3E7AA

Crystal structure of protein phosphatase-1 bound to the natural toxin nodularin-r
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Crystal structures of protein phosphatase-1 bound to nodularin-R and tautomycin: a novel scaffold for structure-based drug design of serine/threonine phosphatase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 110
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3e7aA00
2Z1AA 3QFOA 2O8GA 2DFJA 2HYOA 1S3LA 3C5WC 3PSOA 2WDDA 3H64A 1T70A 3H63A 3H61A 4UWQA 4JA9A 3IVDA 4TUIA 4IYPC 2HY1A 3AV0A 4Q7FA 3DSDA 3H62B 3IB8A 4FBWA 1XZWA 4O24A 2QFPA 2NYLC 5B8IA 4DHLA 1XM7A 4XPNA 4ZVZA 4B2OA 3JYFA 1G5BA 3QFMA 2WDEA 3LL8A 4H2GA 1QFCA 2BDXA 3H66A 3N5UA 3P71C 5J28A 3H69A 3EGHA 2Z72A 1S3MA 2JOGA 4LTYA 1U32A 2A22A 4DT2A 4TUGA 1S3NA 4V0VA 1II7A 1USHA 2NPPC 3ZTVA 1V73A 2Z06A 5F3WA 3H67A 4H2IA 4LU9A 4H1YP 3CK2A 3H68A 4WWLA 5IOHA 1AUIA 1W24A 3GVEA 3HVQA 3ICFA 1T71A 2QFRA 4O5GA 2NXFA 2NYMC 1HO5A 1MF8A 3V4YA 1HP1A 1OI8A 2BCDA 3QG5C 4KBPA 4ZX2A 3C9FA 4H2BA 4V0XA 4I5NC 4ORCA 2BQ8X 1FJMA 3K7WC 4UT3A 1Z2WA 5C1VA 1OIDA 2AHDA 2Q8UA 3AUZA 4YKEA 2CV9A 3E7AA 4LACC 5DNYA 3PSNA 2WDCA 2ZBMA 2IE3C 1HPUA 1WAO1 4O43A 4G9JA 1SU1A 3DW8C 2USHA 4M0VA 2KKNA 3ZU0A 4I5LC 3THNA 4H1SA 4FCXA 4IL1A 5HPEA 4O4KA 3THOB 3RL5A 5JJTA 3QFNA 3E7BA 1WARA 4MOVA 3EGGA 4NZVA 2IE4C 1S95A 4OR9A 5INBA 3K7VC 3H60A 2O8AA 4V0WA 3DSCA 2R17A 2P6BA 2WDFA 4MOYA 4F0ZA 3RL3A 1KBPA 4J6OA 4UT3B 2IAEC 4JA7A 2QJCA 1UTEA 4FBQA 1OIEA 4H2FA 4ORBA 4HD0A 1Z2XA 3IB7A 2YVTA 3FGAC 4ORAA 3IVEA 1JK7A 3RL4A 2GJUA 1M63A 1TCOA 1UF3A 2HYPA 3QFKA 1IT6A 4MP0A 3T1IA 4DSYA 4KKZA 4FBKA 5JPEA 3TGHA 1NNWA 3RQZA 1S70A 1S8EA 2XMOA 3KBPA 5EQVA 5JPFA 1QHWA 5GTUA 4UT2A
chains in the Genus database with same CATH superfamily
2Z1AA 3QFOA 2O8GA 2DFJA 2HYOA 1S3LA 3C5WC 3PSOA 2WDDA 3H64A 1T70A 3H63A 3H61A 4UWQA 4JA9A 3IVDA 4TUIA 4IYPC 2HY1A 2ZOAA 3AV0A 4Q7FA 3DSDA 3H62B 3IB8A 4FBWA 1XZWA 4O24A 2QFPA 2NYLC 5B8IA 4DHLA 1XM7A 4XPNA 4ZVZA 4B2OA 3JYFA 1G5BA 3QFMA 2WDEA 3LL8A 4H2GA 1QFCA 2BDXA 3H66A 3N5UA 3P71C 5J28A 3H69A 3EGHA 2Z72A 1S3MA 2JOGA 4LTYA 1U32A 2A22A 4DT2A 4TUGA 1S3NA 3FLOA 1II7A 1USHA 4V0VA 2ZO9B 2NPPC 3ZTVA 1V73A 2Z06A 5F3WA 3H67A 4H2IA 4LU9A 4H1YP 3CK2A 3H68A 4WWLA 5IOHA 1AUIA 1W24A 3GVEA 3HVQA 3ICFA 1T71A 2QFRA 3D03A 4O5GA 2NXFA 2NYMC 1HO5A 1MF8A 3V4YA 1HP1A 1OI8A 2BCDA 3QG5C 4KBPA 4ZX2A 3C9FA 4H2BA 4V0XA 4I5NC 4ORCA 2BQ8X 1FJMA 3K7WC 4UT3A 1Z2WA 5C1VA 1OIDA 2AHDA 2Q8UA 3AUZA 4YKEA 2CV9A 3E7AA 4LACC 5DNYA 3PSNA 2WDCA 2ZBMA 2IE3C 1HPUA 1WAO1 4O43A 4G9JA 1SU1A 3DW8C 2USHA 4M0VA 2KKNA 3ZU0A 4I5LC 3THNA 4H1SA 4FCXA 4IL1A 5HPEA 4O4KA 3THOB 3RL5A 5JJTA 3QFNA 3E7BA 1WARA 4MOVA 3EGGA 4NZVA 2IE4C 1S95A 4OR9A 3E0JA 5INBA 3K7VC 3H60A 2O8AA 4V0WA 3DSCA 2R17A 2P6BA 2WDFA 4MOYA 4F0ZA 3RL3A 1KBPA 4J6OA 4UT3B 2IAEC 4JA7A 2QJCA 1UTEA 4FBQA 1OIEA 4H2FA 4ORBA 2DXLA 4HD0A 1Z2XA 3IB7A 2YVTA 3FGAC 4ORAA 3IVEA 1JK7A 3RL4A 2GJUA 1M63A 1TCOA 1UF3A 2HYPA 3QFKA 1IT6A 4MP0A 3T1IA 4DSYA 4KKZA 2DXNA 4FBKA 2YEQA 5JPEA 3TGHA 1NNWA 3RQZA 1S70A 1S8EA 2XMOA 3KBPA 5EQVA 5JPFA 1QHWA 5GTUA 4UT2A
chains in the Genus database with same CATH topology
2Z1AA 3QFOA 2O8GA 2DFJA 2HYOA 1S3LA 3C5WC 3PSOA 2WDDA 3H64A 1T70A 3H63A 3H61A 4UWQA 4JA9A 3IVDA 4TUIA 4IYPC 2HY1A 2ZOAA 3AV0A 4Q7FA 3DSDA 3H62B 3IB8A 4FBWA 1XZWA 4O24A 2QFPA 2NYLC 5B8IA 4DHLA 1XM7A 4XPNA 4ZVZA 4B2OA 3JYFA 1G5BA 3QFMA 2WDEA 3LL8A 4H2GA 1QFCA 2BDXA 3H66A 3N5UA 3P71C 5J28A 3H69A 3EGHA 2Z72A 1S3MA 2JOGA 4LTYA 1U32A 2A22A 4DT2A 4TUGA 1S3NA 3FLOA 1II7A 1USHA 4V0VA 2ZO9B 2NPPC 3ZTVA 1V73A 2Z06A 5F3WA 3H67A 4H2IA 4LU9A 4H1YP 3CK2A 3H68A 4WWLA 5IOHA 1AUIA 1W24A 3GVEA 3HVQA 3ICFA 1T71A 2QFRA 3D03A 4O5GA 2NXFA 2NYMC 1HO5A 1MF8A 3V4YA 1HP1A 1OI8A 2BCDA 3QG5C 4KBPA 4ZX2A 3C9FA 4H2BA 4V0XA 4I5NC 4ORCA 2BQ8X 1FJMA 3K7WC 4UT3A 1Z2WA 5C1VA 1OIDA 2AHDA 2Q8UA 3AUZA 4YKEA 2CV9A 3E7AA 4LACC 5DNYA 3PSNA 2WDCA 2ZBMA 2IE3C 1HPUA 1WAO1 4O43A 4G9JA 1SU1A 3DW8C 2USHA 4M0VA 2KKNA 3ZU0A 4I5LC 3THNA 4H1SA 4FCXA 4IL1A 5HPEA 4O4KA 3THOB 3RL5A 5JJTA 3QFNA 3E7BA 1WARA 4MOVA 3EGGA 4NZVA 2IE4C 1S95A 4OR9A 3E0JA 5INBA 3K7VC 3H60A 2O8AA 4V0WA 3DSCA 2R17A 2P6BA 2WDFA 4MOYA 4F0ZA 3RL3A 1KBPA 4J6OA 4UT3B 2IAEC 4JA7A 2QJCA 1UTEA 4FBQA 1OIEA 4H2FA 4ORBA 2DXLA 4HD0A 1Z2XA 3IB7A 2YVTA 3FGAC 4ORAA 3IVEA 1JK7A 3RL4A 2GJUA 1M63A 1TCOA 1UF3A 2HYPA 3QFKA 1IT6A 4MP0A 3T1IA 4DSYA 4KKZA 2DXNA 4FBKA 2YEQA 5JPEA 3TGHA 1NNWA 3RQZA 1S70A 1S8EA 2XMOA 3KBPA 5EQVA 5JPFA 1QHWA 5GTUA 4UT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1A A;  3QFO A;  2O8G A;  2DFJ A;  2HYO A;  1S3L A;  3C5W C;  3PSO A;  2WDD A;  3H64 A;  1T70 A;  3H63 A;  3H61 A;  4UWQ A;  4JA9 A;  3IVD A;  4TUI A;  4IYP C;  2HY1 A;  3AV0 A;  4Q7F A;  3DSD A;  3H62 B;  3IB8 A;  4FBW A;  1XZW A;  4O24 A;  2QFP A;  2NYL C;  5B8I A;  4DHL A;  1XM7 A;  4XPN A;  4ZVZ A;  4B2O A;  3JYF A;  1G5B A;  3QFM A;  2WDE A;  3LL8 A;  4H2G A;  1QFC A;  2BDX A;  3H66 A;  3N5U A;  3P71 C;  5J28 A;  3H69 A;  3EGH A;  2Z72 A;  1S3M A;  2JOG A;  4LTY A;  1U32 A;  2A22 A;  4DT2 A;  4TUG A;  1S3N A;  4V0V A;  1II7 A;  1USH A;  2NPP C;  3ZTV A;  1V73 A;  2Z06 A;  5F3W A;  3H67 A;  4H2I A;  4LU9 A;  4H1Y P;  3CK2 A;  3H68 A;  4WWL A;  5IOH A;  1AUI A;  1W24 A;  3GVE A;  3HVQ A;  3ICF A;  1T71 A;  2QFR A;  4O5G A;  2NXF A;  2NYM C;  1HO5 A;  1MF8 A;  3V4Y A;  1HP1 A;  1OI8 A;  2BCD A;  3QG5 C;  4KBP A;  4ZX2 A;  3C9F A;  4H2B A;  4V0X A;  4I5N C;  4ORC A;  2BQ8 X;  1FJM A;  3K7W C;  4UT3 A;  1Z2W A;  5C1V A;  1OID A;  2AHD A;  2Q8U A;  3AUZ A;  4YKE A;  2CV9 A;  3E7A A;  4LAC C;  5DNY A;  3PSN A;  2WDC A;  2ZBM A;  2IE3 C;  1HPU A;  1WAO 1;  4O43 A;  4G9J A;  1SU1 A;  3DW8 C;  2USH A;  4M0V A;  2KKN A;  3ZU0 A;  4I5L C;  3THN A;  4H1S A;  4FCX A;  4IL1 A;  5HPE A;  4O4K A;  3THO B;  3RL5 A;  5JJT A;  3QFN A;  3E7B A;  1WAR A;  4MOV A;  3EGG A;  4NZV A;  2IE4 C;  1S95 A;  4OR9 A;  5INB A;  3K7V C;  3H60 A;  2O8A A;  4V0W A;  3DSC A;  2R17 A;  2P6B A;  2WDF A;  4MOY A;  4F0Z A;  3RL3 A;  1KBP A;  4J6O A;  4UT3 B;  2IAE C;  4JA7 A;  2QJC A;  1UTE A;  4FBQ A;  1OIE A;  4H2F A;  4ORB A;  4HD0 A;  1Z2X A;  3IB7 A;  2YVT A;  3FGA C;  4ORA A;  3IVE A;  1JK7 A;  3RL4 A;  2GJU A;  1M63 A;  1TCO A;  1UF3 A;  2HYP A;  3QFK A;  1IT6 A;  4MP0 A;  3T1I A;  4DSY A;  4KKZ A;  4FBK A;  5JPE A;  3TGH A;  1NNW A;  3RQZ A;  1S70 A;  1S8E A;  2XMO A;  3KBP A;  5EQV A;  5JPF A;  1QHW A;  5GTU A;  4UT2 A; 
#chains in the Genus database with same CATH topology
 2Z1A A;  3QFO A;  2O8G A;  2DFJ A;  2HYO A;  1S3L A;  3C5W C;  3PSO A;  2WDD A;  3H64 A;  1T70 A;  3H63 A;  3H61 A;  4UWQ A;  4JA9 A;  3IVD A;  4TUI A;  4IYP C;  2HY1 A;  2ZOA A;  3AV0 A;  4Q7F A;  3DSD A;  3H62 B;  3IB8 A;  4FBW A;  1XZW A;  4O24 A;  2QFP A;  2NYL C;  5B8I A;  4DHL A;  1XM7 A;  4XPN A;  4ZVZ A;  4B2O A;  3JYF A;  1G5B A;  3QFM A;  2WDE A;  3LL8 A;  4H2G A;  1QFC A;  2BDX A;  3H66 A;  3N5U A;  3P71 C;  5J28 A;  3H69 A;  3EGH A;  2Z72 A;  1S3M A;  2JOG A;  4LTY A;  1U32 A;  2A22 A;  4DT2 A;  4TUG A;  1S3N A;  3FLO A;  1II7 A;  1USH A;  4V0V A;  2ZO9 B;  2NPP C;  3ZTV A;  1V73 A;  2Z06 A;  5F3W A;  3H67 A;  4H2I A;  4LU9 A;  4H1Y P;  3CK2 A;  3H68 A;  4WWL A;  5IOH A;  1AUI A;  1W24 A;  3GVE A;  3HVQ A;  3ICF A;  1T71 A;  2QFR A;  3D03 A;  4O5G A;  2NXF A;  2NYM C;  1HO5 A;  1MF8 A;  3V4Y A;  1HP1 A;  1OI8 A;  2BCD A;  3QG5 C;  4KBP A;  4ZX2 A;  3C9F A;  4H2B A;  4V0X A;  4I5N C;  4ORC A;  2BQ8 X;  1FJM A;  3K7W C;  4UT3 A;  1Z2W A;  5C1V A;  1OID A;  2AHD A;  2Q8U A;  3AUZ A;  4YKE A;  2CV9 A;  3E7A A;  4LAC C;  5DNY A;  3PSN A;  2WDC A;  2ZBM A;  2IE3 C;  1HPU A;  1WAO 1;  4O43 A;  4G9J A;  1SU1 A;  3DW8 C;  2USH A;  4M0V A;  2KKN A;  3ZU0 A;  4I5L C;  3THN A;  4H1S A;  4FCX A;  4IL1 A;  5HPE A;  4O4K A;  3THO B;  3RL5 A;  5JJT A;  3QFN A;  3E7B A;  1WAR A;  4MOV A;  3EGG A;  4NZV A;  2IE4 C;  1S95 A;  4OR9 A;  3E0J A;  5INB A;  3K7V C;  3H60 A;  2O8A A;  4V0W A;  3DSC A;  2R17 A;  2P6B A;  2WDF A;  4MOY A;  4F0Z A;  3RL3 A;  1KBP A;  4J6O A;  4UT3 B;  2IAE C;  4JA7 A;  2QJC A;  1UTE A;  4FBQ A;  1OIE A;  4H2F A;  4ORB A;  2DXL A;  4HD0 A;  1Z2X A;  3IB7 A;  2YVT A;  3FGA C;  4ORA A;  3IVE A;  1JK7 A;  3RL4 A;  2GJU A;  1M63 A;  1TCO A;  1UF3 A;  2HYP A;  3QFK A;  1IT6 A;  4MP0 A;  3T1I A;  4DSY A;  4KKZ A;  2DXN A;  4FBK A;  2YEQ A;  5JPE A;  3TGH A;  1NNW A;  3RQZ A;  1S70 A;  1S8E A;  2XMO A;  3KBP A;  5EQV A;  5JPF A;  1QHW A;  5GTU A;  4UT2 A; 
#chains in the Genus database with same CATH homology
 2Z1A A;  3QFO A;  2O8G A;  2DFJ A;  2HYO A;  1S3L A;  3C5W C;  3PSO A;  2WDD A;  3H64 A;  1T70 A;  3H63 A;  3H61 A;  4UWQ A;  4JA9 A;  3IVD A;  4TUI A;  4IYP C;  2HY1 A;  2ZOA A;  3AV0 A;  4Q7F A;  3DSD A;  3H62 B;  3IB8 A;  4FBW A;  1XZW A;  4O24 A;  2QFP A;  2NYL C;  5B8I A;  4DHL A;  1XM7 A;  4XPN A;  4ZVZ A;  4B2O A;  3JYF A;  1G5B A;  3QFM A;  2WDE A;  3LL8 A;  4H2G A;  1QFC A;  2BDX A;  3H66 A;  3N5U A;  3P71 C;  5J28 A;  3H69 A;  3EGH A;  2Z72 A;  1S3M A;  2JOG A;  4LTY A;  1U32 A;  2A22 A;  4DT2 A;  4TUG A;  1S3N A;  3FLO A;  1II7 A;  1USH A;  4V0V A;  2ZO9 B;  2NPP C;  3ZTV A;  1V73 A;  2Z06 A;  5F3W A;  3H67 A;  4H2I A;  4LU9 A;  4H1Y P;  3CK2 A;  3H68 A;  4WWL A;  5IOH A;  1AUI A;  1W24 A;  3GVE A;  3HVQ A;  3ICF A;  1T71 A;  2QFR A;  3D03 A;  4O5G A;  2NXF A;  2NYM C;  1HO5 A;  1MF8 A;  3V4Y A;  1HP1 A;  1OI8 A;  2BCD A;  3QG5 C;  4KBP A;  4ZX2 A;  3C9F A;  4H2B A;  4V0X A;  4I5N C;  4ORC A;  2BQ8 X;  1FJM A;  3K7W C;  4UT3 A;  1Z2W A;  5C1V A;  1OID A;  2AHD A;  2Q8U A;  3AUZ A;  4YKE A;  2CV9 A;  3E7A A;  4LAC C;  5DNY A;  3PSN A;  2WDC A;  2ZBM A;  2IE3 C;  1HPU A;  1WAO 1;  4O43 A;  4G9J A;  1SU1 A;  3DW8 C;  2USH A;  4M0V A;  2KKN A;  3ZU0 A;  4I5L C;  3THN A;  4H1S A;  4FCX A;  4IL1 A;  5HPE A;  4O4K A;  3THO B;  3RL5 A;  5JJT A;  3QFN A;  3E7B A;  1WAR A;  4MOV A;  3EGG A;  4NZV A;  2IE4 C;  1S95 A;  4OR9 A;  3E0J A;  5INB A;  3K7V C;  3H60 A;  2O8A A;  4V0W A;  3DSC A;  2R17 A;  2P6B A;  2WDF A;  4MOY A;  4F0Z A;  3RL3 A;  1KBP A;  4J6O A;  4UT3 B;  2IAE C;  4JA7 A;  2QJC A;  1UTE A;  4FBQ A;  1OIE A;  4H2F A;  4ORB A;  2DXL A;  4HD0 A;  1Z2X A;  3IB7 A;  2YVT A;  3FGA C;  4ORA A;  3IVE A;  1JK7 A;  3RL4 A;  2GJU A;  1M63 A;  1TCO A;  1UF3 A;  2HYP A;  3QFK A;  1IT6 A;  4MP0 A;  3T1I A;  4DSY A;  4KKZ A;  2DXN A;  4FBK A;  2YEQ A;  5JPE A;  3TGH A;  1NNW A;  3RQZ A;  1S70 A;  1S8E A;  2XMO A;  3KBP A;  5EQV A;  5JPF A;  1QHW A;  5GTU A;  4UT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...