3E7BA

Crystal structure of protein phosphatase-1 bound to the natural toxin inhibitor tautomycin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
SLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of protein phosphatase-1 bound to nodularin-R and tautomycin: a novel scaffold for structure-based drug design of serine/threonine phosphatase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 114
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3e7bA00
2NXFA 2JOGA 3H64A 3QFOA 5J28A 2IE4C 4TUGA 1V73A 3K7WC 2DFJA 3AV0A 5B8IA 4O4KA 2WDEA 3H68A 3DSCA 4B2OA 3QG5C 3H66A 2P6BA 1JK7A 2BCDA 3DW8C 2AHDA 2Q8UA 4H2GA 4WWLA 3CK2A 4V0XA 4FBWA 4IYPC 1S3NA 3GVEA 2CV9A 4H2FA 4I5NC 1QFCA 2O8GA 4DSYA 1HP1A 1S8EA 4DT2A 5C1VA 1AUIA 5DNYA 3TGHA 5JPEA 2XMOA 2IE3C 1G5BA 4UT3B 1WARA 2QFPA 4UT2A 2WDCA 4V0VA 1M63A 4KKZA 1Z2XA 4JA9A 3V4YA 4MOYA 3QFNA 1XM7A 4F0ZA 2QJCA 3PSOA 2WDDA 4H1YP 4OR9A 4UWQA 2R17A 4UT3A 1NNWA 3H62B 4G9JA 1S95A 2BDXA 4KBPA 4O5GA 3THOB 4TUIA 4FBQA 4ORAA 2Z06A 4O24A 2USHA 1T71A 2ZBMA 1OIEA 1HPUA 3AUZA 4NZVA 4ZVZA 5GTUA 1U32A 3KBPA 3EGGA 1WAO1 2HY1A 1HO5A 2IAEC 2KKNA 4I5LC 1T70A 1KBPA 3IVDA 3K7VC 4HD0A 3N5UA 4MOVA 3IB7A 1UF3A 4MP0A 3H67A 4O43A 2Z1AA 4LACC 2QFRA 4H2IA 2NYMC 2Z72A 3DSDA 4ORCA 2O8AA 1S70A 3QFMA 2BQ8X 3EGHA 4IL1A 1UTEA 2HYOA 1II7A 2HYPA 3C9FA 3E7AA 3THNA 1MF8A 4JA7A 3HVQA 4LTYA 1FJMA 5JJTA 4M0VA 4ORBA 3RL4A 4H2BA 1OIDA 5JPFA 3C5WC 3IVEA 1Z2WA 4ZX2A 1W24A 1SU1A 3H60A 3H63A 5INBA 4Q7FA 3IB8A 1S3LA 1XZWA 2YVTA 1TCOA 3RQZA 1QHWA 4V0WA 3T1IA 5IOHA 1S3MA 1USHA 4YKEA 3JYFA 4DHLA 2A22A 1OI8A 5F3WA 4J6OA 4H1SA 5EQVA 3H69A 3ZTVA 3ZU0A 4LU9A 3QFKA 3LL8A 4FCXA 1IT6A 2NPPC 3FGAC 3P71C 2GJUA 3RL3A 3RL5A 4FBKA 4XPNA 3H61A 2WDFA 3ICFA 5HPEA 3E7BA 3PSNA 2NYLC
chains in the Genus database with same CATH superfamily
2NXFA 2JOGA 3D03A 3H64A 3QFOA 5J28A 2IE4C 4TUGA 1V73A 3K7WC 2DFJA 3AV0A 5B8IA 4O4KA 2WDEA 3H68A 3DSCA 4B2OA 3QG5C 3H66A 2P6BA 1JK7A 2BCDA 3DW8C 2AHDA 2Q8UA 4H2GA 4WWLA 3CK2A 4V0XA 4FBWA 4IYPC 1S3NA 3GVEA 2CV9A 4H2FA 4I5NC 1QFCA 2O8GA 4DSYA 1HP1A 1S8EA 4DT2A 5C1VA 1AUIA 5DNYA 3TGHA 5JPEA 2XMOA 2IE3C 1G5BA 4UT3B 1WARA 2QFPA 4UT2A 2WDCA 4V0VA 1M63A 4KKZA 1Z2XA 4JA9A 3V4YA 4MOYA 3QFNA 1XM7A 4F0ZA 2QJCA 2YEQA 3PSOA 2WDDA 3E0JA 4H1YP 4OR9A 4UWQA 2R17A 4UT3A 1NNWA 3H62B 4G9JA 1S95A 2BDXA 4KBPA 4O5GA 3THOB 4TUIA 4FBQA 4ORAA 2ZOAA 2Z06A 4O24A 2USHA 1T71A 2ZBMA 1OIEA 1HPUA 3AUZA 4NZVA 4ZVZA 5GTUA 1U32A 3KBPA 3EGGA 1WAO1 2HY1A 1HO5A 2IAEC 2KKNA 4I5LC 1T70A 1KBPA 3IVDA 3K7VC 4HD0A 3N5UA 4MOVA 3IB7A 1UF3A 4MP0A 3H67A 4O43A 2Z1AA 4LACC 2QFRA 4H2IA 2NYMC 2Z72A 3DSDA 4ORCA 2O8AA 1S70A 3QFMA 2BQ8X 3EGHA 4IL1A 1UTEA 2HYOA 1II7A 2HYPA 3C9FA 3E7AA 3THNA 1MF8A 4JA7A 3HVQA 4LTYA 1FJMA 5JJTA 4M0VA 4ORBA 3RL4A 4H2BA 1OIDA 5JPFA 3C5WC 3IVEA 1Z2WA 4ZX2A 1W24A 1SU1A 2ZO9B 3H60A 3H63A 5INBA 4Q7FA 3IB8A 3FLOA 1S3LA 1XZWA 2YVTA 1TCOA 3RQZA 1QHWA 2DXLA 4V0WA 3T1IA 5IOHA 1S3MA 1USHA 4YKEA 3JYFA 4DHLA 2A22A 1OI8A 5F3WA 4J6OA 4H1SA 5EQVA 3H69A 3ZTVA 3ZU0A 4LU9A 3QFKA 3LL8A 2DXNA 1IT6A 2NPPC 3FGAC 3P71C 4FCXA 2GJUA 3RL3A 3RL5A 4FBKA 4XPNA 3H61A 2WDFA 3ICFA 5HPEA 3E7BA 3PSNA 2NYLC
chains in the Genus database with same CATH topology
2NXFA 2JOGA 3D03A 3H64A 3QFOA 5J28A 2IE4C 4TUGA 1V73A 3K7WC 2DFJA 3AV0A 5B8IA 4O4KA 2WDEA 3H68A 3DSCA 4B2OA 3QG5C 3H66A 2P6BA 1JK7A 2BCDA 3DW8C 2AHDA 2Q8UA 4H2GA 4WWLA 3CK2A 4V0XA 4FBWA 4IYPC 1S3NA 3GVEA 2CV9A 4H2FA 4I5NC 1QFCA 2O8GA 4DSYA 1HP1A 1S8EA 4DT2A 5C1VA 1AUIA 5DNYA 3TGHA 5JPEA 2XMOA 2IE3C 1G5BA 4UT3B 1WARA 2QFPA 4UT2A 2WDCA 4V0VA 1M63A 4KKZA 1Z2XA 4JA9A 3V4YA 4MOYA 3QFNA 1XM7A 4F0ZA 2QJCA 2YEQA 3PSOA 2WDDA 3E0JA 4H1YP 4OR9A 4UWQA 2R17A 4UT3A 1NNWA 3H62B 4G9JA 1S95A 2BDXA 4KBPA 4O5GA 3THOB 4TUIA 4FBQA 4ORAA 2ZOAA 2Z06A 4O24A 2USHA 1T71A 2ZBMA 1OIEA 1HPUA 3AUZA 4NZVA 4ZVZA 5GTUA 1U32A 3KBPA 3EGGA 1WAO1 2HY1A 1HO5A 2IAEC 2KKNA 4I5LC 1T70A 1KBPA 3IVDA 3K7VC 4HD0A 3N5UA 4MOVA 3IB7A 1UF3A 4MP0A 3H67A 4O43A 2Z1AA 4LACC 2QFRA 4H2IA 2NYMC 2Z72A 3DSDA 4ORCA 2O8AA 1S70A 3QFMA 2BQ8X 3EGHA 4IL1A 1UTEA 2HYOA 1II7A 2HYPA 3C9FA 3E7AA 3THNA 1MF8A 4JA7A 3HVQA 4LTYA 1FJMA 5JJTA 4M0VA 4ORBA 3RL4A 4H2BA 1OIDA 5JPFA 3C5WC 3IVEA 1Z2WA 4ZX2A 1W24A 1SU1A 2ZO9B 3H60A 3H63A 5INBA 4Q7FA 3IB8A 3FLOA 1S3LA 1XZWA 2YVTA 1TCOA 3RQZA 1QHWA 2DXLA 4V0WA 3T1IA 5IOHA 1S3MA 1USHA 4YKEA 3JYFA 4DHLA 2A22A 1OI8A 5F3WA 4J6OA 4H1SA 5EQVA 3H69A 3ZTVA 3ZU0A 4LU9A 3QFKA 3LL8A 2DXNA 1IT6A 2NPPC 3FGAC 3P71C 4FCXA 2GJUA 3RL3A 3RL5A 4FBKA 4XPNA 3H61A 2WDFA 3ICFA 5HPEA 3E7BA 3PSNA 2NYLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXF A;  2JOG A;  3H64 A;  3QFO A;  5J28 A;  2IE4 C;  4TUG A;  1V73 A;  3K7W C;  2DFJ A;  3AV0 A;  5B8I A;  4O4K A;  2WDE A;  3H68 A;  3DSC A;  4B2O A;  3QG5 C;  3H66 A;  2P6B A;  1JK7 A;  2BCD A;  3DW8 C;  2AHD A;  2Q8U A;  4H2G A;  4WWL A;  3CK2 A;  4V0X A;  4FBW A;  4IYP C;  1S3N A;  3GVE A;  2CV9 A;  4H2F A;  4I5N C;  1QFC A;  2O8G A;  4DSY A;  1HP1 A;  1S8E A;  4DT2 A;  5C1V A;  1AUI A;  5DNY A;  3TGH A;  5JPE A;  2XMO A;  2IE3 C;  1G5B A;  4UT3 B;  1WAR A;  2QFP A;  4UT2 A;  2WDC A;  4V0V A;  1M63 A;  4KKZ A;  1Z2X A;  4JA9 A;  3V4Y A;  4MOY A;  3QFN A;  1XM7 A;  4F0Z A;  2QJC A;  3PSO A;  2WDD A;  4H1Y P;  4OR9 A;  4UWQ A;  2R17 A;  4UT3 A;  1NNW A;  3H62 B;  4G9J A;  1S95 A;  2BDX A;  4KBP A;  4O5G A;  3THO B;  4TUI A;  4FBQ A;  4ORA A;  2Z06 A;  4O24 A;  2USH A;  1T71 A;  2ZBM A;  1OIE A;  1HPU A;  3AUZ A;  4NZV A;  4ZVZ A;  5GTU A;  1U32 A;  3KBP A;  3EGG A;  1WAO 1;  2HY1 A;  1HO5 A;  2IAE C;  2KKN A;  4I5L C;  1T70 A;  1KBP A;  3IVD A;  3K7V C;  4HD0 A;  3N5U A;  4MOV A;  3IB7 A;  1UF3 A;  4MP0 A;  3H67 A;  4O43 A;  2Z1A A;  4LAC C;  2QFR A;  4H2I A;  2NYM C;  2Z72 A;  3DSD A;  4ORC A;  2O8A A;  1S70 A;  3QFM A;  2BQ8 X;  3EGH A;  4IL1 A;  1UTE A;  2HYO A;  1II7 A;  2HYP A;  3C9F A;  3E7A A;  3THN A;  1MF8 A;  4JA7 A;  3HVQ A;  4LTY A;  1FJM A;  5JJT A;  4M0V A;  4ORB A;  3RL4 A;  4H2B A;  1OID A;  5JPF A;  3C5W C;  3IVE A;  1Z2W A;  4ZX2 A;  1W24 A;  1SU1 A;  3H60 A;  3H63 A;  5INB A;  4Q7F A;  3IB8 A;  1S3L A;  1XZW A;  2YVT A;  1TCO A;  3RQZ A;  1QHW A;  4V0W A;  3T1I A;  5IOH A;  1S3M A;  1USH A;  4YKE A;  3JYF A;  4DHL A;  2A22 A;  1OI8 A;  5F3W A;  4J6O A;  4H1S A;  5EQV A;  3H69 A;  3ZTV A;  3ZU0 A;  4LU9 A;  3QFK A;  3LL8 A;  4FCX A;  1IT6 A;  2NPP C;  3FGA C;  3P71 C;  2GJU A;  3RL3 A;  3RL5 A;  4FBK A;  4XPN A;  3H61 A;  2WDF A;  3ICF A;  5HPE A;  3E7B A;  3PSN A;  2NYL C; 
#chains in the Genus database with same CATH topology
 2NXF A;  2JOG A;  3D03 A;  3H64 A;  3QFO A;  5J28 A;  2IE4 C;  4TUG A;  1V73 A;  3K7W C;  2DFJ A;  3AV0 A;  5B8I A;  4O4K A;  2WDE A;  3H68 A;  3DSC A;  4B2O A;  3QG5 C;  3H66 A;  2P6B A;  1JK7 A;  2BCD A;  3DW8 C;  2AHD A;  2Q8U A;  4H2G A;  4WWL A;  3CK2 A;  4V0X A;  4FBW A;  4IYP C;  1S3N A;  3GVE A;  2CV9 A;  4H2F A;  4I5N C;  1QFC A;  2O8G A;  4DSY A;  1HP1 A;  1S8E A;  4DT2 A;  5C1V A;  1AUI A;  5DNY A;  3TGH A;  5JPE A;  2XMO A;  2IE3 C;  1G5B A;  4UT3 B;  1WAR A;  2QFP A;  4UT2 A;  2WDC A;  4V0V A;  1M63 A;  4KKZ A;  1Z2X A;  4JA9 A;  3V4Y A;  4MOY A;  3QFN A;  1XM7 A;  4F0Z A;  2QJC A;  2YEQ A;  3PSO A;  2WDD A;  3E0J A;  4H1Y P;  4OR9 A;  4UWQ A;  2R17 A;  4UT3 A;  1NNW A;  3H62 B;  4G9J A;  1S95 A;  2BDX A;  4KBP A;  4O5G A;  3THO B;  4TUI A;  4FBQ A;  4ORA A;  2ZOA A;  2Z06 A;  4O24 A;  2USH A;  1T71 A;  2ZBM A;  1OIE A;  1HPU A;  3AUZ A;  4NZV A;  4ZVZ A;  5GTU A;  1U32 A;  3KBP A;  3EGG A;  1WAO 1;  2HY1 A;  1HO5 A;  2IAE C;  2KKN A;  4I5L C;  1T70 A;  1KBP A;  3IVD A;  3K7V C;  4HD0 A;  3N5U A;  4MOV A;  3IB7 A;  1UF3 A;  4MP0 A;  3H67 A;  4O43 A;  2Z1A A;  4LAC C;  2QFR A;  4H2I A;  2NYM C;  2Z72 A;  3DSD A;  4ORC A;  2O8A A;  1S70 A;  3QFM A;  2BQ8 X;  3EGH A;  4IL1 A;  1UTE A;  2HYO A;  1II7 A;  2HYP A;  3C9F A;  3E7A A;  3THN A;  1MF8 A;  4JA7 A;  3HVQ A;  4LTY A;  1FJM A;  5JJT A;  4M0V A;  4ORB A;  3RL4 A;  4H2B A;  1OID A;  5JPF A;  3C5W C;  3IVE A;  1Z2W A;  4ZX2 A;  1W24 A;  1SU1 A;  2ZO9 B;  3H60 A;  3H63 A;  5INB A;  4Q7F A;  3IB8 A;  3FLO A;  1S3L A;  1XZW A;  2YVT A;  1TCO A;  3RQZ A;  1QHW A;  2DXL A;  4V0W A;  3T1I A;  5IOH A;  1S3M A;  1USH A;  4YKE A;  3JYF A;  4DHL A;  2A22 A;  1OI8 A;  5F3W A;  4J6O A;  4H1S A;  5EQV A;  3H69 A;  3ZTV A;  3ZU0 A;  4LU9 A;  3QFK A;  3LL8 A;  2DXN A;  1IT6 A;  2NPP C;  3FGA C;  3P71 C;  4FCX A;  2GJU A;  3RL3 A;  3RL5 A;  4FBK A;  4XPN A;  3H61 A;  2WDF A;  3ICF A;  5HPE A;  3E7B A;  3PSN A;  2NYL C; 
#chains in the Genus database with same CATH homology
 2NXF A;  2JOG A;  3D03 A;  3H64 A;  3QFO A;  5J28 A;  2IE4 C;  4TUG A;  1V73 A;  3K7W C;  2DFJ A;  3AV0 A;  5B8I A;  4O4K A;  2WDE A;  3H68 A;  3DSC A;  4B2O A;  3QG5 C;  3H66 A;  2P6B A;  1JK7 A;  2BCD A;  3DW8 C;  2AHD A;  2Q8U A;  4H2G A;  4WWL A;  3CK2 A;  4V0X A;  4FBW A;  4IYP C;  1S3N A;  3GVE A;  2CV9 A;  4H2F A;  4I5N C;  1QFC A;  2O8G A;  4DSY A;  1HP1 A;  1S8E A;  4DT2 A;  5C1V A;  1AUI A;  5DNY A;  3TGH A;  5JPE A;  2XMO A;  2IE3 C;  1G5B A;  4UT3 B;  1WAR A;  2QFP A;  4UT2 A;  2WDC A;  4V0V A;  1M63 A;  4KKZ A;  1Z2X A;  4JA9 A;  3V4Y A;  4MOY A;  3QFN A;  1XM7 A;  4F0Z A;  2QJC A;  2YEQ A;  3PSO A;  2WDD A;  3E0J A;  4H1Y P;  4OR9 A;  4UWQ A;  2R17 A;  4UT3 A;  1NNW A;  3H62 B;  4G9J A;  1S95 A;  2BDX A;  4KBP A;  4O5G A;  3THO B;  4TUI A;  4FBQ A;  4ORA A;  2ZOA A;  2Z06 A;  4O24 A;  2USH A;  1T71 A;  2ZBM A;  1OIE A;  1HPU A;  3AUZ A;  4NZV A;  4ZVZ A;  5GTU A;  1U32 A;  3KBP A;  3EGG A;  1WAO 1;  2HY1 A;  1HO5 A;  2IAE C;  2KKN A;  4I5L C;  1T70 A;  1KBP A;  3IVD A;  3K7V C;  4HD0 A;  3N5U A;  4MOV A;  3IB7 A;  1UF3 A;  4MP0 A;  3H67 A;  4O43 A;  2Z1A A;  4LAC C;  2QFR A;  4H2I A;  2NYM C;  2Z72 A;  3DSD A;  4ORC A;  2O8A A;  1S70 A;  3QFM A;  2BQ8 X;  3EGH A;  4IL1 A;  1UTE A;  2HYO A;  1II7 A;  2HYP A;  3C9F A;  3E7A A;  3THN A;  1MF8 A;  4JA7 A;  3HVQ A;  4LTY A;  1FJM A;  5JJT A;  4M0V A;  4ORB A;  3RL4 A;  4H2B A;  1OID A;  5JPF A;  3C5W C;  3IVE A;  1Z2W A;  4ZX2 A;  1W24 A;  1SU1 A;  2ZO9 B;  3H60 A;  3H63 A;  5INB A;  4Q7F A;  3IB8 A;  3FLO A;  1S3L A;  1XZW A;  2YVT A;  1TCO A;  3RQZ A;  1QHW A;  2DXL A;  4V0W A;  3T1I A;  5IOH A;  1S3M A;  1USH A;  4YKE A;  3JYF A;  4DHL A;  2A22 A;  1OI8 A;  5F3W A;  4J6O A;  4H1S A;  5EQV A;  3H69 A;  3ZTV A;  3ZU0 A;  4LU9 A;  3QFK A;  3LL8 A;  2DXN A;  1IT6 A;  2NPP C;  3FGA C;  3P71 C;  4FCX A;  2GJU A;  3RL3 A;  3RL5 A;  4FBK A;  4XPN A;  3H61 A;  2WDF A;  3ICF A;  5HPE A;  3E7B A;  3PSN A;  2NYL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...