3E83A

Crystal structure of the the open nak channel pore
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e83A00
2WLIB 3E8BA 4H33A 2KB1A 1V54C 2QKSA 2EIMC 4MVZA 5CBFA 2WLJA 3K0GA 3E86A 1OCZC 2X6CA 4MS2A 4MVMA 2AHZA 4MW8A 2IH1C 2ZD9A 5EC1C 4XDKA 3HPLC 5KUKA 4DXWA 4PA4A 3EFFK 2QTOA 3IGAC 3FB5C 4MVOA 4PA7A 3OR7C 3UM7A 4MTOA 4JTCB 2Q6AA 5KUMA 3ASNC 3FB7C 4I9WA 3E89A 2WLKA 1G4YB 4PDVA 3PJSK 4P2ZA 4UUJC 2Q69A 4MSWC 2HFEC 3GB7C 4MVSA 5EBLC 2DYRC 4R7CA 1XL6A 2WLHA 4BW5A 3SPCA 5BZBA 2WLIA 4QE9A 4LP8A 4QE7A 1K4CC 3LDEA 4HZ3A 4J9YB 1V55C 3JYCA 2DWDC 2ITDC 2R9RB 2A9HA 2ITCC 2X6AA 3K0DA 3SPIA 3VOUA 4QNHB 2HVKC 4G28B 4LBEC 5E1AC 3BEHA 4KFMA 4WFGA 4P9OA 3RBZA 3RVYA 1R3KC 4MW3A 1QLEC 2Y69C 2ATKC 2AHYA 4H37A 3T1CA 3K03A 1K4DC 2WLMA 1M56C 2DYSC 3R65A 2WLNA 4F4LA 5B1BC 3X2QC 4PA6A 1R3JC 3WG7C 1R3LC 2H8PC 4ZBMA 2Q68A 2WLLB 3SJQC 2P7TC 3ABMC 2WLLA 1LNQA 4R8CA 5IY5C 5J9PC 2A0LA 5EC2C 3K06A 1BL8A 2Q67A 3FB6C 5EBMC 3T4ZA 1R3IC 3AG2C 1ZWIC 2IH3C 5CBGA 1P7BA 3F5WC 2HJFC 3E8HA 2YEVA 4GX2A 1KKDA 1J95A 4R50A 3ZRSA 5EBWC 3UKMA 4X89A 3SYPA 1OCOC 1S5HC 4OXSA 4MVQA 3TETA 3ABKC 4P30A 4PDLA 4WFHA 4X88A 5B1AC 2K1EA 4MTGA 1OCCC 3SYQA 2EIJC 3AG3C 4RUFA 2BOBC 4RO2A 3SPJA 3T4DA 4GX0A 3SYCA 1OCRC 3ZJZA 4GX5A 3E8GA 1ORQC 3LDDA 2EIKC 4GX1A 4P9PA 3E83A 3OGCC 4RAIA 4XDJA 2JK5C 4MVUA 2HG5C 2HVJC 3FB8C 4LCUC 3RVZA 3AG1C 3T2MA 4MVRA 5CBHA 3AG4C 2BOCC 1XL4A 3K04A 4TWKA 4J9ZB 3F7YC 5B3SC 3OR6C 3LNMB 2W0FC 4R6ZA 4WFEA 3E8FA 3OUFA 2EINC 4XDLA 4HYOA 4X8AA 3STZC 4PA9A 3KG2A 3ABLC 2NLJC 1JVMA 3IFXA 3OUSA 2OCCC 3K08A 4MTFA 3SPHA 3SPGA 4G27B 3LDCA 4CBCA 4JTAB 4PDMA 3RW0A 4WFFA 4PDRA 2A79B 2EILC 3STLC 3SYAA 3SYOA 3TCUA 2DWEC 4PA3A 5EK0A 4RUEA 2ZXWC 3LUTB 2X6BA 3F7VC 4JTDB 3ASOC 4EKWA 1M57C
chains in the Genus database with same CATH superfamily
4E4EA 1QR8A 4I55A 2CTPA 3I55V 4D7SA 4MS2A 1EN4A 2QM7A 1JQ0A 1Q86W 1FXVA 4IHJB 1HNWB 3JATA 1YIJV 5KUMA 3UQ8A 5LMUO 5H6QA 2B5UA 2UU9B 3BVOA 4B3MB 2AW9A 2CE4A 5J2UA 1GN3A 1V54B 3ZBHA 4K0KO 3CCVV 4FFBB 4QE9A 2BSKA 2BSKB 3CJHA 1RM1B 5H2FZ 4KUMA 4LFBO 5KMGA 5KMGB 4DR5B 4DR7B 3OMNB 4UCOA 4P9OA 2ATKC 3PN1A 1S76D 3QNEA 2F93B 1AI7A 3KKYA 3VQYA 2KG7B 5JJEB 1XNQO 3FX7A 3CWBH 2LFRA 4OGQB 1X4TA 2Q67A 2IH3C 3ZRXA 2HJFC 2Y69B 1HNXO 5EBWC 4K3AA 1VQ6V 2IJIA 1S5HC 4LFCB 2PI4A 5J2TB 3K59A 3W7TA 1B6QA 1R6KA 1BSMA 5BMVB 4JI3O 2Y0PA 3CE2A 1YSCA 5LOVB 3ZJZA 1I94B 2AGAA 4DK0A 4P9PA 3OTFA 5ITZA 5LGUA 2EILB 3JCUZ 3G6BA 3ABMB 1R73A 1WN7A 3U0ZA 1NVPD 3ZN1A 2WSSG 4KP4A 3ZMVA 1E1QG 1YDXA 3QO7A 1DK1A 5JH7B 3ETEA 4B7EA 3RYIB 5JH7A 2UXBB 5JCOA 2CH7A 3ETQA 2EIKB 3SYOA 3QTCA 1YEWA 1IX9A 1HP8A 4JPRA 3WG7B 1M4UA 2KB1A 4FMTA 4MVZA 3K0GA 3E86A 2ZQMA 5KX5B 2X7RB 4TV8B 3K5LA 1YHQV 2LJ2A 1IXMA 1WNSA 1F23A 4NYKA 5LHGA 3BRCA 1B04A 1MABG 5H5NA 5EYPA 5EYPB 4LF8O 3HKEA 1G4YB 4QPJA 4DV7B 1MZEA 1S72V 1PP9H 1VP7A 3JARB 5DECA 1GH6A 3CP1A 4UCTA 4C7UA 3K5MA 2R9RB 3SPIA 4NXMB 1FPOA 1SC5B 2LFSA 3E2EA 4WFBV 4JI2B 3MDSA 2DYSC 2XUMA 4F4LA 2QE7G 1N32O 3JAMN 4PA6A 1KBHA 3ML0A 3A8TA 5IY5C 2A0LA 4DV1B 3JD0A 3T4ZA 4FLTA 1N8RW 3JD2A 3FYEB 2ZT9B 4FJCC 1GM7A 4QPKA 2UXCO 1V55B 3FKSG 4GKKO 3CCEV 4FM2A 1VQ9V 1QLNA 2BOBC 1SRYA 1IBKO 3D36C 4AI8A 2D3OW 1P4RA 3A0RA 4GX1A 3MD0A 2QWQB 2C2AA 3C90A 3JD1A 3CRCA 2JS5A 3H1JH 2E5LB 3JAKA 3L71H 1YZBA 2OCCC 4NR1A 3LDCA 4CBCA 2P22C 4PDRA 2Q73A 4RUEA 4DV5B 4O2BB 3ABUA 3OM3B 4JI8O 4CC6A 4IYIA 4I55B 1LUWA 2F4VB 5L3GA 4KHPB 3GVMA 4J80A 4PV1B 4JI7B 1BE3H 4PJ0Z 1R6NA 4FLWA 2R9AA 4MTOA 4JTCB 1KU9A 3H1LH 1KYOF 1PKXA 2CH7B 2LQTA 2WLKA 2F1MA 2ZE6A 2CK3G 4DK1A 4ZI7B 2W0XA 3ZN0A 1VF7A 3BY6A 4DR6O 4CH3A 3CMAV 3BHPA 2X6AA 3SGIA 4U3JB 4LF4B 3P32A 1Y76A 1Z5VA 1W2BU 2VQFO 5E1AC 1HR0B 5LA6B 4WFGA 1R3KC 3ZHRA 1I0HA 3K03A 1XNQB 4CH4A 1VF6A 3CXHF 4UCRA 3IC9A 1QCEA 4ZBMA 1CPYA 5GTHZ 1VF6C 4X9QA 3AG1B 1JMKC 1AROP 3TXSA 2VRZA 1XHXA 1ZWIC 1AI4A 1OJHA 2XNDG 2N04A 1BQZA 2YEVA 1FAFA 1PL4A 4X89A 4B3SB 5BMVA 3Q4HB 3D3IA 2EZPA 4I7ZB 1YJNV 1XDCA 2HEPA 2PF4E 4WBNA 3K79A 1G6UA 3K58A 1NU1H 2IM9A 4FFKA 4U3FH 1TUBA 2CGOA 1IZ3A 5DM6V 2WAMA 2WPDG 4NKGB 5GONA 3LSSA 5L3EA 3JCZA 2E3CA 3OUFA 2F43G 1NR7A 4X8AA 2ZE7A 1MMMA 1SZTA 5H9CA 3H1KH 4EFBA 2P90A 1XMOB 1MSDA 2YXYA 1TAEA 1Y6XA 4JTDB 1FFXB 2A06H 1VQ8V 1NR1A 5CA1B 2X6CA 4I50A 2IH1C 1OZ0A 5LP6B 1VIBA 2YI8A 2QKCA 4DO2A 4MVOA 4DV0O 3U11A 3ZHTA 2ZE5A 2ZINA 2UUCO 3E89A 1HW7A 1M9NA 4P2ZA 5LHIA 2CTWA 3MHSC 4R7CA 2WLHA 1NT2B 3LDEA 3JYCA 4X65B 4JI2O 3VOUA 5KLVH 1AJQA 2PTMA 4JYCA 3ZIAG 2QJ1A 2P67A 4J7JA 3H9VA 2AHYA 1QNMA 1D5AA 4O2AA 1YJWV 2XAHA 5IY5B 2WA4A 3JD3A 1DGSA 2Q68A 5KHHA 1KP2A 5J9PC 1WLEA 3HKDA 3AG2C 3RWRD 3HKDB 3D36A 3JAWB 1N36O 3G4SV 3ABLB 1VQ4V 4FVMA 3T1HO 2K1EA 3T4DA 1FJGB 2PYLA 1FYJA 2RJZA 2M7WA 1BZKA 1PNLA 3CCRV 2O57A 2W6JG 4DV6O 4XDJA 1K73W 4MVUA 5C93A 5EZYB 1PNKA 1GK9A 3K04A 2ADPA 3CPWU 4G2KA 4J10A 4U7OA 1JX9A 1IDSA 2IJHA 3RYFB 3RW0A 1MG1A 3JASA 3ETGA 4DR2O 4LNUA 3JASB 1YTFD 3OE7G 4FLYA 1ZUQA 4X20B 3JALA 1TUBB 1KB9F 2ILMA 1NH2B 2B1IA 4Z2WA 2CAZC 4YXWG 2LGQA 2DYSB 4JGSA 3RYCB 4JI3B 2Q6AA 2GHYA 3OAAG 1V9PA 1UFIA 3KCYA 2UXDB 3T1YO 3J81N 2YICA 4NXNO 3N2GA 2P6JA 4UFZA 4DYLA 4DV4B 1TA8A 5L3FA 1SA0B 3P30A 3RVYA 3VQVA 3HKBA 4LC1A 2EBOA 4DR4B 4JI0O 3MHHC 3BPZA 3ZHSA 3CXCU 2OYQA 4CS2A 1NTMH 1D2DA 4ZKIA 1VEWA 3AK2A 4Z1MG 1O9GA 4NB5A 1RM1C 1THZA 1O9HA 2ZM6B 1OHHG 2ZNJA 5J2TA 2OIGA 5IE9A 1IBMO 3W7WA 1XI1A 2QWNB 3P3PA 2JK5C 5ITZB 3J7AU 2YDEA 1PNMA 1PPJH 1JCHA 4J9ZB 2Q9LA 4LH7A 1XNRB 1Q6HA 4I0XB 4X1KA 4B3RB 5KAFZ 1N34B 1I7FA 2IJJA 1QU7A 1B06A 1WA8B 1IXBA 2BTQA 1URFA 2HLDG 3CCQV 1GM8A 1E79G 4H33A 2QKSA 4D6TH 1M5IA 4YHHO 5BR8B 5F2VO 2ETNA 1YITV 4MW8A 5B1NA 1NTZH 4X64O 3EFFK 1S77D 2QWOB 2ZE8A 4I9WA 1N33O 1WP7A 2JRIA 4LNUB 4DR3B 1RSOA 1ZL8B 2HFEC 1RSOB 1ZL8A 3HR0A 2E74B 1YTFB 2Q0AA 1HNZB 4BIZA 4QIWF 2OTLV 3JATB 5LYJA 1QLEC 4LF7O 1D5NA 5TISZ 3RYHA 4JI8B 5B1BC 1H2LA 2F4VO 1AP6A 1LNQA 3N2GB 1NJIW 3C3SA 1H38A 4KHPO 3TGUH 1GO3F 1JFFB 5CBGA 4DV3B 4MT8A 4N23A 1FXKC 1N0JA 5LA6A 1FKAO 4B08A 2JGDB 3AG2B 4JI1O 2JGDA 1FJGO 4PDLA 4P30A 1KQSU 4FIPC 4Q6GA 1F7YA 2MW2B 3AG3C 1OCRC 4UB8Z 1AI5A 1VARA 3SR2C 1WA8A 2EIKC 5D5PA 4BR6A 3IAYA 3B8NA 3T2MA 3G80A 4LF9B 3B8MA 1WPXA 1XL4A 2EIJB 4R6ZA 1BT8A 4FZ0A 2DMXA 4QJFB 4YIPA 4JZ2A 4LFAO 1SQPH 3IFXA 3Q4HA 3C3TA 4DW1A 1SESA 2FMLA 1FD9A 4FLXA 3LUTB 5CA0A 5H6RA 4JYAO 4DUZB 3GWOA 3ZRWB 2WLJA 2UUAB 2Z0AA 3K9SA 1JJ2U 1G1XB 3WB0A 3CS5A 1Q6IA 4PA7A 2Q7GA 1PV0A 5IYZB 4ICGA 5JWPA 1SQBH 3I5DA 2Y4TA 4HNAA 5IJ0B 3CD6V 2Q7EA 4JI4O 2EJRA 3IJ4A 4B3TO 1FXHA 4DR4O 2GTAA 4H37A 1IURA 3BA9A 4RQFA 2LW7A 2QDOA 4H13B 3W7UA 1VMGA 1AR5A 3ABMC 4DR1B 1EN5A 2IU0A 1SERA 1NBMG 3B77A 2FKXA 2P06A 2R70A 1YF2A 2KSDA 4OX9O 2KKWA 1COWG 2Q0OC 1BQ0A 5IT9N 5LL6Y 2RQ6A 3K5OA 1OCCC 2HR3A 4RO2A 5IYCO 4TV9A 1YVWA 3E83A 1U96A 2HG5C 4FM0A 4W4KA 2OIEA 2QTSA 1N34O 3A0HZ 4XDLA 2IU3A 2QWPB 3ZMUA 3ABLC 4I0XA 1OV9A 5B3SB 1JJOA 2VS0A 4WFAV 2DWEC 2ZXWC 2YC0A 3F7VC 3ASOC 5IYBO 5JJJB 2Q4PA 1Y66A 4ZIBA 3O9OA 4O4LB 4KL1A 3T1HB 5LP6A 3K57A 3E22B 4X62B 4IIJB 2WA3A 1DLBA 1XMQO 3IC7A 1NVPB 4WCEV 3PJSK 1Q6UA 3OTOB 1Q43A 5LXTB 3GB7C 1XL6A 4BW5A 4Z1VA 4X66O 4QE7A 1Y74A 1CXZB 4J9YB 3ZHQA 3UCSC 1GAXA 3QO8A 2HP8A 4I4TB 3ZX6A 3DXRB 1L8DA 3CRRA 1TVKA 5A2QN 2XASA 4UV9A 2Y69C 1NQTA 4KXRA 4DR2B 2EX3A 4K35A 3WB1A 4ZHQA 4R8CA 4ZHQB 3I56V 1K97A 1WB8A 3OMIB 3FB6C 4NTXA 3OEEG 2AZ0A 1K5SA 1AI6A 1AP5A 4O4IA 4F6RB 3ASNB 1QVFU 4R50A 3L70H 4BWAA 1OCZB 2PI5A 2F23A 2EIJC 2DYRB 1F4MA 2XOKG 5KHGA 4OPAA 1BGYH 3ZEDA 4FLVA 3B40A 2OWOA 3HKCB 1WJZA 2W0FC 4PA9A 1PL0A 4PHZA 5B66Z 4DUYO 2X0LA 3SPHA 2LW1A 4RQEA 5JVDB 3OT7A 5L3CA 4LF6B 3D3QA 3STLC 5IDJA 3H01A 1N32B 4GKJO 1VQOV 5LGNA 1KUQA 4FZ1A 4AILC 1RFYA 4YJ3B 2EJ7A 2ZDIA 3ZRWA 4I4TA 2AHZA 4HAMA 5B1AB 2CDYA 2RDCA 2YIAA 4DXWA 4PA4A 1VF5B 3OR7C 4JI5O 4UCUA 4B3MO 1VQNV 2DW4A 2XAQA 5DN6G 2Q5ZA 1FFTB 2V4DA 5KHKA 1IBKB 4LFBB 3AK3A 2XHBA 4DR5O 1JFFA 1MSWD 4FLUA 2PZSA 2MK3A 3APQA 2XAFA 1JPXA 2FYUH 2OT5A 4CC5A 1EN6A 2WLMA 4JF3A 3L9DA 5B1OA 4J41A 3TXQA 3L75H 4JV5B 1KD1W 4OPHA 5LXTA 3X2QB 3JSLA 2NR5A 2HJDA 4FK5C 1P7BA 3E8HA 3WU2Z 3H1IH 4FLZA 2FTKA 2IW5A 1GN6A 4L8JA 3TETA 1QBZA 4X88A 5C8YB 1OCOB 4JI6O 2QWRB 3B09A 3CYOA 4AQYO 4GX0A 2HHHO 3OGIB 4BW9A 3ZRVA 4J7ZA 3OGCC 3TJTA 4EB6B 2HVJC 3SJBC 2BE3A 3APOA 5GONB 4TWKA 2FB5A 4WFEA 2EINC 2YI9A 4NVPA 5LBQA 3KG2A 3K9AA 3DSQA 1JVMA 1T5EA 4UVBA 1QQCA 5FNVA 3ZHVA 4JTAB 5IYZA 2LGWA 4A5UB 4WFFA 1TGOA 3OMAB 2EILC 2DQ0A 1K33A 1K8AW 2YUAA 5IJ9A 1X59A 1OCRB 2WLIB 3W7SA 1YJ9V 4MTXA 4X62O 2JIZG 3ZCCA 4ZOLA 1Z2GA 3DTUB 5EC1C 3F5TA 5KAIZ 1KP3A 2F95B 2QTOA 4DV7O 1Y67A 4LF5O 5CB4A 5LP6C 1Y4MA 4AHCA 4JZGA 4X66B 3B2EE 2KG7A 2CTQA 4MVSA 3JARA 3M8AA 5AG2A 2BCCH 2H3OA 3FAVB 4QNHB 3CSXA 1ZX3A 4LBEC 4LFAB 4MW3A 4YJ2A 4NXMO 5LYJB 2RNBA 2ODMA 5C8YA 1M56C 2GSMB 4JYBA 3SDLA 3RFRA 3WG7C 2B1GA 1R3LC 2EIMB 3SJQC 2JVDA 4WBNB 4HBNA 2DOSA 3CC7V 2ZNIA 4XBFA 1Y76B 4JYYA 1KKDA 1J95A 3UKMA 2VQEB 4UCVA 4UVAA 2EULA 2ADQB 3THOA 1MNGA 5DEDA 5B1AC 3A0BZ 1CP9A 4YY3O 2ZIMA 3SPJA 5GW7A 1YI2V 3LDDA 3WB2A 4TSFG 2GUZA 3HKCA 4DR7O 4MVRA 2QM4A 2E5LO 2M6YA 4L87A 3CCLV 1H2NA 3N2KB 1P49A 2ZDIC 2OCHA 1F51A 4FPPA 2NLJC 4MTFA 5JVDA 4U7NA 4DV5O 3RN4A 1Q3EA 3ZHUA 5CB4B 4EFEA 1ENVA 4IGGA 4X1IA 2E75B 2EZOA 4JI7O 1I5YA 3E8BA 1HNXB 2UUBB 1SQGA 4YJ3A 4NTYA 2LO1A 2GDSA 2ZD9A 1SQVH 5L3DA 4XDKA 3CRMA 3RYCA 1NTKH 3BFRA 1M57B 2ZR2A 3ASOB 3FFQA 1YCIA 5KA5A 3RYHB 5EIBC 3KZIZ 2JDIG 4QGPA 2QGNA 5GTIZ 4LR3A 3SPCA 4LF4O 1QR9A 1K4CC 3QF7A 3E22A 3G67A 3RBZA 2UXBO 1FXKB 1Q8IA 2CTRA 2VQFB 1KMIZ 1M90W 3CEIA 5HFMA 3OEHG 1NI8A 3L72H 1RPRA 3HB3B 4B3SO 2UXXA 2YEVB 2Q8VA 1I5XA 1QLEB 1VQ5V 3NXSA 2RCVA 3B4SA 1AJNA 3OTOO 3VBBA 5LMNO 4RUFA 4UCSA 3LNNA 5FPRA 1AILA 1MA1A 3MAQA 4YIOA 1GM9A 4GX5A 1JOYA 2N74A 1W59A 4J11A 5B3SC 1S0VA 1NZ6A 4EEQA 3FD9A 3K08A 4JAVA 4D7TA 4JAAA 1XMOO 4K8XA 3RT3C 4DW0A 4ZI7A 2XAJA 5J2UB 5IJ9B 2A7WA 1MOFA 4CH6A 1EZJA 2YXLA 5JCOC 4CS4A 3CJHB 4I50B 3CRAA 2JEUA 1U97A 3S3WA 3UT5A 4GKKB 2YSUB 3OFNG 4LF5B 3BA8A 1XBLA 3UM7A 4LWSA 3CCMV 4CZZA 3JSNA 1NKDA 4UUJC 4MSWC 5EBLC 1IBMB 4X65O 3E35A 2FL4A 1K3EA 2WWWA 2HVKC 4IYHA 1TVKB 2DJVA 2P4KA 3DGEA 3T1CA 2G38A 3CC4V 3K5NA 1K92A 3TK1A 3DC6A 3CB2A 1M56B 3VQXA 5K1PA 1H8EG 3K06A 1MZFA 1SQXH 4EB6A 1ROPA 2R9IA 2YS8A 4CH5A 4F6RA 2VQEO 1AB3A 4JI5B 3ZRSA 4YY3B 1OCOC 4OXSA 1J5EB 4X64B 3CCSV 1SQFA 4DR6B 1XUQA 2PGGA 3SYCA 3L74H 3E8GA 2GUZB 1K34A 4H0LB 4LCUC 4PELA 5EZYA 1H2MA 2DE0X 5E79Z 3AG4C 3M99B 4DV6B 5HFLA 3E8FA 3CCUV 3BABA 1I08A 3D8CA 1E1RG 3SPGA 4ASUG 2K9PA 2ZIOA 1H2GA 5EK0A 2XT9A 2UUBO 1BMFG 3L73H 1M57C 1SZXA 1CEZA 2R72A 1S3JA 1GN2A 1V54C 3O65A 1Y74B 5FL7G 1OCZC 5KA6A 1RPOA 2AZ2A 3G6EV 4J7KA 5KUKA 3IGAC 3QVNA 3FB5C 2HHHB 3T1YB 1R1BA 3FB7C 2PY5A 4NXNB 4K8ZA 2IBZH 1H8HG 3JD4A 4FFBA 2UXDO 5CA1A 2V7QG 4O4HA 4O4HB 1ZAUA 2DWDC 3K0DA 1AR1B 1F4NA 5LGTA 3CHXA 3LSQA 2CGNA 1SA0A 4G28B 3BEHA 5CMUA 2E76B 2WLNA 4TQDA 1VQPV 1R3JC 2RMKB 2H8PC 2P5OA 2WLLB 2P7TC 5B5EZ 2ZCEA 1WAZA 5IWAO 2Y4UA 4JI0B 1LUVA 4JASA 5EBMC 3FAVA 3LSUA 2JEXA 3DXRA 2ZM6O 4DV0B 1TUEB 1HWYA 3SYPA 3UO2A 1KC8W 5LMNB 1RP3B 2H94A 2YXHA 1BCCH 1GMGA 1LR1A 4TT3G 1IBLB 1ORQC 1K5QA 4LH6A 5CA0B 2HKOA 1PD3A 3AG1C 4K0KB 4BIUA 5KHJA 3ABKB 3OR6C 1DTOA 4W4LA 1EZVH 1XNRO 4X1KB 1K7DA 1JA8A 2L35A 5LHHA 4PDMA 3FYIB 1Q7YW 4O4JA 2VWJA 3SYAA 2Q7HA 2X6BA 1BHAA 2YIDA 4HNAB 5IJ0A 2AXTZ 3ZMTA 1N36B 3SJAC 1US6A 1G8MA 2L6LA 2NNUA 2Y48A 4TV8A 1IVSA 4MVMA 4U3JA 2ZR3A 3UT5B 1KKCA 1SQQH 4GCZA 1EM1A 2GV9A 3JAKB 4X1YB 4YHHB 2Z3YA 1L1FA 4OX9B 1N33B 3NR7A 4DR3O 1XEQA 5EIBD 4TQFA 4PDVA 4BIOA 3H1HH 2QEXV 2A3QA 2DYRC 1VQMV 4CS3A 4F6EA 1HNZO 4GT1A 3CCJV 3ZMSA 2ITCC 4DRXB 3EXAA 2W6IG 4LF7B 4WF9V 3CX5F 3EHBB 1P7GA 4YJ2B 4PD4F 3W7XA 1DF4A 5L3BA 3OD4A 1JR9A 1H2SB 5CA3A 4B7KA 4E2LA 1WP8A 1KECA 3F5WC 1ZTEA 1Q81W 4DV2O 1OCCB 4NTWA 1PM9A 4MVQA 3ABKC 3HKBB 5K1XA 4MTGA 3CRQA 2KQXA 3SYQA 4JI1B 1A32A 2JJ1G 4DV4O 3FB8C 3G71V 5CBHA 2JJ2G 2BOCC 3F7YC 1M93A 2YIBA 2BTOA 4HYOA 4UB6Z 4J42A 3P3NA 1Z5WA 5JQGB 3OUSA 4GUNA 4FM1A 1L0NH 3RYFA 3J80N 4O2BA 4X1IB 4DUZO 4EKWA 1VQKV 1BS3A 3M7MX 4UXNA 2XAGA 3QO5A 2QM8A 5CBFA 2XTAA 1DF5A 1S5JA 4IHJA 3HPLC 2IJKA 2YIBD 5FNVB 1XOUA 2UXCB 1HNWO 2Q69A 1FFXA 5LMUB 5BZBA 2UU9O 3BCCH 1W0JG 2WLIA 5BY1A 4JI4B 3U10A 1V55C 1YXBA 2A9HA 3JAWA 2Z5UA 4B3RO 4KFMA 3EVKA 5FPOA 4BAYA 4LWSB 5D5QA 3ZMZA 1K4DC 1ZLZA 4B3TB 3R66A 1QVGU 1WB7A 3AK1A 2WLLA 4UVCA 5BR8O 1XREA 2GBOA 1BL8A 1R3IC 1H2KA 4ABMA 4DR1O 1W0KG 1FS0G 1XILA 4GX2A 2NN4A 1S5LZ 5KHIA 3WFVA 1ZSPA 1IBLO 4LFCO 1N4CA 1NH2D 3ABTA 1AR4A 2DN9A 4TV9B 2QSAA 4RAIA 1I94O 4O4IB 2N05A 3VQWA 5JJNB 2UXNA 3LNMB 1GRJA 4IT5A 5B1BB 1B3QA 3STZC 2QKAA 3UO3A 1GN4A 1GKFA 1VQ7V 1SF9A 1HR0O 2ZKOA 3RYIA 4I9QA 2GTSA 2A79B 3TCUA 4O4JB 1AVMA 5A9GA 4JV5O 4DV3O 2P4VA 4O4LA 5FLXN 1SKVA 4UV8A 3CC2V 2EIMC 4GZRB 5KX5A 1J5EO 1XMQB 4ZOLB 4IL6Z 3DC5A 3N27A 2JS3A 4TUYB 4TOIA 4TUYA 1XHZA 4X1YA 4JAUA 3OW2U 2QR4A 1FXKA 3AG4B 3ASNC 1SETA 2ZXWB 3S3XA 3HKEB 2RN9A 1NS1A 4JI6B 4LF8B 3AG3B 2D2CB 4I5SA 4AQYB 4LF9O 5IYDO 1GTOA 1R6TA 4LP8A 4HZ3A 4Q20A 1HDJA 2ITDC 3SJCC 3AEIA 2JGUA 5BXZA 4DRXA 1AJPA 2Y0IA 1EBOA 3ZS8C 2OTJV 1UPGA 1M1KW 3R65A 4O2AB 2CUGA 1SS3A 2DQ3A 3BAAA 2ARHA 3X2QC 3ETDA 4JYAB 3QG5A 2B9ZA 4PI2A 1N0NA 3AG7A 2UUAO 1BHBA 3CMEV 3ICXA 5EC2C 1Q5OA 4PI0A 4DV1O 4DV2B 1K9MW 2V1DA 2PUSA 4WFHA 2EINB 1P84F 1EFRG 2LP7A 2PYJA 1WPBA 1XQ8A 5CN0A 4H44B 3K3WA 2UUCB 2BTQB 3KCXA 4RWUA 1Q82W 3RVZA 1L0LH 2OCCB 1QHTA 3N2KA 4DUYB 1UJWB 1VQLV 4IIJA 4LF6O 3A2FA 1Q90D 5JQGA 4G27B 3GWKC 4GYCB 5IWAB 4GKJB 5LOVA 3RGBA 4PA3A 4N21A 3JALB 4X20A 2QA4V 4GLXA 2VWKA 2F66C
chains in the Genus database with same CATH topology
1S3JA 1QR8A 1V54C 1NH2B 2B1IA 2ZDIA 5FL7G 3ZRWA 3I55V 1OCZC 4MS2A 4YXWG 5KA6A 1RPOA 2AHZA 4HAMA 5B1AB 2DYSB 2QM7A 3G6EV 1JQ0A 4JGSA 1Q86W 1FXVA 5KUKA 4DXWA 4PA4A 3IGAC 3FB5C 3OR7C 2Q6AA 1YIJV 5KUMA 2GHYA 3OAAG 3FB7C 1VQNV 5H6QA 2DW4A 2B5UA 2XAQA 5DN6G 1FFTB 1H8HG 1V54B 3JD4A 2P6JA 3CCVV 4QE9A 2V7QG 1MSWD 1RM1B 2DWDC 3K0DA 4KUMA 1AR1B 1F4NA 2MK3A 5L3FA 5LGTA 3LSQA 4G28B 2XAFA 3BEHA 3OMNB 1JPXA 3P30A 4P9OA 5CMUA 3RVYA 2ATKC 2OT5A 1S76D 2WLMA 3QNEA 4JF3A 4LC1A 5B1OA 2WLNA 1AI7A 2EBOA 1VQPV 1R3JC 1KD1W 2H8PC 3MHHC 2WLLB 2LFRA 2P7TC 3X2QB 3CXCU 4JASA 2Q67A 5EBMC 4ZKIA 2IH3C 2JEXA 4FK5C 1P7BA 3ZRXA 3E8HA 2HJFC 2Y69B 4Z1MG 1TUEB 1HWYA 5EBWC 3SYPA 2FTKA 2IW5A 1VQ6V 1KC8W 2IJIA 1S5HC 1RM1C 2PI4A 1THZA 3TETA 1QBZA 1OHHG 2H94A 4X88A 3W7TA 1OCOB 1B6QA 1R6KA 1GMGA 3CYOA 3W7WA 4GX0A 4TT3G 1YSCA 3ZJZA 1ORQC 1K5QA 3ZRVA 4P9PA 2HKOA 3OGCC 1PD3A 2JK5C 2HVJC 5LGUA 2EILB 3AG1C 3ABMB 1R73A 1PNMA 4TWKA 1JCHA 4J9ZB 4BIUA 3ABKB 3OR6C 1NVPD 3ZN1A 2WSSG 1DTOA 4KP4A 2EINC 4WFEA 3ZMVA 5LBQA 3KG2A 1E1QG 3K9AA 1K7DA 1JVMA 3QO7A 4UVBA 3ETEA 5LHHA 4JTAB 4PDMA 3FYIB 4WFFA 2IJJA 1Q7YW 3OMAB 2EIKB 2EILC 2DQ0A 3SYAA 3SYOA 1K33A 1K8AW 2X6BA 1BHAA 4JPRA 2HLDG 1OCRB 3WG7B 1GM8A 1E79G 2WLIB 3ZMTA 4H33A 3W7SA 2KB1A 2QKSA 4FMTA 1YJ9V 4MTXA 4MVZA 1G8MA 2Y48A 2NNUA 3E86A 3K0GA 2ZQMA 2JIZG 4MVMA 3ZCCA 2X7RB 2ZR3A 1YITV 4MW8A 4GCZA 3DTUB 5B1NA 5EC1C 1YHQV 1IXMA 1KP3A 1F23A 2Z3YA 2QTOA 3EFFK 1L1FA 5LHGA 1S77D 1MABG 4I9WA 1G4YB 1Y4MA 4PDVA 4QPJA 2QEXV 1S72V 2HFEC 4MVSA 2DYRC 1VQMV 3CP1A 1YTFB 4GT1A 3CCJV 3ZMSA 4QNHB 2R9RB 2ITCC 3SPIA 2W6IG 4LBEC 4WF9V 3EHBB 4BIZA 2LFSA 3E2EA 4QIWF 4WFBV 2OTLV 4MW3A 1QLEC 1DF4A 3W7XA 5L3BA 1M56C 2DYSC 2GSMB 4JYBA 4F4LA 2QE7G 5B1BC 5CA3A 4PA6A 3WG7C 2B1GA 1R3LC 4E2LA 2EIMB 3ML0A 3SJQC 1LNQA 5IY5C 2A0LA 1NJIW 1H38A 3JD0A 1GO3F 3T4ZA 3CC7V 1N8RW 1KECA 3JD2A 5CBGA 3FYEB 4XBFA 3F5WC 4MT8A 4N23A 1FXKC 1KKDA 1J95A 4FJCC 3UKMA 1GM7A 4QPKA 1Q81W 3AG2B 1OCCB 4UVAA 1V55B 4MVQA 3ABKC 4P30A 4PDLA 1KQSU 4FIPC 3FKSG 5B1AC 4MTGA 3CCEV 1CP9A 3SYQA 1VQ9V 3AG3C 3SPJA 2BOBC 1SRYA 1QLNA 2JJ1G 5GW7A 1YI2V 1OCRC 2D3OW 1AI5A 1P4RA 3A0RA 3LDDA 4TSFG 2EIKC 4GX1A 3MD0A 3FB8C 3B8NA 2C2AA 3T2MA 4MVRA 3G71V 3B8MA 3JD1A 2JJ2G 4L87A 1WPXA 2BOCC 1XL4A 5CBHA 3CCLV 3F7YC 2EIJB 4R6ZA 2ZDIC 4HYOA 1F51A 4FPPA 4QJFB 2NLJC 3IFXA 3OUSA 2OCCC 4MTFA 4U7NA 1SESA 3LDCA 4CBCA 4PDRA 1ENVA 4RUEA 3ABUA 3LUTB 3OM3B 4EKWA 1VQKV 2EZOA 5H6RA 4UXNA 2XAGA 3QO5A 1I5YA 2QM8A 3E8BA 3GWOA 3ZRWB 5CBFA 2WLJA 5L3GA 1DF5A 2ZD9A 1JJ2U 5L3DA 4XDKA 3HPLC 1R6NA 2IJKA 4PA7A 4MTOA 4JTCB 1M57B 2ZR2A 3ASOB 5KA5A 1PKXA 3CCQV 2WLKA 2CK3G 2JDIG 2Q69A 3ZN0A 3BY6A 5BZBA 3SPCA 1W0JG 2WLIA 1QR9A 3CMAV 3CD6V 1K4CC 1V55C 2X6AA 2A9HA 2Z5UA 3P32A 1W2BU 5E1AC 2EJRA 4KFMA 4WFGA 3RBZA 1R3KC 4BAYA 1FXKB 1FXHA 4H37A 3ZMZA 3K03A 1K4DC 4RQFA 1M90W 3W7UA 5HFMA 3OEHG 1QCEA 4ZBMA 1QVGU 1CPYA 3ABMC 2WLLA 4UVCA 3AG1B 2IU0A 1SERA 1NBMG 1AROP 3B77A 1BL8A 1R3IC 1ZWIC 1RPRA 3HB3B 1AI4A 2XNDG 1W0KG 2UXXA 2YEVB 1FS0G 1I5XA 1QLEB 2YEVA 4GX2A 1VQ5V 1COWG 4X89A 3NXSA 1AJNA 3WFVA 1OCCC 3VBBA 3D3IA 2EZPA 1YJNV 4RUFA 2HR3A 4RO2A 5IYCO 1NH2D 3ABTA 1GM9A 4GX5A 3K79A 1JOYA 3E83A 4RAIA 2HG5C 5DM6V 2WAMA 2WPDG 5B3SC 1S0VA 5L3EA 3LSSA 2UXNA 3LNMB 3JCZA 3OUFA 5B1BB 4XDLA 2F43G 1NR7A 4X8AA 5H9CA 3STZC 1SZTA 2IU3A 2P90A 3ZMUA 3ABLC 1GKFA 3K08A 5B3SB 1VQ7V 4JAVA 4WFAV 2A79B 3TCUA 2DWEC 2ZXWC 4JTDB 3F7VC 3ASOC 5IYBO 2XAJA 1VQ8V 1MOFA 1NR1A 1Y66A 1EZJA 4UV8A 3CC2V 2EIMC 2X6CA 2JEUA 2IH1C 1OZ0A 2YSUB 3OFNG 4DO2A 4MVOA 1DLBA 4JAUA 3OW2U 3UM7A 1FXKA 3IC7A 3AG4B 1NVPB 3ASNC 1SETA 4WCEV 3CCMV 4CZZA 2ZXWB 3E89A 3PJSK 1M9NA 1NKDA 4P2ZA 4UUJC 5LHIA 4MSWC 3AG3B 3GB7C 3MHSC 4I5SA 5EBLC 4R7CA 1XL6A 2WLHA 4BW5A 1GTOA 5IYDO 3E35A 4LP8A 4QE7A 3LDEA 4HZ3A 4J9YB 4Q20A 1K3EA 3JYCA 2ITDC 3AEIA 2WWWA 3QO8A 3VOUA 2HVKC 1AJQA 3ZIAG 4JYCA 1AJPA 1EBOA 2XASA 4UV9A 2P67A 2Y69C 2OTJV 2AHYA 3DGEA 3T1CA 1NQTA 1M1KW 3CC4V 3R65A 1YJWV 1K92A 3TK1A 2XAHA 5IY5B 2DQ3A 3X2QC 3JD3A 3ETDA 2Q68A 1KP2A 4R8CA 5J9PC 3I56V 1WLEA 1K97A 1BHBA 1M56B 3CMEV 5EC2C 1H8EG 3K06A 3OMIB 3FB6C 3AG2C 3OEEG 1K5SA 3D36A 1AI6A 1ROPA 2R9IA 1K9MW 2V1DA 3G4SV 3ASNB 3ABLB 1QVFU 4R50A 1VQ4V 3ZRSA 1OCOC 4OXSA 1OCZB 4WFHA 2PI5A 2EINB 2K1EA 3CCSV 2EIJC 1EFRG 2DYRB 2LP7A 3T4DA 1F4MA 2XOKG 5CN0A 2M7WA 3SYCA 3E8GA 1PNLA 3CCRV 3K3WA 2W6JG 1K34A 4XDJA 1K73W 4MVUA 4LCUC 4PELA 1Q82W 3RVZA 5C93A 1PNKA 3AG4C 3M99B 1GK9A 3K04A 2OCCB 5HFLA 3CPWU 4G2KA 2W0FC 4U7OA 3E8FA 1UJWB 3CCUV 1VQLV 4PA9A 1PL0A 1JX9A 2X0LA 3SPHA 1E1RG 3SPGA 2IJHA 4ASUG 4G27B 4RQEA 3RW0A 5L3CA 1MG1A 3STLC 5IDJA 1H2GA 4PA3A 5EK0A 3ETGA 4N21A 1YTFD 1BMFG 3H01A 3OE7G 1M57C 2QA4V 1VQOV 5LGNA 1CEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI B;  3E8B A;  4H33 A;  2KB1 A;  1V54 C;  2QKS A;  2EIM C;  4MVZ A;  5CBF A;  2WLJ A;  3K0G A;  3E86 A;  1OCZ C;  2X6C A;  4MS2 A;  4MVM A;  2AHZ A;  4MW8 A;  2IH1 C;  2ZD9 A;  5EC1 C;  4XDK A;  3HPL C;  5KUK A;  4DXW A;  4PA4 A;  3EFF K;  2QTO A;  3IGA C;  3FB5 C;  4MVO A;  4PA7 A;  3OR7 C;  3UM7 A;  4MTO A;  4JTC B;  2Q6A A;  5KUM A;  3ASN C;  3FB7 C;  4I9W A;  3E89 A;  2WLK A;  1G4Y B;  4PDV A;  3PJS K;  4P2Z A;  4UUJ C;  2Q69 A;  4MSW C;  2HFE C;  3GB7 C;  4MVS A;  5EBL C;  2DYR C;  4R7C A;  1XL6 A;  2WLH A;  4BW5 A;  3SPC A;  5BZB A;  2WLI A;  4QE9 A;  4LP8 A;  4QE7 A;  1K4C C;  3LDE A;  4HZ3 A;  4J9Y B;  1V55 C;  3JYC A;  2DWD C;  2ITD C;  2R9R B;  2A9H A;  2ITC C;  2X6A A;  3K0D A;  3SPI A;  3VOU A;  4QNH B;  2HVK C;  4G28 B;  4LBE C;  5E1A C;  3BEH A;  4KFM A;  4WFG A;  4P9O A;  3RBZ A;  3RVY A;  1R3K C;  4MW3 A;  1QLE C;  2Y69 C;  2ATK C;  2AHY A;  4H37 A;  3T1C A;  3K03 A;  1K4D C;  2WLM A;  1M56 C;  2DYS C;  3R65 A;  2WLN A;  4F4L A;  5B1B C;  3X2Q C;  4PA6 A;  1R3J C;  3WG7 C;  1R3L C;  2H8P C;  4ZBM A;  2Q68 A;  2WLL B;  3SJQ C;  2P7T C;  3ABM C;  2WLL A;  1LNQ A;  4R8C A;  5IY5 C;  5J9P C;  2A0L A;  5EC2 C;  3K06 A;  1BL8 A;  2Q67 A;  3FB6 C;  5EBM C;  3T4Z A;  1R3I C;  3AG2 C;  1ZWI C;  2IH3 C;  5CBG A;  1P7B A;  3F5W C;  2HJF C;  3E8H A;  2YEV A;  4GX2 A;  1KKD A;  1J95 A;  4R50 A;  3ZRS A;  5EBW C;  3UKM A;  4X89 A;  3SYP A;  1OCO C;  1S5H C;  4OXS A;  4MVQ A;  3TET A;  3ABK C;  4P30 A;  4PDL A;  4WFH A;  4X88 A;  5B1A C;  2K1E A;  4MTG A;  1OCC C;  3SYQ A;  2EIJ C;  3AG3 C;  4RUF A;  2BOB C;  4RO2 A;  3SPJ A;  3T4D A;  4GX0 A;  3SYC A;  1OCR C;  3ZJZ A;  4GX5 A;  3E8G A;  1ORQ C;  3LDD A;  2EIK C;  4GX1 A;  4P9P A;  3E83 A;  3OGC C;  4RAI A;  4XDJ A;  2JK5 C;  4MVU A;  2HG5 C;  2HVJ C;  3FB8 C;  4LCU C;  3RVZ A;  3AG1 C;  3T2M A;  4MVR A;  5CBH A;  3AG4 C;  2BOC C;  1XL4 A;  3K04 A;  4TWK A;  4J9Z B;  3F7Y C;  5B3S C;  3OR6 C;  3LNM B;  2W0F C;  4R6Z A;  4WFE A;  3E8F A;  3OUF A;  2EIN C;  4XDL A;  4HYO A;  4X8A A;  3STZ C;  4PA9 A;  3KG2 A;  3ABL C;  2NLJ C;  1JVM A;  3IFX A;  3OUS A;  2OCC C;  3K08 A;  4MTF A;  3SPH A;  3SPG A;  4G27 B;  3LDC A;  4CBC A;  4JTA B;  4PDM A;  3RW0 A;  4WFF A;  4PDR A;  2A79 B;  2EIL C;  3STL C;  3SYA A;  3SYO A;  3TCU A;  2DWE C;  4PA3 A;  5EK0 A;  4RUE A;  2ZXW C;  3LUT B;  2X6B A;  3F7V C;  4JTD B;  3ASO C;  4EKW A;  1M57 C; 
#chains in the Genus database with same CATH topology
 4E4E A;  1QR8 A;  4I55 A;  2CTP A;  3I55 V;  4D7S A;  4MS2 A;  1EN4 A;  2QM7 A;  1JQ0 A;  1Q86 W;  1FXV A;  4IHJ B;  1HNW B;  3JAT A;  1YIJ V;  5KUM A;  3UQ8 A;  5LMU O;  5H6Q A;  2B5U A;  2UU9 B;  3BVO A;  4B3M B;  2AW9 A;  2CE4 A;  5J2U A;  1GN3 A;  1V54 B;  3ZBH A;  4K0K O;  3CCV V;  4FFB B;  4QE9 A;  2BSK A;  2BSK B;  3CJH A;  1RM1 B;  5H2F Z;  4KUM A;  4LFB O;  5KMG A;  5KMG B;  4DR5 B;  4DR7 B;  3OMN B;  4UCO A;  4P9O A;  2ATK C;  3PN1 A;  1S76 D;  3QNE A;  2F93 B;  1AI7 A;  3KKY A;  3VQY A;  2KG7 B;  5JJE B;  1XNQ O;  3FX7 A;  3CWB H;  2LFR A;  4OGQ B;  1X4T A;  2Q67 A;  2IH3 C;  3ZRX A;  2HJF C;  2Y69 B;  1HNX O;  5EBW C;  4K3A A;  1VQ6 V;  2IJI A;  1S5H C;  4LFC B;  2PI4 A;  5J2T B;  3K59 A;  3W7T A;  1B6Q A;  1R6K A;  1BSM A;  5BMV B;  4JI3 O;  2Y0P A;  3CE2 A;  1YSC A;  5LOV B;  3ZJZ A;  1I94 B;  2AGA A;  4DK0 A;  4P9P A;  3OTF A;  5ITZ A;  5LGU A;  2EIL B;  3JCU Z;  3G6B A;  3ABM B;  1R73 A;  1WN7 A;  3U0Z A;  1NVP D;  3ZN1 A;  2WSS G;  4KP4 A;  3ZMV A;  1E1Q G;  1YDX A;  3QO7 A;  1DK1 A;  5JH7 B;  3ETE A;  4B7E A;  3RYI B;  5JH7 A;  2UXB B;  5JCO A;  2CH7 A;  3ETQ A;  2EIK B;  3SYO A;  3QTC A;  1YEW A;  1IX9 A;  1HP8 A;  4JPR A;  3WG7 B;  1M4U A;  2KB1 A;  4FMT A;  4MVZ A;  3K0G A;  3E86 A;  2ZQM A;  5KX5 B;  2X7R B;  4TV8 B;  3K5L A;  1YHQ V;  2LJ2 A;  1IXM A;  1WNS A;  1F23 A;  4NYK A;  5LHG A;  3BRC A;  1B04 A;  1MAB G;  5H5N A;  5EYP A;  5EYP B;  4LF8 O;  3HKE A;  1G4Y B;  4QPJ A;  4DV7 B;  1MZE A;  1S72 V;  1PP9 H;  1VP7 A;  3JAR B;  5DEC A;  1GH6 A;  3CP1 A;  4UCT A;  4C7U A;  3K5M A;  2R9R B;  3SPI A;  4NXM B;  1FPO A;  1SC5 B;  2LFS A;  3E2E A;  4WFB V;  4JI2 B;  3MDS A;  2DYS C;  2XUM A;  4F4L A;  2QE7 G;  1N32 O;  3JAM N;  4PA6 A;  1KBH A;  3ML0 A;  3A8T A;  5IY5 C;  2A0L A;  4DV1 B;  3JD0 A;  3T4Z A;  4FLT A;  1N8R W;  3JD2 A;  3FYE B;  2ZT9 B;  4FJC C;  1GM7 A;  4QPK A;  2UXC O;  1V55 B;  3FKS G;  4GKK O;  3CCE V;  4FM2 A;  1VQ9 V;  1QLN A;  2BOB C;  1SRY A;  1IBK O;  3D36 C;  4AI8 A;  2D3O W;  1P4R A;  3A0R A;  4GX1 A;  3MD0 A;  2QWQ B;  2C2A A;  3C90 A;  3JD1 A;  3CRC A;  2JS5 A;  3H1J H;  2E5L B;  3JAK A;  3L71 H;  1YZB A;  2OCC C;  4NR1 A;  3LDC A;  4CBC A;  2P22 C;  4PDR A;  2Q73 A;  4RUE A;  4DV5 B;  4O2B B;  3ABU A;  3OM3 B;  4JI8 O;  4CC6 A;  4IYI A;  4I55 B;  1LUW A;  2F4V B;  5L3G A;  4KHP B;  3GVM A;  4J80 A;  4PV1 B;  4JI7 B;  1BE3 H;  4PJ0 Z;  1R6N A;  4FLW A;  2R9A A;  4MTO A;  4JTC B;  1KU9 A;  3H1L H;  1KYO F;  1PKX A;  2CH7 B;  2LQT A;  2WLK A;  2F1M A;  2ZE6 A;  2CK3 G;  4DK1 A;  4ZI7 B;  2W0X A;  3ZN0 A;  1VF7 A;  3BY6 A;  4DR6 O;  4CH3 A;  3CMA V;  3BHP A;  2X6A A;  3SGI A;  4U3J B;  4LF4 B;  3P32 A;  1Y76 A;  1Z5V A;  1W2B U;  2VQF O;  5E1A C;  1HR0 B;  5LA6 B;  4WFG A;  1R3K C;  3ZHR A;  1I0H A;  3K03 A;  1XNQ B;  4CH4 A;  1VF6 A;  3CXH F;  4UCR A;  3IC9 A;  1QCE A;  4ZBM A;  1CPY A;  5GTH Z;  1VF6 C;  4X9Q A;  3AG1 B;  1JMK C;  1ARO P;  3TXS A;  2VRZ A;  1XHX A;  1ZWI C;  1AI4 A;  1OJH A;  2XND G;  2N04 A;  1BQZ A;  2YEV A;  1FAF A;  1PL4 A;  4X89 A;  4B3S B;  5BMV A;  3Q4H B;  3D3I A;  2EZP A;  4I7Z B;  1YJN V;  1XDC A;  2HEP A;  2PF4 E;  4WBN A;  3K79 A;  1G6U A;  3K58 A;  1NU1 H;  2IM9 A;  4FFK A;  4U3F H;  1TUB A;  2CGO A;  1IZ3 A;  5DM6 V;  2WAM A;  2WPD G;  4NKG B;  5GON A;  3LSS A;  5L3E A;  3JCZ A;  2E3C A;  3OUF A;  2F43 G;  1NR7 A;  4X8A A;  2ZE7 A;  1MMM A;  1SZT A;  5H9C A;  3H1K H;  4EFB A;  2P90 A;  1XMO B;  1MSD A;  2YXY A;  1TAE A;  1Y6X A;  4JTD B;  1FFX B;  2A06 H;  1VQ8 V;  1NR1 A;  5CA1 B;  2X6C A;  4I50 A;  2IH1 C;  1OZ0 A;  5LP6 B;  1VIB A;  2YI8 A;  2QKC A;  4DO2 A;  4MVO A;  4DV0 O;  3U11 A;  3ZHT A;  2ZE5 A;  2ZIN A;  2UUC O;  3E89 A;  1HW7 A;  1M9N A;  4P2Z A;  5LHI A;  2CTW A;  3MHS C;  4R7C A;  2WLH A;  1NT2 B;  3LDE A;  3JYC A;  4X65 B;  4JI2 O;  3VOU A;  5KLV H;  1AJQ A;  2PTM A;  4JYC A;  3ZIA G;  2QJ1 A;  2P67 A;  4J7J A;  3H9V A;  2AHY A;  1QNM A;  1D5A A;  4O2A A;  1YJW V;  2XAH A;  5IY5 B;  2WA4 A;  3JD3 A;  1DGS A;  2Q68 A;  5KHH A;  1KP2 A;  5J9P C;  1WLE A;  3HKD A;  3AG2 C;  3RWR D;  3HKD B;  3D36 A;  3JAW B;  1N36 O;  3G4S V;  3ABL B;  1VQ4 V;  4FVM A;  3T1H O;  2K1E A;  3T4D A;  1FJG B;  2PYL A;  1FYJ A;  2RJZ A;  2M7W A;  1BZK A;  1PNL A;  3CCR V;  2O57 A;  2W6J G;  4DV6 O;  4XDJ A;  1K73 W;  4MVU A;  5C93 A;  5EZY B;  1PNK A;  1GK9 A;  3K04 A;  2ADP A;  3CPW U;  4G2K A;  4J10 A;  4U7O A;  1JX9 A;  1IDS A;  2IJH A;  3RYF B;  3RW0 A;  1MG1 A;  3JAS A;  3ETG A;  4DR2 O;  4LNU A;  3JAS B;  1YTF D;  3OE7 G;  4FLY A;  1ZUQ A;  4X20 B;  3JAL A;  1TUB B;  1KB9 F;  2ILM A;  1NH2 B;  2B1I A;  4Z2W A;  2CAZ C;  4YXW G;  2LGQ A;  2DYS B;  4JGS A;  3RYC B;  4JI3 B;  2Q6A A;  2GHY A;  3OAA G;  1V9P A;  1UFI A;  3KCY A;  2UXD B;  3T1Y O;  3J81 N;  2YIC A;  4NXN O;  3N2G A;  2P6J A;  4UFZ A;  4DYL A;  4DV4 B;  1TA8 A;  5L3F A;  1SA0 B;  3P30 A;  3RVY A;  3VQV A;  3HKB A;  4LC1 A;  2EBO A;  4DR4 B;  4JI0 O;  3MHH C;  3BPZ A;  3ZHS A;  3CXC U;  2OYQ A;  4CS2 A;  1NTM H;  1D2D A;  4ZKI A;  1VEW A;  3AK2 A;  4Z1M G;  1O9G A;  4NB5 A;  1RM1 C;  1THZ A;  1O9H A;  2ZM6 B;  1OHH G;  2ZNJ A;  5J2T A;  2OIG A;  5IE9 A;  1IBM O;  3W7W A;  1XI1 A;  2QWN B;  3P3P A;  2JK5 C;  5ITZ B;  3J7A U;  2YDE A;  1PNM A;  1PPJ H;  1JCH A;  4J9Z B;  2Q9L A;  4LH7 A;  1XNR B;  1Q6H A;  4I0X B;  4X1K A;  4B3R B;  5KAF Z;  1N34 B;  1I7F A;  2IJJ A;  1QU7 A;  1B06 A;  1WA8 B;  1IXB A;  2BTQ A;  1URF A;  2HLD G;  3CCQ V;  1GM8 A;  1E79 G;  4H33 A;  2QKS A;  4D6T H;  1M5I A;  4YHH O;  5BR8 B;  5F2V O;  2ETN A;  1YIT V;  4MW8 A;  5B1N A;  1NTZ H;  4X64 O;  3EFF K;  1S77 D;  2QWO B;  2ZE8 A;  4I9W A;  1N33 O;  1WP7 A;  2JRI A;  4LNU B;  4DR3 B;  1RSO A;  1ZL8 B;  2HFE C;  1RSO B;  1ZL8 A;  3HR0 A;  2E74 B;  1YTF B;  2Q0A A;  1HNZ B;  4BIZ A;  4QIW F;  2OTL V;  3JAT B;  5LYJ A;  1QLE C;  4LF7 O;  1D5N A;  5TIS Z;  3RYH A;  4JI8 B;  5B1B C;  1H2L A;  2F4V O;  1AP6 A;  1LNQ A;  3N2G B;  1NJI W;  3C3S A;  1H38 A;  4KHP O;  3TGU H;  1GO3 F;  1JFF B;  5CBG A;  4DV3 B;  4MT8 A;  4N23 A;  1FXK C;  1N0J A;  5LA6 A;  1FKA O;  4B08 A;  2JGD B;  3AG2 B;  4JI1 O;  2JGD A;  1FJG O;  4PDL A;  4P30 A;  1KQS U;  4FIP C;  4Q6G A;  1F7Y A;  2MW2 B;  3AG3 C;  1OCR C;  4UB8 Z;  1AI5 A;  1VAR A;  3SR2 C;  1WA8 A;  2EIK C;  5D5P A;  4BR6 A;  3IAY A;  3B8N A;  3T2M A;  3G80 A;  4LF9 B;  3B8M A;  1WPX A;  1XL4 A;  2EIJ B;  4R6Z A;  1BT8 A;  4FZ0 A;  2DMX A;  4QJF B;  4YIP A;  4JZ2 A;  4LFA O;  1SQP H;  3IFX A;  3Q4H A;  3C3T A;  4DW1 A;  1SES A;  2FML A;  1FD9 A;  4FLX A;  3LUT B;  5CA0 A;  5H6R A;  4JYA O;  4DUZ B;  3GWO A;  3ZRW B;  2WLJ A;  2UUA B;  2Z0A A;  3K9S A;  1JJ2 U;  1G1X B;  3WB0 A;  3CS5 A;  1Q6I A;  4PA7 A;  2Q7G A;  1PV0 A;  5IYZ B;  4ICG A;  5JWP A;  1SQB H;  3I5D A;  2Y4T A;  4HNA A;  5IJ0 B;  3CD6 V;  2Q7E A;  4JI4 O;  2EJR A;  3IJ4 A;  4B3T O;  1FXH A;  4DR4 O;  2GTA A;  4H37 A;  1IUR A;  3BA9 A;  4RQF A;  2LW7 A;  2QDO A;  4H13 B;  3W7U A;  1VMG A;  1AR5 A;  3ABM C;  4DR1 B;  1EN5 A;  2IU0 A;  1SER A;  1NBM G;  3B77 A;  2FKX A;  2P06 A;  2R70 A;  1YF2 A;  2KSD A;  4OX9 O;  2KKW A;  1COW G;  2Q0O C;  1BQ0 A;  5IT9 N;  5LL6 Y;  2RQ6 A;  3K5O A;  1OCC C;  2HR3 A;  4RO2 A;  5IYC O;  4TV9 A;  1YVW A;  3E83 A;  1U96 A;  2HG5 C;  4FM0 A;  4W4K A;  2OIE A;  2QTS A;  1N34 O;  3A0H Z;  4XDL A;  2IU3 A;  2QWP B;  3ZMU A;  3ABL C;  4I0X A;  1OV9 A;  5B3S B;  1JJO A;  2VS0 A;  4WFA V;  2DWE C;  2ZXW C;  2YC0 A;  3F7V C;  3ASO C;  5IYB O;  5JJJ B;  2Q4P A;  1Y66 A;  4ZIB A;  3O9O A;  4O4L B;  4KL1 A;  3T1H B;  5LP6 A;  3K57 A;  3E22 B;  4X62 B;  4IIJ B;  2WA3 A;  1DLB A;  1XMQ O;  3IC7 A;  1NVP B;  4WCE V;  3PJS K;  1Q6U A;  3OTO B;  1Q43 A;  5LXT B;  3GB7 C;  1XL6 A;  4BW5 A;  4Z1V A;  4X66 O;  4QE7 A;  1Y74 A;  1CXZ B;  4J9Y B;  3ZHQ A;  3UCS C;  1GAX A;  3QO8 A;  2HP8 A;  4I4T B;  3ZX6 A;  3DXR B;  1L8D A;  3CRR A;  1TVK A;  5A2Q N;  2XAS A;  4UV9 A;  2Y69 C;  1NQT A;  4KXR A;  4DR2 B;  2EX3 A;  4K35 A;  3WB1 A;  4ZHQ A;  4R8C A;  4ZHQ B;  3I56 V;  1K97 A;  1WB8 A;  3OMI B;  3FB6 C;  4NTX A;  3OEE G;  2AZ0 A;  1K5S A;  1AI6 A;  1AP5 A;  4O4I A;  4F6R B;  3ASN B;  1QVF U;  4R50 A;  3L70 H;  4BWA A;  1OCZ B;  2PI5 A;  2F23 A;  2EIJ C;  2DYR B;  1F4M A;  2XOK G;  5KHG A;  4OPA A;  1BGY H;  3ZED A;  4FLV A;  3B40 A;  2OWO A;  3HKC B;  1WJZ A;  2W0F C;  4PA9 A;  1PL0 A;  4PHZ A;  5B66 Z;  4DUY O;  2X0L A;  3SPH A;  2LW1 A;  4RQE A;  5JVD B;  3OT7 A;  5L3C A;  4LF6 B;  3D3Q A;  3STL C;  5IDJ A;  3H01 A;  1N32 B;  4GKJ O;  1VQO V;  5LGN A;  1KUQ A;  4FZ1 A;  4AIL C;  1RFY A;  4YJ3 B;  2EJ7 A;  2ZDI A;  3ZRW A;  4I4T A;  2AHZ A;  4HAM A;  5B1A B;  2CDY A;  2RDC A;  2YIA A;  4DXW A;  4PA4 A;  1VF5 B;  3OR7 C;  4JI5 O;  4UCU A;  4B3M O;  1VQN V;  2DW4 A;  2XAQ A;  5DN6 G;  2Q5Z A;  1FFT B;  2V4D A;  5KHK A;  1IBK B;  4LFB B;  3AK3 A;  2XHB A;  4DR5 O;  1JFF A;  1MSW D;  4FLU A;  2PZS A;  2MK3 A;  3APQ A;  2XAF A;  1JPX A;  2FYU H;  2OT5 A;  4CC5 A;  1EN6 A;  2WLM A;  4JF3 A;  3L9D A;  5B1O A;  4J41 A;  3TXQ A;  3L75 H;  4JV5 B;  1KD1 W;  4OPH A;  5LXT A;  3X2Q B;  3JSL A;  2NR5 A;  2HJD A;  4FK5 C;  1P7B A;  3E8H A;  3WU2 Z;  3H1I H;  4FLZ A;  2FTK A;  2IW5 A;  1GN6 A;  4L8J A;  3TET A;  1QBZ A;  4X88 A;  5C8Y B;  1OCO B;  4JI6 O;  2QWR B;  3B09 A;  3CYO A;  4AQY O;  4GX0 A;  2HHH O;  3OGI B;  4BW9 A;  3ZRV A;  4J7Z A;  3OGC C;  3TJT A;  4EB6 B;  2HVJ C;  3SJB C;  2BE3 A;  3APO A;  5GON B;  4TWK A;  2FB5 A;  4WFE A;  2EIN C;  2YI9 A;  4NVP A;  5LBQ A;  3KG2 A;  3K9A A;  3DSQ A;  1JVM A;  1T5E A;  4UVB A;  1QQC A;  5FNV A;  3ZHV A;  4JTA B;  5IYZ A;  2LGW A;  4A5U B;  4WFF A;  1TGO A;  3OMA B;  2EIL C;  2DQ0 A;  1K33 A;  1K8A W;  2YUA A;  5IJ9 A;  1X59 A;  1OCR B;  2WLI B;  3W7S A;  1YJ9 V;  4MTX A;  4X62 O;  2JIZ G;  3ZCC A;  4ZOL A;  1Z2G A;  3DTU B;  5EC1 C;  3F5T A;  5KAI Z;  1KP3 A;  2F95 B;  2QTO A;  4DV7 O;  1Y67 A;  4LF5 O;  5CB4 A;  5LP6 C;  1Y4M A;  4AHC A;  4JZG A;  4X66 B;  3B2E E;  2KG7 A;  2CTQ A;  4MVS A;  3JAR A;  3M8A A;  5AG2 A;  2BCC H;  2H3O A;  3FAV B;  4QNH B;  3CSX A;  1ZX3 A;  4LBE C;  4LFA B;  4MW3 A;  4YJ2 A;  4NXM O;  5LYJ B;  2RNB A;  2ODM A;  5C8Y A;  1M56 C;  2GSM B;  4JYB A;  3SDL A;  3RFR A;  3WG7 C;  2B1G A;  1R3L C;  2EIM B;  3SJQ C;  2JVD A;  4WBN B;  4HBN A;  2DOS A;  3CC7 V;  2ZNI A;  4XBF A;  1Y76 B;  4JYY A;  1KKD A;  1J95 A;  3UKM A;  2VQE B;  4UCV A;  4UVA A;  2EUL A;  2ADQ B;  3THO A;  1MNG A;  5DED A;  5B1A C;  3A0B Z;  1CP9 A;  4YY3 O;  2ZIM A;  3SPJ A;  5GW7 A;  1YI2 V;  3LDD A;  3WB2 A;  4TSF G;  2GUZ A;  3HKC A;  4DR7 O;  4MVR A;  2QM4 A;  2E5L O;  2M6Y A;  4L87 A;  3CCL V;  1H2N A;  3N2K B;  1P49 A;  2ZDI C;  2OCH A;  1F51 A;  4FPP A;  2NLJ C;  4MTF A;  5JVD A;  4U7N A;  4DV5 O;  3RN4 A;  1Q3E A;  3ZHU A;  5CB4 B;  4EFE A;  1ENV A;  4IGG A;  4X1I A;  2E75 B;  2EZO A;  4JI7 O;  1I5Y A;  3E8B A;  1HNX B;  2UUB B;  1SQG A;  4YJ3 A;  4NTY A;  2LO1 A;  2GDS A;  2ZD9 A;  1SQV H;  5L3D A;  4XDK A;  3CRM A;  3RYC A;  1NTK H;  3BFR A;  1M57 B;  2ZR2 A;  3ASO B;  3FFQ A;  1YCI A;  5KA5 A;  3RYH B;  5EIB C;  3KZI Z;  2JDI G;  4QGP A;  2QGN A;  5GTI Z;  4LR3 A;  3SPC A;  4LF4 O;  1QR9 A;  1K4C C;  3QF7 A;  3E22 A;  3G67 A;  3RBZ A;  2UXB O;  1FXK B;  1Q8I A;  2CTR A;  2VQF B;  1KMI Z;  1M90 W;  3CEI A;  5HFM A;  3OEH G;  1NI8 A;  3L72 H;  1RPR A;  3HB3 B;  4B3S O;  2UXX A;  2YEV B;  2Q8V A;  1I5X A;  1QLE B;  1VQ5 V;  3NXS A;  2RCV A;  3B4S A;  1AJN A;  3OTO O;  3VBB A;  5LMN O;  4RUF A;  4UCS A;  3LNN A;  5FPR A;  1AIL A;  1MA1 A;  3MAQ A;  4YIO A;  1GM9 A;  4GX5 A;  1JOY A;  2N74 A;  1W59 A;  4J11 A;  5B3S C;  1S0V A;  1NZ6 A;  4EEQ A;  3FD9 A;  3K08 A;  4JAV A;  4D7T A;  4JAA A;  1XMO O;  4K8X A;  3RT3 C;  4DW0 A;  4ZI7 A;  2XAJ A;  5J2U B;  5IJ9 B;  2A7W A;  1MOF A;  4CH6 A;  1EZJ A;  2YXL A;  5JCO C;  4CS4 A;  3CJH B;  4I50 B;  3CRA A;  2JEU A;  1U97 A;  3S3W A;  3UT5 A;  4GKK B;  2YSU B;  3OFN G;  4LF5 B;  3BA8 A;  1XBL A;  3UM7 A;  4LWS A;  3CCM V;  4CZZ A;  3JSN A;  1NKD A;  4UUJ C;  4MSW C;  5EBL C;  1IBM B;  4X65 O;  3E35 A;  2FL4 A;  1K3E A;  2WWW A;  2HVK C;  4IYH A;  1TVK B;  2DJV A;  2P4K A;  3DGE A;  3T1C A;  2G38 A;  3CC4 V;  3K5N A;  1K92 A;  3TK1 A;  3DC6 A;  3CB2 A;  1M56 B;  3VQX A;  5K1P A;  1H8E G;  3K06 A;  1MZF A;  1SQX H;  4EB6 A;  1ROP A;  2R9I A;  2YS8 A;  4CH5 A;  4F6R A;  2VQE O;  1AB3 A;  4JI5 B;  3ZRS A;  4YY3 B;  1OCO C;  4OXS A;  1J5E B;  4X64 B;  3CCS V;  1SQF A;  4DR6 B;  1XUQ A;  2PGG A;  3SYC A;  3L74 H;  3E8G A;  2GUZ B;  1K34 A;  4H0L B;  4LCU C;  4PEL A;  5EZY A;  1H2M A;  2DE0 X;  5E79 Z;  3AG4 C;  3M99 B;  4DV6 B;  5HFL A;  3E8F A;  3CCU V;  3BAB A;  1I08 A;  3D8C A;  1E1R G;  3SPG A;  4ASU G;  2K9P A;  2ZIO A;  1H2G A;  5EK0 A;  2XT9 A;  2UUB O;  1BMF G;  3L73 H;  1M57 C;  1SZX A;  1CEZ A;  2R72 A;  1S3J A;  1GN2 A;  1V54 C;  3O65 A;  1Y74 B;  5FL7 G;  1OCZ C;  5KA6 A;  1RPO A;  2AZ2 A;  3G6E V;  4J7K A;  5KUK A;  3IGA C;  3QVN A;  3FB5 C;  2HHH B;  3T1Y B;  1R1B A;  3FB7 C;  2PY5 A;  4NXN B;  4K8Z A;  2IBZ H;  1H8H G;  3JD4 A;  4FFB A;  2UXD O;  5CA1 A;  2V7Q G;  4O4H A;  4O4H B;  1ZAU A;  2DWD C;  3K0D A;  1AR1 B;  1F4N A;  5LGT A;  3CHX A;  3LSQ A;  2CGN A;  1SA0 A;  4G28 B;  3BEH A;  5CMU A;  2E76 B;  2WLN A;  4TQD A;  1VQP V;  1R3J C;  2RMK B;  2H8P C;  2P5O A;  2WLL B;  2P7T C;  5B5E Z;  2ZCE A;  1WAZ A;  5IWA O;  2Y4U A;  4JI0 B;  1LUV A;  4JAS A;  5EBM C;  3FAV A;  3LSU A;  2JEX A;  3DXR A;  2ZM6 O;  4DV0 B;  1TUE B;  1HWY A;  3SYP A;  3UO2 A;  1KC8 W;  5LMN B;  1RP3 B;  2H94 A;  2YXH A;  1BCC H;  1GMG A;  1LR1 A;  4TT3 G;  1IBL B;  1ORQ C;  1K5Q A;  4LH6 A;  5CA0 B;  2HKO A;  1PD3 A;  3AG1 C;  4K0K B;  4BIU A;  5KHJ A;  3ABK B;  3OR6 C;  1DTO A;  4W4L A;  1EZV H;  1XNR O;  4X1K B;  1K7D A;  1JA8 A;  2L35 A;  5LHH A;  4PDM A;  3FYI B;  1Q7Y W;  4O4J A;  2VWJ A;  3SYA A;  2Q7H A;  2X6B A;  1BHA A;  2YID A;  4HNA B;  5IJ0 A;  2AXT Z;  3ZMT A;  1N36 B;  3SJA C;  1US6 A;  1G8M A;  2L6L A;  2NNU A;  2Y48 A;  4TV8 A;  1IVS A;  4MVM A;  4U3J A;  2ZR3 A;  3UT5 B;  1KKC A;  1SQQ H;  4GCZ A;  1EM1 A;  2GV9 A;  3JAK B;  4X1Y B;  4YHH B;  2Z3Y A;  1L1F A;  4OX9 B;  1N33 B;  3NR7 A;  4DR3 O;  1XEQ A;  5EIB D;  4TQF A;  4PDV A;  4BIO A;  3H1H H;  2QEX V;  2A3Q A;  2DYR C;  1VQM V;  4CS3 A;  4F6E A;  1HNZ O;  4GT1 A;  3CCJ V;  3ZMS A;  2ITC C;  4DRX B;  3EXA A;  2W6I G;  4LF7 B;  4WF9 V;  3CX5 F;  3EHB B;  1P7G A;  4YJ2 B;  4PD4 F;  3W7X A;  1DF4 A;  5L3B A;  3OD4 A;  1JR9 A;  1H2S B;  5CA3 A;  4B7K A;  4E2L A;  1WP8 A;  1KEC A;  3F5W C;  1ZTE A;  1Q81 W;  4DV2 O;  1OCC B;  4NTW A;  1PM9 A;  4MVQ A;  3ABK C;  3HKB B;  5K1X A;  4MTG A;  3CRQ A;  2KQX A;  3SYQ A;  4JI1 B;  1A32 A;  2JJ1 G;  4DV4 O;  3FB8 C;  3G71 V;  5CBH A;  2JJ2 G;  2BOC C;  3F7Y C;  1M93 A;  2YIB A;  2BTO A;  4HYO A;  4UB6 Z;  4J42 A;  3P3N A;  1Z5W A;  5JQG B;  3OUS A;  4GUN A;  4FM1 A;  1L0N H;  3RYF A;  3J80 N;  4O2B A;  4X1I B;  4DUZ O;  4EKW A;  1VQK V;  1BS3 A;  3M7M X;  4UXN A;  2XAG A;  3QO5 A;  2QM8 A;  5CBF A;  2XTA A;  1DF5 A;  1S5J A;  4IHJ A;  3HPL C;  2IJK A;  2YIB D;  5FNV B;  1XOU A;  2UXC B;  1HNW O;  2Q69 A;  1FFX A;  5LMU B;  5BZB A;  2UU9 O;  3BCC H;  1W0J G;  2WLI A;  5BY1 A;  4JI4 B;  3U10 A;  1V55 C;  1YXB A;  2A9H A;  3JAW A;  2Z5U A;  4B3R O;  4KFM A;  3EVK A;  5FPO A;  4BAY A;  4LWS B;  5D5Q A;  3ZMZ A;  1K4D C;  1ZLZ A;  4B3T B;  3R66 A;  1QVG U;  1WB7 A;  3AK1 A;  2WLL A;  4UVC A;  5BR8 O;  1XRE A;  2GBO A;  1BL8 A;  1R3I C;  1H2K A;  4ABM A;  4DR1 O;  1W0K G;  1FS0 G;  1XIL A;  4GX2 A;  2NN4 A;  1S5L Z;  5KHI A;  3WFV A;  1ZSP A;  1IBL O;  4LFC O;  1N4C A;  1NH2 D;  3ABT A;  1AR4 A;  2DN9 A;  4TV9 B;  2QSA A;  4RAI A;  1I94 O;  4O4I B;  2N05 A;  3VQW A;  5JJN B;  2UXN A;  3LNM B;  1GRJ A;  4IT5 A;  5B1B B;  1B3Q A;  3STZ C;  2QKA A;  3UO3 A;  1GN4 A;  1GKF A;  1VQ7 V;  1SF9 A;  1HR0 O;  2ZKO A;  3RYI A;  4I9Q A;  2GTS A;  2A79 B;  3TCU A;  4O4J B;  1AVM A;  5A9G A;  4JV5 O;  4DV3 O;  2P4V A;  4O4L A;  5FLX N;  1SKV A;  4UV8 A;  3CC2 V;  2EIM C;  4GZR B;  5KX5 A;  1J5E O;  1XMQ B;  4ZOL B;  4IL6 Z;  3DC5 A;  3N27 A;  2JS3 A;  4TUY B;  4TOI A;  4TUY A;  1XHZ A;  4X1Y A;  4JAU A;  3OW2 U;  2QR4 A;  1FXK A;  3AG4 B;  3ASN C;  1SET A;  2ZXW B;  3S3X A;  3HKE B;  2RN9 A;  1NS1 A;  4JI6 B;  4LF8 B;  3AG3 B;  2D2C B;  4I5S A;  4AQY B;  4LF9 O;  5IYD O;  1GTO A;  1R6T A;  4LP8 A;  4HZ3 A;  4Q20 A;  1HDJ A;  2ITD C;  3SJC C;  3AEI A;  2JGU A;  5BXZ A;  4DRX A;  1AJP A;  2Y0I A;  1EBO A;  3ZS8 C;  2OTJ V;  1UPG A;  1M1K W;  3R65 A;  4O2A B;  2CUG A;  1SS3 A;  2DQ3 A;  3BAA A;  2ARH A;  3X2Q C;  3ETD A;  4JYA B;  3QG5 A;  2B9Z A;  4PI2 A;  1N0N A;  3AG7 A;  2UUA O;  1BHB A;  3CME V;  3ICX A;  5EC2 C;  1Q5O A;  4PI0 A;  4DV1 O;  4DV2 B;  1K9M W;  2V1D A;  2PUS A;  4WFH A;  2EIN B;  1P84 F;  1EFR G;  2LP7 A;  2PYJ A;  1WPB A;  1XQ8 A;  5CN0 A;  4H44 B;  3K3W A;  2UUC B;  2BTQ B;  3KCX A;  4RWU A;  1Q82 W;  3RVZ A;  1L0L H;  2OCC B;  1QHT A;  3N2K A;  4DUY B;  1UJW B;  1VQL V;  4IIJ A;  4LF6 O;  3A2F A;  1Q90 D;  5JQG A;  4G27 B;  3GWK C;  4GYC B;  5IWA B;  4GKJ B;  5LOV A;  3RGB A;  4PA3 A;  4N21 A;  3JAL B;  4X20 A;  2QA4 V;  4GLX A;  2VWK A;  2F66 C; 
#chains in the Genus database with same CATH homology
 1S3J A;  1QR8 A;  1V54 C;  1NH2 B;  2B1I A;  2ZDI A;  5FL7 G;  3ZRW A;  3I55 V;  1OCZ C;  4MS2 A;  4YXW G;  5KA6 A;  1RPO A;  2AHZ A;  4HAM A;  5B1A B;  2DYS B;  2QM7 A;  3G6E V;  1JQ0 A;  4JGS A;  1Q86 W;  1FXV A;  5KUK A;  4DXW A;  4PA4 A;  3IGA C;  3FB5 C;  3OR7 C;  2Q6A A;  1YIJ V;  5KUM A;  2GHY A;  3OAA G;  3FB7 C;  1VQN V;  5H6Q A;  2DW4 A;  2B5U A;  2XAQ A;  5DN6 G;  1FFT B;  1H8H G;  1V54 B;  3JD4 A;  2P6J A;  3CCV V;  4QE9 A;  2V7Q G;  1MSW D;  1RM1 B;  2DWD C;  3K0D A;  4KUM A;  1AR1 B;  1F4N A;  2MK3 A;  5L3F A;  5LGT A;  3LSQ A;  4G28 B;  2XAF A;  3BEH A;  3OMN B;  1JPX A;  3P30 A;  4P9O A;  5CMU A;  3RVY A;  2ATK C;  2OT5 A;  1S76 D;  2WLM A;  3QNE A;  4JF3 A;  4LC1 A;  5B1O A;  2WLN A;  1AI7 A;  2EBO A;  1VQP V;  1R3J C;  1KD1 W;  2H8P C;  3MHH C;  2WLL B;  2LFR A;  2P7T C;  3X2Q B;  3CXC U;  4JAS A;  2Q67 A;  5EBM C;  4ZKI A;  2IH3 C;  2JEX A;  4FK5 C;  1P7B A;  3ZRX A;  3E8H A;  2HJF C;  2Y69 B;  4Z1M G;  1TUE B;  1HWY A;  5EBW C;  3SYP A;  2FTK A;  2IW5 A;  1VQ6 V;  1KC8 W;  2IJI A;  1S5H C;  1RM1 C;  2PI4 A;  1THZ A;  3TET A;  1QBZ A;  1OHH G;  2H94 A;  4X88 A;  3W7T A;  1OCO B;  1B6Q A;  1R6K A;  1GMG A;  3CYO A;  3W7W A;  4GX0 A;  4TT3 G;  1YSC A;  3ZJZ A;  1ORQ C;  1K5Q A;  3ZRV A;  4P9P A;  2HKO A;  3OGC C;  1PD3 A;  2JK5 C;  2HVJ C;  5LGU A;  2EIL B;  3AG1 C;  3ABM B;  1R73 A;  1PNM A;  4TWK A;  1JCH A;  4J9Z B;  4BIU A;  3ABK B;  3OR6 C;  1NVP D;  3ZN1 A;  2WSS G;  1DTO A;  4KP4 A;  2EIN C;  4WFE A;  3ZMV A;  5LBQ A;  3KG2 A;  1E1Q G;  3K9A A;  1K7D A;  1JVM A;  3QO7 A;  4UVB A;  3ETE A;  5LHH A;  4JTA B;  4PDM A;  3FYI B;  4WFF A;  2IJJ A;  1Q7Y W;  3OMA B;  2EIK B;  2EIL C;  2DQ0 A;  3SYA A;  3SYO A;  1K33 A;  1K8A W;  2X6B A;  1BHA A;  4JPR A;  2HLD G;  1OCR B;  3WG7 B;  1GM8 A;  1E79 G;  2WLI B;  3ZMT A;  4H33 A;  3W7S A;  2KB1 A;  2QKS A;  4FMT A;  1YJ9 V;  4MTX A;  4MVZ A;  1G8M A;  2Y48 A;  2NNU A;  3E86 A;  3K0G A;  2ZQM A;  2JIZ G;  4MVM A;  3ZCC A;  2X7R B;  2ZR3 A;  1YIT V;  4MW8 A;  4GCZ A;  3DTU B;  5B1N A;  5EC1 C;  1YHQ V;  1IXM A;  1KP3 A;  1F23 A;  2Z3Y A;  2QTO A;  3EFF K;  1L1F A;  5LHG A;  1S77 D;  1MAB G;  4I9W A;  1G4Y B;  1Y4M A;  4PDV A;  4QPJ A;  2QEX V;  1S72 V;  2HFE C;  4MVS A;  2DYR C;  1VQM V;  3CP1 A;  1YTF B;  4GT1 A;  3CCJ V;  3ZMS A;  4QNH B;  2R9R B;  2ITC C;  3SPI A;  2W6I G;  4LBE C;  4WF9 V;  3EHB B;  4BIZ A;  2LFS A;  3E2E A;  4QIW F;  4WFB V;  2OTL V;  4MW3 A;  1QLE C;  1DF4 A;  3W7X A;  5L3B A;  1M56 C;  2DYS C;  2GSM B;  4JYB A;  4F4L A;  2QE7 G;  5B1B C;  5CA3 A;  4PA6 A;  3WG7 C;  2B1G A;  1R3L C;  4E2L A;  2EIM B;  3ML0 A;  3SJQ C;  1LNQ A;  5IY5 C;  2A0L A;  1NJI W;  1H38 A;  3JD0 A;  1GO3 F;  3T4Z A;  3CC7 V;  1N8R W;  1KEC A;  3JD2 A;  5CBG A;  3FYE B;  4XBF A;  3F5W C;  4MT8 A;  4N23 A;  1FXK C;  1KKD A;  1J95 A;  4FJC C;  3UKM A;  1GM7 A;  4QPK A;  1Q81 W;  3AG2 B;  1OCC B;  4UVA A;  1V55 B;  4MVQ A;  3ABK C;  4P30 A;  4PDL A;  1KQS U;  4FIP C;  3FKS G;  5B1A C;  4MTG A;  3CCE V;  1CP9 A;  3SYQ A;  1VQ9 V;  3AG3 C;  3SPJ A;  2BOB C;  1SRY A;  1QLN A;  2JJ1 G;  5GW7 A;  1YI2 V;  1OCR C;  2D3O W;  1AI5 A;  1P4R A;  3A0R A;  3LDD A;  4TSF G;  2EIK C;  4GX1 A;  3MD0 A;  3FB8 C;  3B8N A;  2C2A A;  3T2M A;  4MVR A;  3G71 V;  3B8M A;  3JD1 A;  2JJ2 G;  4L87 A;  1WPX A;  2BOC C;  1XL4 A;  5CBH A;  3CCL V;  3F7Y C;  2EIJ B;  4R6Z A;  2ZDI C;  4HYO A;  1F51 A;  4FPP A;  4QJF B;  2NLJ C;  3IFX A;  3OUS A;  2OCC C;  4MTF A;  4U7N A;  1SES A;  3LDC A;  4CBC A;  4PDR A;  1ENV A;  4RUE A;  3ABU A;  3LUT B;  3OM3 B;  4EKW A;  1VQK V;  2EZO A;  5H6R A;  4UXN A;  2XAG A;  3QO5 A;  1I5Y A;  2QM8 A;  3E8B A;  3GWO A;  3ZRW B;  5CBF A;  2WLJ A;  5L3G A;  1DF5 A;  2ZD9 A;  1JJ2 U;  5L3D A;  4XDK A;  3HPL C;  1R6N A;  2IJK A;  4PA7 A;  4MTO A;  4JTC B;  1M57 B;  2ZR2 A;  3ASO B;  5KA5 A;  1PKX A;  3CCQ V;  2WLK A;  2CK3 G;  2JDI G;  2Q69 A;  3ZN0 A;  3BY6 A;  5BZB A;  3SPC A;  1W0J G;  2WLI A;  1QR9 A;  3CMA V;  3CD6 V;  1K4C C;  1V55 C;  2X6A A;  2A9H A;  2Z5U A;  3P32 A;  1W2B U;  5E1A C;  2EJR A;  4KFM A;  4WFG A;  3RBZ A;  1R3K C;  4BAY A;  1FXK B;  1FXH A;  4H37 A;  3ZMZ A;  3K03 A;  1K4D C;  4RQF A;  1M90 W;  3W7U A;  5HFM A;  3OEH G;  1QCE A;  4ZBM A;  1QVG U;  1CPY A;  3ABM C;  2WLL A;  4UVC A;  3AG1 B;  2IU0 A;  1SER A;  1NBM G;  1ARO P;  3B77 A;  1BL8 A;  1R3I C;  1ZWI C;  1RPR A;  3HB3 B;  1AI4 A;  2XND G;  1W0K G;  2UXX A;  2YEV B;  1FS0 G;  1I5X A;  1QLE B;  2YEV A;  4GX2 A;  1VQ5 V;  1COW G;  4X89 A;  3NXS A;  1AJN A;  3WFV A;  1OCC C;  3VBB A;  3D3I A;  2EZP A;  1YJN V;  4RUF A;  2HR3 A;  4RO2 A;  5IYC O;  1NH2 D;  3ABT A;  1GM9 A;  4GX5 A;  3K79 A;  1JOY A;  3E83 A;  4RAI A;  2HG5 C;  5DM6 V;  2WAM A;  2WPD G;  5B3S C;  1S0V A;  5L3E A;  3LSS A;  2UXN A;  3LNM B;  3JCZ A;  3OUF A;  5B1B B;  4XDL A;  2F43 G;  1NR7 A;  4X8A A;  5H9C A;  3STZ C;  1SZT A;  2IU3 A;  2P90 A;  3ZMU A;  3ABL C;  1GKF A;  3K08 A;  5B3S B;  1VQ7 V;  4JAV A;  4WFA V;  2A79 B;  3TCU A;  2DWE C;  2ZXW C;  4JTD B;  3F7V C;  3ASO C;  5IYB O;  2XAJ A;  1VQ8 V;  1MOF A;  1NR1 A;  1Y66 A;  1EZJ A;  4UV8 A;  3CC2 V;  2EIM C;  2X6C A;  2JEU A;  2IH1 C;  1OZ0 A;  2YSU B;  3OFN G;  4DO2 A;  4MVO A;  1DLB A;  4JAU A;  3OW2 U;  3UM7 A;  1FXK A;  3IC7 A;  3AG4 B;  1NVP B;  3ASN C;  1SET A;  4WCE V;  3CCM V;  4CZZ A;  2ZXW B;  3E89 A;  3PJS K;  1M9N A;  1NKD A;  4P2Z A;  4UUJ C;  5LHI A;  4MSW C;  3AG3 B;  3GB7 C;  3MHS C;  4I5S A;  5EBL C;  4R7C A;  1XL6 A;  2WLH A;  4BW5 A;  1GTO A;  5IYD O;  3E35 A;  4LP8 A;  4QE7 A;  3LDE A;  4HZ3 A;  4J9Y B;  4Q20 A;  1K3E A;  3JYC A;  2ITD C;  3AEI A;  2WWW A;  3QO8 A;  3VOU A;  2HVK C;  1AJQ A;  3ZIA G;  4JYC A;  1AJP A;  1EBO A;  2XAS A;  4UV9 A;  2P67 A;  2Y69 C;  2OTJ V;  2AHY A;  3DGE A;  3T1C A;  1NQT A;  1M1K W;  3CC4 V;  3R65 A;  1YJW V;  1K92 A;  3TK1 A;  2XAH A;  5IY5 B;  2DQ3 A;  3X2Q C;  3JD3 A;  3ETD A;  2Q68 A;  1KP2 A;  4R8C A;  5J9P C;  3I56 V;  1WLE A;  1K97 A;  1BHB A;  1M56 B;  3CME V;  5EC2 C;  1H8E G;  3K06 A;  3OMI B;  3FB6 C;  3AG2 C;  3OEE G;  1K5S A;  3D36 A;  1AI6 A;  1ROP A;  2R9I A;  1K9M W;  2V1D A;  3G4S V;  3ASN B;  3ABL B;  1QVF U;  4R50 A;  1VQ4 V;  3ZRS A;  1OCO C;  4OXS A;  1OCZ B;  4WFH A;  2PI5 A;  2EIN B;  2K1E A;  3CCS V;  2EIJ C;  1EFR G;  2DYR B;  2LP7 A;  3T4D A;  1F4M A;  2XOK G;  5CN0 A;  2M7W A;  3SYC A;  3E8G A;  1PNL A;  3CCR V;  3K3W A;  2W6J G;  1K34 A;  4XDJ A;  1K73 W;  4MVU A;  4LCU C;  4PEL A;  1Q82 W;  3RVZ A;  5C93 A;  1PNK A;  3AG4 C;  3M99 B;  1GK9 A;  3K04 A;  2OCC B;  5HFL A;  3CPW U;  4G2K A;  2W0F C;  4U7O A;  3E8F A;  1UJW B;  3CCU V;  1VQL V;  4PA9 A;  1PL0 A;  1JX9 A;  2X0L A;  3SPH A;  1E1R G;  3SPG A;  2IJH A;  4ASU G;  4G27 B;  4RQE A;  3RW0 A;  5L3C A;  1MG1 A;  3STL C;  5IDJ A;  1H2G A;  4PA3 A;  5EK0 A;  3ETG A;  4N21 A;  1YTF D;  1BMF G;  3H01 A;  3OE7 G;  1M57 C;  2QA4 V;  1VQO V;  5LGN A;  1CEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...