3E83A

Crystal structure of the the open nak channel pore
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e83A00
1QLEC 4MTOA 2WLLB 3IFXA 2X6BA 4MS2A 4X89A 4MVSA 4J9YB 3RVZA 5EC1C 3E8FA 1R3IC 4H33A 3LUTB 3BEHA 2HFEC 4JTAB 2H8PC 4PA9A 4WFFA 2WLMA 4LP8A 5B3SC 3HPLC 1ORQC 1OCCC 2JK5C 4MW8A 3AG3C 2ZXWC 4MVRA 5EBLC 4BW5A 4LBEC 4HYOA 3F7VC 5B1AC 3OUSA 3SYCA 3SYOA 1XL4A 4DXWA 3LDCA 4GX2A 2Q69A 2ZD9A 3K08A 3ZRSA 3STLC 4P9PA 3AG4C 2EILC 2IH3C 2Q67A 3RVYA 2QTOA 1G4YB 2WLJA 4KFMA 4XDKA 4I9WA 3ZJZA 2WLHA 2OCCC 4RUEA 3JYCA 4ZBMA 4EKWA 3PJSK 4MTGA 4JTCB 4PA3A 3SPIA 2X6CA 3ASOC 4J9ZB 4XDLA 2A9HA 4CBCA 5J9PC 1V54C 1S5HC 4WFHA 1OCRC 3ABKC 3SPCA 4X8AA 3SYQA 4X88A 2X6AA 2Q6AA 5EC2C 4GX1A 4PA4A 4PA7A 1LNQA 2IH1C 2ATKC 3EFFK 4TWKA 4R50A 2AHZA 2KB1A 2EINC 2HVKC 3UKMA 2W0FC 1K4DC 3T1CA 2EIKC 4P9OA 4WFEA 3ABLC 3R65A 2WLIA 4OXSA 4PA6A 5EK0A 3RW0A 4JTDB 2HVJC 2BOBC 3T2MA 2K1EA 3T4ZA 5KUKA 1BL8A 4PDRA 4RO2A 4MVZA 5B1BC 1KKDA 2ITCC 3F7YC 3FB6C 3E8BA 4GX0A 2R9RB 4QNHB 3E8HA 3IGAC 2WLNA 3ABMC 3SJQC 5CBHA 4QE7A 3WG7C 1M56C 3VOUA 3E83A 3FB5C 3OR7C 4QE9A 1ZWIC 5IY5C 1M57C 2DYRC 1R3LC 1R3KC 3AG2C 3AG1C 4MTFA 4UUJC 3K04A 4R6ZA 3KG2A 3TETA 5BZBA 4MVOA 2QKSA 3FB8C 3E86A 3SYPA 3TCUA 3T4DA 4MVQA 4RAIA 3ASNC 3X2QC 4R8CA 2YEVA 5CBGA 1OCOC 1V55C 3LDDA 2A79B 4PDMA 2DWEC 5E1AC 4PDVA 3K0DA 1J95A 4LCUC 2DYSC 3OUFA 3K0GA 2P7TC 3K03A 3OR6C 5KUMA 2HJFC 1XL6A 2HG5C 3LDEA 2WLKA 1K4CC 4G28B 3FB7C 3E8GA 1P7BA 3F5WC 3SPGA 5CBFA 2WLIB 1OCZC 2EIJC 3STZC 2A0LA 3K06A 4GX5A 4P30A 2EIMC 1JVMA 3GB7C 4P2ZA 2Y69C 5EBMC 2WLLA 3SPJA 2BOCC 3UM7A 4HZ3A 3OGCC 4WFGA 4G27B 4H37A 5EBWC 3SPHA 4MVMA 3SYAA 2NLJC 4RUFA 1R3JC 2Q68A 4MSWC 4MVUA 4MW3A 4PDLA 2ITDC 4R7CA 4XDJA 3RBZA 3LNMB 4F4LA 2DWDC 2AHYA 3E89A
chains in the Genus database with same CATH superfamily
1O9GA 5JCOA 2GBOA 4CZZA 3ZN1A 4DK0A 4J9YB 3ZN0A 1KKCA 4B3SO 4DV2O 1G6UA 2B1GA 1TAEA 1M93A 3VQVA 1BGYH 1QNMA 3SYCA 5IJ0A 4A5UB 2RNBA 4TUYA 1KD1W 1XNRB 1BMFG 3AG4C 1YI2V 5JH7A 1THZA 4ZBMA 4XDLA 2PYJA 1OCOB 3ZCCA 3CRCA 2YI8A 2DW4A 2W6JG 1R1BA 2LW1A 1KBHA 2P4VA 4R50A 5B1NA 3ZRWB 3JD3A 4JV5B 3T1YB 2Q73A 5L3DA 3OTFA 1AJQA 3E35A 3R65A 4YJ3B 3CCVV 2HVJC 4ZI7A 4O4IA 4X64B 1BL8A 3CXHF 3F7YC 4PD4F 4X66O 3APQA 4YJ2B 1M56C 3BRCA 2UXXA 2RJZA 4FLTA 3E83A 5IY5C 4GCZA 3K04A 1WPXA 4DUYO 3ASNC 4X1IA 1GK9A 3K9AA 1VQ9V 1WPBA 1Z2GA 2YIBA 1Q3EA 4J7ZA 5F2VO 4EFBA 3APOA 1NJIW 3K0GA 1MOFA 2QTSA 4LH7A 2IJJA 2WLKA 2RCVA 1MZFA 2NNUA 3CJHA 4IYIA 3L74H 3HKBB 3CRQA 2VWKA 4DR6O 4MVMA 2Q68A 1X59A 2EJRA 3I55V 2YIAA 2B5UA 3OTOB 1IDSA 4ZIBA 2L6LA 2F1MA 4MVSA 3KCYA 3UT5A 2RN9A 1HNZB 3L70H 3HKDB 2FB5A 2IJKA 3C3TA 4LF9O 1EZVH 4YIPA 1N36O 3BCCH 1GN4A 4I50A 1P84F 1NTMH 2HEPA 4F6EA 1S5LZ 3ZX6A 1R6TA 2BCCH 4B3MB 2P67A 4H44B 3RGBA 5CA1B 1HNWB 1Q6UA 1SQBH 4CH5A 3BAAA 3D3IA 5LXTA 3U0ZA 1S5HC 2XOKG 1QBZA 1S5JA 1H2NA 1NZ6A 4OGQB 3RN4A 3WFVA 1AP6A 2Z5UA 1XMOO 1FS0G 4DW0A 1QR8A 5KX5B 5JJJB 1ZX3A 3JALB 3SJCC 1YF2A 4OX9O 1MA1A 5FPOA 5BMVA 3RYFA 1Q7YW 3D3QA 2DJVA 3CC7V 2IJIA 3F5TA 1QLEB 3IC9A 1AILA 2YIBD 3OR7C 5CB4A 1R3LC 4U3JB 4ABMA 3FB8C 3E86A 4IHJA 1GKFA 4PHZA 1I7FA 1Q90D 3X2QC 2AZ0A 1OCOC 3AG3B 1OZ0A 5IYCO 1GM7A 3ABUA 3VBBA 2A06H 3CCUV 3ZMSA 1R6NA 2QM7A 1WNSA 1U96A 1R73A 4TT3G 4AI8A 3JATA 4WF9V 1KC8W 4G27B 4I0XA 1RSOB 4DV5O 1V54B 3P30A 1ZTEA 4X1KB 3BABA 2R70A 3K5OA 3H1JH 1XREA 4QIWF 4B3RO 3Q4HB 5IJ9A 1SQVH 1FJGO 3L75H 4DYLA 5EBLC 3QO7A 4J7KA 2ZD9A 4WFAV 1M90W 2QWNB 3H1LH 3B8MA 1OCZB 1YXBA 4LF5B 3CP1A 4EB6B 4NXMB 4GKJO 1JA8A 3AG1B 4UFZA 2Q9LA 2CH7B 3D36C 4JTCB 1FFTB 5JQGA 1TA8A 4DR2B 5HFLA 5JJEB 3FAVB 4WFHA 2ZKOA 2ZE6A 1XNQO 2HHHB 4X62O 1TUEB 1XILA 5H5NA 3CE2A 2UXCO 5EC2C 5DN6G 2ATKC 3H1KH 1F4NA 3DTUB 5E79Z 2AHZA 5LMUB 2AGAA 2XNDG 4DR7O 1AR4A 1EM1A 2R72A 3U11A 2L35A 4FM1A 3FB6C 5CBHA 3A0BZ 3SJAC 4CH3A 5FNVB 3ZHVA 2UXDO 1F51A 4R6ZA 1WB7A 1YZBA 1Y66A 3HKEB 1XNRO 1PKXA 3WB0A 4F6RA 2QA4V 3IJ4A 3G67A 3OUFA 4NYKA 5KUMA 5LHHA 4TQDA 4NTXA 3K57A 3E8GA 1BS3A 2WLIB 1RP3B 1JVMA 3CMAV 3HB3B 4I5SA 3M99B 3SYAA 1PP9H 4JI4B 3D8CA 2FMLA 5B5EZ 2DWDC 1RM1B 3UO3A 1QLEC 2WLLB 4MS2A 3T1YO 2UUCB 1PV0A 2W6IG 5J2TB 1YJNV 4LF8O 1RFYA 5IT9N 4X64O 2LGQA 5H2FZ 2WSSG 3OGIB 1GM8A 3AG3C 5JVDA 1M1KW 5HFMA 4LBEC 1NVPD 3F7VC 3KZIZ 1TUBB 1P49A 5FPRA 3B40A 4LFBB 3LSSA 5LGUA 4J42A 1HW7A 4GLXA 4JZGA 1NTKH 2JIZG 2PI5A 2GV9A 4XDKA 4KFMA 2BE3A 5CA0B 3N2KA 2EBOA 3FX7A 4W4KA 2WWWA 4UB6Z 2VS0A 3CWBH 1V54C 4HAMA 4DR4O 3RWRD 2IU0A 1OCRC 4Z1MG 5BXZA 1HNXB 2FL4A 1NH2B 4YY3O 3T1CA 2DMXA 4JAAA 1ZL8A 3OTOO 2BOBC 4KHPB 4YHHB 5KUKA 5KA6A 1IZ3A 1DK1A 1KKDA 3ZHSA 1VQMV 1HNZO 3IGAC 5LP6B 2OT5A 4QE7A 3R66A 2OCCB 3QVNA 2O57A 3AG1C 3CCQV 2HKOA 3N2GB 3B8NA 2ZQMA 2AXTZ 1XI1A 2DWEC 2FKXA 1T5EA 3JAKB 3NXSA 3G4SV 1HNWO 2B9ZA 5GTHZ 5L3FA 3CXCU 1SZXA 3OGCC 4X1YB 5EYPB 2ZCEA 3LNMB 3DC5A 2AHYA 4DV4O 4AHCA 2G38A 2X6BA 1Q6HA 1WP8A 5LBQA 4TOIA 2HFEC 3P32A 2KG7A 3ICXA 3W7SA 3ZRWA 3FYEB 1PNKA 1JR9A 3KKYA 3OT7A 5GTIZ 4YJ3A 1WN7A 1Q43A 4L87A 2DN9A 2JS3A 2QEXV 1OHHG 1NT2B 3ABMB 1ZSPA 2RMKB 2W0XA 2XAGA 5LHIA 3JCZA 2XAHA 4YJ2A 2JGDB 1QVFU 2WLJA 5KA5A 3ZJZA 3G6BA 1MABG 3SGIA 1DF4A 3OEEG 4LWSA 1S0VA 2A9HA 5JJNB 1RM1C 3SYQA 4X88A 3CMEV 2ZM6O 3HKCB 4JI0B 1VQ4V 4AILC 2RDCA 4DR1B 2V1DA 5LL6Y 1EN5A 3ZHQA 4JI8B 1QLNA 1PL4A 3W7WA 5L3CA 3UQ8A 2VWJA 2KSDA 3HKBA 5H6QA 1TGOA 2F95B 3D36A 4DV0B 4OPAA 1S76D 3L72H 1GM9A 1QHTA 4MTFA 1BCCH 3OM3B 4TV8B 3HKDA 2DE0X 3T4DA 2FTKA 3N27A 4JI1B 2YIDA 2ZT9B 1JX9A 3MD0A 4PDMA 4UB8Z 2ILMA 5C93A 4LF5O 2PI4A 1IBKO 4NXMO 4K35A 5EIBC 2EILB 1NTZH 4D6TH 4OPHA 1SA0B 3STZC 4DR2O 4DV6B 3K5MA 4FFKA 3WU2Z 1HR0B 3LSQA 1QQCA 4UVCA 3AEIA 4UV8A 2NLJC 4RUFA 1H8HG 1YEWA 2N04A 3H1HH 3CCRV 1BHAA 5LP6C 3TXQA 4ZHQB 4X89A 3LUTB 2YEVB 3H1IH 4LF6B 1CPYA 2JK5C 2YS8A 5KX5A 1VQ5V 4FMTA 3ZRXA 3JALA 3ZRSA 4DV1B 1D2DA 1H8EG 2A7WA 4FVMA 2IH3C 2DYRB 3MHSC 2CGOA 3ZEDA 1XQ8A 1ZUQA 4U3JA 5LA6B 3SPIA 2X6CA 3DXRB 2P22C 4O4JA 3K9SA 4H0LB 4J41A 2VQFO 2PUSA 1U97A 4BAYA 1JQ0A 2F4VO 2X6AA 3H9VA 1H2SB 5CMUA 4PELA 2KB1A 5KLVH 2BSKB 4RQEA 4JI4O 4AQYB 2D2CB 2QDOA 2P5OA 1BQZA 1L0NH 1SQFA 4X65B 4GT1A 1IBLO 2UUCO 1HDJA 3E8BA 4GX0A 3ABMC 1N4CA 1RSOA 1VF6C 1H2KA 3JARB 3WG7C 2DQ0A 3FB5C 4X1KA 1I5XA 1US6A 5C8YB 4DR5B 2PGGA 4JI6B 1S72V 1VARA 4NR1A 4DV3B 2JGUA 2ZXWB 1SKVA 2RQ6A 2YDEA 2UXBO 5E1AC 4IIJB 4PDVA 1M4UA 1WJZA 1K4CC 1DF5A 5IYDO 4EB6A 1L0LH 3CC4V 4P30A 1IXBA 2CH7A 2GUZB 3RBZA 3CHXA 3FAVA 1SZTA 1FAFA 1VP7A 2ETNA 4KHPO 3ZMTA 1FYJA 2X7RB 3RYCA 2E76B 3O65A 1N34B 2Q69A 4O4LB 2E75B 2EILC 1AR5A 3JAWB 3FFQA 4CC6A 5FNVA 2Q5ZA 1QR9A 2LO1A 2LP7A 4NTYA 3OMAB 3HKEA 3ZHTA 4PI2A 4O2BB 4BR6A 2Y4TA 3JSNA 4O4HB 3ZMUA 5LYJB 2GDSA 2WA4A 1JMKC 2HVKC 1GN3A 1EBOA 4YXWG 3RYIB 2PF4E 2WLIA 1WA8B 4JI7O 2K1EA 3T4ZA 2E74B 2ZE7A 4HNAB 4JI3O 1YHQV 2EZOA 1VIBA 3ETEA 3EVKA 2MW2B 2HP8A 1RPOA 2ZE8A 1Y74B 2DYRC 5BZBA 4MVOA 5J2TA 2BTOA 5ITZB 3ETQA 3JD1A 3T1HB 1FXVA 3LNNA 5LMNB 5IYZA 2C2AA 4CS2A 2E5LB 4FPPA 2VQEO 1TUBA 1S3JA 2KKWA 3OR6C 3K03A 5LOVB 2HG5C 3M8AA 1K8AW 3AK2A 5CBFA 4IYHA 5CA0A 3E2EA 3NR7A 4HZ3A 4C7UA 3B09A 1KU9A 1VQPV 2PYLA 4R7CA 3OW2U 2H3OA 3BA9A 1PNLA 4JI8O 1L8DA 4D7SA 3E8FA 4UCTA 2JEUA 2UUBB 4PA9A 1IX9A 2KQXA 4NVPA 4DV0O 4B08A 4LFAB 5H6RA 2ZXWC 4HYOA 4UVBA 3C90A 2WA3A 2V7QG 2QM4A 4FLVA 1FD9A 5LP6A 2XT9A 1CEZA 2Y4UA 2Z3YA 4JI1O 1YITV 3AG2B 5J2UB 3CD6V 2WPDG 3ZHUA 4MTGA 2XAFA 1V55B 3N2GA 3EXAA 3UCSC 2ZIMA 1VMGA 3ABTA 1XDCA 1K9MW 3EHBB 4ICGA 4DW1A 3JAKA 2QWPB 2ADQB 4DV6O 3CCSV 1IBMO 1CXZB 4FM2A 2QR4A 5H9CA 1E1QG 5EK0A 1PNMA 3A0HZ 4BW9A 4MVZA 3I56V 2CTQA 4X1YA 2LFRA 3BPZA 1I94B 1VQOV 2GHYA 5EYPA 4QE9A 2HJDA 4LF6O 1N33B 2P4KA 1J5EO 1H2MA 3SYPA 1KQSU 2IW5A 4FM0A 4LFCB 4DV1O 5TISZ 1BHBA 5IYBO 1HP8A 3K0DA 4GKKB 4LF4O 1UPGA 1K97A 2EINB 1YCIA 3JAMN 1VF6A 1B6QA 2JGDA 4P2ZA 5JWPA 4IT5A 4B7KA 2ZR3A 2AW9A 4WFGA 3E22B 5BR8B 5EIBD 1NH2D 4MVUA 4K0KB 1NR1A 3ZMVA 4MTOA 4I9QA 4AQYO 2YSUB 4H33A 4DUZB 5B1OA 4JTAB 1A32A 2BTQB 3G80A 4O2AB 2EIKB 5K1XA 4I7ZB 4RQFA 1BZKA 1G1XB 1SESA 3STLC 2Q7EA 2QWOB 4DR5O 2YC0A 2XHBA 2EIJB 4JGSA 2V4DA 4DV3O 5L3GA 1AI5A 5GONA 3LSUA 4JV5O 1GO3F 4JZ2A 1BE3H 2YI9A 2A3QA 3TJTA 3VQXA 1FPOA 2Q6AA 1Z5WA 1HWYA 4I4TB 2YXLA 4XBFA 2HR3A 2YXHA 2CAZC 1SA0A 4OXSA 4H13B 4J10A 1SQXH 1YIJV 4JI2B 2ITCC 4FLYA 4J11A 2Q0AA 3CS5A 2WLNA 2ARHA 3RT3C 3W7TA 3AG7A 5GW7A 3AG2C 5KAFZ 3TETA 2QKSA 2ZR2A 5D5QA 3CCLV 4UCUA 5B3SB 2YEVA 1V55C 3S3WA 3ABKB 4K8ZA 2OTLV 1W0KG 1J95A 1K5QA 4CS3A 1N0NA 1E1RG 1M5IA 2HJFC 4FK5C 3LDEA 1OV9A 4G28B 1P7BA 1OCZC 4NTWA 4DR3B 5DECA 1SETA 3SPJA 4BIZA 3ASOB 2R9IA 5LA6A 1EFRG 1Z5VA 2QJ1A 3DXRA 4MW3A 3MHHC 4MVQA 5BY1A 3ZIAG 2YXYA 1XBLA 1AJNA 1YTFB 3QO5A 1K73W 1GRJA 4JYBA 1SQGA 4B3MO 2UXNA 3JD2A 4RWUA 3HPLC 2BSKA 2XTAA 4N23A 4DR6B 1NI8A 1XL4A 1QU7A 2OWOA 1LUVA 1B3QA 3JARA 3RVYA 1G4YB 1K5SA 1H2GA 3T1HO 3CB2A 3I5DA 1EN6A 5C8YA 3GWKC 4J9ZB 4X20B 3ZRVA 3FD9A 3A2FA 4FLWA 4IIJA 3G71V 1X4TA 4G2KA 1L1FA 2P90A 3H01A 3PN1A 1FKAO 3ZS8C 3OE7G 2N74A 2EIKC 3RW0A 4EEQA 2Z0AA 2Y69B 2Y0IA 3K58A 1SERA 4QPKA 2JJ1G 1ROPA 3QG5A 2R9RB 5FLXN 4FZ1A 2OIEA 1FXKB 4ZOLB 3SR2C 3TXSA 4LFAO 1XMOB 4JYAB 3JASB 4TV9B 1VQ6V 3FYIB 1SRYA 1E79G 1DTOA 4J7JA 5KAIZ 2E3CA 5B1AB 4DRXB 5IDJA 4LCUC 2X0LA 2ZINA 3C3SA 4O4LA 4JYYA 3F5WC 3SPGA 3JAWA 2XASA 2Q0OC 1I5YA 2UUAB 1Y76B 4H37A 2H94A 4B7EA 3S3XA 1COWG 3E89A 5DEDA 1AROP 4MT8A 4O2BA 1VF7A 4O4HA 5LYJA 5B3SC 3SDLA 3RYIA 1NR7A 4KL1A 1WA8A 1RPRA 4DV5B 3K08A 4QPJA 1NKDA 1N33O 1H2LA 2HHHO 5CA1A 4Q20A 5JVDB 4LH6A 1Y4MA 2Q67A 4LFCO 2QTOA 1M57B 2XUMA 5LMUO 1Y74A 4GZRB 2OCCC 4EKWA 4GKKO 4PA3A 4JI5B 3ASOC 2NN4A 1F23A 5ITZA 2GTSA 4UV9A 4U3FH 1KUQA 3CC2V 2QSAA 2PTMA 4FLXA 4GKJB 3OFNG 5LOVA 4PV1B 5BR8O 1K4DC 2QKCA 4MTXA 4PA6A 4K0KO 4JTDB 5B66Z 1Q82W 1Y6XA 2QWQB 1KP3A 2ZNJA 1XNQB 4LNUB 2Q4PA 4X62B 2K9PA 4WBNB 5LGTA 4UCSA 3K59A 3VOUA 1WB8A 2P06A 1SC5B 1VQNV 5EZYB 2HLDG 4DR7B 3BA8A 4IL6Z 1BQ0A 2Q8VA 3TGUH 2DOSA 1K3EA 4ZKIA 3OEHG 5KHHA 1ZLZA 4IGGA 2UXDB 5L3BA 3GB7C 3J7AU 2Y69C 5J2UA 2BOCC 2EX3A 2Q7HA 2LW7A 3ML0A 3Q4HA 1WAZA 2ZE5A 2ITDC 4JYCA 4XDJA 4LFBO 1FXKC 4NXNB 4E4EA 3CX5F 3CRRA 1R3IC 2EULA 4X9QA 1JFFB 3BEHA 4JASA 3X2QB 2R9AA 3J80N 1Q6IA 4JI2O 2QE7G 1ZAUA 5L3EA 3P3PA 4BW5A 5B1AC 3OUSA 1XHXA 3LDCA 4I55B 2KG7B 5B1BB 4FLUA 4Z1VA 4B3TB 1VEWA 1HNXO 1PM9A 1VQKV 4LF8B 1JCHA 1YSCA 3JYCA 2PZSA 1Y67A 4YHHO 1FFXB 3L73H 4PA4A 2IH1C 4LWSB 4DR3O 4U7OA 1F7YA 3RYHB 1TVKB 3GWOA 3UKMA 1QCEA 3U10A 1NBMG 1B06A 3G6EV 1WLEA 1H38A 1KYOF 4DR4B 1MSDA 1XEQA 4W4LA 3E22A 3CCEV 4JPRA 4YY3B 1M57C 3JD0A 1AVMA 1IXMA 3TCUA 1LR1A 5CBGA 2BTQA 4O2AA 2A79B 2DQ3A 4CC5A 1MZEA 3AK1A 3GVMA 4DV7B 4LF7B 1XMQB 4UCOA 4LR3A 1VQLV 1XL6A 3FKSG 3FB7C 3ZHRA 4YIOA 2WLLA 3UM7A 2LFSA 2EJ7A 5KMGB 5K1PA 4CS4A 4CBCA 1YVWA 3BHPA 4NKGB 1MMMA 3IFXA 4LC1A 1AP5A 2WLMA 4I4TA 1BT8A 2JEXA 4FFBB 2Q7GA 4QGPA 4HBNA 4GX2A 4DV4B 3ETGA 4JYAO 1NQTA 4U7NA 1GN6A 4P9PA 4TSFG 4JI0O 4DR1O 3DC6A 3P3NA 1KECA 4TQFA 1CP9A 3KCXA 1N32B 1XUQA 2F93B 3W7XA 1N8RW 4X8AA 1ENVA 4O4JB 2CUGA 1LNQA 4TWKA 1W59A 4JAVA 2UUAO 4P9OA 2FYUH 1VQ7V 5IJ0B 4CH6A 4TUYB 4PDRA 4RO2A 5B1BC 1YJWV 1MG1A 2F23A 1GTOA 2ZM6B 4Q6GA 1ZWIC 5JH7B 1R3KC 4UUJC 1UFIA 2CTPA 1JPXA 4DO2A 3A8TA 1HR0O 1OCCB 1OCRB 1O9HA 3LDDA 3QF7A 2ZDIC 1Q81W 4JAUA 1UJWB 1FXHA 4E2LA 3BVOA 1KB9F 4UCRA 1IURA 5DM6V 4JI5O 2M6YA 2A0LA 4ZI7B 4O4IB 5KHIA 2QGNA 3TK1A 3ETDA 2XAJA 4WFBV 2YICA 4D7TA 1BSMA 4X20A 1IBKB 2OIGA 4FIPC 1AI6A 3MAQA 3OAAG 1P4RA 3CPWU 2P6JA 2H8PC 4X1IB 1M9NA 2UU9B 4BWAA 1AB3A 1ORQC 1K7DA 1PPJH 4MVRA 1KMIZ 1PD3A 4KUMA 3SYOA 3RFRA 2EZPA 1G8MA 3VQWA 1XOUA 4L8JA 3UO2A 3WB2A 2ZNIA 3CJHB 3RYCB 3L71H 4UVAA 3CRMA 4ZOLA 1FXKA 4I9WA 3AK3A 5D5PA 3PJSK 3JASA 3HKCA 4TV9A 4X65O 5IWAB 1JJ2U 5J9PC 3CCMV 3K3WA 2JVDA 3K5LA 3UT5B 2DYSB 4DRXA 5KHJA 3EFFK 1D5AA 1WP7A 4NB5A 3CRAA 3O9OA 2MK3A 1Q8IA 4I50B 4JI6O 4WFEA 4ASUG 4QJFB 4B3SB 4DV2B 2CTWA 4KXRA 1AR1B 1VQ8V 3K79A 1YTFD 4NXNO 1Y76A 5IE9A 2VQFB 1K92A 4WCEV 4TV8A 2F4VB 1NU1H 1SQQH 2CK3G 4Z2WA 1EN4A 3A0RA 4R8CA 5LXTB 2M7WA 4KP4A 4J80A 5JCOC 4B3TO 1IBLB 3MDSA 1MSWD 2LGWA 2QM8A 3OMNB 2IM9A 2OTJV 5IYZB 2XAQA 1Q86W 1AI7A 5BMVB 3RYFB 1K34A 4ZHQA 2CDYA 1YJ9V 2N05A 3SPHA 5EBWC 4FJCC 1DLBA 2UXBB 4MSWC 4PDLA 1N34O 1LUWA 3BY6A 1SQPH 5CB4B 3QNEA 1W0JG 1MNGA 3RVZA 4IHJB 5EC1C 1P7GA 4X66B 4LP8A 3WB1A 1OCCC 3ABLB 2IBZH 2WAMA 4DUYB 4DXWA 3W7UA 1YDXA 2AZ2A 4N21A 4LNUA 3JATB 4WBNA 4EFEA 3M7MX 5EZYA 4I0XB 1JOYA 3DSQA 1SF9A 2LQTA 3THOA 4DV7O 1GMGA 1XMQO 4LF7O 1N0JA 3BFRA 2F43G 4GX1A 5IJ9B 5A2QN 2EINC 3B2EE 2W0FC 2B1IA 4GUNA 2EIMB 3T2MA 5A9GA 5AG2A 4LF9B 1URFA 5LMNO 4PJ0Z 1N36B 2CE4A 4JF3A 5KHKA 2E5LO 1B04A 1S77D 3CCJV 2LJ2A 1NVPB 3B4SA 2ZIOA 3CSXA 2F66C 3KG2A 3VQYA 5JQGB 2QWRB 1JFFA 4RAIA 4JI7B 1DGSA 4PI0A 2ADPA 3JD4A 4FLZA 2JS5A 3CEIA 4JI3B 1AI4A 5CN0A 1GN2A 1AJPA 2DYSC 2GTAA 4I55A 2P7TC 3AG4B 1NS1A 3ZMZA 2GUZA 2JRIA 2VRZA 1JJOA 1N32O 2UUBO 2EIJC 4GX5A 2IU3A 4CH4A 3L9DA 3B77A 5EBMC 2GSMB 2JDIG 5FL7G 5LHGA 3OD4A 1XHZA 1R3JC 3WG7B 1F4MA 3SJBC 4F4LA 4OX9B 2VQEB 1FFXA 2ZDIA 4K3AA 3K5NA 4WFFA 3DGEA 2CGNA 3RYHA 1TVKA 4MW8A 3HR0A 4F6RB 2ODMA 2CTRA 1M56B 4UCVA 5IY5B 3IAYA 1D5NA 2WLHA 1I08A 4RUEA 5KHGA 1EZJA 3ASNB 1IVSA 1K33A 3OMIB 1KP2A 5GONB 1VF5B 3ABKC 1I94O 3SPCA 2PY5A 1R6KA 3QTCA 4PA7A 2JJ2G 1OJHA 4HNAA 4DK1A 3ABLC 4B3RB 1PL0A 2OCHA 1FJGB 3JCUZ 4UXNA 4QNHB 3E8HA 1Q5OA 5KMGA 3SJQC 3CYOA 2UU9O 3N2KB 1GAXA 1IBMB 4K8XA 2Y48A 3IC7A 2QKAA 4FFBA 2D3OW 4GYCB 2NR5A 1W2BU 1GH6A 3ZBHA 1V9PA 4BIOA 1SS3A 2IJHA 4BIUA 4DUZO 1J5EB 1ZL8B 2UXCB 3QO8A 5IWAO 5LGNA 2YUAA 3K06A 2EIMC 1QVGU 3J81N 2OYQA 5CA3A 1I0HA 3JSLA 2Y0PA 4FZ0A 4LF4B
chains in the Genus database with same CATH topology
3ZMVA 4MTOA 3IFXA 2X6BA 4LC1A 4CZZA 3ZN1A 4J9YB 3ZN0A 5LBQA 2YSUB 4H33A 2HFEC 3P32A 4JTAB 5B1OA 2WLMA 3W7SA 2B1GA 3ZRWA 3FYEB 1PNKA 2EIKB 2JEXA 4RQFA 3SYCA 4GX2A 4L87A 1SESA 3STLC 2QEXV 3ETGA 1NQTA 4U7NA 1KD1W 1OHHG 4P9PA 1BMFG 3ABMB 3AG4C 4TSFG 2XAGA 2EIJB 4JGSA 5LHIA 3JCZA 2XAHA 5L3GA 1AI5A 2WLJA 1KECA 1YI2V 1QVFU 5KA5A 3ZJZA 1CP9A 1THZA 4ZBMA 1GO3F 1MABG 1DF4A 4XDLA 3OEEG 1S0VA 1OCOB 2A9HA 3ZCCA 3W7XA 1N8RW 1RM1C 2DW4A 2W6JG 4X8AA 4X88A 3SYQA 3CMEV 2Q6AA 1VQ4V 1ENVA 1LNQA 1HWYA 4TWKA 2V1DA 4R50A 4JAVA 5B1NA 3ZRWB 1QLNA 3JD3A 4XBFA 3W7WA 2HR3A 5L3CA 5L3DA 4P9OA 3CCVV 1AJQA 3E35A 3R65A 4OXSA 5H6QA 1VQ7V 2HVJC 1BL8A 3D36A 4PDRA 4RO2A 1YIJV 5B1BC 1YJWV 1MG1A 2ITCC 3F7YC 1S76D 2WLNA 1GTOA 1M56C 2UXXA 1GM9A 3W7TA 3E83A 1ZWIC 5GW7A 5IY5C 1R3KC 3AG2C 4MTFA 4UUJC 4GCZA 3K04A 1WPXA 3TETA 2QKSA 3OM3B 1JPXA 2ZR2A 4DO2A 3CCLV 3T4DA 2FTKA 3ASNC 5B3SB 2YEVA 1GK9A 1OCCB 1JX9A 1OCRB 1V55C 3K9AA 3ABKB 3LDDA 3MD0A 1VQ9V 4PDMA 2ZDIC 5C93A 1Q81W 2OTLV 4JAUA 1UJWB 1FXHA 4E2LA 1NJIW 1W0KG 1J95A 2PI4A 1K5QA 3K0GA 1MOFA 1E1RG 2HJFC 4FK5C 2IJJA 2EILB 3LDEA 2WLKA 4G28B 1P7BA 2NNUA 5DM6V 1OCZC 3STZC 2A0LA 1SETA 3TK1A 3ETDA 3LSQA 3SPJA 4BIZA 2XAJA 4UVCA 3ASOB 3AEIA 2R9IA 4UV8A 4WFBV 1EFRG 4MVMA 2NLJC 4RUFA 2Q68A 1H8HG 4MW3A 2EJRA 3I55V 3MHHC 3CCRV 2B5UA 1BHAA 4MVQA 4FIPC 3ZIAG 1AI6A 4X89A 1AJNA 4MVSA 1YTFB 3OAAG 1P4RA 3QO5A 1K73W 3CPWU 2P6JA 3LUTB 4JYBA 2IJKA 2H8PC 2YEVB 1M9NA 2UXNA 3JD2A 3HPLC 1CPYA 1ORQC 2JK5C 1K7DA 4MVRA 4N23A 1VQ5V 4FMTA 1PD3A 3ZRXA 4KUMA 3SYOA 1XL4A 3ZRSA 2EZPA 1G8MA 1H8EG 4UVAA 2IH3C 3RVYA 1G4YB 1K5SA 1H2GA 2DYRB 3MHSC 1FXKA 4I9WA 2P67A 3PJSK 3SPIA 2X6CA 4J9ZB 4CBCA 1JJ2U 3D3IA 5J9PC 3ZRVA 3CCMV 1S5HC 3K3WA 2XOKG 1QBZA 4BAYA 1JQ0A 2DYSB 3WFVA 2X6AA 3G71V 3EFFK 4G2KA 5CMUA 2Z5UA 4PELA 1L1FA 1FS0G 2P90A 2KB1A 3H01A 2MK3A 3OE7G 1QR8A 4RQEA 2EIKC 4WFEA 4ASUG 4QJFB 3RW0A 2Y69B 1AR1B 1VQ8V 1SERA 3K79A 4QPKA 2JJ1G 1Q7YW 1YTFD 4GT1A 1ROPA 1K92A 3CC7V 2IJIA 3E8BA 4GX0A 4WCEV 2R9RB 3ABMC 1QLEB 3WG7C 2CK3G 1FXKB 2DQ0A 3FB5C 3OR7C 1R3LC 1I5XA 1VQ6V 3FYIB 3FB8C 1SRYA 3E86A 1GKFA 1E79G 1DTOA 1S72V 3X2QC 3A0RA 4R8CA 2M7WA 1OCOC 3AG3B 1OZ0A 2ZXWB 4KP4A 5IYCO 5B1AB 5E1AC 1GM7A 3ABUA 4PDVA 3VBBA 5IDJA 4LCUC 3CCUV 2QM8A 2X0LA 3ZMSA 1MSWD 3OMNB 1R6NA 2QM7A 2OTJV 1K4CC 1R73A 1DF5A 3F5WC 3SPGA 2XAQA 5IYDO 4TT3G 1Q86W 1AI7A 2XASA 1K34A 4P30A 4WF9V 3CC4V 1I5YA 1KC8W 1YJ9V 4G27B 4H37A 5EBWC 3SPHA 2H94A 4FJCC 1DLBA 4MSWC 1COWG 1V54B 3P30A 4PDLA 3RBZA 3BY6A 3E89A 3QNEA 1W0JG 1SZTA 4QIWF 3RVZA 1AROP 4MT8A 5EC1C 4LP8A 3ZMTA 5B3SC 1OCCC 2X7RB 3ABLB 5EBLC 3QO7A 2WAMA 1NR7A 1RPRA 4DXWA 3W7UA 2Q69A 2ZD9A 3K08A 4QPJA 4WFAV 1NKDA 1M90W 3B8MA 4Q20A 4N21A 1OCZB 2EILC 3CP1A 1Y4MA 2Q67A 2QTOA 1M57B 3AG1B 2OCCC 4EKWA 1JOYA 1QR9A 4JTCB 4PA3A 1FFTB 3ASOC 1GMGA 2LP7A 5HFLA 1F23A 3OMAB 4WFHA 4UV9A 2F43G 1TUEB 5EC2C 5DN6G 4GX1A 3ZMUA 3CC2V 2ATKC 1F4NA 3DTUB 2AHZA 3OFNG 2EINC 2HVKC 1K4DC 2W0FC 2B1IA 1EBOA 4YXWG 2XNDG 4MTXA 2WLIA 4PA6A 2EIMB 4JTDB 3T2MA 2K1EA 3T4ZA 1Q82W 1KP3A 3FB6C 1YHQV 4JF3A 2EZOA 3ETEA 1S77D 3CCJV 5CBHA 5LGTA 1RPOA 1NVPB 3VOUA 2DYRC 1VQNV 1F51A 4R6ZA 3KG2A 5BZBA 2HLDG 4MVOA 1Y66A 4RAIA 3JD1A 1FXVA 3JD4A 1PKXA 2C2AA 1K3EA 1AI4A 5CN0A 2QA4V 4FPPA 1AJPA 2DYSC 4ZKIA 3OUFA 1S3JA 3OEHG 2P7TC 3AG4B 3K03A 3OR6C 5KUMA 2HG5C 3ZMZA 5LHHA 3E8GA 1K8AW 5CBFA 2WLIB 5L3BA 2EIJC 4GX5A 2IU3A 1JVMA 3GB7C 3E2EA 2Y69C 3B77A 5EBMC 2BOCC 4HZ3A 3CMAV 3HB3B 4I5SA 2GSMB 2JDIG 3M99B 5FL7G 3SYAA 5LHGA 3ML0A 1VQPV 1R3JC 3WG7B 4R7CA 4JYCA 2ITDC 4XDJA 1F4MA 3OW2U 4F4LA 2DWDC 1RM1B 1PNLA 1QLEC 2ZDIA 2WLLB 4MS2A 1FXKC 2W6IG 1YJNV 3E8FA 1R3IC 3X2QB 4JASA 3BEHA 2JEUA 4PA9A 3DGEA 4WFFA 2QE7G 2WSSG 5L3EA 4MW8A 1GM8A 3AG3C 5H6RA 2ZXWC 4BW5A 1M1KW 5HFMA 4LBEC 4HYOA 1NVPD 3F7VC 4UVBA 3OUSA 5B1AC 3LDCA 5B1BB 3LSSA 2V7QG 5LGUA 1M56B 2JIZG 1CEZA 2Z3YA 2PI5A 5IY5B 4XDKA 4KFMA 1VQKV 1YITV 3AG2B 1JCHA 3CD6V 1YSCA 2WLHA 4RUEA 3JYCA 2EBOA 2WPDG 4MTGA 1EZJA 3ASNB 2WWWA 2XAFA 1V55B 1K33A 3OMIB 1V54C 1KP2A 4HAMA 2IU0A 1OCRC 3ABKC 4Z1MG 3SPCA 3ABTA 1K9MW 3EHBB 1R6KA 4PA4A 4PA7A 2IH1C 3CCSV 1NH2B 2JJ2G 4U7OA 3GWOA 5H9CA 3UKMA 1QCEA 1E1QG 1NBMG 3T1CA 3ABLC 1PNMA 5EK0A 3G6EV 1PL0A 2BOBC 1WLEA 1H38A 5KUKA 5KA6A 4MVZA 3I56V 1KKDA 4UXNA 1VQMV 2LFRA 4QNHB 3E8HA 3IGAC 1VQOV 3CCEV 3SJQC 2GHYA 2OT5A 4QE7A 3CYOA 4JPRA 4QE9A 2OCCB 1M57C 3AG1C 3JD0A 1IXMA 3SYPA 3TCUA 1KQSU 2IW5A 3CCQV 2HKOA 3B8NA 2ZQMA 5CBGA 2Y48A 3IC7A 1BHBA 2A79B 5IYBO 2DQ3A 2DWEC 3K0DA 2D3OW 3NXSA 1W2BU 3G4SV 1K97A 2EINB 1VQLV 1XL6A 2IJHA 3FKSG 3FB7C 4BIUA 1B6QA 3QO8A 5LGNA 3K06A 5L3FA 3CXCU 2EIMC 4P2ZA 1QVGU 2WLLA 3UM7A 2ZR3A 3OGCC 2LFSA 4WFGA 5CA3A 1NH2D 4MVUA 3LNMB 2AHYA 1NR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLE C;  4MTO A;  2WLL B;  3IFX A;  2X6B A;  4MS2 A;  4X89 A;  4MVS A;  4J9Y B;  3RVZ A;  5EC1 C;  3E8F A;  1R3I C;  4H33 A;  3LUT B;  3BEH A;  2HFE C;  4JTA B;  2H8P C;  4PA9 A;  4WFF A;  2WLM A;  4LP8 A;  5B3S C;  3HPL C;  1ORQ C;  1OCC C;  2JK5 C;  4MW8 A;  3AG3 C;  2ZXW C;  4MVR A;  5EBL C;  4BW5 A;  4LBE C;  4HYO A;  3F7V C;  5B1A C;  3OUS A;  3SYC A;  3SYO A;  1XL4 A;  4DXW A;  3LDC A;  4GX2 A;  2Q69 A;  2ZD9 A;  3K08 A;  3ZRS A;  3STL C;  4P9P A;  3AG4 C;  2EIL C;  2IH3 C;  2Q67 A;  3RVY A;  2QTO A;  1G4Y B;  2WLJ A;  4KFM A;  4XDK A;  4I9W A;  3ZJZ A;  2WLH A;  2OCC C;  4RUE A;  3JYC A;  4ZBM A;  4EKW A;  3PJS K;  4MTG A;  4JTC B;  4PA3 A;  3SPI A;  2X6C A;  3ASO C;  4J9Z B;  4XDL A;  2A9H A;  4CBC A;  5J9P C;  1V54 C;  1S5H C;  4WFH A;  1OCR C;  3ABK C;  3SPC A;  4X8A A;  3SYQ A;  4X88 A;  2X6A A;  2Q6A A;  5EC2 C;  4GX1 A;  4PA4 A;  4PA7 A;  1LNQ A;  2IH1 C;  2ATK C;  3EFF K;  4TWK A;  4R50 A;  2AHZ A;  2KB1 A;  2EIN C;  2HVK C;  3UKM A;  2W0F C;  1K4D C;  3T1C A;  2EIK C;  4P9O A;  4WFE A;  3ABL C;  3R65 A;  2WLI A;  4OXS A;  4PA6 A;  5EK0 A;  3RW0 A;  4JTD B;  2HVJ C;  2BOB C;  3T2M A;  2K1E A;  3T4Z A;  5KUK A;  1BL8 A;  4PDR A;  4RO2 A;  4MVZ A;  5B1B C;  1KKD A;  2ITC C;  3F7Y C;  3FB6 C;  3E8B A;  4GX0 A;  2R9R B;  4QNH B;  3E8H A;  3IGA C;  2WLN A;  3ABM C;  3SJQ C;  5CBH A;  4QE7 A;  3WG7 C;  1M56 C;  3VOU A;  3E83 A;  3FB5 C;  3OR7 C;  4QE9 A;  1ZWI C;  5IY5 C;  1M57 C;  2DYR C;  1R3L C;  1R3K C;  3AG2 C;  3AG1 C;  4MTF A;  4UUJ C;  3K04 A;  4R6Z A;  3KG2 A;  3TET A;  5BZB A;  4MVO A;  2QKS A;  3FB8 C;  3E86 A;  3SYP A;  3TCU A;  3T4D A;  4MVQ A;  4RAI A;  3ASN C;  3X2Q C;  4R8C A;  2YEV A;  5CBG A;  1OCO C;  1V55 C;  3LDD A;  2A79 B;  4PDM A;  2DWE C;  5E1A C;  4PDV A;  3K0D A;  1J95 A;  4LCU C;  2DYS C;  3OUF A;  3K0G A;  2P7T C;  3K03 A;  3OR6 C;  5KUM A;  2HJF C;  1XL6 A;  2HG5 C;  3LDE A;  2WLK A;  1K4C C;  4G28 B;  3FB7 C;  3E8G A;  1P7B A;  3F5W C;  3SPG A;  5CBF A;  2WLI B;  1OCZ C;  2EIJ C;  3STZ C;  2A0L A;  3K06 A;  4GX5 A;  4P30 A;  2EIM C;  1JVM A;  3GB7 C;  4P2Z A;  2Y69 C;  5EBM C;  2WLL A;  3SPJ A;  2BOC C;  3UM7 A;  4HZ3 A;  3OGC C;  4WFG A;  4G27 B;  4H37 A;  5EBW C;  3SPH A;  4MVM A;  3SYA A;  2NLJ C;  4RUF A;  1R3J C;  2Q68 A;  4MSW C;  4MVU A;  4MW3 A;  4PDL A;  2ITD C;  4R7C A;  4XDJ A;  3RBZ A;  3LNM B;  4F4L A;  2DWD C;  2AHY A;  3E89 A; 
#chains in the Genus database with same CATH topology
 1O9G A;  5JCO A;  2GBO A;  4CZZ A;  3ZN1 A;  4DK0 A;  4J9Y B;  3ZN0 A;  1KKC A;  4B3S O;  4DV2 O;  1G6U A;  2B1G A;  1TAE A;  1M93 A;  3VQV A;  1BGY H;  1QNM A;  3SYC A;  5IJ0 A;  4A5U B;  2RNB A;  4TUY A;  1KD1 W;  1XNR B;  1BMF G;  3AG4 C;  1YI2 V;  5JH7 A;  1THZ A;  4ZBM A;  4XDL A;  2PYJ A;  1OCO B;  3ZCC A;  3CRC A;  2YI8 A;  2DW4 A;  2W6J G;  1R1B A;  2LW1 A;  1KBH A;  2P4V A;  4R50 A;  5B1N A;  3ZRW B;  3JD3 A;  4JV5 B;  3T1Y B;  2Q73 A;  5L3D A;  3OTF A;  1AJQ A;  3E35 A;  3R65 A;  4YJ3 B;  3CCV V;  2HVJ C;  4ZI7 A;  4O4I A;  4X64 B;  1BL8 A;  3CXH F;  3F7Y C;  4PD4 F;  4X66 O;  3APQ A;  4YJ2 B;  1M56 C;  3BRC A;  2UXX A;  2RJZ A;  4FLT A;  3E83 A;  5IY5 C;  4GCZ A;  3K04 A;  1WPX A;  4DUY O;  3ASN C;  4X1I A;  1GK9 A;  3K9A A;  1VQ9 V;  1WPB A;  1Z2G A;  2YIB A;  1Q3E A;  4J7Z A;  5F2V O;  4EFB A;  3APO A;  1NJI W;  3K0G A;  1MOF A;  2QTS A;  4LH7 A;  2IJJ A;  2WLK A;  2RCV A;  1MZF A;  2NNU A;  3CJH A;  4IYI A;  3L74 H;  3HKB B;  3CRQ A;  2VWK A;  4DR6 O;  4MVM A;  2Q68 A;  1X59 A;  2EJR A;  3I55 V;  2YIA A;  2B5U A;  3OTO B;  1IDS A;  4ZIB A;  2L6L A;  2F1M A;  4MVS A;  3KCY A;  3UT5 A;  2RN9 A;  1HNZ B;  3L70 H;  3HKD B;  2FB5 A;  2IJK A;  3C3T A;  4LF9 O;  1EZV H;  4YIP A;  1N36 O;  3BCC H;  1GN4 A;  4I50 A;  1P84 F;  1NTM H;  2HEP A;  4F6E A;  1S5L Z;  3ZX6 A;  1R6T A;  2BCC H;  4B3M B;  2P67 A;  4H44 B;  3RGB A;  5CA1 B;  1HNW B;  1Q6U A;  1SQB H;  4CH5 A;  3BAA A;  3D3I A;  5LXT A;  3U0Z A;  1S5H C;  2XOK G;  1QBZ A;  1S5J A;  1H2N A;  1NZ6 A;  4OGQ B;  3RN4 A;  3WFV A;  1AP6 A;  2Z5U A;  1XMO O;  1FS0 G;  4DW0 A;  1QR8 A;  5KX5 B;  5JJJ B;  1ZX3 A;  3JAL B;  3SJC C;  1YF2 A;  4OX9 O;  1MA1 A;  5FPO A;  5BMV A;  3RYF A;  1Q7Y W;  3D3Q A;  2DJV A;  3CC7 V;  2IJI A;  3F5T A;  1QLE B;  3IC9 A;  1AIL A;  2YIB D;  3OR7 C;  5CB4 A;  1R3L C;  4U3J B;  4ABM A;  3FB8 C;  3E86 A;  4IHJ A;  1GKF A;  4PHZ A;  1I7F A;  1Q90 D;  3X2Q C;  2AZ0 A;  1OCO C;  3AG3 B;  1OZ0 A;  5IYC O;  1GM7 A;  3ABU A;  3VBB A;  2A06 H;  3CCU V;  3ZMS A;  1R6N A;  2QM7 A;  1WNS A;  1U96 A;  1R73 A;  4TT3 G;  4AI8 A;  3JAT A;  4WF9 V;  1KC8 W;  4G27 B;  4I0X A;  1RSO B;  4DV5 O;  1V54 B;  3P30 A;  1ZTE A;  4X1K B;  3BAB A;  2R70 A;  3K5O A;  3H1J H;  1XRE A;  4QIW F;  4B3R O;  3Q4H B;  5IJ9 A;  1SQV H;  1FJG O;  3L75 H;  4DYL A;  5EBL C;  3QO7 A;  4J7K A;  2ZD9 A;  4WFA V;  1M90 W;  2QWN B;  3H1L H;  3B8M A;  1OCZ B;  1YXB A;  4LF5 B;  3CP1 A;  4EB6 B;  4NXM B;  4GKJ O;  1JA8 A;  3AG1 B;  4UFZ A;  2Q9L A;  2CH7 B;  3D36 C;  4JTC B;  1FFT B;  5JQG A;  1TA8 A;  4DR2 B;  5HFL A;  5JJE B;  3FAV B;  4WFH A;  2ZKO A;  2ZE6 A;  1XNQ O;  2HHH B;  4X62 O;  1TUE B;  1XIL A;  5H5N A;  3CE2 A;  2UXC O;  5EC2 C;  5DN6 G;  2ATK C;  3H1K H;  1F4N A;  3DTU B;  5E79 Z;  2AHZ A;  5LMU B;  2AGA A;  2XND G;  4DR7 O;  1AR4 A;  1EM1 A;  2R72 A;  3U11 A;  2L35 A;  4FM1 A;  3FB6 C;  5CBH A;  3A0B Z;  3SJA C;  4CH3 A;  5FNV B;  3ZHV A;  2UXD O;  1F51 A;  4R6Z A;  1WB7 A;  1YZB A;  1Y66 A;  3HKE B;  1XNR O;  1PKX A;  3WB0 A;  4F6R A;  2QA4 V;  3IJ4 A;  3G67 A;  3OUF A;  4NYK A;  5KUM A;  5LHH A;  4TQD A;  4NTX A;  3K57 A;  3E8G A;  1BS3 A;  2WLI B;  1RP3 B;  1JVM A;  3CMA V;  3HB3 B;  4I5S A;  3M99 B;  3SYA A;  1PP9 H;  4JI4 B;  3D8C A;  2FML A;  5B5E Z;  2DWD C;  1RM1 B;  3UO3 A;  1QLE C;  2WLL B;  4MS2 A;  3T1Y O;  2UUC B;  1PV0 A;  2W6I G;  5J2T B;  1YJN V;  4LF8 O;  1RFY A;  5IT9 N;  4X64 O;  2LGQ A;  5H2F Z;  2WSS G;  3OGI B;  1GM8 A;  3AG3 C;  5JVD A;  1M1K W;  5HFM A;  4LBE C;  1NVP D;  3F7V C;  3KZI Z;  1TUB B;  1P49 A;  5FPR A;  3B40 A;  4LFB B;  3LSS A;  5LGU A;  4J42 A;  1HW7 A;  4GLX A;  4JZG A;  1NTK H;  2JIZ G;  2PI5 A;  2GV9 A;  4XDK A;  4KFM A;  2BE3 A;  5CA0 B;  3N2K A;  2EBO A;  3FX7 A;  4W4K A;  2WWW A;  4UB6 Z;  2VS0 A;  3CWB H;  1V54 C;  4HAM A;  4DR4 O;  3RWR D;  2IU0 A;  1OCR C;  4Z1M G;  5BXZ A;  1HNX B;  2FL4 A;  1NH2 B;  4YY3 O;  3T1C A;  2DMX A;  4JAA A;  1ZL8 A;  3OTO O;  2BOB C;  4KHP B;  4YHH B;  5KUK A;  5KA6 A;  1IZ3 A;  1DK1 A;  1KKD A;  3ZHS A;  1VQM V;  1HNZ O;  3IGA C;  5LP6 B;  2OT5 A;  4QE7 A;  3R66 A;  2OCC B;  3QVN A;  2O57 A;  3AG1 C;  3CCQ V;  2HKO A;  3N2G B;  3B8N A;  2ZQM A;  2AXT Z;  1XI1 A;  2DWE C;  2FKX A;  1T5E A;  3JAK B;  3NXS A;  3G4S V;  1HNW O;  2B9Z A;  5GTH Z;  5L3F A;  3CXC U;  1SZX A;  3OGC C;  4X1Y B;  5EYP B;  2ZCE A;  3LNM B;  3DC5 A;  2AHY A;  4DV4 O;  4AHC A;  2G38 A;  2X6B A;  1Q6H A;  1WP8 A;  5LBQ A;  4TOI A;  2HFE C;  3P32 A;  2KG7 A;  3ICX A;  3W7S A;  3ZRW A;  3FYE B;  1PNK A;  1JR9 A;  3KKY A;  3OT7 A;  5GTI Z;  4YJ3 A;  1WN7 A;  1Q43 A;  4L87 A;  2DN9 A;  2JS3 A;  2QEX V;  1OHH G;  1NT2 B;  3ABM B;  1ZSP A;  2RMK B;  2W0X A;  2XAG A;  5LHI A;  3JCZ A;  2XAH A;  4YJ2 A;  2JGD B;  1QVF U;  2WLJ A;  5KA5 A;  3ZJZ A;  3G6B A;  1MAB G;  3SGI A;  1DF4 A;  3OEE G;  4LWS A;  1S0V A;  2A9H A;  5JJN B;  1RM1 C;  3SYQ A;  4X88 A;  3CME V;  2ZM6 O;  3HKC B;  4JI0 B;  1VQ4 V;  4AIL C;  2RDC A;  4DR1 B;  2V1D A;  5LL6 Y;  1EN5 A;  3ZHQ A;  4JI8 B;  1QLN A;  1PL4 A;  3W7W A;  5L3C A;  3UQ8 A;  2VWJ A;  2KSD A;  3HKB A;  5H6Q A;  1TGO A;  2F95 B;  3D36 A;  4DV0 B;  4OPA A;  1S76 D;  3L72 H;  1GM9 A;  1QHT A;  4MTF A;  1BCC H;  3OM3 B;  4TV8 B;  3HKD A;  2DE0 X;  3T4D A;  2FTK A;  3N27 A;  4JI1 B;  2YID A;  2ZT9 B;  1JX9 A;  3MD0 A;  4PDM A;  4UB8 Z;  2ILM A;  5C93 A;  4LF5 O;  2PI4 A;  1IBK O;  4NXM O;  4K35 A;  5EIB C;  2EIL B;  1NTZ H;  4D6T H;  4OPH A;  1SA0 B;  3STZ C;  4DR2 O;  4DV6 B;  3K5M A;  4FFK A;  3WU2 Z;  1HR0 B;  3LSQ A;  1QQC A;  4UVC A;  3AEI A;  4UV8 A;  2NLJ C;  4RUF A;  1H8H G;  1YEW A;  2N04 A;  3H1H H;  3CCR V;  1BHA A;  5LP6 C;  3TXQ A;  4ZHQ B;  4X89 A;  3LUT B;  2YEV B;  3H1I H;  4LF6 B;  1CPY A;  2JK5 C;  2YS8 A;  5KX5 A;  1VQ5 V;  4FMT A;  3ZRX A;  3JAL A;  3ZRS A;  4DV1 B;  1D2D A;  1H8E G;  2A7W A;  4FVM A;  2IH3 C;  2DYR B;  3MHS C;  2CGO A;  3ZED A;  1XQ8 A;  1ZUQ A;  4U3J A;  5LA6 B;  3SPI A;  2X6C A;  3DXR B;  2P22 C;  4O4J A;  3K9S A;  4H0L B;  4J41 A;  2VQF O;  2PUS A;  1U97 A;  4BAY A;  1JQ0 A;  2F4V O;  2X6A A;  3H9V A;  1H2S B;  5CMU A;  4PEL A;  2KB1 A;  5KLV H;  2BSK B;  4RQE A;  4JI4 O;  4AQY B;  2D2C B;  2QDO A;  2P5O A;  1BQZ A;  1L0N H;  1SQF A;  4X65 B;  4GT1 A;  1IBL O;  2UUC O;  1HDJ A;  3E8B A;  4GX0 A;  3ABM C;  1N4C A;  1RSO A;  1VF6 C;  1H2K A;  3JAR B;  3WG7 C;  2DQ0 A;  3FB5 C;  4X1K A;  1I5X A;  1US6 A;  5C8Y B;  4DR5 B;  2PGG A;  4JI6 B;  1S72 V;  1VAR A;  4NR1 A;  4DV3 B;  2JGU A;  2ZXW B;  1SKV A;  2RQ6 A;  2YDE A;  2UXB O;  5E1A C;  4IIJ B;  4PDV A;  1M4U A;  1WJZ A;  1K4C C;  1DF5 A;  5IYD O;  4EB6 A;  1L0L H;  3CC4 V;  4P30 A;  1IXB A;  2CH7 A;  2GUZ B;  3RBZ A;  3CHX A;  3FAV A;  1SZT A;  1FAF A;  1VP7 A;  2ETN A;  4KHP O;  3ZMT A;  1FYJ A;  2X7R B;  3RYC A;  2E76 B;  3O65 A;  1N34 B;  2Q69 A;  4O4L B;  2E75 B;  2EIL C;  1AR5 A;  3JAW B;  3FFQ A;  4CC6 A;  5FNV A;  2Q5Z A;  1QR9 A;  2LO1 A;  2LP7 A;  4NTY A;  3OMA B;  3HKE A;  3ZHT A;  4PI2 A;  4O2B B;  4BR6 A;  2Y4T A;  3JSN A;  4O4H B;  3ZMU A;  5LYJ B;  2GDS A;  2WA4 A;  1JMK C;  2HVK C;  1GN3 A;  1EBO A;  4YXW G;  3RYI B;  2PF4 E;  2WLI A;  1WA8 B;  4JI7 O;  2K1E A;  3T4Z A;  2E74 B;  2ZE7 A;  4HNA B;  4JI3 O;  1YHQ V;  2EZO A;  1VIB A;  3ETE A;  3EVK A;  2MW2 B;  2HP8 A;  1RPO A;  2ZE8 A;  1Y74 B;  2DYR C;  5BZB A;  4MVO A;  5J2T A;  2BTO A;  5ITZ B;  3ETQ A;  3JD1 A;  3T1H B;  1FXV A;  3LNN A;  5LMN B;  5IYZ A;  2C2A A;  4CS2 A;  2E5L B;  4FPP A;  2VQE O;  1TUB A;  1S3J A;  2KKW A;  3OR6 C;  3K03 A;  5LOV B;  2HG5 C;  3M8A A;  1K8A W;  3AK2 A;  5CBF A;  4IYH A;  5CA0 A;  3E2E A;  3NR7 A;  4HZ3 A;  4C7U A;  3B09 A;  1KU9 A;  1VQP V;  2PYL A;  4R7C A;  3OW2 U;  2H3O A;  3BA9 A;  1PNL A;  4JI8 O;  1L8D A;  4D7S A;  3E8F A;  4UCT A;  2JEU A;  2UUB B;  4PA9 A;  1IX9 A;  2KQX A;  4NVP A;  4DV0 O;  4B08 A;  4LFA B;  5H6R A;  2ZXW C;  4HYO A;  4UVB A;  3C90 A;  2WA3 A;  2V7Q G;  2QM4 A;  4FLV A;  1FD9 A;  5LP6 A;  2XT9 A;  1CEZ A;  2Y4U A;  2Z3Y A;  4JI1 O;  1YIT V;  3AG2 B;  5J2U B;  3CD6 V;  2WPD G;  3ZHU A;  4MTG A;  2XAF A;  1V55 B;  3N2G A;  3EXA A;  3UCS C;  2ZIM A;  1VMG A;  3ABT A;  1XDC A;  1K9M W;  3EHB B;  4ICG A;  4DW1 A;  3JAK A;  2QWP B;  2ADQ B;  4DV6 O;  3CCS V;  1IBM O;  1CXZ B;  4FM2 A;  2QR4 A;  5H9C A;  1E1Q G;  5EK0 A;  1PNM A;  3A0H Z;  4BW9 A;  4MVZ A;  3I56 V;  2CTQ A;  4X1Y A;  2LFR A;  3BPZ A;  1I94 B;  1VQO V;  2GHY A;  5EYP A;  4QE9 A;  2HJD A;  4LF6 O;  1N33 B;  2P4K A;  1J5E O;  1H2M A;  3SYP A;  1KQS U;  2IW5 A;  4FM0 A;  4LFC B;  4DV1 O;  5TIS Z;  1BHB A;  5IYB O;  1HP8 A;  3K0D A;  4GKK B;  4LF4 O;  1UPG A;  1K97 A;  2EIN B;  1YCI A;  3JAM N;  1VF6 A;  1B6Q A;  2JGD A;  4P2Z A;  5JWP A;  4IT5 A;  4B7K A;  2ZR3 A;  2AW9 A;  4WFG A;  3E22 B;  5BR8 B;  5EIB D;  1NH2 D;  4MVU A;  4K0K B;  1NR1 A;  3ZMV A;  4MTO A;  4I9Q A;  4AQY O;  2YSU B;  4H33 A;  4DUZ B;  5B1O A;  4JTA B;  1A32 A;  2BTQ B;  3G80 A;  4O2A B;  2EIK B;  5K1X A;  4I7Z B;  4RQF A;  1BZK A;  1G1X B;  1SES A;  3STL C;  2Q7E A;  2QWO B;  4DR5 O;  2YC0 A;  2XHB A;  2EIJ B;  4JGS A;  2V4D A;  4DV3 O;  5L3G A;  1AI5 A;  5GON A;  3LSU A;  4JV5 O;  1GO3 F;  4JZ2 A;  1BE3 H;  2YI9 A;  2A3Q A;  3TJT A;  3VQX A;  1FPO A;  2Q6A A;  1Z5W A;  1HWY A;  4I4T B;  2YXL A;  4XBF A;  2HR3 A;  2YXH A;  2CAZ C;  1SA0 A;  4OXS A;  4H13 B;  4J10 A;  1SQX H;  1YIJ V;  4JI2 B;  2ITC C;  4FLY A;  4J11 A;  2Q0A A;  3CS5 A;  2WLN A;  2ARH A;  3RT3 C;  3W7T A;  3AG7 A;  5GW7 A;  3AG2 C;  5KAF Z;  3TET A;  2QKS A;  2ZR2 A;  5D5Q A;  3CCL V;  4UCU A;  5B3S B;  2YEV A;  1V55 C;  3S3W A;  3ABK B;  4K8Z A;  2OTL V;  1W0K G;  1J95 A;  1K5Q A;  4CS3 A;  1N0N A;  1E1R G;  1M5I A;  2HJF C;  4FK5 C;  3LDE A;  1OV9 A;  4G28 B;  1P7B A;  1OCZ C;  4NTW A;  4DR3 B;  5DEC A;  1SET A;  3SPJ A;  4BIZ A;  3ASO B;  2R9I A;  5LA6 A;  1EFR G;  1Z5V A;  2QJ1 A;  3DXR A;  4MW3 A;  3MHH C;  4MVQ A;  5BY1 A;  3ZIA G;  2YXY A;  1XBL A;  1AJN A;  1YTF B;  3QO5 A;  1K73 W;  1GRJ A;  4JYB A;  1SQG A;  4B3M O;  2UXN A;  3JD2 A;  4RWU A;  3HPL C;  2BSK A;  2XTA A;  4N23 A;  4DR6 B;  1NI8 A;  1XL4 A;  1QU7 A;  2OWO A;  1LUV A;  1B3Q A;  3JAR A;  3RVY A;  1G4Y B;  1K5S A;  1H2G A;  3T1H O;  3CB2 A;  3I5D A;  1EN6 A;  5C8Y A;  3GWK C;  4J9Z B;  4X20 B;  3ZRV A;  3FD9 A;  3A2F A;  4FLW A;  4IIJ A;  3G71 V;  1X4T A;  4G2K A;  1L1F A;  2P90 A;  3H01 A;  3PN1 A;  1FKA O;  3ZS8 C;  3OE7 G;  2N74 A;  2EIK C;  3RW0 A;  4EEQ A;  2Z0A A;  2Y69 B;  2Y0I A;  3K58 A;  1SER A;  4QPK A;  2JJ1 G;  1ROP A;  3QG5 A;  2R9R B;  5FLX N;  4FZ1 A;  2OIE A;  1FXK B;  4ZOL B;  3SR2 C;  3TXS A;  4LFA O;  1XMO B;  4JYA B;  3JAS B;  4TV9 B;  1VQ6 V;  3FYI B;  1SRY A;  1E79 G;  1DTO A;  4J7J A;  5KAI Z;  2E3C A;  5B1A B;  4DRX B;  5IDJ A;  4LCU C;  2X0L A;  2ZIN A;  3C3S A;  4O4L A;  4JYY A;  3F5W C;  3SPG A;  3JAW A;  2XAS A;  2Q0O C;  1I5Y A;  2UUA B;  1Y76 B;  4H37 A;  2H94 A;  4B7E A;  3S3X A;  1COW G;  3E89 A;  5DED A;  1ARO P;  4MT8 A;  4O2B A;  1VF7 A;  4O4H A;  5LYJ A;  5B3S C;  3SDL A;  3RYI A;  1NR7 A;  4KL1 A;  1WA8 A;  1RPR A;  4DV5 B;  3K08 A;  4QPJ A;  1NKD A;  1N33 O;  1H2L A;  2HHH O;  5CA1 A;  4Q20 A;  5JVD B;  4LH6 A;  1Y4M A;  2Q67 A;  4LFC O;  2QTO A;  1M57 B;  2XUM A;  5LMU O;  1Y74 A;  4GZR B;  2OCC C;  4EKW A;  4GKK O;  4PA3 A;  4JI5 B;  3ASO C;  2NN4 A;  1F23 A;  5ITZ A;  2GTS A;  4UV9 A;  4U3F H;  1KUQ A;  3CC2 V;  2QSA A;  2PTM A;  4FLX A;  4GKJ B;  3OFN G;  5LOV A;  4PV1 B;  5BR8 O;  1K4D C;  2QKC A;  4MTX A;  4PA6 A;  4K0K O;  4JTD B;  5B66 Z;  1Q82 W;  1Y6X A;  2QWQ B;  1KP3 A;  2ZNJ A;  1XNQ B;  4LNU B;  2Q4P A;  4X62 B;  2K9P A;  4WBN B;  5LGT A;  4UCS A;  3K59 A;  3VOU A;  1WB8 A;  2P06 A;  1SC5 B;  1VQN V;  5EZY B;  2HLD G;  4DR7 B;  3BA8 A;  4IL6 Z;  1BQ0 A;  2Q8V A;  3TGU H;  2DOS A;  1K3E A;  4ZKI A;  3OEH G;  5KHH A;  1ZLZ A;  4IGG A;  2UXD B;  5L3B A;  3GB7 C;  3J7A U;  2Y69 C;  5J2U A;  2BOC C;  2EX3 A;  2Q7H A;  2LW7 A;  3ML0 A;  3Q4H A;  1WAZ A;  2ZE5 A;  2ITD C;  4JYC A;  4XDJ A;  4LFB O;  1FXK C;  4NXN B;  4E4E A;  3CX5 F;  3CRR A;  1R3I C;  2EUL A;  4X9Q A;  1JFF B;  3BEH A;  4JAS A;  3X2Q B;  2R9A A;  3J80 N;  1Q6I A;  4JI2 O;  2QE7 G;  1ZAU A;  5L3E A;  3P3P A;  4BW5 A;  5B1A C;  3OUS A;  1XHX A;  3LDC A;  4I55 B;  2KG7 B;  5B1B B;  4FLU A;  4Z1V A;  4B3T B;  1VEW A;  1HNX O;  1PM9 A;  1VQK V;  4LF8 B;  1JCH A;  1YSC A;  3JYC A;  2PZS A;  1Y67 A;  4YHH O;  1FFX B;  3L73 H;  4PA4 A;  2IH1 C;  4LWS B;  4DR3 O;  4U7O A;  1F7Y A;  3RYH B;  1TVK B;  3GWO A;  3UKM A;  1QCE A;  3U10 A;  1NBM G;  1B06 A;  3G6E V;  1WLE A;  1H38 A;  1KYO F;  4DR4 B;  1MSD A;  1XEQ A;  4W4L A;  3E22 A;  3CCE V;  4JPR A;  4YY3 B;  1M57 C;  3JD0 A;  1AVM A;  1IXM A;  3TCU A;  1LR1 A;  5CBG A;  2BTQ A;  4O2A A;  2A79 B;  2DQ3 A;  4CC5 A;  1MZE A;  3AK1 A;  3GVM A;  4DV7 B;  4LF7 B;  1XMQ B;  4UCO A;  4LR3 A;  1VQL V;  1XL6 A;  3FKS G;  3FB7 C;  3ZHR A;  4YIO A;  2WLL A;  3UM7 A;  2LFS A;  2EJ7 A;  5KMG B;  5K1P A;  4CS4 A;  4CBC A;  1YVW A;  3BHP A;  4NKG B;  1MMM A;  3IFX A;  4LC1 A;  1AP5 A;  2WLM A;  4I4T A;  1BT8 A;  2JEX A;  4FFB B;  2Q7G A;  4QGP A;  4HBN A;  4GX2 A;  4DV4 B;  3ETG A;  4JYA O;  1NQT A;  4U7N A;  1GN6 A;  4P9P A;  4TSF G;  4JI0 O;  4DR1 O;  3DC6 A;  3P3N A;  1KEC A;  4TQF A;  1CP9 A;  3KCX A;  1N32 B;  1XUQ A;  2F93 B;  3W7X A;  1N8R W;  4X8A A;  1ENV A;  4O4J B;  2CUG A;  1LNQ A;  4TWK A;  1W59 A;  4JAV A;  2UUA O;  4P9O A;  2FYU H;  1VQ7 V;  5IJ0 B;  4CH6 A;  4TUY B;  4PDR A;  4RO2 A;  5B1B C;  1YJW V;  1MG1 A;  2F23 A;  1GTO A;  2ZM6 B;  4Q6G A;  1ZWI C;  5JH7 B;  1R3K C;  4UUJ C;  1UFI A;  2CTP A;  1JPX A;  4DO2 A;  3A8T A;  1HR0 O;  1OCC B;  1OCR B;  1O9H A;  3LDD A;  3QF7 A;  2ZDI C;  1Q81 W;  4JAU A;  1UJW B;  1FXH A;  4E2L A;  3BVO A;  1KB9 F;  4UCR A;  1IUR A;  5DM6 V;  4JI5 O;  2M6Y A;  2A0L A;  4ZI7 B;  4O4I B;  5KHI A;  2QGN A;  3TK1 A;  3ETD A;  2XAJ A;  4WFB V;  2YIC A;  4D7T A;  1BSM A;  4X20 A;  1IBK B;  2OIG A;  4FIP C;  1AI6 A;  3MAQ A;  3OAA G;  1P4R A;  3CPW U;  2P6J A;  2H8P C;  4X1I B;  1M9N A;  2UU9 B;  4BWA A;  1AB3 A;  1ORQ C;  1K7D A;  1PPJ H;  4MVR A;  1KMI Z;  1PD3 A;  4KUM A;  3SYO A;  3RFR A;  2EZP A;  1G8M A;  3VQW A;  1XOU A;  4L8J A;  3UO2 A;  3WB2 A;  2ZNI A;  3CJH B;  3RYC B;  3L71 H;  4UVA A;  3CRM A;  4ZOL A;  1FXK A;  4I9W A;  3AK3 A;  5D5P A;  3PJS K;  3JAS A;  3HKC A;  4TV9 A;  4X65 O;  5IWA B;  1JJ2 U;  5J9P C;  3CCM V;  3K3W A;  2JVD A;  3K5L A;  3UT5 B;  2DYS B;  4DRX A;  5KHJ A;  3EFF K;  1D5A A;  1WP7 A;  4NB5 A;  3CRA A;  3O9O A;  2MK3 A;  1Q8I A;  4I50 B;  4JI6 O;  4WFE A;  4ASU G;  4QJF B;  4B3S B;  4DV2 B;  2CTW A;  4KXR A;  1AR1 B;  1VQ8 V;  3K79 A;  1YTF D;  4NXN O;  1Y76 A;  5IE9 A;  2VQF B;  1K92 A;  4WCE V;  4TV8 A;  2F4V B;  1NU1 H;  1SQQ H;  2CK3 G;  4Z2W A;  1EN4 A;  3A0R A;  4R8C A;  5LXT B;  2M7W A;  4KP4 A;  4J80 A;  5JCO C;  4B3T O;  1IBL B;  3MDS A;  1MSW D;  2LGW A;  2QM8 A;  3OMN B;  2IM9 A;  2OTJ V;  5IYZ B;  2XAQ A;  1Q86 W;  1AI7 A;  5BMV B;  3RYF B;  1K34 A;  4ZHQ A;  2CDY A;  1YJ9 V;  2N05 A;  3SPH A;  5EBW C;  4FJC C;  1DLB A;  2UXB B;  4MSW C;  4PDL A;  1N34 O;  1LUW A;  3BY6 A;  1SQP H;  5CB4 B;  3QNE A;  1W0J G;  1MNG A;  3RVZ A;  4IHJ B;  5EC1 C;  1P7G A;  4X66 B;  4LP8 A;  3WB1 A;  1OCC C;  3ABL B;  2IBZ H;  2WAM A;  4DUY B;  4DXW A;  3W7U A;  1YDX A;  2AZ2 A;  4N21 A;  4LNU A;  3JAT B;  4WBN A;  4EFE A;  3M7M X;  5EZY A;  4I0X B;  1JOY A;  3DSQ A;  1SF9 A;  2LQT A;  3THO A;  4DV7 O;  1GMG A;  1XMQ O;  4LF7 O;  1N0J A;  3BFR A;  2F43 G;  4GX1 A;  5IJ9 B;  5A2Q N;  2EIN C;  3B2E E;  2W0F C;  2B1I A;  4GUN A;  2EIM B;  3T2M A;  5A9G A;  5AG2 A;  4LF9 B;  1URF A;  5LMN O;  4PJ0 Z;  1N36 B;  2CE4 A;  4JF3 A;  5KHK A;  2E5L O;  1B04 A;  1S77 D;  3CCJ V;  2LJ2 A;  1NVP B;  3B4S A;  2ZIO A;  3CSX A;  2F66 C;  3KG2 A;  3VQY A;  5JQG B;  2QWR B;  1JFF A;  4RAI A;  4JI7 B;  1DGS A;  4PI0 A;  2ADP A;  3JD4 A;  4FLZ A;  2JS5 A;  3CEI A;  4JI3 B;  1AI4 A;  5CN0 A;  1GN2 A;  1AJP A;  2DYS C;  2GTA A;  4I55 A;  2P7T C;  3AG4 B;  1NS1 A;  3ZMZ A;  2GUZ A;  2JRI A;  2VRZ A;  1JJO A;  1N32 O;  2UUB O;  2EIJ C;  4GX5 A;  2IU3 A;  4CH4 A;  3L9D A;  3B77 A;  5EBM C;  2GSM B;  2JDI G;  5FL7 G;  5LHG A;  3OD4 A;  1XHZ A;  1R3J C;  3WG7 B;  1F4M A;  3SJB C;  4F4L A;  4OX9 B;  2VQE B;  1FFX A;  2ZDI A;  4K3A A;  3K5N A;  4WFF A;  3DGE A;  2CGN A;  3RYH A;  1TVK A;  4MW8 A;  3HR0 A;  4F6R B;  2ODM A;  2CTR A;  1M56 B;  4UCV A;  5IY5 B;  3IAY A;  1D5N A;  2WLH A;  1I08 A;  4RUE A;  5KHG A;  1EZJ A;  3ASN B;  1IVS A;  1K33 A;  3OMI B;  1KP2 A;  5GON B;  1VF5 B;  3ABK C;  1I94 O;  3SPC A;  2PY5 A;  1R6K A;  3QTC A;  4PA7 A;  2JJ2 G;  1OJH A;  4HNA A;  4DK1 A;  3ABL C;  4B3R B;  1PL0 A;  2OCH A;  1FJG B;  3JCU Z;  4UXN A;  4QNH B;  3E8H A;  1Q5O A;  5KMG A;  3SJQ C;  3CYO A;  2UU9 O;  3N2K B;  1GAX A;  1IBM B;  4K8X A;  2Y48 A;  3IC7 A;  2QKA A;  4FFB A;  2D3O W;  4GYC B;  2NR5 A;  1W2B U;  1GH6 A;  3ZBH A;  1V9P A;  4BIO A;  1SS3 A;  2IJH A;  4BIU A;  4DUZ O;  1J5E B;  1ZL8 B;  2UXC B;  3QO8 A;  5IWA O;  5LGN A;  2YUA A;  3K06 A;  2EIM C;  1QVG U;  3J81 N;  2OYQ A;  5CA3 A;  1I0H A;  3JSL A;  2Y0P A;  4FZ0 A;  4LF4 B; 
#chains in the Genus database with same CATH homology
 3ZMV A;  4MTO A;  3IFX A;  2X6B A;  4LC1 A;  4CZZ A;  3ZN1 A;  4J9Y B;  3ZN0 A;  5LBQ A;  2YSU B;  4H33 A;  2HFE C;  3P32 A;  4JTA B;  5B1O A;  2WLM A;  3W7S A;  2B1G A;  3ZRW A;  3FYE B;  1PNK A;  2EIK B;  2JEX A;  4RQF A;  3SYC A;  4GX2 A;  4L87 A;  1SES A;  3STL C;  2QEX V;  3ETG A;  1NQT A;  4U7N A;  1KD1 W;  1OHH G;  4P9P A;  1BMF G;  3ABM B;  3AG4 C;  4TSF G;  2XAG A;  2EIJ B;  4JGS A;  5LHI A;  3JCZ A;  2XAH A;  5L3G A;  1AI5 A;  2WLJ A;  1KEC A;  1YI2 V;  1QVF U;  5KA5 A;  3ZJZ A;  1CP9 A;  1THZ A;  4ZBM A;  1GO3 F;  1MAB G;  1DF4 A;  4XDL A;  3OEE G;  1S0V A;  1OCO B;  2A9H A;  3ZCC A;  3W7X A;  1N8R W;  1RM1 C;  2DW4 A;  2W6J G;  4X8A A;  4X88 A;  3SYQ A;  3CME V;  2Q6A A;  1VQ4 V;  1ENV A;  1LNQ A;  1HWY A;  4TWK A;  2V1D A;  4R50 A;  4JAV A;  5B1N A;  3ZRW B;  1QLN A;  3JD3 A;  4XBF A;  3W7W A;  2HR3 A;  5L3C A;  5L3D A;  4P9O A;  3CCV V;  1AJQ A;  3E35 A;  3R65 A;  4OXS A;  5H6Q A;  1VQ7 V;  2HVJ C;  1BL8 A;  3D36 A;  4PDR A;  4RO2 A;  1YIJ V;  5B1B C;  1YJW V;  1MG1 A;  2ITC C;  3F7Y C;  1S76 D;  2WLN A;  1GTO A;  1M56 C;  2UXX A;  1GM9 A;  3W7T A;  3E83 A;  1ZWI C;  5GW7 A;  5IY5 C;  1R3K C;  3AG2 C;  4MTF A;  4UUJ C;  4GCZ A;  3K04 A;  1WPX A;  3TET A;  2QKS A;  3OM3 B;  1JPX A;  2ZR2 A;  4DO2 A;  3CCL V;  3T4D A;  2FTK A;  3ASN C;  5B3S B;  2YEV A;  1GK9 A;  1OCC B;  1JX9 A;  1OCR B;  1V55 C;  3K9A A;  3ABK B;  3LDD A;  3MD0 A;  1VQ9 V;  4PDM A;  2ZDI C;  5C93 A;  1Q81 W;  2OTL V;  4JAU A;  1UJW B;  1FXH A;  4E2L A;  1NJI W;  1W0K G;  1J95 A;  2PI4 A;  1K5Q A;  3K0G A;  1MOF A;  1E1R G;  2HJF C;  4FK5 C;  2IJJ A;  2EIL B;  3LDE A;  2WLK A;  4G28 B;  1P7B A;  2NNU A;  5DM6 V;  1OCZ C;  3STZ C;  2A0L A;  1SET A;  3TK1 A;  3ETD A;  3LSQ A;  3SPJ A;  4BIZ A;  2XAJ A;  4UVC A;  3ASO B;  3AEI A;  2R9I A;  4UV8 A;  4WFB V;  1EFR G;  4MVM A;  2NLJ C;  4RUF A;  2Q68 A;  1H8H G;  4MW3 A;  2EJR A;  3I55 V;  3MHH C;  3CCR V;  2B5U A;  1BHA A;  4MVQ A;  4FIP C;  3ZIA G;  1AI6 A;  4X89 A;  1AJN A;  4MVS A;  1YTF B;  3OAA G;  1P4R A;  3QO5 A;  1K73 W;  3CPW U;  2P6J A;  3LUT B;  4JYB A;  2IJK A;  2H8P C;  2YEV B;  1M9N A;  2UXN A;  3JD2 A;  3HPL C;  1CPY A;  1ORQ C;  2JK5 C;  1K7D A;  4MVR A;  4N23 A;  1VQ5 V;  4FMT A;  1PD3 A;  3ZRX A;  4KUM A;  3SYO A;  1XL4 A;  3ZRS A;  2EZP A;  1G8M A;  1H8E G;  4UVA A;  2IH3 C;  3RVY A;  1G4Y B;  1K5S A;  1H2G A;  2DYR B;  3MHS C;  1FXK A;  4I9W A;  2P67 A;  3PJS K;  3SPI A;  2X6C A;  4J9Z B;  4CBC A;  1JJ2 U;  3D3I A;  5J9P C;  3ZRV A;  3CCM V;  1S5H C;  3K3W A;  2XOK G;  1QBZ A;  4BAY A;  1JQ0 A;  2DYS B;  3WFV A;  2X6A A;  3G71 V;  3EFF K;  4G2K A;  5CMU A;  2Z5U A;  4PEL A;  1L1F A;  1FS0 G;  2P90 A;  2KB1 A;  3H01 A;  2MK3 A;  3OE7 G;  1QR8 A;  4RQE A;  2EIK C;  4WFE A;  4ASU G;  4QJF B;  3RW0 A;  2Y69 B;  1AR1 B;  1VQ8 V;  1SER A;  3K79 A;  4QPK A;  2JJ1 G;  1Q7Y W;  1YTF D;  4GT1 A;  1ROP A;  1K92 A;  3CC7 V;  2IJI A;  3E8B A;  4GX0 A;  4WCE V;  2R9R B;  3ABM C;  1QLE B;  3WG7 C;  2CK3 G;  1FXK B;  2DQ0 A;  3FB5 C;  3OR7 C;  1R3L C;  1I5X A;  1VQ6 V;  3FYI B;  3FB8 C;  1SRY A;  3E86 A;  1GKF A;  1E79 G;  1DTO A;  1S72 V;  3X2Q C;  3A0R A;  4R8C A;  2M7W A;  1OCO C;  3AG3 B;  1OZ0 A;  2ZXW B;  4KP4 A;  5IYC O;  5B1A B;  5E1A C;  1GM7 A;  3ABU A;  4PDV A;  3VBB A;  5IDJ A;  4LCU C;  3CCU V;  2QM8 A;  2X0L A;  3ZMS A;  1MSW D;  3OMN B;  1R6N A;  2QM7 A;  2OTJ V;  1K4C C;  1R73 A;  1DF5 A;  3F5W C;  3SPG A;  2XAQ A;  5IYD O;  4TT3 G;  1Q86 W;  1AI7 A;  2XAS A;  1K34 A;  4P30 A;  4WF9 V;  3CC4 V;  1I5Y A;  1KC8 W;  1YJ9 V;  4G27 B;  4H37 A;  5EBW C;  3SPH A;  2H94 A;  4FJC C;  1DLB A;  4MSW C;  1COW G;  1V54 B;  3P30 A;  4PDL A;  3RBZ A;  3BY6 A;  3E89 A;  3QNE A;  1W0J G;  1SZT A;  4QIW F;  3RVZ A;  1ARO P;  4MT8 A;  5EC1 C;  4LP8 A;  3ZMT A;  5B3S C;  1OCC C;  2X7R B;  3ABL B;  5EBL C;  3QO7 A;  2WAM A;  1NR7 A;  1RPR A;  4DXW A;  3W7U A;  2Q69 A;  2ZD9 A;  3K08 A;  4QPJ A;  4WFA V;  1NKD A;  1M90 W;  3B8M A;  4Q20 A;  4N21 A;  1OCZ B;  2EIL C;  3CP1 A;  1Y4M A;  2Q67 A;  2QTO A;  1M57 B;  3AG1 B;  2OCC C;  4EKW A;  1JOY A;  1QR9 A;  4JTC B;  4PA3 A;  1FFT B;  3ASO C;  1GMG A;  2LP7 A;  5HFL A;  1F23 A;  3OMA B;  4WFH A;  4UV9 A;  2F43 G;  1TUE B;  5EC2 C;  5DN6 G;  4GX1 A;  3ZMU A;  3CC2 V;  2ATK C;  1F4N A;  3DTU B;  2AHZ A;  3OFN G;  2EIN C;  2HVK C;  1K4D C;  2W0F C;  2B1I A;  1EBO A;  4YXW G;  2XND G;  4MTX A;  2WLI A;  4PA6 A;  2EIM B;  4JTD B;  3T2M A;  2K1E A;  3T4Z A;  1Q82 W;  1KP3 A;  3FB6 C;  1YHQ V;  4JF3 A;  2EZO A;  3ETE A;  1S77 D;  3CCJ V;  5CBH A;  5LGT A;  1RPO A;  1NVP B;  3VOU A;  2DYR C;  1VQN V;  1F51 A;  4R6Z A;  3KG2 A;  5BZB A;  2HLD G;  4MVO A;  1Y66 A;  4RAI A;  3JD1 A;  1FXV A;  3JD4 A;  1PKX A;  2C2A A;  1K3E A;  1AI4 A;  5CN0 A;  2QA4 V;  4FPP A;  1AJP A;  2DYS C;  4ZKI A;  3OUF A;  1S3J A;  3OEH G;  2P7T C;  3AG4 B;  3K03 A;  3OR6 C;  5KUM A;  2HG5 C;  3ZMZ A;  5LHH A;  3E8G A;  1K8A W;  5CBF A;  2WLI B;  5L3B A;  2EIJ C;  4GX5 A;  2IU3 A;  1JVM A;  3GB7 C;  3E2E A;  2Y69 C;  3B77 A;  5EBM C;  2BOC C;  4HZ3 A;  3CMA V;  3HB3 B;  4I5S A;  2GSM B;  2JDI G;  3M99 B;  5FL7 G;  3SYA A;  5LHG A;  3ML0 A;  1VQP V;  1R3J C;  3WG7 B;  4R7C A;  4JYC A;  2ITD C;  4XDJ A;  1F4M A;  3OW2 U;  4F4L A;  2DWD C;  1RM1 B;  1PNL A;  1QLE C;  2ZDI A;  2WLL B;  4MS2 A;  1FXK C;  2W6I G;  1YJN V;  3E8F A;  1R3I C;  3X2Q B;  4JAS A;  3BEH A;  2JEU A;  4PA9 A;  3DGE A;  4WFF A;  2QE7 G;  2WSS G;  5L3E A;  4MW8 A;  1GM8 A;  3AG3 C;  5H6R A;  2ZXW C;  4BW5 A;  1M1K W;  5HFM A;  4LBE C;  4HYO A;  1NVP D;  3F7V C;  4UVB A;  3OUS A;  5B1A C;  3LDC A;  5B1B B;  3LSS A;  2V7Q G;  5LGU A;  1M56 B;  2JIZ G;  1CEZ A;  2Z3Y A;  2PI5 A;  5IY5 B;  4XDK A;  4KFM A;  1VQK V;  1YIT V;  3AG2 B;  1JCH A;  3CD6 V;  1YSC A;  2WLH A;  4RUE A;  3JYC A;  2EBO A;  2WPD G;  4MTG A;  1EZJ A;  3ASN B;  2WWW A;  2XAF A;  1V55 B;  1K33 A;  3OMI B;  1V54 C;  1KP2 A;  4HAM A;  2IU0 A;  1OCR C;  3ABK C;  4Z1M G;  3SPC A;  3ABT A;  1K9M W;  3EHB B;  1R6K A;  4PA4 A;  4PA7 A;  2IH1 C;  3CCS V;  1NH2 B;  2JJ2 G;  4U7O A;  3GWO A;  5H9C A;  3UKM A;  1QCE A;  1E1Q G;  1NBM G;  3T1C A;  3ABL C;  1PNM A;  5EK0 A;  3G6E V;  1PL0 A;  2BOB C;  1WLE A;  1H38 A;  5KUK A;  5KA6 A;  4MVZ A;  3I56 V;  1KKD A;  4UXN A;  1VQM V;  2LFR A;  4QNH B;  3E8H A;  3IGA C;  1VQO V;  3CCE V;  3SJQ C;  2GHY A;  2OT5 A;  4QE7 A;  3CYO A;  4JPR A;  4QE9 A;  2OCC B;  1M57 C;  3AG1 C;  3JD0 A;  1IXM A;  3SYP A;  3TCU A;  1KQS U;  2IW5 A;  3CCQ V;  2HKO A;  3B8N A;  2ZQM A;  5CBG A;  2Y48 A;  3IC7 A;  1BHB A;  2A79 B;  5IYB O;  2DQ3 A;  2DWE C;  3K0D A;  2D3O W;  3NXS A;  1W2B U;  3G4S V;  1K97 A;  2EIN B;  1VQL V;  1XL6 A;  2IJH A;  3FKS G;  3FB7 C;  4BIU A;  1B6Q A;  3QO8 A;  5LGN A;  3K06 A;  5L3F A;  3CXC U;  2EIM C;  4P2Z A;  1QVG U;  2WLL A;  3UM7 A;  2ZR3 A;  3OGC C;  2LFS A;  4WFG A;  5CA3 A;  1NH2 D;  4MVU A;  3LNM B;  2AHY A;  1NR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...