3A A;  3OJA B;  4Z94 G;  2XOT A;  2RA8 A;  1YRG A;  3G06 A;  3ZYN A;  2V9T B;  3E4G A;  1Z7X W;  2AST B;  4Z61 C;  4FD0 A;  3C6O B;  5FTT B;  1JL5 A;  4R58 A;  4K17 A;  4Q62 A;  1ZIW A;  1XEC A;  2FT3 A;  5GMH A;  1OTO A;  1OTN A;  3C6P B;  1OOK G;  3UL9 A;  1OGQ A;  4CNC A;  4BSR A;  4MQW X;  5GQR K;  4KT1 A;  3W3G A;  4LSX A;  2Z63 A;  3OGK B;  2JQD A;  2UZX A;  1O6V A;  2JE0 A;  2O6S A;  2Z82 A;  4P8S A;  3UL8 A;  4RCW A;  4L3F A;  4UFR A;  1GWB A;  4ECO A;  5HDH A;  3W3J A;  5AWA A;  4M7E C;  4J4L A;  5LFN A;  5B4P A;  3ZYO A;  4XGO A;  4LI2 A;  2ID5 A;  3JB9 j;  4Q3I A;  1M9S A;  4P91 A;  4FDW A;  2O6R A;  2Z81 A;  2JE1 A;  5AWD A;  2Z64 A;  4R6A A;  3A79 B;  4R6F A;  4I6J B;  2OMZ A;  4LXR A;  1H6T A;  1M9L A;  2Z7X A;  4QC0 A;  4TZH A;  2ASS B;  2WFH A;  4U06 A;  2R9U A;  1QYY A;  5GMG A;  1LTX A;  3UL7 A;  5IJC A;  3VQ1 A;  1G9U A;  3GOZ A;  3WPE A;  4R07 A;  5GS2 B;  4C2B B;  4HQ1 A;  5GS0 A;  3RW7 A;  5GMF A;  3ULV A;  2Z66 A;  3DZE A;  4QXE A;  4R08 A;  4WP6 A;  3WPG A;  3REZ A;  1OZN A;  1SQ0 B;  4XSQ A;  5AWB A;  3W3N A;  3SB4 A;  4KXF B;  2IFG A;  2ELL A;  4M7E A;  2Z7X B;  5IYX C;  5B0T A;  4Z64 C;  1DS9 A;  3G39 A;  3RGX A;  4CIL A;  1M0Z A;  3CIY A;  3RGZ A;  1XWD C;  2OMU A;  3KJ4 A;  3G04 C;  2WQU A;  1FT8 A;  3WPF A;  4R0A A;  4LSA A;  1O6T A;  2BEX A;  3BZ5 A;  2WQV A;  3O53 A;  4YEB B;  3TSR E;  2A0Z A;  3E3Z A;  3WPC A;  4ARN A;  3P72 A;  2V70 A;  3ZYI A;  4CC4 C; 
#chains in the Genus database with same CATH topology
 4AY9 X;  3E2J A;  4ECN A;  4R5C A;  3O6N A;  4GLP A;  4ARR A;  4U09 A;  3OGL B;  1U0N D;  4IM6 A;  4Z8G A;  4CP6 A;  4NKH A;  2P1Q B;  1XEU A;  3RJ0 A;  3WPH A;  2P1P B;  4LSC A;  3OJA A;  4C2A B;  4AW4 A;  5IJD A;  1H6U A;  1XKU A;  4V2C A;  4XOS A;  4WYK A;  3ULU A;  5AWC A;  3UN9 A;  1P8T A;  1OTM A;  4PER A;  2OMW A;  4FMZ A;  4R6G A;  4MN8 B;  4OQT A;  5B0N A;  2OMY A;  4GT6 A;  3M18 A;  1FS2 A;  4QBZ A;  1A9N A;  3RIZ A;  2RR6 A;  4U08 A;  5AZ5 A;  3CIG A;  2Y5Q A;  4EZG A;  1W8A A;  4LI1 A;  3RW6 A;  4CC4 A;  1KOO A;  1P8V A;  2XWT C;  2P1N B;  3VQ2 A;  4PEQ B;  3FXI A;  1P9A G;  1D0B A;  3C6N B;  4LXS A;  2OMX A;  4PSJ A;  4Z79 A;  2Z65 A;  3WPD A;  4BSU A;  3M19 A;  4KNG A;  3ULA A;  4G8A A;  2V9S A;  4B8C D;  1O6S A;  1DFJ I;  1K5D C;  2O6Q A;  2Q4G W;  4U7L A;  3WN4 A;  1XCD A;  1FO1 A;  3WPB A;  2UZY A;  4RWT C;  4J0M A;  1K5G C;  5D3I A;  4BV4 R;  1WWL A;  4NKG A;  5A5C A;  3RFJ A;  4H09 A;  4Y61 B;  4FCG A;  4R6J A;  2BNH A;  5CMN A;  5IJB A;  3CVR A;  4NZT M;  2CA6 A;  3RFE A;  4V2E A;  1M10 B;  2OMT A;  5CMP A;  1DCE A;  2P1M B;  4R5D A;  4FS7 A;  3W3M A;  2Z62 A;  3RFS A;  1FQV A;  4RCA B;  5HZL B;  1PGV A;  3ZYJ A;  3OGM B;  1A4Y A;  4LSX C;  3W3L A;  4R09 A;  3WPI A;  3E6J A;  4V2D A;  2P1O B;  4PKI G;  1IO0 A;  3G3A A;  2WQX A;  3PMH G;  1KOH A;  3G3B A;  2OMV A;  4BSS A;  4Q3G A;  3W3K A;  4CNM A;  4PQ8 A;  4FHO A;  2WQW A;  4L3A A;  3OJA B;  4Z94 G;  2XOT A;  2RA8 A;  1YRG A;  3G06 A;  3ZYN A;  2V9T B;  3E4G A;  1Z7X W;  2AST B;  4Z61 C;  4FD0 A;  3C6O B;  5FTT B;  1JL5 A;  4R58 A;  4K17 A;  4Q62 A;  1ZIW A;  1XEC A;  2FT3 A;  5GMH A;  1OTO A;  1OTN A;  3C6P B;  4NZR M;  1OOK G;  3UL9 A;  1OGQ A;  4CNC A;  4BSR A;  4MQW X;  5GQR K;  4KT1 A;  3W3G A;  4LSX A;  2Z63 A;  3OGK B;  2JQD A;  2UZX A;  1O6V A;  2JE0 A;  2O6S A;  2Z82 A;  4P8S A;  3UL8 A;  4RCW A;  4L3F A;  4UFR A;  1GWB A;  4ECO A;  5HDH A;  3W3J A;  5AWA A;  4M7E C;  4J4L A;  5LFN A;  5B4P A;  3ZYO A;  4XGO A;  4LI2 A;  2ID5 A;  3JB9 j;  4Q3I A;  1M9S A;  4P91 A;  4FDW A;  2O6R A;  2Z81 A;  2JE1 A;  5AWD A;  2Z64 A;  4R6A A;  3A79 B;  4R6F A;  4I6J B;  2OMZ A;  4LXR A;  1H6T A;  1M9L A;  2Z7X A;  4QC0 A;  4TZH A;  2ASS B;  2WFH A;  4U06 A;  2R9U A;  1QYY A;  5GMG A;  1LTX A;  3UL7 A;  5IJC A;  3VQ1 A;  1G9U A;  3GOZ A;  3WPE A;  4R07 A;  5GS2 B;  4C2B B;  4HQ1 A;  5GS0 A;  3RW7 A;  5GMF A;  3ULV A;  2Z66 A;  3DZE A;  4QXE A;  4R08 A;  4WP6 A;  3WPG A;  3REZ A;  1OZN A;  1SQ0 B;  4XSQ A;  5AWB A;  3W3N A;  3SB4 A;  4KXF B;  2IFG A;  2ELL A;  4M7E A;  2Z7X B;  5IYX C;  5B0T A;  4Z64 C;  1DS9 A;  3G39 A;  3RGX A;  4CIL A;  1M0Z A;  3CIY A;  3RGZ A;  1XWD C;  2OMU A;  3KJ4 A;  3G04 C;  2WQU A;  1FT8 A;  3WPF A;  4R0A A;  4LSA A;  1O6T A;  2BEX A;  3BZ5 A;  2WQV A;  3O53 A;  4YEB B;  3TSR E;  2A0Z A;  3E3Z A;  3WPC A;  4ARN A;  3P72 A;  2V70 A;  3ZYI A;  4CC4 C; 
#chains in the Genus database with same CATH homology
 4AY9 X;  3E2J A;  4ECN A;  4R5C A;  3O6N A;  4GLP A;  4ARR A;  4U09 A;  3OGL B;  1U0N D;  4IM6 A;  4Z8G A;  4CP6 A;  4NKH A;  2P1Q B;  1XEU A;  3RJ0 A;  3WPH A;  2P1P B;  4LSC A;  3OJA A;  4C2A B;  4AW4 A;  5IJD A;  1H6U A;  1XKU A;  4V2C A;  4XOS A;  4WYK A;  3ULU A;  5AWC A;  3UN9 A;  1P8T A;  1OTM A;  4PER A;  2OMW A;  4FMZ A;  4R6G A;  4MN8 B;  4OQT A;  5B0N A;  2OMY A;  4GT6 A;  3M18 A;  1FS2 A;  4QBZ A;  1A9N A;  3RIZ A;  2RR6 A;  4U08 A;  5AZ5 A;  3CIG A;  2Y5Q A;  4EZG A;  1W8A A;  4LI1 A;  3RW6 A;  4CC4 A;  1KOO A;  1P8V A;  2XWT C;  2P1N B;  3VQ2 A;  4PEQ B;  3FXI A;  1P9A G;  1D0B A;  3C6N B;  4LXS A;  2OMX A;  4PSJ A;  4Z79 A;  2Z65 A;  3WPD A;  4BSU A;  3M19 A;  4KNG A;  3ULA A;  4G8A A;  2V9S A;  4B8C D;  1O6S A;  1DFJ I;  1K5D C;  2O6Q A;  2Q4G W;  4U7L A;  3WN4 A;  1XCD A;  1FO1 A;  3WPB A;  2UZY A;  4RWT C;  4J0M A;  1K5G C;  5D3I A;  4BV4 R;  1WWL A;  4NKG A;  5A5C A;  3RFJ A;  4H09 A;  4Y61 B;  4FCG A;  4R6J A;  2BNH A;  5CMN A;  5IJB A;  3CVR A;  2CA6 A;  3RFE A;  4V2E A;  1M10 B;  2OMT A;  5CMP A;  1DCE A;  2P1M B;  4R5D A;  4FS7 A;  3W3M A;  2Z62 A;  3RFS A;  1FQV A;  4RCA B;  5HZL B;  1PGV A;  3ZYJ A;  3OGM B;  1A4Y A;  4LSX C;  3W3L A;  4R09 A;  3WPI A;  3E6J A;  4V2D A;  2P1O B;  4PKI G;  1IO0 A;  3G3A A;  2WQX A;  3PMH G;  1KOH A;  3G3B A;  2OMV A;  4BSS A;  4Q3G A;  3W3K A;  4CNM A;  4PQ8 A;  4FHO A;  2WQW A;  4L3A A;  3OJA B;  4Z94 G;  2XOT A;  2RA8 A;  1YRG A;  3G06 A;  3ZYN A;  2V9T B;  3E4G A;  1Z7X W;  2AST B;  4Z61 C;  4FD0 A;  3C6O B;  5FTT B;  1JL5 A;  4R58 A;  4K17 A;  4Q62 A;  1ZIW A;  1XEC A;  2FT3 A;  5GMH A;  1OTO A;  1OTN A;  3C6P B;  1OOK G;  3UL9 A;  1OGQ A;  4CNC A;  4BSR A;  4MQW X;  5GQR K;  4KT1 A;  3W3G A;  4LSX A;  2Z63 A;  3OGK B;  2JQD A;  2UZX A;  1O6V A;  2JE0 A;  2O6S A;  2Z82 A;  4P8S A;  3UL8 A;  4RCW A;  4L3F A;  4UFR A;  1GWB A;  4ECO A;  5HDH A;  3W3J A;  5AWA A;  4M7E C;  4J4L A;  5LFN A;  5B4P A;  3ZYO A;  4XGO A;  4LI2 A;  2ID5 A;  3JB9 j;  4Q3I A;  1M9S A;  4P91 A;  4FDW A;  2O6R A;  2Z81 A;  2JE1 A;  5AWD A;  2Z64 A;  4R6A A;  3A79 B;  4R6F A;  4I6J B;  2OMZ A;  4LXR A;  1H6T A;  1M9L A;  2Z7X A;  4QC0 A;  4TZH A;  2ASS B;  2WFH A;  4U06 A;  2R9U A;  1QYY A;  5GMG A;  1LTX A;  3UL7 A;  5IJC A;  3VQ1 A;  1G9U A;  3GOZ A;  3WPE A;  4R07 A;  5GS2 B;  4C2B B;  4HQ1 A;  5GS0 A;  3RW7 A;  5GMF A;  3ULV A;  2Z66 A;  3DZE A;  4QXE A;  4R08 A;  4WP6 A;  3WPG A;  3REZ A;  1OZN A;  1SQ0 B;  4XSQ A;  5AWB A;  3W3N A;  3SB4 A;  4KXF B;  2IFG A;  2ELL A;  4M7E A;  2Z7X B;  5IYX C;  5B0T A;  4Z64 C;  1DS9 A;  3G39 A;  3RGX A;  4CIL A;  1M0Z A;  3CIY A;  3RGZ A;  1XWD C;  2OMU A;  3KJ4 A;  3G04 C;  2WQU A;  1FT8 A;  3WPF A;  4R0A A;  4LSA A;  1O6T A;  2BEX A;  3BZ5 A;  2WQV A;  3O53 A;  4YEB B;  3TSR E;  2A0Z A;  3E3Z A;  3WPC A;  4ARN A;  3P72 A;  2V70 A;  3ZYI A;  4CC4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...