3E7BA

Crystal structure of protein phosphatase-1 bound to the natural toxin inhibitor tautomycin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
SLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Crystal structures of protein phosphatase-1 bound to nodularin-R and tautomycin: a novel scaffold for structure-based drug design of serine/threonine phosphatase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3e7bA00
4O43A 1QFCA 1S95A 3IVEA 4DT2A 2Z1AA 3H63A 4F0ZA 4UT3A 4H1YP 4KKZA 4HD0A 2QFPA 2CV9A 4IL1A 2USHA 3N5UA 1T70A 1MF8A 2P6BA 4MP0A 1OIEA 5B8IA 1USHA 4UT2A 3QFNA 3H66A 4DSYA 4FCXA 1KBPA 3THOB 2IE3C 1U32A 3LL8A 4JA7A 3T1IA 2BCDA 5IOHA 4FBWA 3QFKA 1WARA 5HPEA 3ZTVA 1FJMA 3H69A 3H64A 1WAO1 3QG5C 1UF3A 4ZX2A 3IVDA 1Z2XA 3FGAC 2IAEC 2DFJA 2HY1A 1V73A 3V4YA 4IYPC 1NNWA 4FBKA 3KBPA 4H2GA 4MOVA 3AV0A 4LACC 1W24A 1OIDA 1TCOA 3TGHA 4I5LC 2R17A 3GVEA 2Z06A 4B2OA 5J28A 2KKNA 3EGGA 1S3LA 3IB8A 4V0XA 2JOGA 3JYFA 2YVTA 3QFMA 3CK2A 4M0VA 2NYMC 1QHWA 1SU1A 4JA9A 2WDDA 3ZU0A 5JPEA 4DHLA 2NPPC 2GJUA 4O4KA 1HPUA 2ZBMA 3QFOA 2NYLC 3H62B 1AUIA 4ZVZA 3RQZA 2NXFA 2WDEA 4TUGA 5EQVA 3DW8C 3E7BA 4H1SA 4LU9A 1JK7A 4J6OA 2XMOA 4ORBA 2Z72A 4V0WA 1T71A 3PSOA 3HVQA 4ORCA 1UTEA 1G5BA 3ICFA 4Q7FA 2A22A 2O8AA 4TUIA 1XZWA 3AUZA 4H2BA 1XM7A 4NZVA 2QJCA 4UT3B 5JPFA 2WDFA 4KBPA 4XPNA 3H60A 4OR9A 5DNYA 4YKEA 5F3WA 2HYOA 2Q8UA 4O5GA 3RL5A 5INBA 5C1VA 2HYPA 2BDXA 1OI8A 2QFRA 3RL3A 3H67A 4ORAA 2AHDA 1S8EA 1S70A 3IB7A 1M63A 2IE4C 2O8GA 4H2FA 1IT6A 3H68A 4G9JA 1Z2WA 5JJTA 3DSDA 3C9FA 5GTUA 3RL4A 1HO5A 3K7VC 3P71C 3DSCA 1S3MA 4I5NC 4LTYA 3K7WC 1II7A 4MOYA 4O24A 3EGHA 2WDCA 2BQ8X 3C5WC 1S3NA 3PSNA 1HP1A 4UWQA 4H2IA 4V0VA 4FBQA 3THNA 4WWLA 3E7AA 3H61A
chains in the Genus database with same CATH superfamily
4O43A 1QFCA 1S95A 3IVEA 4DT2A 2Z1AA 3H63A 4F0ZA 4UT3A 4H1YP 4KKZA 4HD0A 2QFPA 2CV9A 4IL1A 2USHA 3N5UA 1T70A 1MF8A 2P6BA 4MP0A 1OIEA 5B8IA 1USHA 4UT2A 3QFNA 3H66A 4DSYA 4FCXA 1KBPA 3THOB 2IE3C 1U32A 2DXLA 3LL8A 4JA7A 3T1IA 2BCDA 5IOHA 4FBWA 3QFKA 1WARA 5HPEA 3ZTVA 1FJMA 3H69A 3H64A 1WAO1 3QG5C 1UF3A 2DXNA 4ZX2A 3IVDA 1Z2XA 3FGAC 2IAEC 3FLOA 2DFJA 2HY1A 1V73A 3V4YA 4IYPC 1NNWA 4FBKA 3KBPA 4H2GA 4MOVA 3AV0A 4LACC 1W24A 1OIDA 1TCOA 3TGHA 4I5LC 2R17A 3GVEA 2Z06A 4B2OA 5J28A 2KKNA 3EGGA 1S3LA 3IB8A 4V0XA 2JOGA 3JYFA 2YVTA 3QFMA 3CK2A 4M0VA 2NYMC 1QHWA 1SU1A 4JA9A 2WDDA 3ZU0A 5JPEA 4DHLA 2NPPC 2GJUA 4O4KA 1HPUA 2ZBMA 2ZOAA 3QFOA 2NYLC 3H62B 1AUIA 4ZVZA 3RQZA 2NXFA 2WDEA 4TUGA 5EQVA 3DW8C 3E7BA 4H1SA 4LU9A 1JK7A 4J6OA 2XMOA 4ORBA 2Z72A 4V0WA 1T71A 3PSOA 3HVQA 4ORCA 1UTEA 1G5BA 3ICFA 4Q7FA 2A22A 2O8AA 4TUIA 1XZWA 3AUZA 4H2BA 1XM7A 4NZVA 2QJCA 4UT3B 5JPFA 2WDFA 4KBPA 4XPNA 3H60A 4OR9A 5DNYA 4YKEA 5F3WA 2HYOA 2Q8UA 4O5GA 2YEQA 3D03A 3RL5A 5INBA 5C1VA 2HYPA 2BDXA 1OI8A 2QFRA 3RL3A 3H67A 4ORAA 2AHDA 1S8EA 1S70A 3IB7A 1M63A 2IE4C 2O8GA 4H2FA 1IT6A 3H68A 4G9JA 1Z2WA 5JJTA 3DSDA 3C9FA 5GTUA 3RL4A 1HO5A 3K7VC 3E0JA 3P71C 3DSCA 1S3MA 2ZO9B 4I5NC 3K7WC 1II7A 4LTYA 4MOYA 4O24A 3EGHA 2WDCA 2BQ8X 3C5WC 1S3NA 3PSNA 1HP1A 4UWQA 4H2IA 4V0VA 4FBQA 3THNA 4WWLA 3E7AA 3H61A
chains in the Genus database with same CATH topology
4O43A 1QFCA 1S95A 3IVEA 4DT2A 2Z1AA 3H63A 4F0ZA 4UT3A 4H1YP 4KKZA 4HD0A 2QFPA 2CV9A 4IL1A 2USHA 3N5UA 1T70A 1MF8A 2P6BA 4MP0A 1OIEA 5B8IA 1USHA 4UT2A 3QFNA 3H66A 4DSYA 4FCXA 1KBPA 3THOB 2IE3C 1U32A 2DXLA 3LL8A 4JA7A 3T1IA 2BCDA 5IOHA 4FBWA 3QFKA 1WARA 5HPEA 3ZTVA 1FJMA 3H69A 3H64A 1WAO1 3QG5C 1UF3A 2DXNA 4ZX2A 3IVDA 1Z2XA 3FGAC 2IAEC 3FLOA 2DFJA 2HY1A 1V73A 3V4YA 4IYPC 1NNWA 4FBKA 3KBPA 4H2GA 4MOVA 3AV0A 4LACC 1W24A 1OIDA 1TCOA 3TGHA 4I5LC 2R17A 3GVEA 2Z06A 4B2OA 5J28A 2KKNA 3EGGA 1S3LA 3IB8A 4V0XA 2JOGA 3JYFA 2YVTA 3QFMA 3CK2A 4M0VA 2NYMC 1QHWA 1SU1A 4JA9A 2WDDA 3ZU0A 5JPEA 4DHLA 2NPPC 2GJUA 4O4KA 1HPUA 2ZBMA 2ZOAA 3QFOA 2NYLC 3H62B 1AUIA 4ZVZA 3RQZA 2NXFA 2WDEA 4TUGA 5EQVA 3DW8C 3E7BA 4H1SA 4LU9A 1JK7A 4J6OA 2XMOA 4ORBA 2Z72A 4V0WA 1T71A 3PSOA 3HVQA 4ORCA 1UTEA 1G5BA 3ICFA 4Q7FA 2A22A 2O8AA 4TUIA 1XZWA 3AUZA 4H2BA 1XM7A 4NZVA 2QJCA 4UT3B 5JPFA 2WDFA 4KBPA 4XPNA 3H60A 4OR9A 5DNYA 4YKEA 5F3WA 2HYOA 2Q8UA 4O5GA 2YEQA 3D03A 3RL5A 5INBA 5C1VA 2HYPA 2BDXA 1OI8A 2QFRA 3RL3A 3H67A 4ORAA 2AHDA 1S8EA 1S70A 3IB7A 1M63A 2IE4C 2O8GA 4H2FA 1IT6A 3H68A 4G9JA 1Z2WA 5JJTA 3DSDA 3C9FA 5GTUA 3RL4A 1HO5A 3K7VC 3E0JA 3P71C 3DSCA 1S3MA 2ZO9B 4I5NC 3K7WC 1II7A 4LTYA 4MOYA 4O24A 3EGHA 2WDCA 2BQ8X 3C5WC 1S3NA 3PSNA 1HP1A 4UWQA 4H2IA 4V0VA 4FBQA 3THNA 4WWLA 3E7AA 3H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O43 A;  1QFC A;  1S95 A;  3IVE A;  4DT2 A;  2Z1A A;  3H63 A;  4F0Z A;  4UT3 A;  4H1Y P;  4KKZ A;  4HD0 A;  2QFP A;  2CV9 A;  4IL1 A;  2USH A;  3N5U A;  1T70 A;  1MF8 A;  2P6B A;  4MP0 A;  1OIE A;  5B8I A;  1USH A;  4UT2 A;  3QFN A;  3H66 A;  4DSY A;  4FCX A;  1KBP A;  3THO B;  2IE3 C;  1U32 A;  3LL8 A;  4JA7 A;  3T1I A;  2BCD A;  5IOH A;  4FBW A;  3QFK A;  1WAR A;  5HPE A;  3ZTV A;  1FJM A;  3H69 A;  3H64 A;  1WAO 1;  3QG5 C;  1UF3 A;  4ZX2 A;  3IVD A;  1Z2X A;  3FGA C;  2IAE C;  2DFJ A;  2HY1 A;  1V73 A;  3V4Y A;  4IYP C;  1NNW A;  4FBK A;  3KBP A;  4H2G A;  4MOV A;  3AV0 A;  4LAC C;  1W24 A;  1OID A;  1TCO A;  3TGH A;  4I5L C;  2R17 A;  3GVE A;  2Z06 A;  4B2O A;  5J28 A;  2KKN A;  3EGG A;  1S3L A;  3IB8 A;  4V0X A;  2JOG A;  3JYF A;  2YVT A;  3QFM A;  3CK2 A;  4M0V A;  2NYM C;  1QHW A;  1SU1 A;  4JA9 A;  2WDD A;  3ZU0 A;  5JPE A;  4DHL A;  2NPP C;  2GJU A;  4O4K A;  1HPU A;  2ZBM A;  3QFO A;  2NYL C;  3H62 B;  1AUI A;  4ZVZ A;  3RQZ A;  2NXF A;  2WDE A;  4TUG A;  5EQV A;  3DW8 C;  3E7B A;  4H1S A;  4LU9 A;  1JK7 A;  4J6O A;  2XMO A;  4ORB A;  2Z72 A;  4V0W A;  1T71 A;  3PSO A;  3HVQ A;  4ORC A;  1UTE A;  1G5B A;  3ICF A;  4Q7F A;  2A22 A;  2O8A A;  4TUI A;  1XZW A;  3AUZ A;  4H2B A;  1XM7 A;  4NZV A;  2QJC A;  4UT3 B;  5JPF A;  2WDF A;  4KBP A;  4XPN A;  3H60 A;  4OR9 A;  5DNY A;  4YKE A;  5F3W A;  2HYO A;  2Q8U A;  4O5G A;  3RL5 A;  5INB A;  5C1V A;  2HYP A;  2BDX A;  1OI8 A;  2QFR A;  3RL3 A;  3H67 A;  4ORA A;  2AHD A;  1S8E A;  1S70 A;  3IB7 A;  1M63 A;  2IE4 C;  2O8G A;  4H2F A;  1IT6 A;  3H68 A;  4G9J A;  1Z2W A;  5JJT A;  3DSD A;  3C9F A;  5GTU A;  3RL4 A;  1HO5 A;  3K7V C;  3P71 C;  3DSC A;  1S3M A;  4I5N C;  4LTY A;  3K7W C;  1II7 A;  4MOY A;  4O24 A;  3EGH A;  2WDC A;  2BQ8 X;  3C5W C;  1S3N A;  3PSN A;  1HP1 A;  4UWQ A;  4H2I A;  4V0V A;  4FBQ A;  3THN A;  4WWL A;  3E7A A;  3H61 A; 
#chains in the Genus database with same CATH topology
 4O43 A;  1QFC A;  1S95 A;  3IVE A;  4DT2 A;  2Z1A A;  3H63 A;  4F0Z A;  4UT3 A;  4H1Y P;  4KKZ A;  4HD0 A;  2QFP A;  2CV9 A;  4IL1 A;  2USH A;  3N5U A;  1T70 A;  1MF8 A;  2P6B A;  4MP0 A;  1OIE A;  5B8I A;  1USH A;  4UT2 A;  3QFN A;  3H66 A;  4DSY A;  4FCX A;  1KBP A;  3THO B;  2IE3 C;  1U32 A;  2DXL A;  3LL8 A;  4JA7 A;  3T1I A;  2BCD A;  5IOH A;  4FBW A;  3QFK A;  1WAR A;  5HPE A;  3ZTV A;  1FJM A;  3H69 A;  3H64 A;  1WAO 1;  3QG5 C;  1UF3 A;  2DXN A;  4ZX2 A;  3IVD A;  1Z2X A;  3FGA C;  2IAE C;  3FLO A;  2DFJ A;  2HY1 A;  1V73 A;  3V4Y A;  4IYP C;  1NNW A;  4FBK A;  3KBP A;  4H2G A;  4MOV A;  3AV0 A;  4LAC C;  1W24 A;  1OID A;  1TCO A;  3TGH A;  4I5L C;  2R17 A;  3GVE A;  2Z06 A;  4B2O A;  5J28 A;  2KKN A;  3EGG A;  1S3L A;  3IB8 A;  4V0X A;  2JOG A;  3JYF A;  2YVT A;  3QFM A;  3CK2 A;  4M0V A;  2NYM C;  1QHW A;  1SU1 A;  4JA9 A;  2WDD A;  3ZU0 A;  5JPE A;  4DHL A;  2NPP C;  2GJU A;  4O4K A;  1HPU A;  2ZBM A;  2ZOA A;  3QFO A;  2NYL C;  3H62 B;  1AUI A;  4ZVZ A;  3RQZ A;  2NXF A;  2WDE A;  4TUG A;  5EQV A;  3DW8 C;  3E7B A;  4H1S A;  4LU9 A;  1JK7 A;  4J6O A;  2XMO A;  4ORB A;  2Z72 A;  4V0W A;  1T71 A;  3PSO A;  3HVQ A;  4ORC A;  1UTE A;  1G5B A;  3ICF A;  4Q7F A;  2A22 A;  2O8A A;  4TUI A;  1XZW A;  3AUZ A;  4H2B A;  1XM7 A;  4NZV A;  2QJC A;  4UT3 B;  5JPF A;  2WDF A;  4KBP A;  4XPN A;  3H60 A;  4OR9 A;  5DNY A;  4YKE A;  5F3W A;  2HYO A;  2Q8U A;  4O5G A;  2YEQ A;  3D03 A;  3RL5 A;  5INB A;  5C1V A;  2HYP A;  2BDX A;  1OI8 A;  2QFR A;  3RL3 A;  3H67 A;  4ORA A;  2AHD A;  1S8E A;  1S70 A;  3IB7 A;  1M63 A;  2IE4 C;  2O8G A;  4H2F A;  1IT6 A;  3H68 A;  4G9J A;  1Z2W A;  5JJT A;  3DSD A;  3C9F A;  5GTU A;  3RL4 A;  1HO5 A;  3K7V C;  3E0J A;  3P71 C;  3DSC A;  1S3M A;  2ZO9 B;  4I5N C;  3K7W C;  1II7 A;  4LTY A;  4MOY A;  4O24 A;  3EGH A;  2WDC A;  2BQ8 X;  3C5W C;  1S3N A;  3PSN A;  1HP1 A;  4UWQ A;  4H2I A;  4V0V A;  4FBQ A;  3THN A;  4WWL A;  3E7A A;  3H61 A; 
#chains in the Genus database with same CATH homology
 4O43 A;  1QFC A;  1S95 A;  3IVE A;  4DT2 A;  2Z1A A;  3H63 A;  4F0Z A;  4UT3 A;  4H1Y P;  4KKZ A;  4HD0 A;  2QFP A;  2CV9 A;  4IL1 A;  2USH A;  3N5U A;  1T70 A;  1MF8 A;  2P6B A;  4MP0 A;  1OIE A;  5B8I A;  1USH A;  4UT2 A;  3QFN A;  3H66 A;  4DSY A;  4FCX A;  1KBP A;  3THO B;  2IE3 C;  1U32 A;  2DXL A;  3LL8 A;  4JA7 A;  3T1I A;  2BCD A;  5IOH A;  4FBW A;  3QFK A;  1WAR A;  5HPE A;  3ZTV A;  1FJM A;  3H69 A;  3H64 A;  1WAO 1;  3QG5 C;  1UF3 A;  2DXN A;  4ZX2 A;  3IVD A;  1Z2X A;  3FGA C;  2IAE C;  3FLO A;  2DFJ A;  2HY1 A;  1V73 A;  3V4Y A;  4IYP C;  1NNW A;  4FBK A;  3KBP A;  4H2G A;  4MOV A;  3AV0 A;  4LAC C;  1W24 A;  1OID A;  1TCO A;  3TGH A;  4I5L C;  2R17 A;  3GVE A;  2Z06 A;  4B2O A;  5J28 A;  2KKN A;  3EGG A;  1S3L A;  3IB8 A;  4V0X A;  2JOG A;  3JYF A;  2YVT A;  3QFM A;  3CK2 A;  4M0V A;  2NYM C;  1QHW A;  1SU1 A;  4JA9 A;  2WDD A;  3ZU0 A;  5JPE A;  4DHL A;  2NPP C;  2GJU A;  4O4K A;  1HPU A;  2ZBM A;  2ZOA A;  3QFO A;  2NYL C;  3H62 B;  1AUI A;  4ZVZ A;  3RQZ A;  2NXF A;  2WDE A;  4TUG A;  5EQV A;  3DW8 C;  3E7B A;  4H1S A;  4LU9 A;  1JK7 A;  4J6O A;  2XMO A;  4ORB A;  2Z72 A;  4V0W A;  1T71 A;  3PSO A;  3HVQ A;  4ORC A;  1UTE A;  1G5B A;  3ICF A;  4Q7F A;  2A22 A;  2O8A A;  4TUI A;  1XZW A;  3AUZ A;  4H2B A;  1XM7 A;  4NZV A;  2QJC A;  4UT3 B;  5JPF A;  2WDF A;  4KBP A;  4XPN A;  3H60 A;  4OR9 A;  5DNY A;  4YKE A;  5F3W A;  2HYO A;  2Q8U A;  4O5G A;  2YEQ A;  3D03 A;  3RL5 A;  5INB A;  5C1V A;  2HYP A;  2BDX A;  1OI8 A;  2QFR A;  3RL3 A;  3H67 A;  4ORA A;  2AHD A;  1S8E A;  1S70 A;  3IB7 A;  1M63 A;  2IE4 C;  2O8G A;  4H2F A;  1IT6 A;  3H68 A;  4G9J A;  1Z2W A;  5JJT A;  3DSD A;  3C9F A;  5GTU A;  3RL4 A;  1HO5 A;  3K7V C;  3E0J A;  3P71 C;  3DSC A;  1S3M A;  2ZO9 B;  4I5N C;  3K7W C;  1II7 A;  4LTY A;  4MOY A;  4O24 A;  3EGH A;  2WDC A;  2BQ8 X;  3C5W C;  1S3N A;  3PSN A;  1HP1 A;  4UWQ A;  4H2I A;  4V0V A;  4FBQ A;  3THN A;  4WWL A;  3E7A A;  3H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...