3E83A

Crystal structure of the the open nak channel pore
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e83A00
2ZXWC 2ITCC 3UM7A 4WFFA 4XDJA 3RVZA 2ITDC 5EC1C 1G4YB 4LCUC 3RBZA 4PDMA 4PA3A 2X6AA 3GB7C 4P30A 4MVZA 5EK0A 3UKMA 4ZBMA 1ZWIC 4G28B 3SYAA 2Q67A 3ZJZA 3T4ZA 3T1CA 3T4DA 3ZRSA 4RO2A 2X6CA 5EBLC 4MVOA 2ATKC 3HPLC 2BOCC 2EINC 1JVMA 4OXSA 3AG1C 2WLIB 4MTOA 2Y69C 2ZD9A 2WLHA 3AG2C 3FB8C 4QE9A 4PDLA 3SPJA 4P2ZA 4R7CA 1ORQC 5CBHA 5J9PC 3JYCA 3KG2A 3OGCC 2WLNA 5CBFA 4LBEC 4PA7A 4WFHA 4H37A 2Q6AA 3K0DA 2WLKA 2HVKC 3K06A 4MTGA 3SJQC 1XL6A 3RW0A 2HFEC 3ABKC 2WLLA 3R65A 4GX0A 4MW8A 2QTOA 2R9RB 3SYCA 4X89A 4MTFA 3SPCA 4J9YB 3SPHA 5BZBA 4UUJC 4JTDB 2A79B 3SYPA 2W0FC 5EBMC 2WLLB 3E86A 1QLEC 4PA6A 2P7TC 4MS2A 3E8HA 4XDLA 1R3JC 2IH1C 5KUMA 4PDRA 4GX5A 1OCRC 4X88A 5B1AC 2X6BA 4GX1A 3SPIA 2H8PC 3SYOA 3PJSK 1K4DC 3E8GA 2QKSA 3LDDA 2KB1A 3STZC 1M57C 4TWKA 4R50A 2AHYA 4RAIA 3K0GA 4RUFA 5E1AC 2JK5C 3SPGA 5IY5C 4QNHB 2DYSC 3TCUA 1R3IC 5CBGA 3SYQA 3OUFA 3LDEA 4PA4A 1K4CC 3T2MA 2DYRC 4QE7A 1P7BA 2WLIA 1V55C 3E8BA 3F7YC 1OCCC 2DWEC 4BW5A 4R8CA 2WLMA 1R3KC 3K03A 4MVQA 3X2QC 4CBCA 1V54C 3FB6C 2NLJC 2HG5C 4GX2A 4P9OA 3ASOC 4EKWA 2EIJC 5EC2C 4XDKA 3LUTB 3IGAC 2OCCC 4WFEA 3ABMC 3FB5C 2BOBC 2K1EA 4LP8A 5B3SC 3AG4C 4PA9A 4P9PA 2A9HA 3AG3C 2YEVA 3F7VC 3LNMB 4WFGA 3STLC 4G27B 3VOUA 1BL8A 3F5WC 5KUKA 1OCOC 2AHZA 1M56C 3E83A 2HJFC 3OR6C 3ABLC 5B1BC 4R6ZA 3TETA 4MW3A 3LDCA 4HZ3A 3ASNC 4KFMA 3OUSA 5EBWC 1R3LC 4J9ZB 3E89A 3BEHA 3EFFK 2EIKC 2DWDC 2A0LA 4HYOA 4JTCB 1LNQA 4DXWA 4PDVA 4F4LA 2EILC 2IH3C 1XL4A 4H33A 4MVUA 4X8AA 3E8FA 4JTAB 1S5HC 2HVJC 3K04A 4MVRA 2EIMC 4I9WA 4MVMA 4RUEA 3IFXA 2Q69A 2Q68A 3K08A 4MSWC 1KKDA 3FB7C 1OCZC 3RVYA 3WG7C 4MVSA 3OR7C 1J95A 2WLJA
chains in the Genus database with same CATH superfamily
1XOUA 3RBZA 4N23A 3ABLB 2RN9A 3FYEB 4TOIA 1R6TA 2WPDG 4JI7O 1GRJA 4FVMA 3RT3C 3EHBB 2DOSA 2QGNA 3OGCC 5KMGB 4QPJA 1WAZA 2WLKA 2HVKC 4Z2WA 3OMNB 1V55B 3UO2A 3DC5A 4FMTA 2E5LB 2P22C 5LXTA 1G1XB 2DYSB 1K5SA 3CXHF 2EBOA 2ZQMA 1GTOA 1MSDA 1IBMO 4O4HA 3SPCA 4LFBO 3CCSV 4KHPB 2YICA 3E86A 1VEWA 3U0ZA 1Z2GA 4FPPA 4KP4A 1OCRC 1ZL8A 3AG7A 1TA8A 3ABUA 1MA1A 2ZNJA 2M7WA 1GO3F 2Q7HA 4R50A 2Q0AA 1M93A 5IY5C 2GTSA 4EFEA 4LF8O 1VQLV 1BSMA 3JAKB 1G8MA 2NNUA 3U11A 4NTXA 1PP9H 2F4VO 5LYJB 5EC2C 1GAXA 1Q86W 4JAAA 3ZN1A 1P7GA 4WFBV 1Z5WA 1ZSPA 2IJHA 2GTAA 1GN6A 2V4DA 4I4TB 4DR4O 3ZHVA 1WB7A 2ZCEA 2DQ3A 1FXVA 2HJDA 3ABMB 1F51A 3FFQA 4NXMB 2P4KA 3H1LH 4IL6Z 1YSCA 4LFCO 5EIBC 2EILC 2IH3C 4H33A 4JZGA 5K1XA 4B3SB 5KHHA 2LGQA 3TK1A 1VQPV 1O9GA 1RM1B 1Q81W 4U3FH 2GUZA 2EX3A 3ZRVA 4DW0A 5CA1B 5TISZ 3ZHRA 3AG1C 4J42A 3CMEV 4GYCB 3WG7B 4MTOA 5K1PA 1N32O 3KG2A 1M9NA 1JA8A 1H8HG 1QBZA 5CMUA 1YHQV 1AROP 1CP9A 4NKGB 5C8YB 4JAVA 3JASB 3VQWA 1WPBA 1Q6HA 2ILMA 1SC5B 3D36A 3QTCA 3CPWU 1RP3B 5BZBA 2ZR2A 4QPKA 4UV8A 3RYFA 4X62O 2UUCO 3CCVV 1RFYA 1TUEB 4GKJB 1PNMA 3JD3A 5J2TB 2DW4A 1SETA 2BTQA 5GONB 2H3OA 1HNXB 3S3WA 5B1NA 2OYQA 2JJ2G 2DQ0A 5JJNB 1BS3A 2WLIA 4DR7O 1R73A 1W0JG 3IC9A 5J2UA 2Q7GA 2E3CA 4TUYA 3SJCC 1VQOV 1NVPD 3BY6A 5FNVB 4FIPC 4FLWA 3AG4C 1KQSU 4GZRB 4DR6B 2A9HA 3AG3C 3F7VC 1HNWO 1YVWA 3L70H 1TGOA 4G2KA 3CCMV 3JATA 3TETA 2N05A 4O4LA 2UXDO 1R3LC 4O2BB 2IBZH 4JTCB 4W4KA 1LNQA 4RQEA 1SQFA 3H1JH 1JPXA 2MK3A 4LF4B 2UXCB 2ITDC 2YC0A 4PI2A 2OIEA 2MW2B 4J7KA 3T4DA 2X6CA 3HPLC 2YDEA 5DM6V 1SQPH 4DR2O 2Z3YA 2WLHA 3AG2C 5HFMA 1W2BU 3E22A 4P2ZA 1X59A 1F23A 2B9ZA 3HKCB 3KZIZ 1H2NA 2PF4E 2OTLV 5DN6G 1Y67A 3OT7A 2NR5A 4FLZA 4MT8A 3T1HB 1X4TA 3IJ4A 5AG2A 4WBNA 3FKSG 3K9SA 4I50A 2XAQA 3RN4A 3SYPA 2W0FC 5EBMC 5JJEB 2HEPA 4ZI7B 2KSDA 1ZUQA 1K5QA 1CPYA 2P90A 4DR3O 2EIJB 1LUVA 4RUFA 4BR6A 4X65B 1VARA 3TCUA 1W59A 4YIOA 1R3IC 4DV4B 1DTOA 3L72H 1EN5A 4I55A 4NXNB 1K33A 3CP1A 3X2QC 1HNZO 4LF6O 1NTMH 4C7UA 2B1IA 4IYIA 5FPRA 4BIOA 1VQ7V 4LF5O 4EKWA 1Y4MA 1SKVA 2A06H 1K97A 1XHZA 4ICGA 5JH7A 4DUZO 2N74A 3BAAA 1M56B 1J5EB 2Y48A 2OTJV 2Q9LA 4JI4O 2AHZA 1NTKH 5B1BC 1JQ0A 4LC1A 3SR2C 4TV8B 4CH3A 4I0XA 5B1BB 1R6KA 2OIGA 2YS8A 1VQ9V 5LGNA 3K59A 1YXBA 2YXYA 1XL4A 3JD2A 3L75H 3N2GB 4X66B 4MVRA 3DSQA 3B2EE 4MVMA 4MSWC 4YHHB 4B3TO 1N0NA 3CJHA 3OR7C 2JGDA 4DV0O 3B4SA 3JAKA 2LFSA 4TQFA 5L3CA 2F95B 3SYAA 1XI1A 3CRMA 1RM1C 1WJZA 5B5EZ 4YHHO 2CTPA 4NYKA 5BMVA 2CGOA 3O65A 4JI8B 4FZ1A 3H01A 4UFZA 2CH7A 4K0KO 4ZKIA 4ASUG 4JI5B 3QF7A 1DF4A 4MTGA 4IIJB 5JQGB 4IYHA 3W7WA 4E2LA 1N8RW 5JCOA 3VQXA 1HR0O 5JH7B 1WNSA 4X20B 4DUZB 4FM0A 4FFKA 1O9HA 3ZS8C 2QTSA 1D5NA 5B1AC 4B3RO 1GN4A 3LDDA 1I0HA 4LWSA 2D3OW 3G6EV 3JAWB 4LH6A 1HNZB 4LF6B 1PNKA 5BR8B 1GM8A 3M8AA 1K4CC 3QNEA 1NZ6A 2FL4A 4DUYB 3F7YC 4BW5A 1SQXH 4DR3B 2WWWA 4HNAA 2HG5C 2ZM6B 4O2AA 1XDCA 1QLEB 3RYHB 2UXBO 2OCCC 2ZE5A 1IBLO 4PA9A 2EJ7A 4WFGA 2EIMB 2UU9O 3HKBB 1F4NA 3HKDB 3HKEA 3A0RA 1XMOO 3ASNC 4DV6B 1AP6A 2EIKC 1AR4A 1YI2V 1L8DA 4PDVA 4MVUA 1JJOA 3ZRWB 5IJ0A 1OCZC 3L74H 2ZKOA 2UUBB 4JI2O 2ITCC 5IYCO 3H1KH 5E79Z 1H2GA 1BHAA 2X6AA 1H38A 5H5NA 2EIKB 5B1OA 3T1CA 5C93A 5KAFZ 3P3PA 3VQYA 2A7WA 4GT1A 3JD4A 3ZIAG 2WLNA 2FB5A 2G38A 2CAZC 4LBEC 4WFHA 2F93B 3E35A 4H37A 3K0DA 1SQVH 3JSNA 2JJ1G 3C3TA 1T5EA 3ZCCA 4X64O 5LHGA 5KMGA 2PUSA 3OMIB 4B7KA 1SERA 4JI3O 4DR6O 1R6NA 2B5UA 4MS2A 3A2FA 1SQQH 3I56V 2IW5A 3QO5A 3TXQA 4DYLA 1YJNV 1K4DC 2ADPA 3K0GA 3IC7A 3SPGA 5IYZA 2V7QG 4NVPA 4UCTA 4RQFA 4DR7B 3A8TA 1KC8W 3SYQA 4J41A 4QE7A 5F2VO 3I55V 5CA3A 2ZT9B 3CEIA 3MHSC 1M4UA 4FLXA 4TV9A 3X2QB 1EN6A 3D3QA 4GKJO 1I5YA 4TSFG 2ZR3A 3HKEB 3OFNG 2LW1A 3OMAB 4UCUA 1K34A 5JVDA 1MG1A 4JI3B 2DE0X 1OCOC 3TXSA 3E83A 5CB4A 4FLTA 3ABLC 1JFFA 3CYOA 3KCYA 3JSLA 5ITZA 3B8MA 2DJVA 1MZEA 1KU9A 3THOA 1KUQA 4WF9V 2WSSG 2AGAA 1U96A 4F4LA 1SA0B 3OTFA 3CCEV 3E8FA 2LFRA 1DF5A 1KKDA 2F66C 4AQYO 1SZTA 4FK5C 1PNLA 3CSXA 3J7AU 1N33O 3CRCA 4PA3A 3K3WA 4JI2B 2UUBO 1YTFD 5BY1A 3N2KA 1NJIW 2JGDB 3HB3B 2P6JA 4UVAA 3FB8C 1FAFA 4ZOLA 4UB8Z 1F7YA 3JYCA 3QO8A 4JV5O 1DK1A 1SESA 4X1IB 5C8YA 2IM9A 1XMOB 2YIAA 3OM3B 4H0LB 3CB2A 4DR4B 3BVOA 4UVCA 2E75B 5FL7G 2H94A 3G4SV 1B6QA 2CTRA 3K5MA 5IWAB 3CC4V 2GUZB 4JYYA 1IBLB 3RFRA 3BPZA 4DK0A 4BIZA 1JR9A 2F4VB 2ZM6O 1FXKB 2PI4A 1OCZB 4CS4A 5KHGA 3FYIB 2JK5C 3ZMTA 5LBQA 3LSUA 3CJHB 3D3IA 3CD6V 1AI4A 2HP8A 2EULA 1S5LZ 2XHBA 4D7TA 4Z1MG 4LF8B 1MNGA 5KHIA 1S0VA 1RPRA 3ASNB 1XUQA 4ZIBA 4GX2A 3NXSA 4B3RB 2Y69B 3SDLA 3AK2A 1XREA 1IXBA 2BCCH 4HNAB 5FPOA 1IXMA 4JI0O 3STLC 1HR0B 3VOUA 1IBMB 1GM7A 5GONA 2YSUB 4CC6A 2E5LO 3OEEG 3ASOB 2YXHA 3LDCA 4J80A 3JATB 3WFVA 4OPHA 3ZRXA 3APOA 4PD4F 4CS3A 4JI7B 4JI8O 5B3SB 2W0XA 4GKKB 2XTAA 4EEQA 1FFXA 1K8AW 1V9PA 3UM7A 3RGBA 2VRZA 4UB6Z 5HFLA 3RYHA 4FLUA 1OV9A 5IJ0B 4G28B 4DV0B 2ATKC 4JI6B 4DV5B 2JEXA 1KYOF 4H13B 2Y69C 4X66O 4DV5O 4PDLA 1TUBB 4XBFA 5CBHA 1S76D 1NR1A 3HKCA 1XMQO 2Q6AA 1AR1B 1OCOB 2UXXA 4B7EA 1XEQA 4JI4B 4GKKO 3GVMA 1VMGA 2Q4PA 2HHHB 1IBKB 1NKDA 4ZHQB 2YIBD 4XDLA 5GW7A 4BAYA 2LP7A 1E1QG 1SS3A 4LF5B 4O2AB 4I5SA 4K8XA 4TT3G 3STZC 4TWKA 3S3XA 1UFIA 3WB2A 2KG7B 2FYUH 4IT5A 4NXNO 1B3QA 4JI0B 3CMAV 3K79A 3JALB 2FTKA 2A3QA 1H2LA 3DTUB 1S77D 4LR3A 5B66Z 3C90A 4HAMA 4LP8A 2OT5A 5L3GA 1Y74B 4DV7O 1N36O 3K5NA 1NR7A 2GDSA 1TUBA 4JASA 1Y76A 3MD0A 4UCRA 1BZKA 4TV8A 4PJ0Z 4UCSA 4LH7A 5IWAO 2A0LA 1HDJA 3CCRV 4FFBB 1GN3A 1Q7YW 3BCCH 4X1YA 1E1RG 3BRCA 4DR2B 3DC6A 4IHJB 1BQ0A 1Q5OA 3ETDA 1J95A 2QM4A 2Q8VA 3UKMA 3A0HZ 2UXCO 4LF4O 2RDCA 4RO2A 1EZVH 1XQ8A 2EINC 1NS1A 1NVPB 1NT2B 1Q3EA 2PTMA 1I5XA 2QR4A 1N33B 2JEUA 4DRXA 2QDOA 2Q5ZA 2ZE8A 1BGYH 1QR9A 4YJ3B 1AJPA 5JVDB 1XL6A 2WLLA 3H9VA 4MW8A 3KCXA 1JFFB 1HNWB 4B08A 1MOFA 4UV9A 1R3JC 1FJGB 4GX1A 1NH2B 1XHXA 3JALA 3G80A 2AZ0A 3CRRA 1N34O 5H6RA 1WB8A 3LDEA 1KKCA 2DMXA 3E8BA 1SQGA 5EZYB 1VF6A 1YTFB 4JF3A 1FXHA 3TJTA 2YEVB 2IJJA 2UUCB 4X62B 4JGSA 3NR7A 3A0BZ 2BE3A 1N34B 2OCHA 4KL1A 1XNRO 4CH6A 1FJGO 3ZHTA 3BHPA 1N32B 1COWG 2FKXA 2IJIA 3JD1A 1Q8IA 1K9MW 4A5UB 2ZNIA 3FB7C 2D2CB 4X64B 2X7RB 2ZXWC 3CCQV 4WFFA 3RVZA 1JCHA 1G4YB 4QIWF 2ARHA 4I4TA 3UCSC 2Q67A 4MVOA 4B3SO 4FLVA 2OCCB 3MHHC 1MSWD 4EB6A 5J9PC 4LFCB 4QGPA 3WB0A 1R1BA 5CN0A 2XUMA 2GV9A 1M5IA 2RNBA 3ZEDA 1I94B 3SYCA 2ZDIC 3AG1B 4CH4A 1PKXA 4WFAV 5CA0B 3RWRD 1M57C 3OEHG 5B1AB 2CDYA 1FXKC 2UU9B 4QNHB 1FFXB 1YITV 5CBGA 1OJHA 4NTWA 2CGNA 2QM8A 2QWNB 1AI6A 4AI8A 1DGSA 4B3MB 1QNMA 4QJFB 4U3JA 5GTHZ 3DGEA 3OD4A 3RYCA 1PPJH 2XAJA 5IYBO 1D2DA 3AG2B 3CX5F 2ODMA 2QWPB 4TV9B 3OAAG 2M6YA 1H8EG 4J7JA 5BR8O 4LFBB 1L0LH 1BL8A 4WCEV 3AG3B 5FNVA 3OR6C 1GM9A 3CCUV 4FM2A 2EZOA 3OE7G 2VQEO 5CB4B 4ZHQA 4NTYA 3L9DA 2DWDC 5ITZB 2JIZG 4TUYB 4O4HB 2HVJC 1RSOB 2HHHO 3IFXA 1PL4A 1D5AA 1E79G 1VIBA 3JAWA 5A9GA 4XDJA 4LCUC 3GWOA 4JPRA 3J81N 4K0KB 3GB7C 2QM7A 3T4ZA 2QSAA 1AI5A 3ML0A 1Z5VA 1AI7A 2DN9A 4OPAA 4JI6O 2O57A 1OZ0A 1SA0A 1ZAUA 3FD9A 5CBFA 2Q0OC 4PI0A 3ZN0A 2VWKA 4X1IA 1NQTA 1IURA 3T1YB 2HFEC 1Y76B 2R9RB 4I50B 5LA6B 3SPHA 1FYJA 2P5OA 1HWYA 5JWPA 2P7TC 4YY3B 1BE3H 4DV2O 3E8HA 3N2KB 5DECA 2ZINA 2CK3G 2W6JG 3FAVA 3PJSK 1BHBA 2QKSA 2KB1A 5D5PA 2IU3A 4LF7O 3K58A 2PGGA 5KLVH 2WAMA 1N0JA 2FMLA 3ABTA 1QU7A 1JMKC 3CE2A 4NR1A 2NLJC 4KXRA 4EFBA 1KP3A 4JI1O 1B06A 3ASOC 4MTXA 2GHYA 3BA8A 3FB5C 2BOBC 5B3SC 1XNQO 5LMNO 4DV4O 4E4EA 1H2KA 2ETNA 4R6ZA 4D6TH 3TGUH 4J7ZA 2QKAA 5IJ9B 2X0LA 4J9ZB 3ZMSA 5IYDO 1THZA 5JJJB 2LJ2A 1EM1A 5LA6A 1S5HC 1PL0A 1AJQA 4I9WA 3JASA 3T1HO 1K3EA 2LQTA 1KECA 5EC1C 4IGGA 4DRXB 4JV5B 3L73H 1VQNV 4YJ3A 3OGIB 5H6QA 1N4CA 1JVMA 2LW7A 4GCZA 3D36C 2WLIB 1LUWA 5H9CA 2ZD9A 2BTQB 1BQZA 4O4JB 4R7CA 3JARB 3RW0A 1JJ2U 4AQYB 1FFTB 4DV1B 3ETEA 2GBOA 1SZXA 3N2GA 4J10A 2AZ2A 5JQGA 3K9AA 3ETQA 1VP7A 1YZBA 3M7MX 2JDIG 3OTOO 2PI5A 1AILA 3RYIB 1HP8A 4U7OA 2WA4A 3UT5B 2R9IA 4RAIA 1GN2A 5E1AC 5J2UB 4LFAB 2CE4A 1K7DA 4PELA 2R72A 3U10A 3OUFA 5BXZA 3T2MA 2YIDA 1V55C 1OCCC 4CBCA 4MVQA 1R3KC 1TVKA 1OCRB 2ZE7A 3GWKC 3LSQA 3QG5A 1CEZA 3LUTB 1W0KG 3IGAC 4JYAB 5LL6Y 1IDSA 5LGUA 4X20A 4O4JA 1HNXO 2KG7A 2Q73A 4MW3A 1US6A 5CA0A 1V54B 3BA9A 3E89A 1I08A 2KKWA 4HYOA 4DXWA 1ZL8B 2JS5A 4Z1VA 3K04A 3ETGA 2IJKA 1YJWV 5KA5A 2Y4TA 1AR5A 1AVMA 1FXKA 1YIJV 3ZHSA 5EK0A 1OCCB 2QKCA 3ZJZA 2YUAA 4K3AA 1EBOA 3E22B 2EILB 5KA6A 2L35A 4L8JA 4J11A 4QE9A 1FS0G 2PYLA 1JX9A 1ORQC 1AP5A 4HBNA 4PA7A 3K06A 4YJ2B 4JYCA 3ZX6A 3G71V 3R65A 4GX0A 2DYRB 3QVNA 2XNDG 4I9QA 4ZI7A 4FJCC 3AK1A 1YJ9V 4DV3B 1P84F 1ENVA 5KUMA 4GX5A 5KX5A 1GMGA 3SPIA 4DV6O 4DW1A 2W6IG 2YIBA 5EYPB 1Q43A 1YCIA 5D5QA 1VQ6V 2DYSC 3Q4HB 3RYFB 1K73W 4R8CA 5IYZB 1KB9F 4RWUA 2UXBB 4O4IB 5EIBD 2CUGA 1XBLA 5A2QN 2EIJC 4XDKA 2E76B 3L71H 3OTOB 1M57B 4JYBA 4F6EA 2BTOA 3AG4B 3CS5A 4DUYO 1ZTEA 3H1IH 3K5OA 2RJZA 2F1MA 2NN4A 3LNMB 2ZIMA 1I7FA 5LMUO 1WA8B 4DV1O 1VQ8V 5L3BA 2OWOA 5GTIZ 4HZ3A 4DO2A 1UJWB 5BMVB 1KMIZ 4L87A 5EBWC 4Q6GA 1QLNA 1WPXA 4GLXA 4CH5A 4KHPO 3ZHQA 2EIMC 1RPOA 2Q69A 2Q68A 4IIJA 4MVSA 4OX9B 3DXRA 2P67A 5LP6B 1IVSA 4JI5O 2HKOA 2VQFB 3BFRA 4JAUA 2XAFA 4D7SA 5EBLC 2Y0PA 1QHTA 3Q4HA 4LWSB 4PHZA 3SGIA 1F4MA 4CC5A 1LR1A 3BABA 3ABKC 4B3TB 3B09A 5L3FA 3M99B 4LNUB 2YI9A 2XAHA 4UUJC 2A79B 1MZFA 1Q6UA 1SF9A 1XNQB 2PY5A 4X88A 3JCZA 3PN1A 1Y6XA 1URFA 3FX7A 3CCLV 2ZDIA 1XILA 3LSSA 1Y74A 1J5EO 1QQCA 2BSKB 2CTQA 2DWEC 1S3JA 1B04A 1DLBA 4LF9O 1L0NH 3JARA 1CXZB 3CRQA 5IJ9A 1P4RA 4WFEA 2UXNA 2K1EA 1WP8A 3HKBA 4DV2B 3JAMN 2B1GA 4CZZA 2UUAO 5KHKA 4UCOA 5KHJA 4IHJA 1M56C 3ZMUA 4X65O 3O9OA 1M90W 3T1YO 4W4LA 1Q82W 4UCVA 2QJ1A 5L3EA 3UT5A 3BEHA 2L6LA 3WB1A 2EJRA 4AILC 1YF2A 4LNUA 2ZIOA 1VQ5V 3K08A 3P32A 1OHHG 3WG7C 4DR5O 2JGUA 2VQFO 1Q90D 4OX9O 2Y4UA 2KQXA 4I55B 4ZBMA 3AEIA 3ZMVA 2BOCC 2LO1A 1KD1W 3SJAC 2PZSA 2BSKA 4GUNA 1ROPA 1VF6C 2VQEB 3B40A 3ABKB 3MDSA 4I0XB 1VF5B 2JS3A 1HW7A 3G67A 1FPOA 2JRIA 4X89A 3KKYA 4MTFA 2VWJA 4J9YB 5LMUB 1WLEA 4PA6A 1QLEC 4NB5A 2P06A 2HLDG 4PDRA 4F6RA 2UXDB 1VF7A 2X6BA 4TQDA 1P49A 3SYOA 2H8PC 4H44B 3APQA 1YEWA 4B3MO 3H1HH 3CC7V 1MABG 1A32A 3K57A 3EVKA 3AK3A 4PA4A 4U7NA 2VS0A 1S5JA 5LOVB 3FB6C 4YXWG 1QR8A 1GKFA 2K9PA 4DR1O 4OGQB 5IE9A 4UXNA 1BCCH 3W7UA 4DV3O 3QO7A 1TAEA 1S72V 3CCJV 1KP2A 4G27B 1NBMG 1QVFU 3F5WC 2QWOB 5KUKA 1I94O 2HJFC 5H2FZ 4JZ2A 3JD0A 2ZXWB 4O4LB 3SJBC 1NU1H 2IU0A 1EFRG 4O2BA 1BT8A 5EYPA 2Z0AA 3F5TA 4FM1A 4BWAA 2Q7EA 3EFFK 1UPGA 4FZ0A 4X9QA 2QEXV 4JTAB 2RMKB 2WA3A 3UQ8A 3ZHUA 2RCVA 4O4IA 3UO3A 2F43G 4PDMA 1GH6A 1IZ3A 1PM9A 4MVZA 1ZX3A 1ZWIC 1PV0A 2ADQB 2XASA 4PV1B 1QVGU 5KAIZ 3SPJA 4WBNB 5LXTB 4U3JB 3RYCB 3B77A 1WA8A 1XNRB 3CHXA 3HKDA 1BMFG 1K92A 3HR0A 4FFBA 5IT9N 5L3DA 4X1KB 2WLLB 4CS2A 4JYAO 4I7ZB 3LNNA 3G6BA 3W7XA 2IH1C 4NXMO 2F23A 2ZE6A 3ICXA 1GK9A 3RYIA 3ZRWA 1JOYA 3E8GA 5LHHA 1Q6IA 2YI8A 5LOVA 5JCOC 1VQMV 3N27A 5LGTA 2AXTZ 3J80N 2WLMA 4LFAO 3CWBH 2Z5UA 1FKAO 1V54C 4DR1B 5CA1A 3P3NA 1M1KW 3MAQA 1TVKB 2LGWA 2JVDA 2EINB 4P9PA 4K35A 1SRYA 2YEVA 1FD9A 1EZJA 2R9AA 2QE7G 3DXRB 5LP6A 3OUSA 3D8CA 1WN7A 4Q20A 5EZYA 2EZPA 5LHIA 1QCEA 2QWRB 4X8AA 1H2MA 1NH2D 3FAVB 4RUEA 5DEDA 3OW2U 4AHCA 3RVYA 2XAGA 1VQKV 2R70A 1PD3A 5J2TA 1AB3A 4P30A 3W7SA 1KBHA 3CRAA 3B8NA 3ZRSA 3WU2Z 4DK1A 3W7TA 4OXSA 4BIUA 3ZBHA 1ZLZA 3ZMZA 2CTWA 2YXLA 2P4VA 3EXAA 2CH7B 3CC2V 2E74B 5IY5B 4BW9A 3P30A 4YJ2A 4X1KA 3SJQC 3VBBA 1EN4A 4DR5B 2QTOA 3K5LA 2RQ6A 4DV7B 1N36B 2GSMB 3JCUZ 4JTDB 2AW9A 5LMNB 2PYJA 4KUMA 3VQVA 1Y66A 1VQ4V 2Y0IA 3C3SA 5KX5B 4N21A 2V1DA 4JI1B 3I5DA 4EB6B 1AJNA 2AHYA 1NTZH 2UUAB 2DYRC 3IAYA 1IX9A 1P7BA 1MMMA 1SQBH 3CXCU 1G6UA 3K03A 4LF7B 5FLXN 4P9OA 1U97A 4LF9B 4ZOLB 3ABMC 4YIPA 4YY3O 2QA4V 1YDXA 1IBKO 1NI8A 5LYJA 2N04A 1H2SB 3E2EA 3R66A 4KFMA 1XMQB 1WP7A 2XOKG 4ABMA 5IDJA 2C2AA 4F6RB 2XT9A 4K8ZA 4FLYA 4X1YB 1RSOA 2HR3A 2QWQB 4UVBA 5LP6C 1L1FA 2WLJA
chains in the Genus database with same CATH topology
2X7RB 2ZXWC 2ITCC 3CCQV 4WFFA 3RVZA 1JCHA 1G4YB 3RBZA 5IYCO 1H2GA 2P67A 4QIWF 4N23A 1BHAA 3ABLB 2X6AA 1H38A 3FYEB 2EIKB 5B1OA 2HKOA 4JAUA 2XAFA 2Q67A 3T1CA 5C93A 5EBLC 4MVOA 2WPDG 4GT1A 3JD4A 2OCCB 3MHHC 1MSWD 3ZIAG 3EHBB 1F4MA 5J9PC 3OGCC 2WLNA 4QPJA 4LBEC 4WFHA 3E35A 4H37A 3K0DA 2WLKA 2HVKC 5CN0A 2JJ1G 3OMNB 1V55B 3ZCCA 3ABKC 4FMTA 5LHGA 3OMIB 3SYCA 5L3FA 1SERA 2DYSB 1K5SA 2ZDIC 2EBOA 2ZQMA 1GTOA 3M99B 3SPCA 2XAHA 3CCSV 4UUJC 1R6NA 2A79B 3E86A 2B5UA 4MS2A 3AG1B 3I56V 4FPPA 2IW5A 4KP4A 1OCRC 4X88A 1PKXA 3ABUA 3QO5A 4WFAV 1YJNV 1K4DC 3JCZA 2M7WA 1GO3F 1M57C 3OEHG 4R50A 5B1AB 3K0GA 3CCLV 1FXKC 3IC7A 2ZDIA 3SPGA 5IY5C 4QNHB 2V7QG 3LSSA 4RQFA 1YITV 5CBGA 1KC8W 1VQLV 3SYQA 4QE7A 3I55V 1G8MA 2NNUA 2QM8A 2DWEC 1S3JA 5CA3A 1DLBA 1AI6A 3MHSC 3X2QB 4QJFB 3DGEA 5EC2C 2XAJA 5IYBO 1P4RA 4WFEA 1Q86W 3AG2B 2UXNA 3ZN1A 2K1EA 1I5YA 4TSFG 2ZR3A 4WFBV 2B1GA 3OFNG 4CZZA 3OAAG 1H8EG 3OMAB 1K34A 2IJHA 1BL8A 1MG1A 1OCOC 4WCEV 3AG3B 1M56C 3E83A 3OR6C 3ZMUA 3ABLC 1M90W 2DQ3A 1FXVA 3CYOA 1Q82W 3B8MA 1GM9A 3CCUV 2EZOA 3ABMB 1F51A 3OE7G 5L3EA 4WF9V 2WSSG 3BEHA 1YSCA 2EJRA 2DWDC 4F4LA 2JIZG 2EILC 2IH3C 4H33A 3CCEV 3E8FA 2LFRA 2HVJC 1DF5A 3IFXA 1VQ5V 3K08A 3P32A 3TK1A 1VQPV 1E79G 1OHHG 1KKDA 3WG7C 1SZTA 4XDJA 4FK5C 4LCUC 1PNLA 3GWOA 4JPRA 4PA3A 1RM1B 3GB7C 2QM7A 1Q81W 3K3WA 4ZBMA 3AEIA 3ZMVA 3T4ZA 1YTFD 3ZRVA 1NJIW 1AI5A 3HB3B 3ML0A 2BOCC 2P6JA 1AI7A 3AG1C 4UVAA 3CMEV 1KD1W 3WG7B 4MTOA 3FB8C 3JYCA 3KG2A 1OZ0A 1M9NA 1H8HG 1QBZA 1ROPA 5CMUA 5CBFA 1YHQV 1AROP 1CP9A 3QO8A 3ZN0A 1SESA 3ABKB 1NQTA 4JAVA 2HFEC 3OM3B 3D36A 2R9RB 4UVCA 4X89A 4MTFA 5FL7G 3SPHA 4J9YB 3CPWU 2H94A 5BZBA 3G4SV 2ZR2A 1WLEA 4QPKA 4UV8A 1B6QA 4PA6A 1HWYA 1QLEC 2P7TC 3CC4V 3E8HA 3CCVV 2HLDG 4PDRA 2CK3G 1TUEB 4BIZA 2X6BA 2W6JG 1PNMA 2H8PC 3JD3A 3SYOA 2DW4A 3PJSK 1SETA 1BHBA 2QKSA 1FXKB 2PI4A 2KB1A 1OCZB 2IU3A 3FYIB 2JK5C 3CC7V 3ZMTA 5LBQA 5B1NA 1MABG 3D3IA 3CD6V 2JJ2G 1AI4A 2DQ0A 2WAMA 4PA4A 4U7NA 3ABTA 2WLIA 4Z1MG 1R73A 1W0JG 3FB6C 4YXWG 1QR8A 2NLJC 1S0VA 1RPRA 1GKFA 1VQOV 3ASNB 1KP3A 4GX2A 1NVPD 3ASOC 3NXSA 3BY6A 4MTXA 2GHYA 2Y69B 3FB5C 4UXNA 2BOBC 5B3SC 4FIPC 3W7UA 3AG4C 3QO7A 1S72V 1IXMA 3CCJV 1KQSU 1KP2A 2A9HA 3AG3C 3F7VC 3STLC 4G27B 3VOUA 1NBMG 1GM7A 3F5WC 4G2KA 5KUKA 3CCMV 1QVFU 2YSUB 3TETA 2HJFC 4R6ZA 3OEEG 3ASOB 3JD0A 2ZXWB 3LDCA 2IU0A 1EFRG 3WFVA 1R3LC 2X0LA 4J9ZB 3ZMSA 3EFFK 4JTCB 5IYDO 1THZA 1LNQA 3ZRXA 4RQEA 2QEXV 4JTAB 1S5HC 1PL0A 1AJQA 4I9WA 5B3SB 1JPXA 1K8AW 2MK3A 1K3EA 3UM7A 2F43G 1KECA 2ITDC 5EC1C 5HFLA 4PDMA 1VQNV 4MVZA 1ZWIC 4G28B 5H6QA 3T4DA 2XASA 2X6CA 2ATKC 3HPLC 5DM6V 1JVMA 4GCZA 2JEXA 2WLIB 1QVGU 5H9CA 2Z3YA 2Y69C 2ZD9A 2WLHA 3AG2C 5HFMA 1W2BU 4PDLA 3SPJA 4XBFA 4P2ZA 4R7CA 5CBHA 1S76D 1F23A 1NR1A 2OTLV 5DN6G 2Q6AA 3B77A 1AR1B 1OCOB 2UXXA 4MT8A 3RW0A 1JJ2U 1BMFG 1K92A 3FKSG 1FFTB 2XAQA 3ETEA 5L3DA 3SYPA 2W0FC 5EBMC 1NKDA 2WLLB 3K9AA 4XDLA 3W7XA 5GW7A 2IH1C 4BAYA 1K5QA 2LP7A 1E1QG 2JDIG 2PI5A 1CPYA 1GK9A 4I5SA 3ZRWA 2P90A 4U7OA 3E8GA 4TT3G 1JOYA 3STZC 2R9IA 5LHHA 4TWKA 4RAIA 2EIJB 4RUFA 5E1AC 3TCUA 1R3IC 1K7DA 4PELA 1VQMV 3OUFA 3T2MA 1DTOA 5LGTA 3CMAV 1V55C 3K79A 2FTKA 1OCCC 4CBCA 2WLMA 1K33A 1R3KC 3CP1A 2Z5UA 4MVQA 1V54C 3DTUB 3X2QC 1S77D 1OCRB 3LSQA 2B1IA 1VQ7V 4EKWA 1CEZA 3LUTB 1W0KG 3IGAC 1M1KW 4HAMA 1Y4MA 4LP8A 2OT5A 2EINB 1K97A 5L3GA 4P9PA 5LGUA 1SRYA 2YEVA 1M56B 2Y48A 2OTJV 1NR7A 2AHZA 4JASA 3MD0A 5B1BC 1EZJA 4MW3A 1JQ0A 4LC1A 2QE7G 3OUSA 5B1BB 1R6KA 1V54B 1VQ9V 4Q20A 3E89A 4HYOA 2EZPA 2A0LA 5LGNA 4DXWA 1QCEA 5LHIA 3CCRV 1XL4A 3JD2A 4X8AA 3K04A 1Q7YW 4MVRA 1NH2D 3ETGA 2IJKA 1E1RG 1YJWV 4MVMA 4RUEA 5KA5A 3OW2U 4MSWC 3RVYA 2XAGA 3ETDA 3OR7C 1J95A 1VQKV 1PD3A 1FXKA 1YIJV 4P30A 5EK0A 1OCCB 3W7SA 3UKMA 2LFSA 5L3CA 3B8NA 3SYAA 3ZJZA 3ZRSA 1RM1C 1EBOA 4RO2A 2EILB 3W7TA 5KA6A 2EINC 4OXSA 4BIUA 1NVPB 3ZMZA 1I5XA 4QE9A 1FS0G 3H01A 1JX9A 1ORQC 3CC2V 5IY5B 4ZKIA 4PA7A 4ASUG 2JEUA 1DF4A 3K06A 4JYCA 4MTGA 3G71V 3P30A 1QR9A 3VBBA 3SJQC 1AJPA 1XL6A 2WLLA 3R65A 4GX0A 2DYRB 4MW8A 2XNDG 2QTOA 3W7WA 4E2LA 1N8RW 2GSMB 1MOFA 4FJCC 4JTDB 1YJ9V 4KUMA 4UV9A 1R3JC 1ENVA 1Y66A 5KUMA 1VQ4V 4GX5A 5B1AC 1GMGA 4GX1A 3SPIA 4N21A 2V1DA 1NH2B 2W6IG 3LDDA 2D3OW 3G6EV 1AJNA 2AHYA 1VQ6V 1PNKA 5H6RA 2DYSC 1GM8A 3LDEA 1K4CC 3QNEA 2DYRC 1P7BA 3E8BA 3CXCU 3F7YC 4BW5A 1K73W 4R8CA 3K03A 1YTFB 2WWWA 4JF3A 2HG5C 1FXHA 4P9OA 2EIJC 1QLEB 2YEVB 4XDKA 1M57B 4JYBA 2OCCC 3ABMC 3AG4B 2IJJA 2QA4V 4JGSA 4PA9A 4WFGA 3LNMB 1VQ8V 2EIMB 5L3BA 1F4NA 3A0RA 4HZ3A 3E2EA 3ASNC 4DO2A 1UJWB 4KFMA 4L87A 5EBWC 1QLNA 2XOKG 1WPXA 5IDJA 2C2AA 2EIKC 1YI2V 4PDVA 1COWG 4MVUA 2EIMC 1RPOA 2IJIA 3ZRWB 2HR3A 3JD1A 2Q69A 2Q68A 1K9MW 3FB7C 4UVBA 1OCZC 1L1FA 4MVSA 2WLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW C;  2ITC C;  3UM7 A;  4WFF A;  4XDJ A;  3RVZ A;  2ITD C;  5EC1 C;  1G4Y B;  4LCU C;  3RBZ A;  4PDM A;  4PA3 A;  2X6A A;  3GB7 C;  4P30 A;  4MVZ A;  5EK0 A;  3UKM A;  4ZBM A;  1ZWI C;  4G28 B;  3SYA A;  2Q67 A;  3ZJZ A;  3T4Z A;  3T1C A;  3T4D A;  3ZRS A;  4RO2 A;  2X6C A;  5EBL C;  4MVO A;  2ATK C;  3HPL C;  2BOC C;  2EIN C;  1JVM A;  4OXS A;  3AG1 C;  2WLI B;  4MTO A;  2Y69 C;  2ZD9 A;  2WLH A;  3AG2 C;  3FB8 C;  4QE9 A;  4PDL A;  3SPJ A;  4P2Z A;  4R7C A;  1ORQ C;  5CBH A;  5J9P C;  3JYC A;  3KG2 A;  3OGC C;  2WLN A;  5CBF A;  4LBE C;  4PA7 A;  4WFH A;  4H37 A;  2Q6A A;  3K0D A;  2WLK A;  2HVK C;  3K06 A;  4MTG A;  3SJQ C;  1XL6 A;  3RW0 A;  2HFE C;  3ABK C;  2WLL A;  3R65 A;  4GX0 A;  4MW8 A;  2QTO A;  2R9R B;  3SYC A;  4X89 A;  4MTF A;  3SPC A;  4J9Y B;  3SPH A;  5BZB A;  4UUJ C;  4JTD B;  2A79 B;  3SYP A;  2W0F C;  5EBM C;  2WLL B;  3E86 A;  1QLE C;  4PA6 A;  2P7T C;  4MS2 A;  3E8H A;  4XDL A;  1R3J C;  2IH1 C;  5KUM A;  4PDR A;  4GX5 A;  1OCR C;  4X88 A;  5B1A C;  2X6B A;  4GX1 A;  3SPI A;  2H8P C;  3SYO A;  3PJS K;  1K4D C;  3E8G A;  2QKS A;  3LDD A;  2KB1 A;  3STZ C;  1M57 C;  4TWK A;  4R50 A;  2AHY A;  4RAI A;  3K0G A;  4RUF A;  5E1A C;  2JK5 C;  3SPG A;  5IY5 C;  4QNH B;  2DYS C;  3TCU A;  1R3I C;  5CBG A;  3SYQ A;  3OUF A;  3LDE A;  4PA4 A;  1K4C C;  3T2M A;  2DYR C;  4QE7 A;  1P7B A;  2WLI A;  1V55 C;  3E8B A;  3F7Y C;  1OCC C;  2DWE C;  4BW5 A;  4R8C A;  2WLM A;  1R3K C;  3K03 A;  4MVQ A;  3X2Q C;  4CBC A;  1V54 C;  3FB6 C;  2NLJ C;  2HG5 C;  4GX2 A;  4P9O A;  3ASO C;  4EKW A;  2EIJ C;  5EC2 C;  4XDK A;  3LUT B;  3IGA C;  2OCC C;  4WFE A;  3ABM C;  3FB5 C;  2BOB C;  2K1E A;  4LP8 A;  5B3S C;  3AG4 C;  4PA9 A;  4P9P A;  2A9H A;  3AG3 C;  2YEV A;  3F7V C;  3LNM B;  4WFG A;  3STL C;  4G27 B;  3VOU A;  1BL8 A;  3F5W C;  5KUK A;  1OCO C;  2AHZ A;  1M56 C;  3E83 A;  2HJF C;  3OR6 C;  3ABL C;  5B1B C;  4R6Z A;  3TET A;  4MW3 A;  3LDC A;  4HZ3 A;  3ASN C;  4KFM A;  3OUS A;  5EBW C;  1R3L C;  4J9Z B;  3E89 A;  3BEH A;  3EFF K;  2EIK C;  2DWD C;  2A0L A;  4HYO A;  4JTC B;  1LNQ A;  4DXW A;  4PDV A;  4F4L A;  2EIL C;  2IH3 C;  1XL4 A;  4H33 A;  4MVU A;  4X8A A;  3E8F A;  4JTA B;  1S5H C;  2HVJ C;  3K04 A;  4MVR A;  2EIM C;  4I9W A;  4MVM A;  4RUE A;  3IFX A;  2Q69 A;  2Q68 A;  3K08 A;  4MSW C;  1KKD A;  3FB7 C;  1OCZ C;  3RVY A;  3WG7 C;  4MVS A;  3OR7 C;  1J95 A;  2WLJ A; 
#chains in the Genus database with same CATH topology
 1XOU A;  3RBZ A;  4N23 A;  3ABL B;  2RN9 A;  3FYE B;  4TOI A;  1R6T A;  2WPD G;  4JI7 O;  1GRJ A;  4FVM A;  3RT3 C;  3EHB B;  2DOS A;  2QGN A;  3OGC C;  5KMG B;  4QPJ A;  1WAZ A;  2WLK A;  2HVK C;  4Z2W A;  3OMN B;  1V55 B;  3UO2 A;  3DC5 A;  4FMT A;  2E5L B;  2P22 C;  5LXT A;  1G1X B;  2DYS B;  1K5S A;  3CXH F;  2EBO A;  2ZQM A;  1GTO A;  1MSD A;  1IBM O;  4O4H A;  3SPC A;  4LFB O;  3CCS V;  4KHP B;  2YIC A;  3E86 A;  1VEW A;  3U0Z A;  1Z2G A;  4FPP A;  4KP4 A;  1OCR C;  1ZL8 A;  3AG7 A;  1TA8 A;  3ABU A;  1MA1 A;  2ZNJ A;  2M7W A;  1GO3 F;  2Q7H A;  4R50 A;  2Q0A A;  1M93 A;  5IY5 C;  2GTS A;  4EFE A;  4LF8 O;  1VQL V;  1BSM A;  3JAK B;  1G8M A;  2NNU A;  3U11 A;  4NTX A;  1PP9 H;  2F4V O;  5LYJ B;  5EC2 C;  1GAX A;  1Q86 W;  4JAA A;  3ZN1 A;  1P7G A;  4WFB V;  1Z5W A;  1ZSP A;  2IJH A;  2GTA A;  1GN6 A;  2V4D A;  4I4T B;  4DR4 O;  3ZHV A;  1WB7 A;  2ZCE A;  2DQ3 A;  1FXV A;  2HJD A;  3ABM B;  1F51 A;  3FFQ A;  4NXM B;  2P4K A;  3H1L H;  4IL6 Z;  1YSC A;  4LFC O;  5EIB C;  2EIL C;  2IH3 C;  4H33 A;  4JZG A;  5K1X A;  4B3S B;  5KHH A;  2LGQ A;  3TK1 A;  1VQP V;  1O9G A;  1RM1 B;  1Q81 W;  4U3F H;  2GUZ A;  2EX3 A;  3ZRV A;  4DW0 A;  5CA1 B;  5TIS Z;  3ZHR A;  3AG1 C;  4J42 A;  3CME V;  4GYC B;  3WG7 B;  4MTO A;  5K1P A;  1N32 O;  3KG2 A;  1M9N A;  1JA8 A;  1H8H G;  1QBZ A;  5CMU A;  1YHQ V;  1ARO P;  1CP9 A;  4NKG B;  5C8Y B;  4JAV A;  3JAS B;  3VQW A;  1WPB A;  1Q6H A;  2ILM A;  1SC5 B;  3D36 A;  3QTC A;  3CPW U;  1RP3 B;  5BZB A;  2ZR2 A;  4QPK A;  4UV8 A;  3RYF A;  4X62 O;  2UUC O;  3CCV V;  1RFY A;  1TUE B;  4GKJ B;  1PNM A;  3JD3 A;  5J2T B;  2DW4 A;  1SET A;  2BTQ A;  5GON B;  2H3O A;  1HNX B;  3S3W A;  5B1N A;  2OYQ A;  2JJ2 G;  2DQ0 A;  5JJN B;  1BS3 A;  2WLI A;  4DR7 O;  1R73 A;  1W0J G;  3IC9 A;  5J2U A;  2Q7G A;  2E3C A;  4TUY A;  3SJC C;  1VQO V;  1NVP D;  3BY6 A;  5FNV B;  4FIP C;  4FLW A;  3AG4 C;  1KQS U;  4GZR B;  4DR6 B;  2A9H A;  3AG3 C;  3F7V C;  1HNW O;  1YVW A;  3L70 H;  1TGO A;  4G2K A;  3CCM V;  3JAT A;  3TET A;  2N05 A;  4O4L A;  2UXD O;  1R3L C;  4O2B B;  2IBZ H;  4JTC B;  4W4K A;  1LNQ A;  4RQE A;  1SQF A;  3H1J H;  1JPX A;  2MK3 A;  4LF4 B;  2UXC B;  2ITD C;  2YC0 A;  4PI2 A;  2OIE A;  2MW2 B;  4J7K A;  3T4D A;  2X6C A;  3HPL C;  2YDE A;  5DM6 V;  1SQP H;  4DR2 O;  2Z3Y A;  2WLH A;  3AG2 C;  5HFM A;  1W2B U;  3E22 A;  4P2Z A;  1X59 A;  1F23 A;  2B9Z A;  3HKC B;  3KZI Z;  1H2N A;  2PF4 E;  2OTL V;  5DN6 G;  1Y67 A;  3OT7 A;  2NR5 A;  4FLZ A;  4MT8 A;  3T1H B;  1X4T A;  3IJ4 A;  5AG2 A;  4WBN A;  3FKS G;  3K9S A;  4I50 A;  2XAQ A;  3RN4 A;  3SYP A;  2W0F C;  5EBM C;  5JJE B;  2HEP A;  4ZI7 B;  2KSD A;  1ZUQ A;  1K5Q A;  1CPY A;  2P90 A;  4DR3 O;  2EIJ B;  1LUV A;  4RUF A;  4BR6 A;  4X65 B;  1VAR A;  3TCU A;  1W59 A;  4YIO A;  1R3I C;  4DV4 B;  1DTO A;  3L72 H;  1EN5 A;  4I55 A;  4NXN B;  1K33 A;  3CP1 A;  3X2Q C;  1HNZ O;  4LF6 O;  1NTM H;  4C7U A;  2B1I A;  4IYI A;  5FPR A;  4BIO A;  1VQ7 V;  4LF5 O;  4EKW A;  1Y4M A;  1SKV A;  2A06 H;  1K97 A;  1XHZ A;  4ICG A;  5JH7 A;  4DUZ O;  2N74 A;  3BAA A;  1M56 B;  1J5E B;  2Y48 A;  2OTJ V;  2Q9L A;  4JI4 O;  2AHZ A;  1NTK H;  5B1B C;  1JQ0 A;  4LC1 A;  3SR2 C;  4TV8 B;  4CH3 A;  4I0X A;  5B1B B;  1R6K A;  2OIG A;  2YS8 A;  1VQ9 V;  5LGN A;  3K59 A;  1YXB A;  2YXY A;  1XL4 A;  3JD2 A;  3L75 H;  3N2G B;  4X66 B;  4MVR A;  3DSQ A;  3B2E E;  4MVM A;  4MSW C;  4YHH B;  4B3T O;  1N0N A;  3CJH A;  3OR7 C;  2JGD A;  4DV0 O;  3B4S A;  3JAK A;  2LFS A;  4TQF A;  5L3C A;  2F95 B;  3SYA A;  1XI1 A;  3CRM A;  1RM1 C;  1WJZ A;  5B5E Z;  4YHH O;  2CTP A;  4NYK A;  5BMV A;  2CGO A;  3O65 A;  4JI8 B;  4FZ1 A;  3H01 A;  4UFZ A;  2CH7 A;  4K0K O;  4ZKI A;  4ASU G;  4JI5 B;  3QF7 A;  1DF4 A;  4MTG A;  4IIJ B;  5JQG B;  4IYH A;  3W7W A;  4E2L A;  1N8R W;  5JCO A;  3VQX A;  1HR0 O;  5JH7 B;  1WNS A;  4X20 B;  4DUZ B;  4FM0 A;  4FFK A;  1O9H A;  3ZS8 C;  2QTS A;  1D5N A;  5B1A C;  4B3R O;  1GN4 A;  3LDD A;  1I0H A;  4LWS A;  2D3O W;  3G6E V;  3JAW B;  4LH6 A;  1HNZ B;  4LF6 B;  1PNK A;  5BR8 B;  1GM8 A;  3M8A A;  1K4C C;  3QNE A;  1NZ6 A;  2FL4 A;  4DUY B;  3F7Y C;  4BW5 A;  1SQX H;  4DR3 B;  2WWW A;  4HNA A;  2HG5 C;  2ZM6 B;  4O2A A;  1XDC A;  1QLE B;  3RYH B;  2UXB O;  2OCC C;  2ZE5 A;  1IBL O;  4PA9 A;  2EJ7 A;  4WFG A;  2EIM B;  2UU9 O;  3HKB B;  1F4N A;  3HKD B;  3HKE A;  3A0R A;  1XMO O;  3ASN C;  4DV6 B;  1AP6 A;  2EIK C;  1AR4 A;  1YI2 V;  1L8D A;  4PDV A;  4MVU A;  1JJO A;  3ZRW B;  5IJ0 A;  1OCZ C;  3L74 H;  2ZKO A;  2UUB B;  4JI2 O;  2ITC C;  5IYC O;  3H1K H;  5E79 Z;  1H2G A;  1BHA A;  2X6A A;  1H38 A;  5H5N A;  2EIK B;  5B1O A;  3T1C A;  5C93 A;  5KAF Z;  3P3P A;  3VQY A;  2A7W A;  4GT1 A;  3JD4 A;  3ZIA G;  2WLN A;  2FB5 A;  2G38 A;  2CAZ C;  4LBE C;  4WFH A;  2F93 B;  3E35 A;  4H37 A;  3K0D A;  1SQV H;  3JSN A;  2JJ1 G;  3C3T A;  1T5E A;  3ZCC A;  4X64 O;  5LHG A;  5KMG A;  2PUS A;  3OMI B;  4B7K A;  1SER A;  4JI3 O;  4DR6 O;  1R6N A;  2B5U A;  4MS2 A;  3A2F A;  1SQQ H;  3I56 V;  2IW5 A;  3QO5 A;  3TXQ A;  4DYL A;  1YJN V;  1K4D C;  2ADP A;  3K0G A;  3IC7 A;  3SPG A;  5IYZ A;  2V7Q G;  4NVP A;  4UCT A;  4RQF A;  4DR7 B;  3A8T A;  1KC8 W;  3SYQ A;  4J41 A;  4QE7 A;  5F2V O;  3I55 V;  5CA3 A;  2ZT9 B;  3CEI A;  3MHS C;  1M4U A;  4FLX A;  4TV9 A;  3X2Q B;  1EN6 A;  3D3Q A;  4GKJ O;  1I5Y A;  4TSF G;  2ZR3 A;  3HKE B;  3OFN G;  2LW1 A;  3OMA B;  4UCU A;  1K34 A;  5JVD A;  1MG1 A;  4JI3 B;  2DE0 X;  1OCO C;  3TXS A;  3E83 A;  5CB4 A;  4FLT A;  3ABL C;  1JFF A;  3CYO A;  3KCY A;  3JSL A;  5ITZ A;  3B8M A;  2DJV A;  1MZE A;  1KU9 A;  3THO A;  1KUQ A;  4WF9 V;  2WSS G;  2AGA A;  1U96 A;  4F4L A;  1SA0 B;  3OTF A;  3CCE V;  3E8F A;  2LFR A;  1DF5 A;  1KKD A;  2F66 C;  4AQY O;  1SZT A;  4FK5 C;  1PNL A;  3CSX A;  3J7A U;  1N33 O;  3CRC A;  4PA3 A;  3K3W A;  4JI2 B;  2UUB O;  1YTF D;  5BY1 A;  3N2K A;  1NJI W;  2JGD B;  3HB3 B;  2P6J A;  4UVA A;  3FB8 C;  1FAF A;  4ZOL A;  4UB8 Z;  1F7Y A;  3JYC A;  3QO8 A;  4JV5 O;  1DK1 A;  1SES A;  4X1I B;  5C8Y A;  2IM9 A;  1XMO B;  2YIA A;  3OM3 B;  4H0L B;  3CB2 A;  4DR4 B;  3BVO A;  4UVC A;  2E75 B;  5FL7 G;  2H94 A;  3G4S V;  1B6Q A;  2CTR A;  3K5M A;  5IWA B;  3CC4 V;  2GUZ B;  4JYY A;  1IBL B;  3RFR A;  3BPZ A;  4DK0 A;  4BIZ A;  1JR9 A;  2F4V B;  2ZM6 O;  1FXK B;  2PI4 A;  1OCZ B;  4CS4 A;  5KHG A;  3FYI B;  2JK5 C;  3ZMT A;  5LBQ A;  3LSU A;  3CJH B;  3D3I A;  3CD6 V;  1AI4 A;  2HP8 A;  2EUL A;  1S5L Z;  2XHB A;  4D7T A;  4Z1M G;  4LF8 B;  1MNG A;  5KHI A;  1S0V A;  1RPR A;  3ASN B;  1XUQ A;  4ZIB A;  4GX2 A;  3NXS A;  4B3R B;  2Y69 B;  3SDL A;  3AK2 A;  1XRE A;  1IXB A;  2BCC H;  4HNA B;  5FPO A;  1IXM A;  4JI0 O;  3STL C;  1HR0 B;  3VOU A;  1IBM B;  1GM7 A;  5GON A;  2YSU B;  4CC6 A;  2E5L O;  3OEE G;  3ASO B;  2YXH A;  3LDC A;  4J80 A;  3JAT B;  3WFV A;  4OPH A;  3ZRX A;  3APO A;  4PD4 F;  4CS3 A;  4JI7 B;  4JI8 O;  5B3S B;  2W0X A;  4GKK B;  2XTA A;  4EEQ A;  1FFX A;  1K8A W;  1V9P A;  3UM7 A;  3RGB A;  2VRZ A;  4UB6 Z;  5HFL A;  3RYH A;  4FLU A;  1OV9 A;  5IJ0 B;  4G28 B;  4DV0 B;  2ATK C;  4JI6 B;  4DV5 B;  2JEX A;  1KYO F;  4H13 B;  2Y69 C;  4X66 O;  4DV5 O;  4PDL A;  1TUB B;  4XBF A;  5CBH A;  1S76 D;  1NR1 A;  3HKC A;  1XMQ O;  2Q6A A;  1AR1 B;  1OCO B;  2UXX A;  4B7E A;  1XEQ A;  4JI4 B;  4GKK O;  3GVM A;  1VMG A;  2Q4P A;  2HHH B;  1IBK B;  1NKD A;  4ZHQ B;  2YIB D;  4XDL A;  5GW7 A;  4BAY A;  2LP7 A;  1E1Q G;  1SS3 A;  4LF5 B;  4O2A B;  4I5S A;  4K8X A;  4TT3 G;  3STZ C;  4TWK A;  3S3X A;  1UFI A;  3WB2 A;  2KG7 B;  2FYU H;  4IT5 A;  4NXN O;  1B3Q A;  4JI0 B;  3CMA V;  3K79 A;  3JAL B;  2FTK A;  2A3Q A;  1H2L A;  3DTU B;  1S77 D;  4LR3 A;  5B66 Z;  3C90 A;  4HAM A;  4LP8 A;  2OT5 A;  5L3G A;  1Y74 B;  4DV7 O;  1N36 O;  3K5N A;  1NR7 A;  2GDS A;  1TUB A;  4JAS A;  1Y76 A;  3MD0 A;  4UCR A;  1BZK A;  4TV8 A;  4PJ0 Z;  4UCS A;  4LH7 A;  5IWA O;  2A0L A;  1HDJ A;  3CCR V;  4FFB B;  1GN3 A;  1Q7Y W;  3BCC H;  4X1Y A;  1E1R G;  3BRC A;  4DR2 B;  3DC6 A;  4IHJ B;  1BQ0 A;  1Q5O A;  3ETD A;  1J95 A;  2QM4 A;  2Q8V A;  3UKM A;  3A0H Z;  2UXC O;  4LF4 O;  2RDC A;  4RO2 A;  1EZV H;  1XQ8 A;  2EIN C;  1NS1 A;  1NVP B;  1NT2 B;  1Q3E A;  2PTM A;  1I5X A;  2QR4 A;  1N33 B;  2JEU A;  4DRX A;  2QDO A;  2Q5Z A;  2ZE8 A;  1BGY H;  1QR9 A;  4YJ3 B;  1AJP A;  5JVD B;  1XL6 A;  2WLL A;  3H9V A;  4MW8 A;  3KCX A;  1JFF B;  1HNW B;  4B08 A;  1MOF A;  4UV9 A;  1R3J C;  1FJG B;  4GX1 A;  1NH2 B;  1XHX A;  3JAL A;  3G80 A;  2AZ0 A;  3CRR A;  1N34 O;  5H6R A;  1WB8 A;  3LDE A;  1KKC A;  2DMX A;  3E8B A;  1SQG A;  5EZY B;  1VF6 A;  1YTF B;  4JF3 A;  1FXH A;  3TJT A;  2YEV B;  2IJJ A;  2UUC B;  4X62 B;  4JGS A;  3NR7 A;  3A0B Z;  2BE3 A;  1N34 B;  2OCH A;  4KL1 A;  1XNR O;  4CH6 A;  1FJG O;  3ZHT A;  3BHP A;  1N32 B;  1COW G;  2FKX A;  2IJI A;  3JD1 A;  1Q8I A;  1K9M W;  4A5U B;  2ZNI A;  3FB7 C;  2D2C B;  4X64 B;  2X7R B;  2ZXW C;  3CCQ V;  4WFF A;  3RVZ A;  1JCH A;  1G4Y B;  4QIW F;  2ARH A;  4I4T A;  3UCS C;  2Q67 A;  4MVO A;  4B3S O;  4FLV A;  2OCC B;  3MHH C;  1MSW D;  4EB6 A;  5J9P C;  4LFC B;  4QGP A;  3WB0 A;  1R1B A;  5CN0 A;  2XUM A;  2GV9 A;  1M5I A;  2RNB A;  3ZED A;  1I94 B;  3SYC A;  2ZDI C;  3AG1 B;  4CH4 A;  1PKX A;  4WFA V;  5CA0 B;  3RWR D;  1M57 C;  3OEH G;  5B1A B;  2CDY A;  1FXK C;  2UU9 B;  4QNH B;  1FFX B;  1YIT V;  5CBG A;  1OJH A;  4NTW A;  2CGN A;  2QM8 A;  2QWN B;  1AI6 A;  4AI8 A;  1DGS A;  4B3M B;  1QNM A;  4QJF B;  4U3J A;  5GTH Z;  3DGE A;  3OD4 A;  3RYC A;  1PPJ H;  2XAJ A;  5IYB O;  1D2D A;  3AG2 B;  3CX5 F;  2ODM A;  2QWP B;  4TV9 B;  3OAA G;  2M6Y A;  1H8E G;  4J7J A;  5BR8 O;  4LFB B;  1L0L H;  1BL8 A;  4WCE V;  3AG3 B;  5FNV A;  3OR6 C;  1GM9 A;  3CCU V;  4FM2 A;  2EZO A;  3OE7 G;  2VQE O;  5CB4 B;  4ZHQ A;  4NTY A;  3L9D A;  2DWD C;  5ITZ B;  2JIZ G;  4TUY B;  4O4H B;  2HVJ C;  1RSO B;  2HHH O;  3IFX A;  1PL4 A;  1D5A A;  1E79 G;  1VIB A;  3JAW A;  5A9G A;  4XDJ A;  4LCU C;  3GWO A;  4JPR A;  3J81 N;  4K0K B;  3GB7 C;  2QM7 A;  3T4Z A;  2QSA A;  1AI5 A;  3ML0 A;  1Z5V A;  1AI7 A;  2DN9 A;  4OPA A;  4JI6 O;  2O57 A;  1OZ0 A;  1SA0 A;  1ZAU A;  3FD9 A;  5CBF A;  2Q0O C;  4PI0 A;  3ZN0 A;  2VWK A;  4X1I A;  1NQT A;  1IUR A;  3T1Y B;  2HFE C;  1Y76 B;  2R9R B;  4I50 B;  5LA6 B;  3SPH A;  1FYJ A;  2P5O A;  1HWY A;  5JWP A;  2P7T C;  4YY3 B;  1BE3 H;  4DV2 O;  3E8H A;  3N2K B;  5DEC A;  2ZIN A;  2CK3 G;  2W6J G;  3FAV A;  3PJS K;  1BHB A;  2QKS A;  2KB1 A;  5D5P A;  2IU3 A;  4LF7 O;  3K58 A;  2PGG A;  5KLV H;  2WAM A;  1N0J A;  2FML A;  3ABT A;  1QU7 A;  1JMK C;  3CE2 A;  4NR1 A;  2NLJ C;  4KXR A;  4EFB A;  1KP3 A;  4JI1 O;  1B06 A;  3ASO C;  4MTX A;  2GHY A;  3BA8 A;  3FB5 C;  2BOB C;  5B3S C;  1XNQ O;  5LMN O;  4DV4 O;  4E4E A;  1H2K A;  2ETN A;  4R6Z A;  4D6T H;  3TGU H;  4J7Z A;  2QKA A;  5IJ9 B;  2X0L A;  4J9Z B;  3ZMS A;  5IYD O;  1THZ A;  5JJJ B;  2LJ2 A;  1EM1 A;  5LA6 A;  1S5H C;  1PL0 A;  1AJQ A;  4I9W A;  3JAS A;  3T1H O;  1K3E A;  2LQT A;  1KEC A;  5EC1 C;  4IGG A;  4DRX B;  4JV5 B;  3L73 H;  1VQN V;  4YJ3 A;  3OGI B;  5H6Q A;  1N4C A;  1JVM A;  2LW7 A;  4GCZ A;  3D36 C;  2WLI B;  1LUW A;  5H9C A;  2ZD9 A;  2BTQ B;  1BQZ A;  4O4J B;  4R7C A;  3JAR B;  3RW0 A;  1JJ2 U;  4AQY B;  1FFT B;  4DV1 B;  3ETE A;  2GBO A;  1SZX A;  3N2G A;  4J10 A;  2AZ2 A;  5JQG A;  3K9A A;  3ETQ A;  1VP7 A;  1YZB A;  3M7M X;  2JDI G;  3OTO O;  2PI5 A;  1AIL A;  3RYI B;  1HP8 A;  4U7O A;  2WA4 A;  3UT5 B;  2R9I A;  4RAI A;  1GN2 A;  5E1A C;  5J2U B;  4LFA B;  2CE4 A;  1K7D A;  4PEL A;  2R72 A;  3U10 A;  3OUF A;  5BXZ A;  3T2M A;  2YID A;  1V55 C;  1OCC C;  4CBC A;  4MVQ A;  1R3K C;  1TVK A;  1OCR B;  2ZE7 A;  3GWK C;  3LSQ A;  3QG5 A;  1CEZ A;  3LUT B;  1W0K G;  3IGA C;  4JYA B;  5LL6 Y;  1IDS A;  5LGU A;  4X20 A;  4O4J A;  1HNX O;  2KG7 A;  2Q73 A;  4MW3 A;  1US6 A;  5CA0 A;  1V54 B;  3BA9 A;  3E89 A;  1I08 A;  2KKW A;  4HYO A;  4DXW A;  1ZL8 B;  2JS5 A;  4Z1V A;  3K04 A;  3ETG A;  2IJK A;  1YJW V;  5KA5 A;  2Y4T A;  1AR5 A;  1AVM A;  1FXK A;  1YIJ V;  3ZHS A;  5EK0 A;  1OCC B;  2QKC A;  3ZJZ A;  2YUA A;  4K3A A;  1EBO A;  3E22 B;  2EIL B;  5KA6 A;  2L35 A;  4L8J A;  4J11 A;  4QE9 A;  1FS0 G;  2PYL A;  1JX9 A;  1ORQ C;  1AP5 A;  4HBN A;  4PA7 A;  3K06 A;  4YJ2 B;  4JYC A;  3ZX6 A;  3G71 V;  3R65 A;  4GX0 A;  2DYR B;  3QVN A;  2XND G;  4I9Q A;  4ZI7 A;  4FJC C;  3AK1 A;  1YJ9 V;  4DV3 B;  1P84 F;  1ENV A;  5KUM A;  4GX5 A;  5KX5 A;  1GMG A;  3SPI A;  4DV6 O;  4DW1 A;  2W6I G;  2YIB A;  5EYP B;  1Q43 A;  1YCI A;  5D5Q A;  1VQ6 V;  2DYS C;  3Q4H B;  3RYF B;  1K73 W;  4R8C A;  5IYZ B;  1KB9 F;  4RWU A;  2UXB B;  4O4I B;  5EIB D;  2CUG A;  1XBL A;  5A2Q N;  2EIJ C;  4XDK A;  2E76 B;  3L71 H;  3OTO B;  1M57 B;  4JYB A;  4F6E A;  2BTO A;  3AG4 B;  3CS5 A;  4DUY O;  1ZTE A;  3H1I H;  3K5O A;  2RJZ A;  2F1M A;  2NN4 A;  3LNM B;  2ZIM A;  1I7F A;  5LMU O;  1WA8 B;  4DV1 O;  1VQ8 V;  5L3B A;  2OWO A;  5GTI Z;  4HZ3 A;  4DO2 A;  1UJW B;  5BMV B;  1KMI Z;  4L87 A;  5EBW C;  4Q6G A;  1QLN A;  1WPX A;  4GLX A;  4CH5 A;  4KHP O;  3ZHQ A;  2EIM C;  1RPO A;  2Q69 A;  2Q68 A;  4IIJ A;  4MVS A;  4OX9 B;  3DXR A;  2P67 A;  5LP6 B;  1IVS A;  4JI5 O;  2HKO A;  2VQF B;  3BFR A;  4JAU A;  2XAF A;  4D7S A;  5EBL C;  2Y0P A;  1QHT A;  3Q4H A;  4LWS B;  4PHZ A;  3SGI A;  1F4M A;  4CC5 A;  1LR1 A;  3BAB A;  3ABK C;  4B3T B;  3B09 A;  5L3F A;  3M99 B;  4LNU B;  2YI9 A;  2XAH A;  4UUJ C;  2A79 B;  1MZF A;  1Q6U A;  1SF9 A;  1XNQ B;  2PY5 A;  4X88 A;  3JCZ A;  3PN1 A;  1Y6X A;  1URF A;  3FX7 A;  3CCL V;  2ZDI A;  1XIL A;  3LSS A;  1Y74 A;  1J5E O;  1QQC A;  2BSK B;  2CTQ A;  2DWE C;  1S3J A;  1B04 A;  1DLB A;  4LF9 O;  1L0N H;  3JAR A;  1CXZ B;  3CRQ A;  5IJ9 A;  1P4R A;  4WFE A;  2UXN A;  2K1E A;  1WP8 A;  3HKB A;  4DV2 B;  3JAM N;  2B1G A;  4CZZ A;  2UUA O;  5KHK A;  4UCO A;  5KHJ A;  4IHJ A;  1M56 C;  3ZMU A;  4X65 O;  3O9O A;  1M90 W;  3T1Y O;  4W4L A;  1Q82 W;  4UCV A;  2QJ1 A;  5L3E A;  3UT5 A;  3BEH A;  2L6L A;  3WB1 A;  2EJR A;  4AIL C;  1YF2 A;  4LNU A;  2ZIO A;  1VQ5 V;  3K08 A;  3P32 A;  1OHH G;  3WG7 C;  4DR5 O;  2JGU A;  2VQF O;  1Q90 D;  4OX9 O;  2Y4U A;  2KQX A;  4I55 B;  4ZBM A;  3AEI A;  3ZMV A;  2BOC C;  2LO1 A;  1KD1 W;  3SJA C;  2PZS A;  2BSK A;  4GUN A;  1ROP A;  1VF6 C;  2VQE B;  3B40 A;  3ABK B;  3MDS A;  4I0X B;  1VF5 B;  2JS3 A;  1HW7 A;  3G67 A;  1FPO A;  2JRI A;  4X89 A;  3KKY A;  4MTF A;  2VWJ A;  4J9Y B;  5LMU B;  1WLE A;  4PA6 A;  1QLE C;  4NB5 A;  2P06 A;  2HLD G;  4PDR A;  4F6R A;  2UXD B;  1VF7 A;  2X6B A;  4TQD A;  1P49 A;  3SYO A;  2H8P C;  4H44 B;  3APQ A;  1YEW A;  4B3M O;  3H1H H;  3CC7 V;  1MAB G;  1A32 A;  3K57 A;  3EVK A;  3AK3 A;  4PA4 A;  4U7N A;  2VS0 A;  1S5J A;  5LOV B;  3FB6 C;  4YXW G;  1QR8 A;  1GKF A;  2K9P A;  4DR1 O;  4OGQ B;  5IE9 A;  4UXN A;  1BCC H;  3W7U A;  4DV3 O;  3QO7 A;  1TAE A;  1S72 V;  3CCJ V;  1KP2 A;  4G27 B;  1NBM G;  1QVF U;  3F5W C;  2QWO B;  5KUK A;  1I94 O;  2HJF C;  5H2F Z;  4JZ2 A;  3JD0 A;  2ZXW B;  4O4L B;  3SJB C;  1NU1 H;  2IU0 A;  1EFR G;  4O2B A;  1BT8 A;  5EYP A;  2Z0A A;  3F5T A;  4FM1 A;  4BWA A;  2Q7E A;  3EFF K;  1UPG A;  4FZ0 A;  4X9Q A;  2QEX V;  4JTA B;  2RMK B;  2WA3 A;  3UQ8 A;  3ZHU A;  2RCV A;  4O4I A;  3UO3 A;  2F43 G;  4PDM A;  1GH6 A;  1IZ3 A;  1PM9 A;  4MVZ A;  1ZX3 A;  1ZWI C;  1PV0 A;  2ADQ B;  2XAS A;  4PV1 B;  1QVG U;  5KAI Z;  3SPJ A;  4WBN B;  5LXT B;  4U3J B;  3RYC B;  3B77 A;  1WA8 A;  1XNR B;  3CHX A;  3HKD A;  1BMF G;  1K92 A;  3HR0 A;  4FFB A;  5IT9 N;  5L3D A;  4X1K B;  2WLL B;  4CS2 A;  4JYA O;  4I7Z B;  3LNN A;  3G6B A;  3W7X A;  2IH1 C;  4NXM O;  2F23 A;  2ZE6 A;  3ICX A;  1GK9 A;  3RYI A;  3ZRW A;  1JOY A;  3E8G A;  5LHH A;  1Q6I A;  2YI8 A;  5LOV A;  5JCO C;  1VQM V;  3N27 A;  5LGT A;  2AXT Z;  3J80 N;  2WLM A;  4LFA O;  3CWB H;  2Z5U A;  1FKA O;  1V54 C;  4DR1 B;  5CA1 A;  3P3N A;  1M1K W;  3MAQ A;  1TVK B;  2LGW A;  2JVD A;  2EIN B;  4P9P A;  4K35 A;  1SRY A;  2YEV A;  1FD9 A;  1EZJ A;  2R9A A;  2QE7 G;  3DXR B;  5LP6 A;  3OUS A;  3D8C A;  1WN7 A;  4Q20 A;  5EZY A;  2EZP A;  5LHI A;  1QCE A;  2QWR B;  4X8A A;  1H2M A;  1NH2 D;  3FAV B;  4RUE A;  5DED A;  3OW2 U;  4AHC A;  3RVY A;  2XAG A;  1VQK V;  2R70 A;  1PD3 A;  5J2T A;  1AB3 A;  4P30 A;  3W7S A;  1KBH A;  3CRA A;  3B8N A;  3ZRS A;  3WU2 Z;  4DK1 A;  3W7T A;  4OXS A;  4BIU A;  3ZBH A;  1ZLZ A;  3ZMZ A;  2CTW A;  2YXL A;  2P4V A;  3EXA A;  2CH7 B;  3CC2 V;  2E74 B;  5IY5 B;  4BW9 A;  3P30 A;  4YJ2 A;  4X1K A;  3SJQ C;  3VBB A;  1EN4 A;  4DR5 B;  2QTO A;  3K5L A;  2RQ6 A;  4DV7 B;  1N36 B;  2GSM B;  3JCU Z;  4JTD B;  2AW9 A;  5LMN B;  2PYJ A;  4KUM A;  3VQV A;  1Y66 A;  1VQ4 V;  2Y0I A;  3C3S A;  5KX5 B;  4N21 A;  2V1D A;  4JI1 B;  3I5D A;  4EB6 B;  1AJN A;  2AHY A;  1NTZ H;  2UUA B;  2DYR C;  3IAY A;  1IX9 A;  1P7B A;  1MMM A;  1SQB H;  3CXC U;  1G6U A;  3K03 A;  4LF7 B;  5FLX N;  4P9O A;  1U97 A;  4LF9 B;  4ZOL B;  3ABM C;  4YIP A;  4YY3 O;  2QA4 V;  1YDX A;  1IBK O;  1NI8 A;  5LYJ A;  2N04 A;  1H2S B;  3E2E A;  3R66 A;  4KFM A;  1XMQ B;  1WP7 A;  2XOK G;  4ABM A;  5IDJ A;  2C2A A;  4F6R B;  2XT9 A;  4K8Z A;  4FLY A;  4X1Y B;  1RSO A;  2HR3 A;  2QWQ B;  4UVB A;  5LP6 C;  1L1F A;  2WLJ A; 
#chains in the Genus database with same CATH homology
 2X7R B;  2ZXW C;  2ITC C;  3CCQ V;  4WFF A;  3RVZ A;  1JCH A;  1G4Y B;  3RBZ A;  5IYC O;  1H2G A;  2P67 A;  4QIW F;  4N23 A;  1BHA A;  3ABL B;  2X6A A;  1H38 A;  3FYE B;  2EIK B;  5B1O A;  2HKO A;  4JAU A;  2XAF A;  2Q67 A;  3T1C A;  5C93 A;  5EBL C;  4MVO A;  2WPD G;  4GT1 A;  3JD4 A;  2OCC B;  3MHH C;  1MSW D;  3ZIA G;  3EHB B;  1F4M A;  5J9P C;  3OGC C;  2WLN A;  4QPJ A;  4LBE C;  4WFH A;  3E35 A;  4H37 A;  3K0D A;  2WLK A;  2HVK C;  5CN0 A;  2JJ1 G;  3OMN B;  1V55 B;  3ZCC A;  3ABK C;  4FMT A;  5LHG A;  3OMI B;  3SYC A;  5L3F A;  1SER A;  2DYS B;  1K5S A;  2ZDI C;  2EBO A;  2ZQM A;  1GTO A;  3M99 B;  3SPC A;  2XAH A;  3CCS V;  4UUJ C;  1R6N A;  2A79 B;  3E86 A;  2B5U A;  4MS2 A;  3AG1 B;  3I56 V;  4FPP A;  2IW5 A;  4KP4 A;  1OCR C;  4X88 A;  1PKX A;  3ABU A;  3QO5 A;  4WFA V;  1YJN V;  1K4D C;  3JCZ A;  2M7W A;  1GO3 F;  1M57 C;  3OEH G;  4R50 A;  5B1A B;  3K0G A;  3CCL V;  1FXK C;  3IC7 A;  2ZDI A;  3SPG A;  5IY5 C;  4QNH B;  2V7Q G;  3LSS A;  4RQF A;  1YIT V;  5CBG A;  1KC8 W;  1VQL V;  3SYQ A;  4QE7 A;  3I55 V;  1G8M A;  2NNU A;  2QM8 A;  2DWE C;  1S3J A;  5CA3 A;  1DLB A;  1AI6 A;  3MHS C;  3X2Q B;  4QJF B;  3DGE A;  5EC2 C;  2XAJ A;  5IYB O;  1P4R A;  4WFE A;  1Q86 W;  3AG2 B;  2UXN A;  3ZN1 A;  2K1E A;  1I5Y A;  4TSF G;  2ZR3 A;  4WFB V;  2B1G A;  3OFN G;  4CZZ A;  3OAA G;  1H8E G;  3OMA B;  1K34 A;  2IJH A;  1BL8 A;  1MG1 A;  1OCO C;  4WCE V;  3AG3 B;  1M56 C;  3E83 A;  3OR6 C;  3ZMU A;  3ABL C;  1M90 W;  2DQ3 A;  1FXV A;  3CYO A;  1Q82 W;  3B8M A;  1GM9 A;  3CCU V;  2EZO A;  3ABM B;  1F51 A;  3OE7 G;  5L3E A;  4WF9 V;  2WSS G;  3BEH A;  1YSC A;  2EJR A;  2DWD C;  4F4L A;  2JIZ G;  2EIL C;  2IH3 C;  4H33 A;  3CCE V;  3E8F A;  2LFR A;  2HVJ C;  1DF5 A;  3IFX A;  1VQ5 V;  3K08 A;  3P32 A;  3TK1 A;  1VQP V;  1E79 G;  1OHH G;  1KKD A;  3WG7 C;  1SZT A;  4XDJ A;  4FK5 C;  4LCU C;  1PNL A;  3GWO A;  4JPR A;  4PA3 A;  1RM1 B;  3GB7 C;  2QM7 A;  1Q81 W;  3K3W A;  4ZBM A;  3AEI A;  3ZMV A;  3T4Z A;  1YTF D;  3ZRV A;  1NJI W;  1AI5 A;  3HB3 B;  3ML0 A;  2BOC C;  2P6J A;  1AI7 A;  3AG1 C;  4UVA A;  3CME V;  1KD1 W;  3WG7 B;  4MTO A;  3FB8 C;  3JYC A;  3KG2 A;  1OZ0 A;  1M9N A;  1H8H G;  1QBZ A;  1ROP A;  5CMU A;  5CBF A;  1YHQ V;  1ARO P;  1CP9 A;  3QO8 A;  3ZN0 A;  1SES A;  3ABK B;  1NQT A;  4JAV A;  2HFE C;  3OM3 B;  3D36 A;  2R9R B;  4UVC A;  4X89 A;  4MTF A;  5FL7 G;  3SPH A;  4J9Y B;  3CPW U;  2H94 A;  5BZB A;  3G4S V;  2ZR2 A;  1WLE A;  4QPK A;  4UV8 A;  1B6Q A;  4PA6 A;  1HWY A;  1QLE C;  2P7T C;  3CC4 V;  3E8H A;  3CCV V;  2HLD G;  4PDR A;  2CK3 G;  1TUE B;  4BIZ A;  2X6B A;  2W6J G;  1PNM A;  2H8P C;  3JD3 A;  3SYO A;  2DW4 A;  3PJS K;  1SET A;  1BHB A;  2QKS A;  1FXK B;  2PI4 A;  2KB1 A;  1OCZ B;  2IU3 A;  3FYI B;  2JK5 C;  3CC7 V;  3ZMT A;  5LBQ A;  5B1N A;  1MAB G;  3D3I A;  3CD6 V;  2JJ2 G;  1AI4 A;  2DQ0 A;  2WAM A;  4PA4 A;  4U7N A;  3ABT A;  2WLI A;  4Z1M G;  1R73 A;  1W0J G;  3FB6 C;  4YXW G;  1QR8 A;  2NLJ C;  1S0V A;  1RPR A;  1GKF A;  1VQO V;  3ASN B;  1KP3 A;  4GX2 A;  1NVP D;  3ASO C;  3NXS A;  3BY6 A;  4MTX A;  2GHY A;  2Y69 B;  3FB5 C;  4UXN A;  2BOB C;  5B3S C;  4FIP C;  3W7U A;  3AG4 C;  3QO7 A;  1S72 V;  1IXM A;  3CCJ V;  1KQS U;  1KP2 A;  2A9H A;  3AG3 C;  3F7V C;  3STL C;  4G27 B;  3VOU A;  1NBM G;  1GM7 A;  3F5W C;  4G2K A;  5KUK A;  3CCM V;  1QVF U;  2YSU B;  3TET A;  2HJF C;  4R6Z A;  3OEE G;  3ASO B;  3JD0 A;  2ZXW B;  3LDC A;  2IU0 A;  1EFR G;  3WFV A;  1R3L C;  2X0L A;  4J9Z B;  3ZMS A;  3EFF K;  4JTC B;  5IYD O;  1THZ A;  1LNQ A;  3ZRX A;  4RQE A;  2QEX V;  4JTA B;  1S5H C;  1PL0 A;  1AJQ A;  4I9W A;  5B3S B;  1JPX A;  1K8A W;  2MK3 A;  1K3E A;  3UM7 A;  2F43 G;  1KEC A;  2ITD C;  5EC1 C;  5HFL A;  4PDM A;  1VQN V;  4MVZ A;  1ZWI C;  4G28 B;  5H6Q A;  3T4D A;  2XAS A;  2X6C A;  2ATK C;  3HPL C;  5DM6 V;  1JVM A;  4GCZ A;  2JEX A;  2WLI B;  1QVG U;  5H9C A;  2Z3Y A;  2Y69 C;  2ZD9 A;  2WLH A;  3AG2 C;  5HFM A;  1W2B U;  4PDL A;  3SPJ A;  4XBF A;  4P2Z A;  4R7C A;  5CBH A;  1S76 D;  1F23 A;  1NR1 A;  2OTL V;  5DN6 G;  2Q6A A;  3B77 A;  1AR1 B;  1OCO B;  2UXX A;  4MT8 A;  3RW0 A;  1JJ2 U;  1BMF G;  1K92 A;  3FKS G;  1FFT B;  2XAQ A;  3ETE A;  5L3D A;  3SYP A;  2W0F C;  5EBM C;  1NKD A;  2WLL B;  3K9A A;  4XDL A;  3W7X A;  5GW7 A;  2IH1 C;  4BAY A;  1K5Q A;  2LP7 A;  1E1Q G;  2JDI G;  2PI5 A;  1CPY A;  1GK9 A;  4I5S A;  3ZRW A;  2P90 A;  4U7O A;  3E8G A;  4TT3 G;  1JOY A;  3STZ C;  2R9I A;  5LHH A;  4TWK A;  4RAI A;  2EIJ B;  4RUF A;  5E1A C;  3TCU A;  1R3I C;  1K7D A;  4PEL A;  1VQM V;  3OUF A;  3T2M A;  1DTO A;  5LGT A;  3CMA V;  1V55 C;  3K79 A;  2FTK A;  1OCC C;  4CBC A;  2WLM A;  1K33 A;  1R3K C;  3CP1 A;  2Z5U A;  4MVQ A;  1V54 C;  3DTU B;  3X2Q C;  1S77 D;  1OCR B;  3LSQ A;  2B1I A;  1VQ7 V;  4EKW A;  1CEZ A;  3LUT B;  1W0K G;  3IGA C;  1M1K W;  4HAM A;  1Y4M A;  4LP8 A;  2OT5 A;  2EIN B;  1K97 A;  5L3G A;  4P9P A;  5LGU A;  1SRY A;  2YEV A;  1M56 B;  2Y48 A;  2OTJ V;  1NR7 A;  2AHZ A;  4JAS A;  3MD0 A;  5B1B C;  1EZJ A;  4MW3 A;  1JQ0 A;  4LC1 A;  2QE7 G;  3OUS A;  5B1B B;  1R6K A;  1V54 B;  1VQ9 V;  4Q20 A;  3E89 A;  4HYO A;  2EZP A;  2A0L A;  5LGN A;  4DXW A;  1QCE A;  5LHI A;  3CCR V;  1XL4 A;  3JD2 A;  4X8A A;  3K04 A;  1Q7Y W;  4MVR A;  1NH2 D;  3ETG A;  2IJK A;  1E1R G;  1YJW V;  4MVM A;  4RUE A;  5KA5 A;  3OW2 U;  4MSW C;  3RVY A;  2XAG A;  3ETD A;  3OR7 C;  1J95 A;  1VQK V;  1PD3 A;  1FXK A;  1YIJ V;  4P30 A;  5EK0 A;  1OCC B;  3W7S A;  3UKM A;  2LFS A;  5L3C A;  3B8N A;  3SYA A;  3ZJZ A;  3ZRS A;  1RM1 C;  1EBO A;  4RO2 A;  2EIL B;  3W7T A;  5KA6 A;  2EIN C;  4OXS A;  4BIU A;  1NVP B;  3ZMZ A;  1I5X A;  4QE9 A;  1FS0 G;  3H01 A;  1JX9 A;  1ORQ C;  3CC2 V;  5IY5 B;  4ZKI A;  4PA7 A;  4ASU G;  2JEU A;  1DF4 A;  3K06 A;  4JYC A;  4MTG A;  3G71 V;  3P30 A;  1QR9 A;  3VBB A;  3SJQ C;  1AJP A;  1XL6 A;  2WLL A;  3R65 A;  4GX0 A;  2DYR B;  4MW8 A;  2XND G;  2QTO A;  3W7W A;  4E2L A;  1N8R W;  2GSM B;  1MOF A;  4FJC C;  4JTD B;  1YJ9 V;  4KUM A;  4UV9 A;  1R3J C;  1ENV A;  1Y66 A;  5KUM A;  1VQ4 V;  4GX5 A;  5B1A C;  1GMG A;  4GX1 A;  3SPI A;  4N21 A;  2V1D A;  1NH2 B;  2W6I G;  3LDD A;  2D3O W;  3G6E V;  1AJN A;  2AHY A;  1VQ6 V;  1PNK A;  5H6R A;  2DYS C;  1GM8 A;  3LDE A;  1K4C C;  3QNE A;  2DYR C;  1P7B A;  3E8B A;  3CXC U;  3F7Y C;  4BW5 A;  1K73 W;  4R8C A;  3K03 A;  1YTF B;  2WWW A;  4JF3 A;  2HG5 C;  1FXH A;  4P9O A;  2EIJ C;  1QLE B;  2YEV B;  4XDK A;  1M57 B;  4JYB A;  2OCC C;  3ABM C;  3AG4 B;  2IJJ A;  2QA4 V;  4JGS A;  4PA9 A;  4WFG A;  3LNM B;  1VQ8 V;  2EIM B;  5L3B A;  1F4N A;  3A0R A;  4HZ3 A;  3E2E A;  3ASN C;  4DO2 A;  1UJW B;  4KFM A;  4L87 A;  5EBW C;  1QLN A;  2XOK G;  1WPX A;  5IDJ A;  2C2A A;  2EIK C;  1YI2 V;  4PDV A;  1COW G;  4MVU A;  2EIM C;  1RPO A;  2IJI A;  3ZRW B;  2HR3 A;  3JD1 A;  2Q69 A;  2Q68 A;  1K9M W;  3FB7 C;  4UVB A;  1OCZ C;  1L1F A;  4MVS A;  2WLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...