3E6KA

X-ray structure of human arginase i: the mutant d183a in complex with abh
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
308
structure length
308
Chain Sequence
RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVAPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Probing the specificity determinants of amino acid recognition by arginase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3e6kA00
3F80A 3KV2A 4IXVA 3MFVA 3MJLA 2EIVA 3THJA 3LHLA 4Q41A 1P8NA 1T4PA 3PZLA 3TH7A 4Q3RA 1HQ5A 4IE2A 4Q42A 1TBJA 1WOHA 1GQ6A 1TA1A 2ZAVA 4Q3TA 2PHAA 1P8RA 3LP7A 4MYNA 5RLAA 4RHJA 3SL0A 3E8ZA 4IE3A 4MYFA 3THEA 2PHOA 1TBHA 4CEVA 3GMZA 1P8QA 4Q3VA 1WVBA 1P8OA 4Q3QA 4HWWA 3RLAA 4RHLA 1RLAA 1T5GA 1D3VA 4IU4A 4RHQA 2RLAA 4FCKA 3MFWA 1TBLA 3SKKA 1P8PA 3CEVA 3THHA 4GSZA 1HQHA 2CEVA 4Q3RC 4GWDA 4Q3UA 4IXUA 1P8SA 1T4RA 1HQXA 4MXRA 3DJ8A 4G3HA 1CEVA 3E6VA 1GQ7A 4RHKA 3TF3A 4MYKA 1T4TA 4RLAA 1T4SA 1HQGA 4GSVA 3E6KA 2PLLA 4DZ4A 3E9BA 3SJTA 1ZPGA 3E8QA 1P8MA 3NIPA 4HXQA 1R1OA 2AEBA 1PQ3A 4HZEA 3M1RA 4RHMA 3MMRA 5HJAA 4GWCA 3NIOA 4Q3SA 3NIQA 4IU5A 4FCIA 1WOIA 1WVAA 1WOGA 3LP4A 4ITYA 5CEVA 4RHIA 4I06A 3GN0A 4GSMA 3SL1A 4IU1A 4Q3PA 2EF5A 2EF4A 1T5FA 5HJ9A 1HQFA 4Q40A 1ZPEA 2A0MA 4IE1A 4MYLA 4IU0A 1XFKA
chains in the Genus database with same CATH superfamily
5G0GA 3F80A 3KV2A 4QA1A 4ZUNA 5EEIA 5G1AA 5G11A 5A2SA 3Q9EA 5EFGA 4IXVA 2GH6A 2VQQA 3MFVA 2EIVA 1VKGA 2VQMA 3MJLA 3MZ4A 3LHLA 3THJA 4Q41A 1P8NA 1T4PA 5FCWA 5G0YA 2VQWG 3PZLA 3Q9BA 4Q3RA 1ZZ3A 4QA2A 5EEMA 3TH7A 1HQ5A 3C0ZA 1C3PA 5IWGA 4IE2A 4Q42A 1TBJA 1WOHA 1GQ6A 1TA1A 5EFBD 4ZUOA 5G17A 2ZAVA 4Q3TA 4BZ9A 2PHAA 1P8RA 3LP7A 2V5XA 2VQOA 4RN0A 4MYNA 3MZ7A 5DC8A 5RLAA 3F0RA 4QA5A 4RHJA 5EFKB 5THSA 5D1CA 3E8ZA 4IE3A 3SL0A 5ICNB 4MYFA 3THEA 2PHOA 5DC6A 3Q9CA 5THVA 1TBHA 4CEVA 5G0IA 3GMZA 5IX0A 1P8QA 3C0YA 1WVBA 4Q3VA 5BWZA 1P8OA 4Q3QA 4QA4A 4HWWA 5EEFA 3RLAA 4RHLA 5G0HA 3MZ3A 1RLAA 1T5GA 1D3VA 4RN2A 4IU4A 1C3SA 5EENA 5EFHA 4RHQA 5G1BA 5G10A 2RLAA 2VQVA 4FCKA 4LXZA 5THTA 3MFWA 4CBYA 1TBLA 3SKKA 4CQFA 5EFJD 1P8PA 3CEVA 3THHA 4GSZA 5DC7A 1HQHA 2CEVA 1ZZ0A 3EW8A 4GWDA 4Q3RC 4Q3UA 5G1CA 4IXUA 3RQDA 1P8SA 1T4RA 4A69A 4BZ8A 4ZUPA 1HQXA 4MXRA 3DJ8A 4G3HA 1CEVA 4QA0A 3EWFA 5EEKA 4BZ5A 5D1BA 3E6VA 4QA3A 4BZ6A 5G13A 1GQ7A 4RHKA 3SFFA 4BKXB 3TF3A 4MYKA 1T4TA 4RLAA 1W22A 1T4SA 1HQGA 3C10A 5G12A 4GSVA 3E6KA 2PLLA 4DZ4A 3E9BA 3F07A 3SJTA 1ZPGA 3E8QA 5EF7A 5LI3A 1P8MA 4QA7A 3EZTA 5THUA 3NIPA 5FUEA 4HXQA 1T64A 5DC5A 4ZURA 1R1OA 4LY1A 1C3RA 4ZUQA 4RN1A 2AEBA 1PQ3A 4HZEA 2VCGA 5G3WA 3M1RA 3MAXA 3ZNSA 1ZZ1A 5EFNA 4CBTA 4RHMA 3MMRA 5HJAA 4GWCA 3NIOA 5G0XA 4Q3SA 3NIQA 4IU5A 4FCIA 1WOIA 1WVAA 5EF8A 3MZ6A 1WOGA 3LP4A 4ITYA 5CEVA 3ZNRA 4RHIA 3MENA 4I06A 3GN0A 1T69A 4GSMA 5G0JA 3SL1A 4BZ7A 4IU1A 4Q3PA 4QA6A 4ZUMA 2EF5A 2EF4A 3Q9FA 1T5FA 2VQJA 5JI5A 5HJ9A 1HQFA 4Q40A 1ZPEA 1T67A 2A0MA 2V5WA 3F06A 3SFHA 5D1DA 4IE1A 4MYLA 3EZPA 4IU0A 1XFKA
chains in the Genus database with same CATH topology
3F80A 3KV2A 4IXVA 3MFVA 3MJLA 2EIVA 3THJA 3LHLA 4Q41A 1P8NA 1T4PA 3PZLA 3TH7A 4Q3RA 1HQ5A 4IE2A 4Q42A 1TBJA 1WOHA 1GQ6A 1TA1A 2ZAVA 4Q3TA 2PHAA 1P8RA 3LP7A 4MYNA 5RLAA 4RHJA 3SL0A 3E8ZA 4IE3A 4MYFA 3THEA 2PHOA 1TBHA 4CEVA 3GMZA 1P8QA 4Q3VA 1WVBA 1P8OA 4Q3QA 4HWWA 3RLAA 4RHLA 1RLAA 1T5GA 1D3VA 4IU4A 4RHQA 2RLAA 4FCKA 3MFWA 1TBLA 3SKKA 1P8PA 3CEVA 3THHA 4GSZA 1HQHA 2CEVA 4Q3RC 4GWDA 4Q3UA 4IXUA 1P8SA 1T4RA 1HQXA 4MXRA 3DJ8A 4G3HA 1CEVA 3E6VA 1GQ7A 4RHKA 3TF3A 4MYKA 1T4TA 4RLAA 1T4SA 1HQGA 4GSVA 3E6KA 2PLLA 4DZ4A 3E9BA 3SJTA 1ZPGA 3E8QA 1P8MA 3NIPA 4HXQA 1R1OA 2AEBA 1PQ3A 4HZEA 3M1RA 4RHMA 3MMRA 5HJAA 4GWCA 3NIOA 4Q3SA 3NIQA 4IU5A 4FCIA 1WOIA 1WVAA 1WOGA 3LP4A 4ITYA 5CEVA 4RHIA 4I06A 3GN0A 4GSMA 3SL1A 4IU1A 4Q3PA 2EF5A 2EF4A 1T5FA 5HJ9A 1HQFA 4Q40A 1ZPEA 2A0MA 4IE1A 4MYLA 4IU0A 1XFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F80 A;  3KV2 A;  4IXV A;  3MFV A;  3MJL A;  2EIV A;  3THJ A;  3LHL A;  4Q41 A;  1P8N A;  1T4P A;  3PZL A;  3TH7 A;  4Q3R A;  1HQ5 A;  4IE2 A;  4Q42 A;  1TBJ A;  1WOH A;  1GQ6 A;  1TA1 A;  2ZAV A;  4Q3T A;  2PHA A;  1P8R A;  3LP7 A;  4MYN A;  5RLA A;  4RHJ A;  3SL0 A;  3E8Z A;  4IE3 A;  4MYF A;  3THE A;  2PHO A;  1TBH A;  4CEV A;  3GMZ A;  1P8Q A;  4Q3V A;  1WVB A;  1P8O A;  4Q3Q A;  4HWW A;  3RLA A;  4RHL A;  1RLA A;  1T5G A;  1D3V A;  4IU4 A;  4RHQ A;  2RLA A;  4FCK A;  3MFW A;  1TBL A;  3SKK A;  1P8P A;  3CEV A;  3THH A;  4GSZ A;  1HQH A;  2CEV A;  4Q3R C;  4GWD A;  4Q3U A;  4IXU A;  1P8S A;  1T4R A;  1HQX A;  4MXR A;  3DJ8 A;  4G3H A;  1CEV A;  3E6V A;  1GQ7 A;  4RHK A;  3TF3 A;  4MYK A;  1T4T A;  4RLA A;  1T4S A;  1HQG A;  4GSV A;  3E6K A;  2PLL A;  4DZ4 A;  3E9B A;  3SJT A;  1ZPG A;  3E8Q A;  1P8M A;  3NIP A;  4HXQ A;  1R1O A;  2AEB A;  1PQ3 A;  4HZE A;  3M1R A;  4RHM A;  3MMR A;  5HJA A;  4GWC A;  3NIO A;  4Q3S A;  3NIQ A;  4IU5 A;  4FCI A;  1WOI A;  1WVA A;  1WOG A;  3LP4 A;  4ITY A;  5CEV A;  4RHI A;  4I06 A;  3GN0 A;  4GSM A;  3SL1 A;  4IU1 A;  4Q3P A;  2EF5 A;  2EF4 A;  1T5F A;  5HJ9 A;  1HQF A;  4Q40 A;  1ZPE A;  2A0M A;  4IE1 A;  4MYL A;  4IU0 A;  1XFK A; 
#chains in the Genus database with same CATH topology
 5G0G A;  3F80 A;  3KV2 A;  4QA1 A;  4ZUN A;  5EEI A;  5G1A A;  5G11 A;  5A2S A;  3Q9E A;  5EFG A;  4IXV A;  2GH6 A;  2VQQ A;  3MFV A;  2EIV A;  1VKG A;  2VQM A;  3MJL A;  3MZ4 A;  3LHL A;  3THJ A;  4Q41 A;  1P8N A;  1T4P A;  5FCW A;  5G0Y A;  2VQW G;  3PZL A;  3Q9B A;  4Q3R A;  1ZZ3 A;  4QA2 A;  5EEM A;  3TH7 A;  1HQ5 A;  3C0Z A;  1C3P A;  5IWG A;  4IE2 A;  4Q42 A;  1TBJ A;  1WOH A;  1GQ6 A;  1TA1 A;  5EFB D;  4ZUO A;  5G17 A;  2ZAV A;  4Q3T A;  4BZ9 A;  2PHA A;  1P8R A;  3LP7 A;  2V5X A;  2VQO A;  4RN0 A;  4MYN A;  3MZ7 A;  5DC8 A;  5RLA A;  3F0R A;  4QA5 A;  4RHJ A;  5EFK B;  5THS A;  5D1C A;  3E8Z A;  4IE3 A;  3SL0 A;  5ICN B;  4MYF A;  3THE A;  2PHO A;  5DC6 A;  3Q9C A;  5THV A;  1TBH A;  4CEV A;  5G0I A;  3GMZ A;  5IX0 A;  1P8Q A;  3C0Y A;  1WVB A;  4Q3V A;  5BWZ A;  1P8O A;  4Q3Q A;  4QA4 A;  4HWW A;  5EEF A;  3RLA A;  4RHL A;  5G0H A;  3MZ3 A;  1RLA A;  1T5G A;  1D3V A;  4RN2 A;  4IU4 A;  1C3S A;  5EEN A;  5EFH A;  4RHQ A;  5G1B A;  5G10 A;  2RLA A;  2VQV A;  4FCK A;  4LXZ A;  5THT A;  3MFW A;  4CBY A;  1TBL A;  3SKK A;  4CQF A;  5EFJ D;  1P8P A;  3CEV A;  3THH A;  4GSZ A;  5DC7 A;  1HQH A;  2CEV A;  1ZZ0 A;  3EW8 A;  4GWD A;  4Q3R C;  4Q3U A;  5G1C A;  4IXU A;  3RQD A;  1P8S A;  1T4R A;  4A69 A;  4BZ8 A;  4ZUP A;  1HQX A;  4MXR A;  3DJ8 A;  4G3H A;  1CEV A;  4QA0 A;  3EWF A;  5EEK A;  4BZ5 A;  5D1B A;  3E6V A;  4QA3 A;  4BZ6 A;  5G13 A;  1GQ7 A;  4RHK A;  3SFF A;  4BKX B;  3TF3 A;  4MYK A;  1T4T A;  4RLA A;  1W22 A;  1T4S A;  1HQG A;  3C10 A;  5G12 A;  4GSV A;  3E6K A;  2PLL A;  4DZ4 A;  3E9B A;  3F07 A;  3SJT A;  1ZPG A;  3E8Q A;  5EF7 A;  5LI3 A;  1P8M A;  4QA7 A;  3EZT A;  5THU A;  3NIP A;  5FUE A;  4HXQ A;  1T64 A;  5DC5 A;  4ZUR A;  1R1O A;  4LY1 A;  1C3R A;  4ZUQ A;  4RN1 A;  2AEB A;  1PQ3 A;  4HZE A;  2VCG A;  5G3W A;  3M1R A;  3MAX A;  3ZNS A;  1ZZ1 A;  5EFN A;  4CBT A;  4RHM A;  3MMR A;  5HJA A;  4GWC A;  3NIO A;  5G0X A;  4Q3S A;  3NIQ A;  4IU5 A;  4FCI A;  1WOI A;  1WVA A;  5EF8 A;  3MZ6 A;  1WOG A;  3LP4 A;  4ITY A;  5CEV A;  3ZNR A;  4RHI A;  3MEN A;  4I06 A;  3GN0 A;  1T69 A;  4GSM A;  5G0J A;  3SL1 A;  4BZ7 A;  4IU1 A;  4Q3P A;  4QA6 A;  4ZUM A;  2EF5 A;  2EF4 A;  3Q9F A;  1T5F A;  2VQJ A;  5JI5 A;  5HJ9 A;  1HQF A;  4Q40 A;  1ZPE A;  1T67 A;  2A0M A;  2V5W A;  3F06 A;  3SFH A;  5D1D A;  4IE1 A;  4MYL A;  3EZP A;  4IU0 A;  1XFK A; 
#chains in the Genus database with same CATH homology
 3F80 A;  3KV2 A;  4IXV A;  3MFV A;  3MJL A;  2EIV A;  3THJ A;  3LHL A;  4Q41 A;  1P8N A;  1T4P A;  3PZL A;  3TH7 A;  4Q3R A;  1HQ5 A;  4IE2 A;  4Q42 A;  1TBJ A;  1WOH A;  1GQ6 A;  1TA1 A;  2ZAV A;  4Q3T A;  2PHA A;  1P8R A;  3LP7 A;  4MYN A;  5RLA A;  4RHJ A;  3SL0 A;  3E8Z A;  4IE3 A;  4MYF A;  3THE A;  2PHO A;  1TBH A;  4CEV A;  3GMZ A;  1P8Q A;  4Q3V A;  1WVB A;  1P8O A;  4Q3Q A;  4HWW A;  3RLA A;  4RHL A;  1RLA A;  1T5G A;  1D3V A;  4IU4 A;  4RHQ A;  2RLA A;  4FCK A;  3MFW A;  1TBL A;  3SKK A;  1P8P A;  3CEV A;  3THH A;  4GSZ A;  1HQH A;  2CEV A;  4Q3R C;  4GWD A;  4Q3U A;  4IXU A;  1P8S A;  1T4R A;  1HQX A;  4MXR A;  3DJ8 A;  4G3H A;  1CEV A;  3E6V A;  1GQ7 A;  4RHK A;  3TF3 A;  4MYK A;  1T4T A;  4RLA A;  1T4S A;  1HQG A;  4GSV A;  3E6K A;  2PLL A;  4DZ4 A;  3E9B A;  3SJT A;  1ZPG A;  3E8Q A;  1P8M A;  3NIP A;  4HXQ A;  1R1O A;  2AEB A;  1PQ3 A;  4HZE A;  3M1R A;  4RHM A;  3MMR A;  5HJA A;  4GWC A;  3NIO A;  4Q3S A;  3NIQ A;  4IU5 A;  4FCI A;  1WOI A;  1WVA A;  1WOG A;  3LP4 A;  4ITY A;  5CEV A;  4RHI A;  4I06 A;  3GN0 A;  4GSM A;  3SL1 A;  4IU1 A;  4Q3P A;  2EF5 A;  2EF4 A;  1T5F A;  5HJ9 A;  1HQF A;  4Q40 A;  1ZPE A;  2A0M A;  4IE1 A;  4MYL A;  4IU0 A;  1XFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...