3E83A

Crystal structure of the the open nak channel pore
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e83A00
3KG2A 5EBLC 4HYOA 3LUTB 2ATKC 3SPHA 3SYQA 2R9RB 2ZXWC 4PA6A 3JYCA 4MVSA 3SYAA 4TWKA 2AHZA 4RUFA 3SPCA 4MW3A 1V55C 2HJFC 4LBEC 1OCOC 4MVUA 4RO2A 3BEHA 4MVMA 2HVJC 3OR7C 2QTOA 4WFFA 2WLJA 1XL6A 2X6CA 3F7YC 2DYRC 2YEVA 4EKWA 5CBGA 2HFEC 3EFFK 3ZJZA 4WFEA 3SPJA 3ASOC 3SYOA 3TCUA 4WFHA 4PA7A 4OXSA 4PDMA 4J9ZB 4MS2A 2P7TC 4R8CA 3E86A 5B1AC 3K08A 3AG1C 3UKMA 4BW5A 4PDLA 4P2ZA 4QE7A 1K4DC 3OGCC 4F4LA 2BOCC 2HG5C 5BZBA 5B1BC 2NLJC 2WLNA 5KUKA 5E1AC 3ASNC 4PA4A 2WLHA 4P9PA 3LDDA 4RUEA 4UUJC 2Q67A 2WLIB 4MTGA 5EC2C 3STZC 5CBFA 3FB7C 4P9OA 3VOUA 1J95A 3UM7A 3ZRSA 1JVMA 4RAIA 4JTCB 2WLLB 2WLLA 3X2QC 1ZWIC 4MTFA 2BOBC 2K1EA 5EBMC 1K4CC 1BL8A 4G28B 3ABLC 4JTAB 4JTDB 3SJQC 4X88A 5EC1C 2W0FC 1KKDA 4DXWA 4MVQA 5B3SC 1OCRC 4LCUC 1ORQC 1V54C 2H8PC 3FB8C 3F7VC 4X89A 3RW0A 3RBZA 1R3KC 2WLMA 4PA9A 1LNQA 1OCCC 1R3LC 3IFXA 3LDCA 3K0DA 4I9WA 3SPIA 1M57C 3E8BA 3IGAC 2EINC 4HZ3A 1P7BA 3SYCA 1OCZC 2ITDC 2WLIA 2Y69C 4QE9A 3K06A 1S5HC 4GX0A 4QNHB 2DWDC 4MVZA 2A79B 2HVKC 2EIMC 4J9YB 1XL4A 3SYPA 3OUSA 3T1CA 4H37A 1R3JC 3LDEA 1R3IC 4X8AA 4MW8A 4H33A 3PJSK 2DWEC 2ITCC 3WG7C 1G4YB 2Q68A 2X6BA 3GB7C 5EK0A 3E89A 4MVRA 3ABMC 4R7CA 4XDJA 3SPGA 5IY5C 4XDLA 2QKSA 3LNMB 4MVOA 3AG4C 4P30A 2EIJC 3OUFA 3RVYA 5EBWC 2A9HA 3K0GA 3STLC 3AG3C 2OCCC 2ZD9A 3E8FA 3F5WC 4R6ZA 3RVZA 3T2MA 3T4ZA 2IH1C 5J9PC 3K04A 4GX5A 3E8GA 4ZBMA 4CBCA 4KFMA 4PA3A 3T4DA 1M56C 2X6AA 4PDRA 3FB6C 3OR6C 2JK5C 2AHYA 4R50A 4G27B 3HPLC 3R65A 2EIKC 4MSWC 2WLKA 3E8HA 3E83A 1QLEC 3FB5C 5CBHA 2A0LA 5KUMA 4WFGA 4PDVA 2EILC 2Q69A 2KB1A 2Q6AA 4GX2A 3AG2C 3K03A 4GX1A 4XDKA 2IH3C 3TETA 4LP8A 3ABKC 4MTOA 2DYSC
chains in the Genus database with same CATH superfamily
4IL6Z 1IXMA 1W0KG 5C8YA 4QPKA 1FXVA 4EB6A 1G6UA 4BWAA 3N2GB 5CB4B 2HP8A 5CN0A 4FM1A 2HFEC 2PYJA 5B1AB 3SPJA 2R70A 4FPPA 3ZMUA 5KHGA 2P7TC 2QJ1A 3A2FA 3JAKA 3RYFA 2R72A 4FFBA 2HLDG 1DGSA 2LW1A 4JYCA 1PP9H 4JAAA 4X1KA 2HEPA 3RYIA 1Y76A 1M90W 1CPYA 3ETQA 5EC1C 1NS1A 1Q86W 1OCRC 5LGUA 3FB8C 3ZN0A 3A0BZ 3CMAV 3U11A 4DK1A 1MNGA 4DR6O 4DV1O 2ETNA 2F4VO 2GUZB 2AZ0A 1PL0A 1HDJA 5J2UA 1JX9A 4QNHB 4UVCA 3T1CA 4BIOA 4YY3O 3R66A 4FZ1A 1Y6XA 1GN6A 1PL4A 4FLUA 2X6BA 3GB7C 1PPJH 5JCOC 3ZHTA 3AG4C 2ZXWB 5EBWC 2OCCC 3A0RA 1SQGA 2GBOA 3T2MA 1M56B 2AXTZ 3BFRA 3ZMVA 2ODMA 1CXZB 3O9OA 5J9PC 3OEEG 1V9PA 1MZEA 2IU3A 2ZR3A 2XAQA 5BR8O 4F6RA 2P4VA 1BGYH 2R9IA 3I5DA 1QLEC 3FB5C 3I56V 3CC2V 1SS3A 1KB9F 4UB6Z 3AG2C 4YJ3B 3ZHVA 4JPRA 3UO2A 4MTOA 1GN4A 1PM9A 5JH7A 1Y74B 1S0VA 2YC0A 3RWRD 4DW1A 3W7XA 2OIEA 2ZCEA 2EX3A 3MHHC 4UCTA 4RUFA 3D3IA 3BCCH 3ASOB 3CS5A 5H5NA 2QDOA 1V54B 3SYOA 3TCUA 2PUSA 2JGDA 3THOA 4LFBO 2XT9A 3AG1C 3ASNB 1K4DC 2F1MA 3UO3A 3UT5B 3G6BA 4UV8A 2WLNA 1S3JA 4LF7O 4UVBA 3IJ4A 3JARA 4X62B 4DR2B 1FFXA 3WFVA 1AJNA 5EBMC 2XTAA 1WLEA 1YDXA 1GN2A 1M1KW 2ZE7A 1S5LZ 5LMUB 1BS3A 3HKDA 3RW0A 1I94B 5FNVA 2DMXA 4KL1A 1XNQB 4K0KB 2EINC 1R6KA 3CRMA 4E2LA 2ITDC 1S5HC 1N33O 2RMKB 5H6QA 2HJDA 1VMGA 4MW8A 5JCOA 5L3DA 4JYYA 3WG7C 3H1LH 1FS0G 2ARHA 3HKCA 5IY5C 3MDSA 3CCLV 3LNMB 1SQBH 2ZD9A 1WNSA 4B08A 3IC9A 4YXWG 4IIJB 4JI8B 4RQEA 1Q90D 1VEWA 4IYHA 2PF4E 1Q43A 2ZINA 4JAUA 1EBOA 4KUMA 2CTPA 4CC5A 5L3GA 2YIDA 3TJTA 1DLBA 1NJIW 3TXQA 1FXKC 2Q7GA 1VQ6V 3RYCA 4AHCA 4B3MO 2UU9B 1BMFG 4EB6B 5C8YB 2JVDA 3JYCA 3X2QB 3K9SA 1XOUA 5B3SB 3FX7A 3LNNA 5LMNB 3AK1A 3IC7A 3JAMN 1NI8A 1GMGA 2OT5A 4DV6B 5GTIZ 3RYFB 4FFBB 3P3PA 3P3NA 2OWOA 2ZE8A 5H6RA 3ETGA 1L8DA 3VOUA 1NTMH 3K3WA 3RYIB 1K92A 5JVDB 4TV8A 3ZS8C 1YXBA 3CHXA 4UCOA 2OYQA 2Z0AA 3JATA 3CB2A 4NXNO 1N36O 1OCZB 5EYPB 3E8BA 1P7BA 2Q4PA 3E22A 4I0XA 3CXHF 5J2UB 5GW7A 2HVKC 3CE2A 2P4KA 5BY1A 2CTRA 4DV2B 3K5MA 1SA0B 5L3EA 4H33A 1H2GA 2ZQMA 2IJKA 3BVOA 3QTCA 4MVOA 4DUYB 1J5EO 3CCEV 2LGWA 3CRQA 1N0NA 5ITZB 4FLVA 2WA3A 1P84F 1EN5A 3ZRWA 1B3QA 1P49A 2VQFO 3ML0A 1P4RA 2AHYA 4F6RB 3ETEA 4HAMA 1DF4A 1G8MA 3G4SV 3DTUB 5E79Z 3QF7A 4OPAA 1FXKA 4GX2A 4UCSA 3K03A 5GONA 4U3JB 1JR9A 1XMOO 3ABKC 2CTWA 1VF7A 4J7ZA 2YUAA 5JH7B 3OTFA 4NYKA 3K57A 2ZXWC 3C90A 2Y4TA 4RO2A 1XL6A 3G71V 1K34A 1I08A 2L35A 2Y4UA 1VQLV 1EN4A 3MHSC 4PDMA 2JGDB 3KCYA 4ZIBA 4J9ZB 4MS2A 1Z2GA 4LFAO 2FKXA 2QTSA 4DR5O 3OTOO 3CCMV 5IE9A 4RAIA 3TXSA 5HFLA 4DR6B 5CB4A 4DV1B 2Q73A 2QA4V 2F4VB 2NNUA 1OCRB 4C7UA 1KU9A 2CAZC 3ICXA 1V54C 3HKDB 3QO5A 1O9GA 1Q8IA 5FNVB 3ZMZA 3GVMA 4YY3B 4LWSA 1HP8A 2IW5A 3JALA 4DV0O 4WF9V 5KHJA 3HKBA 4I7ZB 4MVZA 2F23A 4UXNA 3OUSA 3JD3A 1R6NA 4NTXA 3AG4B 1G4YB 5BR8B 4EEQA 4R7CA 1FD9A 4R6ZA 3M7MX 1QCEA 3QNEA 4DV4O 3VQYA 1HW7A 3CCSV 2GUZA 3H1KH 2JK5C 4KXRA 2XAFA 1Q6IA 2H94A 3AG2B 1AB3A 1GH6A 2M6YA 3KCXA 1AR4A 3OAAG 3H9VA 1KP2A 3H1HH 2XUMA 1MOFA 3CCVV 4CZZA 4IHJA 2ATKC 3CCQV 1D2DA 4LFBB 4DUZO 2UUAO 1LUWA 4NVPA 5DN6G 1AVMA 4FK5C 3LSUA 3B77A 4LF7B 3RN4A 4WFHA 5IT9N 2GV9A 2W0XA 1JA8A 1WB8A 4R8CA 1EFRG 4LH7A 3FAVA 4YJ3A 5IDJA 3B09A 2WSSG 4DW0A 3F5TA 4DR4O 4IYIA 5E1AC 2AZ2A 4PA4A 1NH2D 1Y74A 5CBFA 2YIAA 4L87A 4OX9O 1JPXA 4TOIA 3JD2A 1Z5VA 3X2QC 1YF2A 2YXYA 4TV8B 2BE3A 2JJ2G 1BL8A 3CSXA 2V4DA 2IM9A 4MVQA 5B3SC 1N33B 2YI9A 2EINB 3SPIA 4X9QA 3CXCU 3UT5A 1M93A 2YS8A 4I0XB 1KP3A 4FFKA 4CH5A 2QM4A 1OV9A 1GM8A 3WG7B 1ZLZA 1Y67A 1MZFA 3K59A 2PI5A 3ZMSA 2YIBA 1QHTA 4XDJA 3OT7A 1P7GA 4H13B 2UXXA 4LC1A 4XBFA 3RVZA 5KX5B 1VF5B 4X20A 4JI3O 4KFMA 3ZRWB 1SC5B 3ABTA 1RM1C 4R50A 4B3MB 2CK3G 2M7WA 3P30A 3BPZA 5LBQA 5CBHA 2A0LA 5KUMA 2F43G 2VWJA 2E5LO 2BSKA 4NKGB 5GONB 4UV9A 1WB7A 4ZOLB 4GZRB 3F7YC 2CDYA 3SPHA 4ZI7B 4LBEC 4YIOA 4WFFA 2ZE5A 2E74B 3M99B 2VRZA 4UB8Z 1DF5A 1N32O 4GCZA 1AROP 4PA7A 1THZA 1GKFA 2EZPA 2QWPB 3L75H 1Q3EA 2LO1A 2Z5UA 3ZBHA 1TA8A 2DE0X 4CS2A 1SETA 4J7JA 4CH4A 1VQMV 4NXNB 1N36B 4FJCC 4GUNA 5IJ9A 5BXZA 1K7DA 2GDSA 5CA0A 1SZXA 1IVSA 1SF9A 1WPBA 2QE7G 3ZHQA 3SJQC 2HHHO 2DQ3A 2VWKA 2W0FC 4DR7O 1HNWO 1K9MW 4LWSB 4JI1O 1LNQA 4UVAA 4I9WA 3JALB 1BHBA 2K9PA 4BIUA 3L74H 3RYHA 1VQNV 2QWRB 3EHBB 1J5EB 3HKBB 3FFQA 3KZIZ 5JVDA 2PYLA 3OFNG 4H37A 3CX5F 2VQFB 5EK0A 1SQXH 3W7UA 3E89A 4MVRA 4Q6GA 4UCVA 1NR1A 4AQYO 3HB3B 5FPRA 3FD9A 1OCOB 5EYPA 2IH1C 5B1NA 4DV5O 1FAFA 4PDRA 1XMOB 4ICGA 3HPLC 3E8HA 4CS3A 1ZUQA 2IJIA 1SA0A 3ABKB 4GX1A 4DK0A 3CCRV 4K8ZA 4YIPA 1N0JA 3DC6A 3A8TA 4IHJB 1Q82W 3N2KA 1BQZA 1YCIA 2LW7A 4YHHO 4TT3G 5ITZA 4MW3A 4X65O 1YJWV 2Y0IA 4LFAB 3BEHA 4DR5B 3OR7C 1D5AA 2D3OW 3OTOB 1PNKA 4WFEA 3CWBH 4LNUB 1YVWA 1OCCB 4RQFA 3FAVB 5IWAO 4P2ZA 4U3JA 4QIWF 2UXCO 2WAMA 5LXTA 4UUJC 4D7SA 4LF5O 1QQCA 4KHPO 1JVMA 1XBLA 2IJJA 5BMVA 1W2BU 4DV0B 1EZVH 2G38A 4JTDB 4X88A 1YJ9V 5K1XA 4JI4O 3ETDA 4H44B 4X89A 3OW2U 1JJOA 2Q8VA 4B3TO 1PNMA 2QM7A 3E35A 3CCUV 1FJGO 4O4LB 3SR2C 3BHPA 4DV4B 2KSDA 2OIGA 4U7NA 2JGUA 1URFA 4FM2A 3RVYA 3ABUA 3GWOA 2UXNA 3STLC 2KG7B 3O65A 1DK1A 1AI7A 3D36C 3L70H 3AK2A 4X20B 3WB0A 3T4DA 2X6AA 1FPOA 2FL4A 3OR6C 1SQVH 3DSQA 1XDCA 2DQ0A 3ZCCA 2N05A 4D7TA 3N27A 4DUZB 3ZHUA 2UUAB 2BSKB 4U7OA 4B3RO 2UXBO 4WBNB 2L6LA 1Q81W 1NT2B 1XREA 5D5QA 4JYAO 2JEUA 4MVMA 1XQ8A 5JJNB 1PNLA 4DR4B 1WAZA 1RSOB 3K58A 1AI4A 4PD4F 5DEDA 1HR0O 4OX9B 3L71H 4BW5A 1VQ9V 3CJHB 5B1BC 4KP4A 2WLHA 3SDLA 1AJQA 4P9OA 2QEXV 3UM7A 1K5QA 1GAXA 5DECA 5IJ9B 3SJAC 5CA0B 1MABG 1SQQH 3VQXA 4ZHQB 2ZM6O 5EIBD 2RDCA 2B1IA 3NXSA 2H3OA 4J42A 2P5OA 1NU1H 1GRJA 2XAHA 3CEIA 1YITV 1XHXA 3SYCA 2EIKB 3RYHB 1Q6UA 3CYOA 3E2EA 4DV7O 1L0LH 2DWDC 4J10A 2EILB 1KD1W 3BA8A 4JI3B 4ABMA 4NTWA 2GTAA 1W59A 5IYCO 4O2AA 2XAGA 3CRAA 5LYJB 3OEHG 3D36A 3E8FA 3U0ZA 4I4TA 3ZIAG 2E5LB 1RM1B 3W7TA 2OCHA 4OPHA 3P32A 2YEVB 4Z1VA 4RWUA 3VBBA 1M9NA 1KC8W 3JAWB 2ZIOA 1CP9A 2RCVA 1WP7A 3ZN1A 3N2KB 2W6JG 1YTFD 1WP8A 1N32B 4LF8O 4O4JA 5KX5A 3SYAA 4TWKA 1VQKV 1E1QG 1OCOC 4MVUA 4LF9O 5LP6B 4BAYA 2LFSA 3BA9A 4EKWA 1ROPA 2HR3A 1XI1A 4CH3A 1R1BA 2GHYA 3OGCC 5LGNA 1L0NH 4B7KA 2HG5C 1IBKO 4ZOLA 5LXTB 3JCUZ 5C93A 4PI0A 2HHHB 3LDDA 4ZI7A 3STZC 3LSSA 5EC2C 4GKKO 3WB2A 3ZRSA 1J95A 4DR7B 1HNWB 4D6TH 4JI1B 5BMVB 1XMQO 4Z1MG 1RFYA 1X59A 3L72H 1YHQV 1KECA 3OM3B 3K5OA 1YIJV 3AG3B 3VQVA 2ZNJA 1BZKA 2DW4A 5LOVA 3QO8A 1R3KC 2P90A 1OCCC 1GK9A 2XOKG 1HNZO 3AEIA 1GTOA 2WA4A 1K8AW 3K06A 4AQYB 1QR8A 4GX0A 2A79B 4J9YB 5FLXN 2JS5A 4JI5O 2ZT9B 4X8AA 1R3IC 4X64O 4DV5B 4TSFG 1TUEB 2B5UA 3SGIA 2CE4A 3MAQA 2YSUB 4WFAV 1XEQA 4J41A 4TUYA 4CC6A 1NTKH 1XNRO 3E8GA 4CBCA 2JS3A 1M5IA 3CD6V 1GM9A 1SRYA 1WA8B 1H38A 1K33A 4YHHB 4DO2A 3JSNA 1YZBA 2RQ6A 3T1YO 4EFBA 4X65B 5JJEB 4PDVA 1Q5OA 4JI0O 2Q6AA 4LF4O 3IAYA 4XDKA 3W7WA 1NVPB 5EBLC 4JV5O 3K5LA 2B1GA 1QLNA 4MVSA 4O4IB 4FZ0A 2EJRA 5IWAB 1IBMO 2X6CA 2UXCB 1AI5A 1TUBB 5LHIA 4LF5B 4OXSA 4KHPB 3OMAB 2KKWA 1ZL8B 4X66O 3WB1A 1QR9A 3A0HZ 1VQ4V 4QJFB 5KUKA 2Z3YA 2ZR2A 1I5YA 4JI4B 4RUEA 1N34O 2O57A 1JFFB 4JTCB 1F51A 4B3TB 4JI2O 1B6QA 2D2CB 2BOBC 2BTOA 1H2KA 4LNUA 1EZJA 1FJGB 1N4CA 4DXWA 1YEWA 1FFTB 2H8PC 3NR7A 1H8EG 5F2VO 1K3EA 1NQTA 4WCEV 2EBOA 2IJHA 3UQ8A 1FKAO 3IGAC 1F7YA 4EFEA 3QG5A 4HZ3A 4NXMO 1SQFA 1BCCH 5KA5A 1EN6A 1XL4A 1JOYA 1R3JC 1IDSA 3LDEA 4O2AB 4NR1A 2P22C 2B9ZA 2YXHA 5LHHA 2A9HA 2OTLV 5B1OA 1KYOF 4I4TB 4B3RB 4ZKIA 2UXBB 3RFRA 3CRCA 4FLWA 5JQGB 4O4LA 1TAEA 3JASB 4G27B 1KBHA 3R65A 2EIKC 4JI7O 5FL7G 4JGSA 4JYAB 1S77D 4I9QA 2EILC 1NBMG 3BAAA 2KB1A 2IH3C 1WJZA 2AW9A 2LGQA 2CGOA 4K3AA 2MW2B 4GT1A 3JD1A 3T1HO 4O4JB 3J7AU 1HR0B 2KG7A 5KAFZ 3FKSG 2Q7EA 2AHZA 1RPOA 1K73W 5IYZB 2CUGA 2QTOA 1VQ8V 2WLJA 1QU7A 4N21A 3D8CA 4X1YB 1VP7A 2NN4A 3E86A 4DR1O 5B1BB 1VQ5V 4K35A 4LFCO 1AI6A 4GYCB 4F4LA 4WBNA 1Z5WA 2VQEO 2ZM6B 2PTMA 3OMIB 2WLIB 2EIMB 5IJ0A 2QKAA 3HKEB 2V7QG 1D5NA 4B3SO 5LP6C 4J11A 1RSOA 4TQFA 3B8MA 2UUBO 4DV7B 2JRIA 3C3SA 4WFBV 1VF6C 2YXLA 5LOVB 4LF6O 4DV3O 2N04A 3CJHA 4AI8A 2JIZG 5DM6V 4UFZA 3ZEDA 5LA6B 2F66C 2P67A 1ZTEA 2QWNB 3M8AA 4JZ2A 4ZHQA 4FIPC 1SQPH 1TVKB 3TGUH 4TUYB 3AG3C 4J7KA 4GX5A 1IX9A 4LR3A 3JD0A 1QBZA 3VQWA 1MMMA 4LF8B 2YI8A 4NTYA 2LQTA 1NKDA 3Q4HA 5LGTA 4LF9B 1KUQA 3TETA 2QM8A 5LYJA 2DYSC 4HYOA 3ZRVA 3L9DA 2X0LA 3OMNB 1WPXA 3SPCA 2HJFC 4IT5A 1IBKB 2PI4A 3ABLB 2YEVA 3EFFK 5L3BA 4DR3O 4MT8A 4F6EA 4GKKB 1Q7YW 4A5UB 3JAWA 1COWG 1MSWD 1XMQB 2KQXA 1E79G 2BOCC 2CH7B 1XUQA 1I0HA 5BZBA 2IBZH 4W4KA 1US6A 5L3FA 1JMKC 1MG1A 4PJ0Z 2EZOA 5LP6A 2LJ2A 1HNZB 5TISZ 2WWWA 1ZAUA 2ADPA 1VF6A 3CPWU 1ENVA 1QVFU 1IURA 3ZRXA 1ZSPA 4JI5B 1R3LC 4U3FH 4X64B 2IU0A 3OD4A 2Y48A 2UUCO 1UPGA 4FMTA 1AJPA 2X7RB 2Q0OC 3FYEB 3SYPA 1SKVA 1XNRB 2JJ1G 2E76B 2C2AA 5IYBO 3CC7V 4H0LB 3SPGA 4XDLA 3KKYA 4P30A 2EIJC 1QNMA 1PD3A 3F5WC 3T1YB 3EVKA 3T4ZA 4JI0B 1S5JA 4LF4B 4PA3A 2XHBA 2F95B 4L8JA 4MTXA 5J2TB 4JV5B 2DOSA 3DXRB 2QGNA 3JCZA 4FM0A 4JZGA 2YDEA 4JI6O 1NH2B 4CH6A 1IBMB 2XNDG 2A06H 2ZKOA 1S72V 2ADQB 5AG2A 1NTZH 4YJ2A 3DGEA 4PA6A 1NVPD 1V55C 4X66B 1AR1B 1BE3H 2CTQA 2DYRC 1WA8A 1I5XA 3ZJZA 3CCJV 5EIBC 1H2SB 1MA1A 1N34B 5D5PA 5A9GA 2GTSA 4FLZA 4Z2WA 3K08A 4BW9A 3I55V 3UKMA 4JI2B 2UXDO 3DC5A 3RT3C 1YSCA 3JD4A 4DRXA 3OE7G 4P9PA 2BCCH 1K5SA 4O4IA 4HNAB 3J81N 5IJ0B 1KQSU 4TV9B 2WLLA 1NR7A 4O4HB 4NXMB 5FPOA 1K4CC 4QGPA 1TUBA 5KA6A 1LUVA 4GKJO 1BHAA 1QVGU 1ORQC 1ZL8A 3LDCA 3QVNA 4I50B 1RPRA 1IBLO 4I5SA 4QE9A 2Y69C 1MSDA 2Y0PA 1AR5A 1B06A 1JFFA 2EIMC 4FLXA 1PV0A 2FYUH 1E1RG 2DWEC 5EZYA 2LP7A 2ITCC 2QWOB 2R9AA 2QKSA 4JI7B 3QO7A 3K0GA 2MK3A 3B2EE 3K04A 3BABA 5KHKA 4OGQB 4PI2A 3T1HB 2CGNA 2P06A 3Q4HB 1HNXO 4IGGA 4WFGA 5B66Z 2DN9A 3JAKB 3LUTB 1B04A 3SYQA 3SJCC 4DR1B 4X1KB 1U96A 3CMEV 4LFCB 4JYBA 1Y76B 5JQGA 2VQEB 5CBGA 3JASA 1AP5A 1BQ0A 3APOA 2XASA 3K5NA 2LFRA 5B1AC 4ASUG 1M57B 3S3WA 4B3SB 4O2BA 5KMGA 2PY5A 4QPJA 1I7FA 2HKOA 3G6EV 2UUBB 1S76D 4LF6B 2A3QA 4DV3B 3GWKC 1H2MA 3J80N 5IYZA 1DTOA 1R6TA 4MTFA 1RP3B 3ABMB 1T5EA 5CA3A 4X1YA 4G28B 3ABLC 4JTAB 1L1FA 1OZ0A 5CA1A 1KKCA 1O9HA 2WLMA 3IFXA 3CC4V 5KHIA 4NB5A 2W6IG 5IYDO 1BT8A 2RNBA 1NZ6A 3B4SA 2WLIA 4AILC 4X1IA 3HKEA 2QWQB 5CMUA 5B5EZ 2BTQA 5A2QN 3PJSK 4I55A 1GN3A 4DYLA 1XHZA 3W7SA 4FLYA 5JWPA 1TGOA 3ZX6A 1IXBA 1GO3F 2N74A 5LA6A 2PZSA 1M56C 4J80A 1UFIA 3FB6C 1EM1A 1XILA 1AP6A 3SJBC 2E3CA 2VS0A 2DYSB 2P6JA 1TVKA 1HWYA 1SERA 4MSWC 3KG2A 4DR3B 4W4LA 2ZDIC 1LR1A 4YJ2B 2ZE6A 3JARB 4GLXA 1F4MA 1FFXB 3N2GA 2HVJC 3S3XA 2QSAA 2OTJV 1JQ0A 2XAJA 3ASOC 1BSMA 2Q9LA 1JCHA 1F23A 2QKCA 4QE7A 2NLJC 4DRXB 3ASNC 5H2FZ 1PKXA 4PHZA 3LSQA 3EXAA 2GSMB 4MTGA 3FB7C 3D3QA 5LL6Y 2WLLB 3AK3A 3L73H 4LH6A 1ZWIC 1WN7A 3H01A 2RJZA 4K8XA 2UUCB 2F93B 3ZHSA 2JDIG 3HKCB 2OCCB 5LHGA 1KKDA 1Y66A 2QR4A 4X62O 3APQA 3PN1A 4DR2O 4PA9A 4E4EA 1FYJA 2CH7A 3K0DA 2YICA 1VQOV 3G80A 1U97A 4N23A 1QLEB 5LMUO 1YJNV 5H9CA 1R73A 1I94O 3B8NA 1XNQO 1UJWB 4K0KO 5EZYB 2EIJB 2EULA 1JJ2U 5HFMA 3RYCB 1Q6HA 4FVMA 4JI6B 2RN9A 4ZBMA 3K9AA 1OJHA 4UCRA 4JF3A 1VQPV 5KHHA 3AG1B 2Q7HA 1X4TA 4JI8O 2Q69A 2ZDIA 3UCSC 4LP8A 4PELA 1V55B 2PGGA 2YIBD 2R9RB 2UXDB 2DYRB 3BRCA 2DJVA 3G67A 1K97A 3ZHRA 1VARA 1VIBA 5J2TA 4JAVA 1YI2V 3CP1A 3DXRA 1IZ3A 3JATB 2UU9O 2Q0AA 4PV1B 1N8RW 1M4UA 4O2BB 4PDLA 5KMGB 4G2KA 3FYIB 5GTHZ 5KAIZ 3E22B 4FLTA 2Q67A 4GKJB 2Q5ZA 1OHHG 3B40A 3WU2Z 5LMNO 3MD0A 1Y4MA 1H2NA 2K1EA 4BR6A 2E75B 4BIZA 5IY5B 1IBLB 1ZX3A 4DV6O 3JSLA 5K1PA 2FMLA 3BY6A 5L3CA 4HBNA 4LCUC 5CA1B 2A7WA 3F7VC 1A32A 3RBZA 4UCUA 3H1JH 2Y69B 2AGAA 1M57C 1VQ7V 2NR5A 2JEXA 1OCZC 2FTKA 3TK1A 2V1DA 4HNAA 4TV9A 4X1IB 2BTQB 3RGBA 4O4HA 4I55B 5KLVH 1YTFB 1FXKB 2Q68A 1FXHA 3ABMC 4CS4A 3OUFA 1CEZA 1H8HG 1W0JG 3CRRA 4TQDA 3ZMTA 1HNXB 1AILA 3H1IH 4IIJA 4DV2O 4I50A 2FB5A 4JASA 1F4NA 4Q20A 3OGIB 1GM7A 3C3TA 2ZNIA 3U10A 5JJJB 4DUYO 2WPDG 2WLKA 3E83A 1KMIZ 1H2LA 3K79A 1SESA 1SZTA 3AG7A 2ZIMA 1G1XB 2ILMA 2EJ7A 3HR0A 4B7EA
chains in the Genus database with same CATH topology
1IXMA 2W6JG 1YTFD 2ATKC 3CCQV 1W0KG 3DGEA 4PA6A 4QPKA 1FXVA 3SYAA 1NVPD 4TWKA 1VQKV 1V55C 1E1QG 1OCOC 4MVUA 1AR1B 4BAYA 2LFSA 4FK5C 5DN6G 3B77A 2DYRC 5CN0A 1I5XA 4EKWA 2HFEC 3ZJZA 3CCJV 1ROPA 5B1AB 3SPJA 4FPPA 2HR3A 3ZMUA 4WFHA 2P7TC 4R8CA 1EFRG 3K08A 3I55V 3UKMA 2GHYA 3OGCC 5LGNA 5IDJA 2HG5C 2WSSG 1YSCA 5E1AC 4PA4A 3JD4A 1NH2D 5C93A 3OE7G 3LDDA 4P9PA 2HLDG 3STZC 3LSSA 5CBFA 5EC2C 1K5SA 4L87A 4JYCA 3ZRSA 1J95A 1KQSU 1JPXA 3JD2A 2WLLA 3X2QC 1NR7A 4Z1MG 1YHQV 1K4CC 2JJ2G 1BL8A 1M90W 1CPYA 1KECA 3OM3B 5KA6A 1YIJV 3AG3B 5EC1C 1Q86W 4MVQA 5B3SC 1OCRC 5LGUA 1BHAA 1QVGU 1ORQC 2DW4A 3FB8C 3ZN0A 2EINB 3CMAV 3QO8A 1R3KC 2P90A 3SPIA 1OCCC 3LDCA 1GK9A 2XOKG 3CXCU 1RPRA 3AEIA 4I5SA 1GTOA 4QE9A 1KP3A 2Y69C 1K8AW 1PL0A 3K06A 1JX9A 1QR8A 4GX0A 4QNHB 1GM8A 2A79B 4UVCA 2EIMC 4J9YB 3WG7B 3T1CA 4X8AA 1R3IC 1E1RG 2PI5A 2DWEC 2LP7A 2ITCC 3ZMSA 4TSFG 1TUEB 2B5UA 2X6BA 3GB7C 4XDJA 2QKSA 3AG4C 2YSUB 2ZXWB 5EBWC 3QO7A 2UXXA 3K0GA 4WFAV 2OCCC 4LC1A 4XBFA 3A0RA 3RVZA 3T2MA 1M56B 2MK3A 3ZMVA 5J9PC 3K04A 3E8GA 3OEEG 4CBCA 4KFMA 2IU3A 2ZR3A 3ZRWB 3CD6V 1GM9A 2XAQA 1SRYA 3ABTA 1RM1C 1H38A 4R50A 1K33A 2CK3G 2R9IA 4DO2A 2M7WA 3P30A 1QLEC 3FB5C 5LBQA 3I56V 5CBHA 3CC2V 2A0LA 5KUMA 2F43G 4PDVA 4WFGA 2Q6AA 3AG2C 4JPRA 4XDKA 4UV9A 3W7WA 1NVPB 3F7YC 4MTOA 5EBLC 3LUTB 2B1GA 1S0VA 3SPHA 3SYQA 1QLNA 3W7XA 4MVSA 3MHHC 4RUFA 3CMEV 2EJRA 3D3IA 4LBEC 4JYBA 4WFFA 3ASOB 2X6CA 3M99B 5CBGA 1DF5A 1AI5A 4GCZA 1V54B 1AROP 2XASA 3SYOA 3TCUA 5LHIA 4PA7A 4OXSA 1THZA 2LFRA 1GKFA 3OMAB 5B1AC 2EZPA 4ASUG 3AG1C 1M57B 3ASNB 1K4DC 1QR9A 1VQ4V 4QPJA 4QJFB 2Z5UA 4UV8A 2WLNA 1S3JA 5KUKA 2HKOA 2Z3YA 2ZR2A 4UVBA 1I5YA 3G6EV 4RUEA 1SETA 1S76D 4JTCB 1VQMV 4FJCC 3WFVA 1F51A 1B6QA 1AJNA 1DTOA 4MTFA 5EBMC 1K7DA 2BOBC 3ABMB 5CA3A 1WLEA 2QE7G 1EZJA 4G28B 3ABLC 4JTAB 1L1FA 3SJQC 1M1KW 2DQ3A 2W0FC 4DXWA 1OZ0A 1FFTB 2H8PC 1H8EG 3RW0A 1K3EA 1K9MW 2WLMA 1LNQA 1NQTA 3IFXA 4I9WA 4UVAA 2EBOA 2IJHA 4WCEV 3CC4V 3IGAC 1BHBA 2EINC 1R6KA 2W6IG 4HZ3A 5IYDO 4BIUA 4E2LA 5KA5A 2ITDC 2WLIA 1VQNV 3EHBB 1S5HC 5CMUA 1XL4A 5H6QA 1JOYA 3OFNG 4H37A 1R3JC 3LDEA 4MW8A 3PJSK 5L3DA 3WG7C 1FS0G 5EK0A 3W7UA 3E89A 3W7SA 4MVRA 5IY5C 3CCLV 1NR1A 3LNMB 5LHHA 2A9HA 3HB3B 2ZD9A 2OTLV 1OCOB 5B1OA 4YXWG 2IH1C 5B1NA 4RQEA 1GO3F 4ZKIA 1M56C 4PDRA 3FB6C 4G27B 3HPLC 4JAUA 3R65A 2EIKC 1EBOA 5FL7G 3E8HA 4JGSA 4KUMA 2IJIA 1S77D 3ABKB 2DYSB 2EILC 1NBMG 5L3GA 2KB1A 4GX1A 2P6JA 3CCRV 1NJIW 1DLBA 2IH3C 1HWYA 1SERA 4MSWC 1Q82W 1FXKC 3KG2A 1VQ6V 2ZDIC 4GT1A 3JD1A 4TT3G 1BMFG 3JYCA 3FKSG 3X2QB 2AHZA 4MW3A 1RPOA 1YJWV 1K73W 1F4MA 3BEHA 2HVJC 3OR7C 2QTOA 1VQ8V 2WLJA 4N21A 2OTJV 2D3OW 1PNKA 5B3SB 1JQ0A 4WFEA 2XAJA 3ASOC 1OCCB 4RQFA 1JCHA 1F23A 3E86A 3IC7A 5B1BB 1VQ5V 4P2ZA 4QE7A 1AI6A 4F4LA 4QIWF 1GMGA 2OT5A 2NLJC 3ASNC 1PKXA 2WAMA 3LSQA 4UUJC 3OMIB 2GSMB 2WLIB 4MTGA 3FB7C 5H6RA 2EIMB 3ETGA 3VOUA 1JVMA 3K3WA 2WLLB 1K92A 2IJJA 2V7QG 1ZWIC 1W2BU 3H01A 2JDIG 4JTDB 4X88A 2OCCB 3B8MA 1YJ9V 5LHGA 3ETDA 1KKDA 4WFBV 1Y66A 4X89A 3OW2U 4PA9A 2JIZG 3K0DA 1OCZB 1PNMA 5DM6V 3E8BA 2QM7A 3E35A 1VQOV 1P7BA 3CCUV 2P67A 4N23A 1QLEB 1YJNV 5H9CA 5GW7A 1R73A 2HVKC 3B8NA 5L3EA 4H33A 1H2GA 4U7NA 1UJWB 2EIJB 2ZQMA 4FIPC 2IJKA 4MVOA 3RVYA 3ABUA 3GWOA 2UXNA 1JJ2U 5HFMA 3STLC 3AG3C 3CCEV 1AI7A 4GX5A 4ZBMA 3K9AA 3T4DA 3ZRWA 2X6AA 3JD0A 3ML0A 3OR6C 1P4RA 2AHYA 4JF3A 1QBZA 2DQ0A 1VQPV 3ETEA 4HAMA 1DF4A 1G8MA 3ZCCA 3G4SV 3DTUB 1NKDA 3AG1B 5LGTA 4U7OA 2Q69A 1FXKA 4GX2A 3K03A 2ZDIA 3TETA 4LP8A 2QM8A 3ABKC 2DYSC 1Q81W 4HYOA 3ZRVA 4PELA 1V55B 2X0LA 2R9RB 2ZXWC 3OMNB 1WPXA 2DYRB 3SPCA 2HJFC 2JEUA 4RO2A 1K97A 4MVMA 1PNLA 1XL6A 3G71V 2PI4A 3ABLB 2YEVA 4JAVA 3EFFK 5L3BA 1K34A 3CP1A 1YI2V 1AI4A 4MT8A 1VQLV 1Q7YW 3MHSC 4PDMA 4J9ZB 1COWG 4MS2A 1MSWD 1N8RW 4BW5A 1VQ9V 4PDLA 1E79G 2BOCC 4G2KA 3FYIB 5BZBA 5B1BC 4KP4A 2WLHA 3CCMV 2Q67A 1S72V 5L3FA 1OHHG 1AJQA 4P9OA 2QEXV 3UM7A 4RAIA 1K5QA 1MG1A 2EZOA 3MD0A 1Y4MA 5HFLA 2K1EA 4BIZA 5IY5B 2QA4V 1MABG 2NNUA 1OCRB 2WWWA 3BY6A 3CPWU 1ENVA 5L3CA 2B1IA 1QVFU 4LCUC 3NXSA 1V54C 3QO5A 3ZRXA 3F7VC 3ZMZA 3RBZA 1R3LC 2Y69B 2IW5A 1M57C 2XAHA 2IU0A 2Y48A 1YITV 1VQ7V 4WF9V 3SYCA 2JEXA 2EIKB 1OCZC 4FMTA 2FTKA 3TK1A 3CYOA 2V1DA 1AJPA 3E2EA 2X7RB 3FYEB 2DWDC 4MVZA 2EILB 4UXNA 3SYPA 3OUSA 1KD1W 3JD3A 1R6NA 2JJ1G 1YTFB 3AG4B 1FXKB 1G4YB 2C2AA 2Q68A 5IYCO 5IYBO 3CC7V 1FXHA 3ABMC 4R7CA 3SPGA 4XDLA 4P30A 2XAGA 2EIJC 3OUFA 3OEHG 3D36A 1CEZA 1H8HG 1W0JG 3E8FA 1PD3A 3F5WC 4R6ZA 1QCEA 3QNEA 3ZMTA 3T4ZA 3ZIAG 3CCSV 1RM1B 4PA3A 4JASA 1F4NA 4Q20A 3W7TA 3P32A 1GM7A 2JK5C 2YEVB 4MTXA 2XAFA 3VBBA 2WPDG 2WLKA 1M9NA 2H94A 3E83A 3JCZA 3AG2B 1KC8W 1CP9A 1NH2B 3K79A 1SESA 1SZTA 3OAAG 2XNDG 1KP2A 3ZN1A 1MOFA 3CCVV 4CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KG2 A;  5EBL C;  4HYO A;  3LUT B;  2ATK C;  3SPH A;  3SYQ A;  2R9R B;  2ZXW C;  4PA6 A;  3JYC A;  4MVS A;  3SYA A;  4TWK A;  2AHZ A;  4RUF A;  3SPC A;  4MW3 A;  1V55 C;  2HJF C;  4LBE C;  1OCO C;  4MVU A;  4RO2 A;  3BEH A;  4MVM A;  2HVJ C;  3OR7 C;  2QTO A;  4WFF A;  2WLJ A;  1XL6 A;  2X6C A;  3F7Y C;  2DYR C;  2YEV A;  4EKW A;  5CBG A;  2HFE C;  3EFF K;  3ZJZ A;  4WFE A;  3SPJ A;  3ASO C;  3SYO A;  3TCU A;  4WFH A;  4PA7 A;  4OXS A;  4PDM A;  4J9Z B;  4MS2 A;  2P7T C;  4R8C A;  3E86 A;  5B1A C;  3K08 A;  3AG1 C;  3UKM A;  4BW5 A;  4PDL A;  4P2Z A;  4QE7 A;  1K4D C;  3OGC C;  4F4L A;  2BOC C;  2HG5 C;  5BZB A;  5B1B C;  2NLJ C;  2WLN A;  5KUK A;  5E1A C;  3ASN C;  4PA4 A;  2WLH A;  4P9P A;  3LDD A;  4RUE A;  4UUJ C;  2Q67 A;  2WLI B;  4MTG A;  5EC2 C;  3STZ C;  5CBF A;  3FB7 C;  4P9O A;  3VOU A;  1J95 A;  3UM7 A;  3ZRS A;  1JVM A;  4RAI A;  4JTC B;  2WLL B;  2WLL A;  3X2Q C;  1ZWI C;  4MTF A;  2BOB C;  2K1E A;  5EBM C;  1K4C C;  1BL8 A;  4G28 B;  3ABL C;  4JTA B;  4JTD B;  3SJQ C;  4X88 A;  5EC1 C;  2W0F C;  1KKD A;  4DXW A;  4MVQ A;  5B3S C;  1OCR C;  4LCU C;  1ORQ C;  1V54 C;  2H8P C;  3FB8 C;  3F7V C;  4X89 A;  3RW0 A;  3RBZ A;  1R3K C;  2WLM A;  4PA9 A;  1LNQ A;  1OCC C;  1R3L C;  3IFX A;  3LDC A;  3K0D A;  4I9W A;  3SPI A;  1M57 C;  3E8B A;  3IGA C;  2EIN C;  4HZ3 A;  1P7B A;  3SYC A;  1OCZ C;  2ITD C;  2WLI A;  2Y69 C;  4QE9 A;  3K06 A;  1S5H C;  4GX0 A;  4QNH B;  2DWD C;  4MVZ A;  2A79 B;  2HVK C;  2EIM C;  4J9Y B;  1XL4 A;  3SYP A;  3OUS A;  3T1C A;  4H37 A;  1R3J C;  3LDE A;  1R3I C;  4X8A A;  4MW8 A;  4H33 A;  3PJS K;  2DWE C;  2ITC C;  3WG7 C;  1G4Y B;  2Q68 A;  2X6B A;  3GB7 C;  5EK0 A;  3E89 A;  4MVR A;  3ABM C;  4R7C A;  4XDJ A;  3SPG A;  5IY5 C;  4XDL A;  2QKS A;  3LNM B;  4MVO A;  3AG4 C;  4P30 A;  2EIJ C;  3OUF A;  3RVY A;  5EBW C;  2A9H A;  3K0G A;  3STL C;  3AG3 C;  2OCC C;  2ZD9 A;  3E8F A;  3F5W C;  4R6Z A;  3RVZ A;  3T2M A;  3T4Z A;  2IH1 C;  5J9P C;  3K04 A;  4GX5 A;  3E8G A;  4ZBM A;  4CBC A;  4KFM A;  4PA3 A;  3T4D A;  1M56 C;  2X6A A;  4PDR A;  3FB6 C;  3OR6 C;  2JK5 C;  2AHY A;  4R50 A;  4G27 B;  3HPL C;  3R65 A;  2EIK C;  4MSW C;  2WLK A;  3E8H A;  3E83 A;  1QLE C;  3FB5 C;  5CBH A;  2A0L A;  5KUM A;  4WFG A;  4PDV A;  2EIL C;  2Q69 A;  2KB1 A;  2Q6A A;  4GX2 A;  3AG2 C;  3K03 A;  4GX1 A;  4XDK A;  2IH3 C;  3TET A;  4LP8 A;  3ABK C;  4MTO A;  2DYS C; 
#chains in the Genus database with same CATH topology
 4IL6 Z;  1IXM A;  1W0K G;  5C8Y A;  4QPK A;  1FXV A;  4EB6 A;  1G6U A;  4BWA A;  3N2G B;  5CB4 B;  2HP8 A;  5CN0 A;  4FM1 A;  2HFE C;  2PYJ A;  5B1A B;  3SPJ A;  2R70 A;  4FPP A;  3ZMU A;  5KHG A;  2P7T C;  2QJ1 A;  3A2F A;  3JAK A;  3RYF A;  2R72 A;  4FFB A;  2HLD G;  1DGS A;  2LW1 A;  4JYC A;  1PP9 H;  4JAA A;  4X1K A;  2HEP A;  3RYI A;  1Y76 A;  1M90 W;  1CPY A;  3ETQ A;  5EC1 C;  1NS1 A;  1Q86 W;  1OCR C;  5LGU A;  3FB8 C;  3ZN0 A;  3A0B Z;  3CMA V;  3U11 A;  4DK1 A;  1MNG A;  4DR6 O;  4DV1 O;  2ETN A;  2F4V O;  2GUZ B;  2AZ0 A;  1PL0 A;  1HDJ A;  5J2U A;  1JX9 A;  4QNH B;  4UVC A;  3T1C A;  4BIO A;  4YY3 O;  3R66 A;  4FZ1 A;  1Y6X A;  1GN6 A;  1PL4 A;  4FLU A;  2X6B A;  3GB7 C;  1PPJ H;  5JCO C;  3ZHT A;  3AG4 C;  2ZXW B;  5EBW C;  2OCC C;  3A0R A;  1SQG A;  2GBO A;  3T2M A;  1M56 B;  2AXT Z;  3BFR A;  3ZMV A;  2ODM A;  1CXZ B;  3O9O A;  5J9P C;  3OEE G;  1V9P A;  1MZE A;  2IU3 A;  2ZR3 A;  2XAQ A;  5BR8 O;  4F6R A;  2P4V A;  1BGY H;  2R9I A;  3I5D A;  1QLE C;  3FB5 C;  3I56 V;  3CC2 V;  1SS3 A;  1KB9 F;  4UB6 Z;  3AG2 C;  4YJ3 B;  3ZHV A;  4JPR A;  3UO2 A;  4MTO A;  1GN4 A;  1PM9 A;  5JH7 A;  1Y74 B;  1S0V A;  2YC0 A;  3RWR D;  4DW1 A;  3W7X A;  2OIE A;  2ZCE A;  2EX3 A;  3MHH C;  4UCT A;  4RUF A;  3D3I A;  3BCC H;  3ASO B;  3CS5 A;  5H5N A;  2QDO A;  1V54 B;  3SYO A;  3TCU A;  2PUS A;  2JGD A;  3THO A;  4LFB O;  2XT9 A;  3AG1 C;  3ASN B;  1K4D C;  2F1M A;  3UO3 A;  3UT5 B;  3G6B A;  4UV8 A;  2WLN A;  1S3J A;  4LF7 O;  4UVB A;  3IJ4 A;  3JAR A;  4X62 B;  4DR2 B;  1FFX A;  3WFV A;  1AJN A;  5EBM C;  2XTA A;  1WLE A;  1YDX A;  1GN2 A;  1M1K W;  2ZE7 A;  1S5L Z;  5LMU B;  1BS3 A;  3HKD A;  3RW0 A;  1I94 B;  5FNV A;  2DMX A;  4KL1 A;  1XNQ B;  4K0K B;  2EIN C;  1R6K A;  3CRM A;  4E2L A;  2ITD C;  1S5H C;  1N33 O;  2RMK B;  5H6Q A;  2HJD A;  1VMG A;  4MW8 A;  5JCO A;  5L3D A;  4JYY A;  3WG7 C;  3H1L H;  1FS0 G;  2ARH A;  3HKC A;  5IY5 C;  3MDS A;  3CCL V;  3LNM B;  1SQB H;  2ZD9 A;  1WNS A;  4B08 A;  3IC9 A;  4YXW G;  4IIJ B;  4JI8 B;  4RQE A;  1Q90 D;  1VEW A;  4IYH A;  2PF4 E;  1Q43 A;  2ZIN A;  4JAU A;  1EBO A;  4KUM A;  2CTP A;  4CC5 A;  5L3G A;  2YID A;  3TJT A;  1DLB A;  1NJI W;  3TXQ A;  1FXK C;  2Q7G A;  1VQ6 V;  3RYC A;  4AHC A;  4B3M O;  2UU9 B;  1BMF G;  4EB6 B;  5C8Y B;  2JVD A;  3JYC A;  3X2Q B;  3K9S A;  1XOU A;  5B3S B;  3FX7 A;  3LNN A;  5LMN B;  3AK1 A;  3IC7 A;  3JAM N;  1NI8 A;  1GMG A;  2OT5 A;  4DV6 B;  5GTI Z;  3RYF B;  4FFB B;  3P3P A;  3P3N A;  2OWO A;  2ZE8 A;  5H6R A;  3ETG A;  1L8D A;  3VOU A;  1NTM H;  3K3W A;  3RYI B;  1K92 A;  5JVD B;  4TV8 A;  3ZS8 C;  1YXB A;  3CHX A;  4UCO A;  2OYQ A;  2Z0A A;  3JAT A;  3CB2 A;  4NXN O;  1N36 O;  1OCZ B;  5EYP B;  3E8B A;  1P7B A;  2Q4P A;  3E22 A;  4I0X A;  3CXH F;  5J2U B;  5GW7 A;  2HVK C;  3CE2 A;  2P4K A;  5BY1 A;  2CTR A;  4DV2 B;  3K5M A;  1SA0 B;  5L3E A;  4H33 A;  1H2G A;  2ZQM A;  2IJK A;  3BVO A;  3QTC A;  4MVO A;  4DUY B;  1J5E O;  3CCE V;  2LGW A;  3CRQ A;  1N0N A;  5ITZ B;  4FLV A;  2WA3 A;  1P84 F;  1EN5 A;  3ZRW A;  1B3Q A;  1P49 A;  2VQF O;  3ML0 A;  1P4R A;  2AHY A;  4F6R B;  3ETE A;  4HAM A;  1DF4 A;  1G8M A;  3G4S V;  3DTU B;  5E79 Z;  3QF7 A;  4OPA A;  1FXK A;  4GX2 A;  4UCS A;  3K03 A;  5GON A;  4U3J B;  1JR9 A;  1XMO O;  3ABK C;  2CTW A;  1VF7 A;  4J7Z A;  2YUA A;  5JH7 B;  3OTF A;  4NYK A;  3K57 A;  2ZXW C;  3C90 A;  2Y4T A;  4RO2 A;  1XL6 A;  3G71 V;  1K34 A;  1I08 A;  2L35 A;  2Y4U A;  1VQL V;  1EN4 A;  3MHS C;  4PDM A;  2JGD B;  3KCY A;  4ZIB A;  4J9Z B;  4MS2 A;  1Z2G A;  4LFA O;  2FKX A;  2QTS A;  4DR5 O;  3OTO O;  3CCM V;  5IE9 A;  4RAI A;  3TXS A;  5HFL A;  4DR6 B;  5CB4 A;  4DV1 B;  2Q73 A;  2QA4 V;  2F4V B;  2NNU A;  1OCR B;  4C7U A;  1KU9 A;  2CAZ C;  3ICX A;  1V54 C;  3HKD B;  3QO5 A;  1O9G A;  1Q8I A;  5FNV B;  3ZMZ A;  3GVM A;  4YY3 B;  4LWS A;  1HP8 A;  2IW5 A;  3JAL A;  4DV0 O;  4WF9 V;  5KHJ A;  3HKB A;  4I7Z B;  4MVZ A;  2F23 A;  4UXN A;  3OUS A;  3JD3 A;  1R6N A;  4NTX A;  3AG4 B;  1G4Y B;  5BR8 B;  4EEQ A;  4R7C A;  1FD9 A;  4R6Z A;  3M7M X;  1QCE A;  3QNE A;  4DV4 O;  3VQY A;  1HW7 A;  3CCS V;  2GUZ A;  3H1K H;  2JK5 C;  4KXR A;  2XAF A;  1Q6I A;  2H94 A;  3AG2 B;  1AB3 A;  1GH6 A;  2M6Y A;  3KCX A;  1AR4 A;  3OAA G;  3H9V A;  1KP2 A;  3H1H H;  2XUM A;  1MOF A;  3CCV V;  4CZZ A;  4IHJ A;  2ATK C;  3CCQ V;  1D2D A;  4LFB B;  4DUZ O;  2UUA O;  1LUW A;  4NVP A;  5DN6 G;  1AVM A;  4FK5 C;  3LSU A;  3B77 A;  4LF7 B;  3RN4 A;  4WFH A;  5IT9 N;  2GV9 A;  2W0X A;  1JA8 A;  1WB8 A;  4R8C A;  1EFR G;  4LH7 A;  3FAV A;  4YJ3 A;  5IDJ A;  3B09 A;  2WSS G;  4DW0 A;  3F5T A;  4DR4 O;  4IYI A;  5E1A C;  2AZ2 A;  4PA4 A;  1NH2 D;  1Y74 A;  5CBF A;  2YIA A;  4L87 A;  4OX9 O;  1JPX A;  4TOI A;  3JD2 A;  1Z5V A;  3X2Q C;  1YF2 A;  2YXY A;  4TV8 B;  2BE3 A;  2JJ2 G;  1BL8 A;  3CSX A;  2V4D A;  2IM9 A;  4MVQ A;  5B3S C;  1N33 B;  2YI9 A;  2EIN B;  3SPI A;  4X9Q A;  3CXC U;  3UT5 A;  1M93 A;  2YS8 A;  4I0X B;  1KP3 A;  4FFK A;  4CH5 A;  2QM4 A;  1OV9 A;  1GM8 A;  3WG7 B;  1ZLZ A;  1Y67 A;  1MZF A;  3K59 A;  2PI5 A;  3ZMS A;  2YIB A;  1QHT A;  4XDJ A;  3OT7 A;  1P7G A;  4H13 B;  2UXX A;  4LC1 A;  4XBF A;  3RVZ A;  5KX5 B;  1VF5 B;  4X20 A;  4JI3 O;  4KFM A;  3ZRW B;  1SC5 B;  3ABT A;  1RM1 C;  4R50 A;  4B3M B;  2CK3 G;  2M7W A;  3P30 A;  3BPZ A;  5LBQ A;  5CBH A;  2A0L A;  5KUM A;  2F43 G;  2VWJ A;  2E5L O;  2BSK A;  4NKG B;  5GON B;  4UV9 A;  1WB7 A;  4ZOL B;  4GZR B;  3F7Y C;  2CDY A;  3SPH A;  4ZI7 B;  4LBE C;  4YIO A;  4WFF A;  2ZE5 A;  2E74 B;  3M99 B;  2VRZ A;  4UB8 Z;  1DF5 A;  1N32 O;  4GCZ A;  1ARO P;  4PA7 A;  1THZ A;  1GKF A;  2EZP A;  2QWP B;  3L75 H;  1Q3E A;  2LO1 A;  2Z5U A;  3ZBH A;  1TA8 A;  2DE0 X;  4CS2 A;  1SET A;  4J7J A;  4CH4 A;  1VQM V;  4NXN B;  1N36 B;  4FJC C;  4GUN A;  5IJ9 A;  5BXZ A;  1K7D A;  2GDS A;  5CA0 A;  1SZX A;  1IVS A;  1SF9 A;  1WPB A;  2QE7 G;  3ZHQ A;  3SJQ C;  2HHH O;  2DQ3 A;  2VWK A;  2W0F C;  4DR7 O;  1HNW O;  1K9M W;  4LWS B;  4JI1 O;  1LNQ A;  4UVA A;  4I9W A;  3JAL B;  1BHB A;  2K9P A;  4BIU A;  3L74 H;  3RYH A;  1VQN V;  2QWR B;  3EHB B;  1J5E B;  3HKB B;  3FFQ A;  3KZI Z;  5JVD A;  2PYL A;  3OFN G;  4H37 A;  3CX5 F;  2VQF B;  5EK0 A;  1SQX H;  3W7U A;  3E89 A;  4MVR A;  4Q6G A;  4UCV A;  1NR1 A;  4AQY O;  3HB3 B;  5FPR A;  3FD9 A;  1OCO B;  5EYP A;  2IH1 C;  5B1N A;  4DV5 O;  1FAF A;  4PDR A;  1XMO B;  4ICG A;  3HPL C;  3E8H A;  4CS3 A;  1ZUQ A;  2IJI A;  1SA0 A;  3ABK B;  4GX1 A;  4DK0 A;  3CCR V;  4K8Z A;  4YIP A;  1N0J A;  3DC6 A;  3A8T A;  4IHJ B;  1Q82 W;  3N2K A;  1BQZ A;  1YCI A;  2LW7 A;  4YHH O;  4TT3 G;  5ITZ A;  4MW3 A;  4X65 O;  1YJW V;  2Y0I A;  4LFA B;  3BEH A;  4DR5 B;  3OR7 C;  1D5A A;  2D3O W;  3OTO B;  1PNK A;  4WFE A;  3CWB H;  4LNU B;  1YVW A;  1OCC B;  4RQF A;  3FAV B;  5IWA O;  4P2Z A;  4U3J A;  4QIW F;  2UXC O;  2WAM A;  5LXT A;  4UUJ C;  4D7S A;  4LF5 O;  1QQC A;  4KHP O;  1JVM A;  1XBL A;  2IJJ A;  5BMV A;  1W2B U;  4DV0 B;  1EZV H;  2G38 A;  4JTD B;  4X88 A;  1YJ9 V;  5K1X A;  4JI4 O;  3ETD A;  4H44 B;  4X89 A;  3OW2 U;  1JJO A;  2Q8V A;  4B3T O;  1PNM A;  2QM7 A;  3E35 A;  3CCU V;  1FJG O;  4O4L B;  3SR2 C;  3BHP A;  4DV4 B;  2KSD A;  2OIG A;  4U7N A;  2JGU A;  1URF A;  4FM2 A;  3RVY A;  3ABU A;  3GWO A;  2UXN A;  3STL C;  2KG7 B;  3O65 A;  1DK1 A;  1AI7 A;  3D36 C;  3L70 H;  3AK2 A;  4X20 B;  3WB0 A;  3T4D A;  2X6A A;  1FPO A;  2FL4 A;  3OR6 C;  1SQV H;  3DSQ A;  1XDC A;  2DQ0 A;  3ZCC A;  2N05 A;  4D7T A;  3N27 A;  4DUZ B;  3ZHU A;  2UUA B;  2BSK B;  4U7O A;  4B3R O;  2UXB O;  4WBN B;  2L6L A;  1Q81 W;  1NT2 B;  1XRE A;  5D5Q A;  4JYA O;  2JEU A;  4MVM A;  1XQ8 A;  5JJN B;  1PNL A;  4DR4 B;  1WAZ A;  1RSO B;  3K58 A;  1AI4 A;  4PD4 F;  5DED A;  1HR0 O;  4OX9 B;  3L71 H;  4BW5 A;  1VQ9 V;  3CJH B;  5B1B C;  4KP4 A;  2WLH A;  3SDL A;  1AJQ A;  4P9O A;  2QEX V;  3UM7 A;  1K5Q A;  1GAX A;  5DEC A;  5IJ9 B;  3SJA C;  5CA0 B;  1MAB G;  1SQQ H;  3VQX A;  4ZHQ B;  2ZM6 O;  5EIB D;  2RDC A;  2B1I A;  3NXS A;  2H3O A;  4J42 A;  2P5O A;  1NU1 H;  1GRJ A;  2XAH A;  3CEI A;  1YIT V;  1XHX A;  3SYC A;  2EIK B;  3RYH B;  1Q6U A;  3CYO A;  3E2E A;  4DV7 O;  1L0L H;  2DWD C;  4J10 A;  2EIL B;  1KD1 W;  3BA8 A;  4JI3 B;  4ABM A;  4NTW A;  2GTA A;  1W59 A;  5IYC O;  4O2A A;  2XAG A;  3CRA A;  5LYJ B;  3OEH G;  3D36 A;  3E8F A;  3U0Z A;  4I4T A;  3ZIA G;  2E5L B;  1RM1 B;  3W7T A;  2OCH A;  4OPH A;  3P32 A;  2YEV B;  4Z1V A;  4RWU A;  3VBB A;  1M9N A;  1KC8 W;  3JAW B;  2ZIO A;  1CP9 A;  2RCV A;  1WP7 A;  3ZN1 A;  3N2K B;  2W6J G;  1YTF D;  1WP8 A;  1N32 B;  4LF8 O;  4O4J A;  5KX5 A;  3SYA A;  4TWK A;  1VQK V;  1E1Q G;  1OCO C;  4MVU A;  4LF9 O;  5LP6 B;  4BAY A;  2LFS A;  3BA9 A;  4EKW A;  1ROP A;  2HR3 A;  1XI1 A;  4CH3 A;  1R1B A;  2GHY A;  3OGC C;  5LGN A;  1L0N H;  4B7K A;  2HG5 C;  1IBK O;  4ZOL A;  5LXT B;  3JCU Z;  5C93 A;  4PI0 A;  2HHH B;  3LDD A;  4ZI7 A;  3STZ C;  3LSS A;  5EC2 C;  4GKK O;  3WB2 A;  3ZRS A;  1J95 A;  4DR7 B;  1HNW B;  4D6T H;  4JI1 B;  5BMV B;  1XMQ O;  4Z1M G;  1RFY A;  1X59 A;  3L72 H;  1YHQ V;  1KEC A;  3OM3 B;  3K5O A;  1YIJ V;  3AG3 B;  3VQV A;  2ZNJ A;  1BZK A;  2DW4 A;  5LOV A;  3QO8 A;  1R3K C;  2P90 A;  1OCC C;  1GK9 A;  2XOK G;  1HNZ O;  3AEI A;  1GTO A;  2WA4 A;  1K8A W;  3K06 A;  4AQY B;  1QR8 A;  4GX0 A;  2A79 B;  4J9Y B;  5FLX N;  2JS5 A;  4JI5 O;  2ZT9 B;  4X8A A;  1R3I C;  4X64 O;  4DV5 B;  4TSF G;  1TUE B;  2B5U A;  3SGI A;  2CE4 A;  3MAQ A;  2YSU B;  4WFA V;  1XEQ A;  4J41 A;  4TUY A;  4CC6 A;  1NTK H;  1XNR O;  3E8G A;  4CBC A;  2JS3 A;  1M5I A;  3CD6 V;  1GM9 A;  1SRY A;  1WA8 B;  1H38 A;  1K33 A;  4YHH B;  4DO2 A;  3JSN A;  1YZB A;  2RQ6 A;  3T1Y O;  4EFB A;  4X65 B;  5JJE B;  4PDV A;  1Q5O A;  4JI0 O;  2Q6A A;  4LF4 O;  3IAY A;  4XDK A;  3W7W A;  1NVP B;  5EBL C;  4JV5 O;  3K5L A;  2B1G A;  1QLN A;  4MVS A;  4O4I B;  4FZ0 A;  2EJR A;  5IWA B;  1IBM O;  2X6C A;  2UXC B;  1AI5 A;  1TUB B;  5LHI A;  4LF5 B;  4OXS A;  4KHP B;  3OMA B;  2KKW A;  1ZL8 B;  4X66 O;  3WB1 A;  1QR9 A;  3A0H Z;  1VQ4 V;  4QJF B;  5KUK A;  2Z3Y A;  2ZR2 A;  1I5Y A;  4JI4 B;  4RUE A;  1N34 O;  2O57 A;  1JFF B;  4JTC B;  1F51 A;  4B3T B;  4JI2 O;  1B6Q A;  2D2C B;  2BOB C;  2BTO A;  1H2K A;  4LNU A;  1EZJ A;  1FJG B;  1N4C A;  4DXW A;  1YEW A;  1FFT B;  2H8P C;  3NR7 A;  1H8E G;  5F2V O;  1K3E A;  1NQT A;  4WCE V;  2EBO A;  2IJH A;  3UQ8 A;  1FKA O;  3IGA C;  1F7Y A;  4EFE A;  3QG5 A;  4HZ3 A;  4NXM O;  1SQF A;  1BCC H;  5KA5 A;  1EN6 A;  1XL4 A;  1JOY A;  1R3J C;  1IDS A;  3LDE A;  4O2A B;  4NR1 A;  2P22 C;  2B9Z A;  2YXH A;  5LHH A;  2A9H A;  2OTL V;  5B1O A;  1KYO F;  4I4T B;  4B3R B;  4ZKI A;  2UXB B;  3RFR A;  3CRC A;  4FLW A;  5JQG B;  4O4L A;  1TAE A;  3JAS B;  4G27 B;  1KBH A;  3R65 A;  2EIK C;  4JI7 O;  5FL7 G;  4JGS A;  4JYA B;  1S77 D;  4I9Q A;  2EIL C;  1NBM G;  3BAA A;  2KB1 A;  2IH3 C;  1WJZ A;  2AW9 A;  2LGQ A;  2CGO A;  4K3A A;  2MW2 B;  4GT1 A;  3JD1 A;  3T1H O;  4O4J B;  3J7A U;  1HR0 B;  2KG7 A;  5KAF Z;  3FKS G;  2Q7E A;  2AHZ A;  1RPO A;  1K73 W;  5IYZ B;  2CUG A;  2QTO A;  1VQ8 V;  2WLJ A;  1QU7 A;  4N21 A;  3D8C A;  4X1Y B;  1VP7 A;  2NN4 A;  3E86 A;  4DR1 O;  5B1B B;  1VQ5 V;  4K35 A;  4LFC O;  1AI6 A;  4GYC B;  4F4L A;  4WBN A;  1Z5W A;  2VQE O;  2ZM6 B;  2PTM A;  3OMI B;  2WLI B;  2EIM B;  5IJ0 A;  2QKA A;  3HKE B;  2V7Q G;  1D5N A;  4B3S O;  5LP6 C;  4J11 A;  1RSO A;  4TQF A;  3B8M A;  2UUB O;  4DV7 B;  2JRI A;  3C3S A;  4WFB V;  1VF6 C;  2YXL A;  5LOV B;  4LF6 O;  4DV3 O;  2N04 A;  3CJH A;  4AI8 A;  2JIZ G;  5DM6 V;  4UFZ A;  3ZED A;  5LA6 B;  2F66 C;  2P67 A;  1ZTE A;  2QWN B;  3M8A A;  4JZ2 A;  4ZHQ A;  4FIP C;  1SQP H;  1TVK B;  3TGU H;  4TUY B;  3AG3 C;  4J7K A;  4GX5 A;  1IX9 A;  4LR3 A;  3JD0 A;  1QBZ A;  3VQW A;  1MMM A;  4LF8 B;  2YI8 A;  4NTY A;  2LQT A;  1NKD A;  3Q4H A;  5LGT A;  4LF9 B;  1KUQ A;  3TET A;  2QM8 A;  5LYJ A;  2DYS C;  4HYO A;  3ZRV A;  3L9D A;  2X0L A;  3OMN B;  1WPX A;  3SPC A;  2HJF C;  4IT5 A;  1IBK B;  2PI4 A;  3ABL B;  2YEV A;  3EFF K;  5L3B A;  4DR3 O;  4MT8 A;  4F6E A;  4GKK B;  1Q7Y W;  4A5U B;  3JAW A;  1COW G;  1MSW D;  1XMQ B;  2KQX A;  1E79 G;  2BOC C;  2CH7 B;  1XUQ A;  1I0H A;  5BZB A;  2IBZ H;  4W4K A;  1US6 A;  5L3F A;  1JMK C;  1MG1 A;  4PJ0 Z;  2EZO A;  5LP6 A;  2LJ2 A;  1HNZ B;  5TIS Z;  2WWW A;  1ZAU A;  2ADP A;  1VF6 A;  3CPW U;  1ENV A;  1QVF U;  1IUR A;  3ZRX A;  1ZSP A;  4JI5 B;  1R3L C;  4U3F H;  4X64 B;  2IU0 A;  3OD4 A;  2Y48 A;  2UUC O;  1UPG A;  4FMT A;  1AJP A;  2X7R B;  2Q0O C;  3FYE B;  3SYP A;  1SKV A;  1XNR B;  2JJ1 G;  2E76 B;  2C2A A;  5IYB O;  3CC7 V;  4H0L B;  3SPG A;  4XDL A;  3KKY A;  4P30 A;  2EIJ C;  1QNM A;  1PD3 A;  3F5W C;  3T1Y B;  3EVK A;  3T4Z A;  4JI0 B;  1S5J A;  4LF4 B;  4PA3 A;  2XHB A;  2F95 B;  4L8J A;  4MTX A;  5J2T B;  4JV5 B;  2DOS A;  3DXR B;  2QGN A;  3JCZ A;  4FM0 A;  4JZG A;  2YDE A;  4JI6 O;  1NH2 B;  4CH6 A;  1IBM B;  2XND G;  2A06 H;  2ZKO A;  1S72 V;  2ADQ B;  5AG2 A;  1NTZ H;  4YJ2 A;  3DGE A;  4PA6 A;  1NVP D;  1V55 C;  4X66 B;  1AR1 B;  1BE3 H;  2CTQ A;  2DYR C;  1WA8 A;  1I5X A;  3ZJZ A;  3CCJ V;  5EIB C;  1H2S B;  1MA1 A;  1N34 B;  5D5P A;  5A9G A;  2GTS A;  4FLZ A;  4Z2W A;  3K08 A;  4BW9 A;  3I55 V;  3UKM A;  4JI2 B;  2UXD O;  3DC5 A;  3RT3 C;  1YSC A;  3JD4 A;  4DRX A;  3OE7 G;  4P9P A;  2BCC H;  1K5S A;  4O4I A;  4HNA B;  3J81 N;  5IJ0 B;  1KQS U;  4TV9 B;  2WLL A;  1NR7 A;  4O4H B;  4NXM B;  5FPO A;  1K4C C;  4QGP A;  1TUB A;  5KA6 A;  1LUV A;  4GKJ O;  1BHA A;  1QVG U;  1ORQ C;  1ZL8 A;  3LDC A;  3QVN A;  4I50 B;  1RPR A;  1IBL O;  4I5S A;  4QE9 A;  2Y69 C;  1MSD A;  2Y0P A;  1AR5 A;  1B06 A;  1JFF A;  2EIM C;  4FLX A;  1PV0 A;  2FYU H;  1E1R G;  2DWE C;  5EZY A;  2LP7 A;  2ITC C;  2QWO B;  2R9A A;  2QKS A;  4JI7 B;  3QO7 A;  3K0G A;  2MK3 A;  3B2E E;  3K04 A;  3BAB A;  5KHK A;  4OGQ B;  4PI2 A;  3T1H B;  2CGN A;  2P06 A;  3Q4H B;  1HNX O;  4IGG A;  4WFG A;  5B66 Z;  2DN9 A;  3JAK B;  3LUT B;  1B04 A;  3SYQ A;  3SJC C;  4DR1 B;  4X1K B;  1U96 A;  3CME V;  4LFC B;  4JYB A;  1Y76 B;  5JQG A;  2VQE B;  5CBG A;  3JAS A;  1AP5 A;  1BQ0 A;  3APO A;  2XAS A;  3K5N A;  2LFR A;  5B1A C;  4ASU G;  1M57 B;  3S3W A;  4B3S B;  4O2B A;  5KMG A;  2PY5 A;  4QPJ A;  1I7F A;  2HKO A;  3G6E V;  2UUB B;  1S76 D;  4LF6 B;  2A3Q A;  4DV3 B;  3GWK C;  1H2M A;  3J80 N;  5IYZ A;  1DTO A;  1R6T A;  4MTF A;  1RP3 B;  3ABM B;  1T5E A;  5CA3 A;  4X1Y A;  4G28 B;  3ABL C;  4JTA B;  1L1F A;  1OZ0 A;  5CA1 A;  1KKC A;  1O9H A;  2WLM A;  3IFX A;  3CC4 V;  5KHI A;  4NB5 A;  2W6I G;  5IYD O;  1BT8 A;  2RNB A;  1NZ6 A;  3B4S A;  2WLI A;  4AIL C;  4X1I A;  3HKE A;  2QWQ B;  5CMU A;  5B5E Z;  2BTQ A;  5A2Q N;  3PJS K;  4I55 A;  1GN3 A;  4DYL A;  1XHZ A;  3W7S A;  4FLY A;  5JWP A;  1TGO A;  3ZX6 A;  1IXB A;  1GO3 F;  2N74 A;  5LA6 A;  2PZS A;  1M56 C;  4J80 A;  1UFI A;  3FB6 C;  1EM1 A;  1XIL A;  1AP6 A;  3SJB C;  2E3C A;  2VS0 A;  2DYS B;  2P6J A;  1TVK A;  1HWY A;  1SER A;  4MSW C;  3KG2 A;  4DR3 B;  4W4L A;  2ZDI C;  1LR1 A;  4YJ2 B;  2ZE6 A;  3JAR B;  4GLX A;  1F4M A;  1FFX B;  3N2G A;  2HVJ C;  3S3X A;  2QSA A;  2OTJ V;  1JQ0 A;  2XAJ A;  3ASO C;  1BSM A;  2Q9L A;  1JCH A;  1F23 A;  2QKC A;  4QE7 A;  2NLJ C;  4DRX B;  3ASN C;  5H2F Z;  1PKX A;  4PHZ A;  3LSQ A;  3EXA A;  2GSM B;  4MTG A;  3FB7 C;  3D3Q A;  5LL6 Y;  2WLL B;  3AK3 A;  3L73 H;  4LH6 A;  1ZWI C;  1WN7 A;  3H01 A;  2RJZ A;  4K8X A;  2UUC B;  2F93 B;  3ZHS A;  2JDI G;  3HKC B;  2OCC B;  5LHG A;  1KKD A;  1Y66 A;  2QR4 A;  4X62 O;  3APQ A;  3PN1 A;  4DR2 O;  4PA9 A;  4E4E A;  1FYJ A;  2CH7 A;  3K0D A;  2YIC A;  1VQO V;  3G80 A;  1U97 A;  4N23 A;  1QLE B;  5LMU O;  1YJN V;  5H9C A;  1R73 A;  1I94 O;  3B8N A;  1XNQ O;  1UJW B;  4K0K O;  5EZY B;  2EIJ B;  2EUL A;  1JJ2 U;  5HFM A;  3RYC B;  1Q6H A;  4FVM A;  4JI6 B;  2RN9 A;  4ZBM A;  3K9A A;  1OJH A;  4UCR A;  4JF3 A;  1VQP V;  5KHH A;  3AG1 B;  2Q7H A;  1X4T A;  4JI8 O;  2Q69 A;  2ZDI A;  3UCS C;  4LP8 A;  4PEL A;  1V55 B;  2PGG A;  2YIB D;  2R9R B;  2UXD B;  2DYR B;  3BRC A;  2DJV A;  3G67 A;  1K97 A;  3ZHR A;  1VAR A;  1VIB A;  5J2T A;  4JAV A;  1YI2 V;  3CP1 A;  3DXR A;  1IZ3 A;  3JAT B;  2UU9 O;  2Q0A A;  4PV1 B;  1N8R W;  1M4U A;  4O2B B;  4PDL A;  5KMG B;  4G2K A;  3FYI B;  5GTH Z;  5KAI Z;  3E22 B;  4FLT A;  2Q67 A;  4GKJ B;  2Q5Z A;  1OHH G;  3B40 A;  3WU2 Z;  5LMN O;  3MD0 A;  1Y4M A;  1H2N A;  2K1E A;  4BR6 A;  2E75 B;  4BIZ A;  5IY5 B;  1IBL B;  1ZX3 A;  4DV6 O;  3JSL A;  5K1P A;  2FML A;  3BY6 A;  5L3C A;  4HBN A;  4LCU C;  5CA1 B;  2A7W A;  3F7V C;  1A32 A;  3RBZ A;  4UCU A;  3H1J H;  2Y69 B;  2AGA A;  1M57 C;  1VQ7 V;  2NR5 A;  2JEX A;  1OCZ C;  2FTK A;  3TK1 A;  2V1D A;  4HNA A;  4TV9 A;  4X1I B;  2BTQ B;  3RGB A;  4O4H A;  4I55 B;  5KLV H;  1YTF B;  1FXK B;  2Q68 A;  1FXH A;  3ABM C;  4CS4 A;  3OUF A;  1CEZ A;  1H8H G;  1W0J G;  3CRR A;  4TQD A;  3ZMT A;  1HNX B;  1AIL A;  3H1I H;  4IIJ A;  4DV2 O;  4I50 A;  2FB5 A;  4JAS A;  1F4N A;  4Q20 A;  3OGI B;  1GM7 A;  3C3T A;  2ZNI A;  3U10 A;  5JJJ B;  4DUY O;  2WPD G;  2WLK A;  3E83 A;  1KMI Z;  1H2L A;  3K79 A;  1SES A;  1SZT A;  3AG7 A;  2ZIM A;  1G1X B;  2ILM A;  2EJ7 A;  3HR0 A;  4B7E A; 
#chains in the Genus database with same CATH homology
 1IXM A;  2W6J G;  1YTF D;  2ATK C;  3CCQ V;  1W0K G;  3DGE A;  4PA6 A;  4QPK A;  1FXV A;  3SYA A;  1NVP D;  4TWK A;  1VQK V;  1V55 C;  1E1Q G;  1OCO C;  4MVU A;  1AR1 B;  4BAY A;  2LFS A;  4FK5 C;  5DN6 G;  3B77 A;  2DYR C;  5CN0 A;  1I5X A;  4EKW A;  2HFE C;  3ZJZ A;  3CCJ V;  1ROP A;  5B1A B;  3SPJ A;  4FPP A;  2HR3 A;  3ZMU A;  4WFH A;  2P7T C;  4R8C A;  1EFR G;  3K08 A;  3I55 V;  3UKM A;  2GHY A;  3OGC C;  5LGN A;  5IDJ A;  2HG5 C;  2WSS G;  1YSC A;  5E1A C;  4PA4 A;  3JD4 A;  1NH2 D;  5C93 A;  3OE7 G;  3LDD A;  4P9P A;  2HLD G;  3STZ C;  3LSS A;  5CBF A;  5EC2 C;  1K5S A;  4L87 A;  4JYC A;  3ZRS A;  1J95 A;  1KQS U;  1JPX A;  3JD2 A;  2WLL A;  3X2Q C;  1NR7 A;  4Z1M G;  1YHQ V;  1K4C C;  2JJ2 G;  1BL8 A;  1M90 W;  1CPY A;  1KEC A;  3OM3 B;  5KA6 A;  1YIJ V;  3AG3 B;  5EC1 C;  1Q86 W;  4MVQ A;  5B3S C;  1OCR C;  5LGU A;  1BHA A;  1QVG U;  1ORQ C;  2DW4 A;  3FB8 C;  3ZN0 A;  2EIN B;  3CMA V;  3QO8 A;  1R3K C;  2P90 A;  3SPI A;  1OCC C;  3LDC A;  1GK9 A;  2XOK G;  3CXC U;  1RPR A;  3AEI A;  4I5S A;  1GTO A;  4QE9 A;  1KP3 A;  2Y69 C;  1K8A W;  1PL0 A;  3K06 A;  1JX9 A;  1QR8 A;  4GX0 A;  4QNH B;  1GM8 A;  2A79 B;  4UVC A;  2EIM C;  4J9Y B;  3WG7 B;  3T1C A;  4X8A A;  1R3I C;  1E1R G;  2PI5 A;  2DWE C;  2LP7 A;  2ITC C;  3ZMS A;  4TSF G;  1TUE B;  2B5U A;  2X6B A;  3GB7 C;  4XDJ A;  2QKS A;  3AG4 C;  2YSU B;  2ZXW B;  5EBW C;  3QO7 A;  2UXX A;  3K0G A;  4WFA V;  2OCC C;  4LC1 A;  4XBF A;  3A0R A;  3RVZ A;  3T2M A;  1M56 B;  2MK3 A;  3ZMV A;  5J9P C;  3K04 A;  3E8G A;  3OEE G;  4CBC A;  4KFM A;  2IU3 A;  2ZR3 A;  3ZRW B;  3CD6 V;  1GM9 A;  2XAQ A;  1SRY A;  3ABT A;  1RM1 C;  1H38 A;  4R50 A;  1K33 A;  2CK3 G;  2R9I A;  4DO2 A;  2M7W A;  3P30 A;  1QLE C;  3FB5 C;  5LBQ A;  3I56 V;  5CBH A;  3CC2 V;  2A0L A;  5KUM A;  2F43 G;  4PDV A;  4WFG A;  2Q6A A;  3AG2 C;  4JPR A;  4XDK A;  4UV9 A;  3W7W A;  1NVP B;  3F7Y C;  4MTO A;  5EBL C;  3LUT B;  2B1G A;  1S0V A;  3SPH A;  3SYQ A;  1QLN A;  3W7X A;  4MVS A;  3MHH C;  4RUF A;  3CME V;  2EJR A;  3D3I A;  4LBE C;  4JYB A;  4WFF A;  3ASO B;  2X6C A;  3M99 B;  5CBG A;  1DF5 A;  1AI5 A;  4GCZ A;  1V54 B;  1ARO P;  2XAS A;  3SYO A;  3TCU A;  5LHI A;  4PA7 A;  4OXS A;  1THZ A;  2LFR A;  1GKF A;  3OMA B;  5B1A C;  2EZP A;  4ASU G;  3AG1 C;  1M57 B;  3ASN B;  1K4D C;  1QR9 A;  1VQ4 V;  4QPJ A;  4QJF B;  2Z5U A;  4UV8 A;  2WLN A;  1S3J A;  5KUK A;  2HKO A;  2Z3Y A;  2ZR2 A;  4UVB A;  1I5Y A;  3G6E V;  4RUE A;  1SET A;  1S76 D;  4JTC B;  1VQM V;  4FJC C;  3WFV A;  1F51 A;  1B6Q A;  1AJN A;  1DTO A;  4MTF A;  5EBM C;  1K7D A;  2BOB C;  3ABM B;  5CA3 A;  1WLE A;  2QE7 G;  1EZJ A;  4G28 B;  3ABL C;  4JTA B;  1L1F A;  3SJQ C;  1M1K W;  2DQ3 A;  2W0F C;  4DXW A;  1OZ0 A;  1FFT B;  2H8P C;  1H8E G;  3RW0 A;  1K3E A;  1K9M W;  2WLM A;  1LNQ A;  1NQT A;  3IFX A;  4I9W A;  4UVA A;  2EBO A;  2IJH A;  4WCE V;  3CC4 V;  3IGA C;  1BHB A;  2EIN C;  1R6K A;  2W6I G;  4HZ3 A;  5IYD O;  4BIU A;  4E2L A;  5KA5 A;  2ITD C;  2WLI A;  1VQN V;  3EHB B;  1S5H C;  5CMU A;  1XL4 A;  5H6Q A;  1JOY A;  3OFN G;  4H37 A;  1R3J C;  3LDE A;  4MW8 A;  3PJS K;  5L3D A;  3WG7 C;  1FS0 G;  5EK0 A;  3W7U A;  3E89 A;  3W7S A;  4MVR A;  5IY5 C;  3CCL V;  1NR1 A;  3LNM B;  5LHH A;  2A9H A;  3HB3 B;  2ZD9 A;  2OTL V;  1OCO B;  5B1O A;  4YXW G;  2IH1 C;  5B1N A;  4RQE A;  1GO3 F;  4ZKI A;  1M56 C;  4PDR A;  3FB6 C;  4G27 B;  3HPL C;  4JAU A;  3R65 A;  2EIK C;  1EBO A;  5FL7 G;  3E8H A;  4JGS A;  4KUM A;  2IJI A;  1S77 D;  3ABK B;  2DYS B;  2EIL C;  1NBM G;  5L3G A;  2KB1 A;  4GX1 A;  2P6J A;  3CCR V;  1NJI W;  1DLB A;  2IH3 C;  1HWY A;  1SER A;  4MSW C;  1Q82 W;  1FXK C;  3KG2 A;  1VQ6 V;  2ZDI C;  4GT1 A;  3JD1 A;  4TT3 G;  1BMF G;  3JYC A;  3FKS G;  3X2Q B;  2AHZ A;  4MW3 A;  1RPO A;  1YJW V;  1K73 W;  1F4M A;  3BEH A;  2HVJ C;  3OR7 C;  2QTO A;  1VQ8 V;  2WLJ A;  4N21 A;  2OTJ V;  2D3O W;  1PNK A;  5B3S B;  1JQ0 A;  4WFE A;  2XAJ A;  3ASO C;  1OCC B;  4RQF A;  1JCH A;  1F23 A;  3E86 A;  3IC7 A;  5B1B B;  1VQ5 V;  4P2Z A;  4QE7 A;  1AI6 A;  4F4L A;  4QIW F;  1GMG A;  2OT5 A;  2NLJ C;  3ASN C;  1PKX A;  2WAM A;  3LSQ A;  4UUJ C;  3OMI B;  2GSM B;  2WLI B;  4MTG A;  3FB7 C;  5H6R A;  2EIM B;  3ETG A;  3VOU A;  1JVM A;  3K3W A;  2WLL B;  1K92 A;  2IJJ A;  2V7Q G;  1ZWI C;  1W2B U;  3H01 A;  2JDI G;  4JTD B;  4X88 A;  2OCC B;  3B8M A;  1YJ9 V;  5LHG A;  3ETD A;  1KKD A;  4WFB V;  1Y66 A;  4X89 A;  3OW2 U;  4PA9 A;  2JIZ G;  3K0D A;  1OCZ B;  1PNM A;  5DM6 V;  3E8B A;  2QM7 A;  3E35 A;  1VQO V;  1P7B A;  3CCU V;  2P67 A;  4N23 A;  1QLE B;  1YJN V;  5H9C A;  5GW7 A;  1R73 A;  2HVK C;  3B8N A;  5L3E A;  4H33 A;  1H2G A;  4U7N A;  1UJW B;  2EIJ B;  2ZQM A;  4FIP C;  2IJK A;  4MVO A;  3RVY A;  3ABU A;  3GWO A;  2UXN A;  1JJ2 U;  5HFM A;  3STL C;  3AG3 C;  3CCE V;  1AI7 A;  4GX5 A;  4ZBM A;  3K9A A;  3T4D A;  3ZRW A;  2X6A A;  3JD0 A;  3ML0 A;  3OR6 C;  1P4R A;  2AHY A;  4JF3 A;  1QBZ A;  2DQ0 A;  1VQP V;  3ETE A;  4HAM A;  1DF4 A;  1G8M A;  3ZCC A;  3G4S V;  3DTU B;  1NKD A;  3AG1 B;  5LGT A;  4U7O A;  2Q69 A;  1FXK A;  4GX2 A;  3K03 A;  2ZDI A;  3TET A;  4LP8 A;  2QM8 A;  3ABK C;  2DYS C;  1Q81 W;  4HYO A;  3ZRV A;  4PEL A;  1V55 B;  2X0L A;  2R9R B;  2ZXW C;  3OMN B;  1WPX A;  2DYR B;  3SPC A;  2HJF C;  2JEU A;  4RO2 A;  1K97 A;  4MVM A;  1PNL A;  1XL6 A;  3G71 V;  2PI4 A;  3ABL B;  2YEV A;  4JAV A;  3EFF K;  5L3B A;  1K34 A;  3CP1 A;  1YI2 V;  1AI4 A;  4MT8 A;  1VQL V;  1Q7Y W;  3MHS C;  4PDM A;  4J9Z B;  1COW G;  4MS2 A;  1MSW D;  1N8R W;  4BW5 A;  1VQ9 V;  4PDL A;  1E79 G;  2BOC C;  4G2K A;  3FYI B;  5BZB A;  5B1B C;  4KP4 A;  2WLH A;  3CCM V;  2Q67 A;  1S72 V;  5L3F A;  1OHH G;  1AJQ A;  4P9O A;  2QEX V;  3UM7 A;  4RAI A;  1K5Q A;  1MG1 A;  2EZO A;  3MD0 A;  1Y4M A;  5HFL A;  2K1E A;  4BIZ A;  5IY5 B;  2QA4 V;  1MAB G;  2NNU A;  1OCR B;  2WWW A;  3BY6 A;  3CPW U;  1ENV A;  5L3C A;  2B1I A;  1QVF U;  4LCU C;  3NXS A;  1V54 C;  3QO5 A;  3ZRX A;  3F7V C;  3ZMZ A;  3RBZ A;  1R3L C;  2Y69 B;  2IW5 A;  1M57 C;  2XAH A;  2IU0 A;  2Y48 A;  1YIT V;  1VQ7 V;  4WF9 V;  3SYC A;  2JEX A;  2EIK B;  1OCZ C;  4FMT A;  2FTK A;  3TK1 A;  3CYO A;  2V1D A;  1AJP A;  3E2E A;  2X7R B;  3FYE B;  2DWD C;  4MVZ A;  2EIL B;  4UXN A;  3SYP A;  3OUS A;  1KD1 W;  3JD3 A;  1R6N A;  2JJ1 G;  1YTF B;  3AG4 B;  1FXK B;  1G4Y B;  2C2A A;  2Q68 A;  5IYC O;  5IYB O;  3CC7 V;  1FXH A;  3ABM C;  4R7C A;  3SPG A;  4XDL A;  4P30 A;  2XAG A;  2EIJ C;  3OUF A;  3OEH G;  3D36 A;  1CEZ A;  1H8H G;  1W0J G;  3E8F A;  1PD3 A;  3F5W C;  4R6Z A;  1QCE A;  3QNE A;  3ZMT A;  3T4Z A;  3ZIA G;  3CCS V;  1RM1 B;  4PA3 A;  4JAS A;  1F4N A;  4Q20 A;  3W7T A;  3P32 A;  1GM7 A;  2JK5 C;  2YEV B;  4MTX A;  2XAF A;  3VBB A;  2WPD G;  2WLK A;  1M9N A;  2H94 A;  3E83 A;  3JCZ A;  3AG2 B;  1KC8 W;  1CP9 A;  1NH2 B;  3K79 A;  1SES A;  1SZT A;  3OAA G;  2XND G;  1KP2 A;  3ZN1 A;  1MOF A;  3CCV V;  4CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...