3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
4PDVA 4X8AA 3GB7C 4R7CA 2WLLB 2DYSC 3SYQA 4PA7A 3LDEA 1OCRC 3IFXA 4JTDB 2A0LA 2BOBC 2JK5C 2KB1A 3ABMC 3ZJZA 3AG4C 2BOCC 3E8GA 3AG1C 4J9YB 2QKSA 5B3SC 3E8HA 3FB6C 3FB8C 3K0GA 4GX5A 1R3LC 4G27B 2YEVA 3STLC 3T4ZA 2IH1C 3TCUA 4PDLA 3WG7C 1OCCC 3PJSK 4P2ZA 3SYCA 2DYRC 2HFEC 4LCUC 2EINC 4H33A 2X6BA 3E8FA 4MVUA 4BW5A 1ORQC 2W0FC 3K08A 1OCZC 2WLLA 1LNQA 2Q69A 4P9OA 2Q67A 3UM7A 2X6CA 3KG2A 1M57C 2ITDC 4EKWA 4JTAB 3K03A 2ZXWC 5B1AC 4OXSA 2ZD9A 2HJFC 4MW3A 4PDRA 2AHZA 4QE9A 4R8CA 4X88A 5EBWC 4F4LA 5EBLC 1OCOC 3X2QC 3AG2C 4I9WA 3SYPA 4MSWC 3F5WC 1J95A 2DWEC 2HG5C 1S5HC 3R65A 3LNMB 3ZRSA 5CBGA 3UKMA 4R6ZA 3T4DA 3SPCA 3OR7C 5EC2C 4XDKA 3K04A 1R3JC 2WLIB 4X89A 4WFGA 4MTOA 4ZBMA 3SYAA 3T2MA 4LBEC 3SPIA 3E8BA 2ATKC 3E83A 3OUFA 4LP8A 1JVMA 3AG3C 2HVKC 4H37A 4MTFA 3RVZA 4RUEA 5EC1C 4RAIA 4RO2A 4XDJA 5KUMA 3SPJA 4J9ZB 4GX1A 4MVMA 2Q6AA 4R50A 3VOUA 2WLJA 2WLHA 4WFFA 3T1CA 4XDLA 2P7TC 4RUFA 3LDCA 1BL8A 3RVYA 4MTGA 5KUKA 3E86A 1XL6A 2Q68A 4JTCB 3TETA 2EIJC 2WLKA 3RW0A 4QNHB 5BZBA 1KKDA 5J9PC 5IY5C 4PA4A 4PA9A 3IGAC 4KFMA 4CBCA 4GX2A 5CBFA 5E1AC 2AHYA 3ASNC 4MVOA 3OUSA 4MS2A 3SPGA 3BEHA 4PA6A 3SJQC 3F7VC 2EILC 2IH3C 1V54C 1M56C 2A9HA 4MW8A 4P30A 3FB7C 1K4CC 4HZ3A 4G28B 3SPHA 4QE7A 2WLIA 5EBMC 3F7YC 1ZWIC 4MVQA 3HPLC 3STZC 2OCCC 3ABKC 4HYOA 2QTOA 4MVSA 4TWKA 1R3KC 4MVZA 5CBHA 1R3IC 4DXWA 4UUJC 2EIMC 3ABLC 3SYOA 2WLNA 2EIKC 3EFFK 1QLEC 3ASOC 1P7BA 1K4DC 3FB5C 3JYCA 2A79B 3K0DA 4P9PA 4WFEA 3LDDA 2WLMA 5EK0A 2K1EA 2ITCC 3OGCC 4PDMA 3E89A 1G4YB 1XL4A 2H8PC 2Y69C 3OR6C 4GX0A 2R9RB 4WFHA 5B1BC 3RBZA 2HVJC 4PA3A 2X6AA 4MVRA 1V55C 3K06A 2DWDC 2NLJC 3LUTB
chains in the Genus database with same CATH superfamily
1MG1A 4LFAO 4LF8B 4X20B 1BHAA 3KZIZ 5FNVA 1SQGA 4X1KA 4DUZO 2PYLA 2M7WA 1K5QA 1L1FA 3ZX6A 3FB8C 2E76B 1N0NA 3K5OA 3UT5A 1AI5A 3B40A 3B8MA 2N04A 4JYCA 1H8HG 1ENVA 4X1YB 4DV6O 5KHHA 1Q81W 1JOYA 4FZ1A 1QQCA 4YJ3B 4DV1B 1LNQA 4NYKA 1XMQB 1JFFB 4DYLA 1ZTEA 1SA0B 1Y66A 4JYBA 1B6QA 4FVMA 1XOUA 5B1AC 4OXSA 1E1RG 2HJFC 2Y0IA 4PDRA 4DK1A 1UFIA 3N2GB 5J2TA 1M57B 2X7RB 4PV1B 1ZAUA 4DV4B 1HP8A 5IJ9A 4GKJB 1K33A 3LNMB 3SJBC 2QE7G 5CBGA 3SPCA 1Q7YW 1EN4A 3TXSA 1DTOA 4TV8B 5LBQA 5IWAO 1IURA 1XHXA 3U10A 4JI0O 3HKBA 3ASNB 4XDJA 3GVMA 3SPJA 5L3BA 4FM2A 3CCJV 1SC5B 1Q8IA 1F51A 4DR7O 1RPRA 2D2CB 4MTGA 1Q3EA 1ROPA 4I5SA 3OMNB 4L87A 3ZMZA 2WWWA 3HKDB 4B3MO 4QPKA 2BE3A 4LF9O 3DXRB 3BEHA 4UXNA 4B7EA 5CA1A 1U97A 5IWAB 3C90A 5LP6B 1K8AW 2LGQA 2CGOA 2QM7A 1P4RA 4JI3B 4ASUG 2FYUH 4DR7B 4DW0A 2XHBA 5IYDO 4Z2WA 4P9PA 3FB5C 4ZHQB 4LFCO 4OPAA 3K58A 4JYYA 4TQDA 1F23A 2PYJA 2F1MA 3DTUB 2JK5C 1QLEB 5L3GA 3P3NA 3E2EA 1VMGA 2QKSA 1FXHA 5HFMA 2ZCEA 2HR3A 1Q82W 3JD0A 1VQ8V 4KP4A 2HFEC 4B08A 4NXNO 1VQPV 1IBLO 1B06A 1Q6UA 2XNDG 3JD1A 3CRRA 1Q43A 3JAMN 4F4LA 2EJRA 5LYJA 3B09A 3QTCA 2RN9A 4CH6A 4WFAV 4J7JA 3ZRSA 4DR2O 3B4SA 4XDKA 4WFGA 4B3RB 3RYCB 3ZRVA 2GDSA 3RVZA 3HR0A 2FL4A 2YIBD 3H1HH 3E86A 1Z2GA 5BZBA 2H3OA 1AR4A 1P84F 4G2KA 1YTFB 2IW5A 4B3SB 2W0XA 3G71V 3SPGA 1W0JG 1V54C 2PF4E 3HKBB 2ZDIC 1AB3A 1PD3A 2OT5A 2OWOA 1HNWB 3CCLV 3F7YC 3CC4V 3CCUV 2F93B 1ZX3A 2YIDA 3ZCCA 2Q7EA 1M9NA 1GTOA 4UUJC 2LJ2A 2IM9A 1K4DC 3JARB 1M56B 4LF9B 1XL4A 2RDCA 3RBZA 3CCRV 1VQ6V 1NTKH 1SA0A 1GAXA 3CD6V 1D2DA 4JI4B 4X8AA 5EYPB 2WLLB 2IJHA 1ZLZA 5KHKA 2OYQA 1I08A 1AJNA 1H2LA 1PNLA 1XQ8A 4UVCA 4ZHQA 3JD3A 2YUAA 1XBLA 2OCHA 4FFBB 1IVSA 1W2BU 1XNQB 3K59A 5EZYB 1RPOA 1NVPD 1Y76B 4I55B 4BIUA 3AG4B 2Q69A 4FLYA 4F6EA 2EULA 4N21A 3SJCC 1HNZO 4JTAB 1AJQA 4JAAA 1MSWD 2B1IA 3C3TA 1QBZA 4J10A 5B1OA 3RWRD 4B3TO 4X64O 3KKYA 1K7DA 3A0HZ 4I9WA 3SYPA 1RM1B 4LF4O 4DV1O 2R70A 3X2QB 4NXNB 2R9AA 3SYAA 4JYAB 3E8BA 4AHCA 3CJHA 3CSXA 1KC8W 5C93A 4RO2A 2BTQA 2AXTZ 1N32B 2PTMA 1VEWA 2UXNA 2WLJA 2WLHA 4DR1O 3BVOA 1QR9A 4KXRA 2KSDA 4JTCB 2CGNA 2OCCB 1HR0B 1NVPB 2L6LA 1MABG 1THZA 5C8YA 3CJHB 2F23A 1N0JA 4X1IB 5B1NA 1AP5A 1H2SB 2HHHO 2DE0X 4QE7A 4B7KA 2IBZH 1NQTA 4TWKA 4MVSA 1PPJH 4FK5C 1BZKA 1S77D 4LF7O 4BIOA 2UXBB 2CDYA 3APQA 1NBMG 4B3SO 3ASOC 2KQXA 2A79B 4HNAA 1XUQA 3OGCC 3W7SA 3ZS8C 1GM9A 2R9RB 1X59A 3ZMSA 3M7MX 3ZHRA 1FFXB 4K8ZA 1Y76A 2QM4A 5L3DA 2C2AA 4X65B 1K73W 2O57A 1XI1A 1BGYH 4J9YB 2FMLA 3E8HA 4K0KB 3JAKA 3ETDA 5LGTA 1TUEB 1YEWA 1G1XB 4PJ0Z 2WLLA 1FFXA 2X6CA 5CN0A 2BSKA 3BPZA 4FLWA 2Y4UA 5JH7B 1OZ0A 1UPGA 5CA0B 2ZM6B 3S3WA 4UVBA 3JARA 1VIBA 3FAVB 2CTWA 3T1YB 3R65A 2EJ7A 1SQPH 3AK3A 1YIJV 4DV5O 3T2MA 4X1IA 4H0LB 4U3JB 2Q7HA 3W7WA 2P06A 1EZJA 1GO3F 4GX1A 4B3TB 2DOSA 5J2UA 3MHSC 4JI7B 4D6TH 4JZGA 1VF7A 2JGUA 1EN6A 4DUYO 2EIJC 4DW1A 3APOA 3BRCA 3N27A 3TXQA 3J7AU 4ZI7A 1KB9F 2A9HA 4P30A 3CRCA 5JCOA 3AK1A 5DM6V 4BW9A 4PELA 4WCEV 2Y69C 1VF5B 2ADQB 1AI7A 2GUZB 3HKCB 2FTKA 2PGGA 1FFTB 1KD1W 2HHHB 4OX9O 3LDEA 1OCRC 2HP8A 2ZE5A 5IYZA 3DC5A 1WB7A 4J80A 1M5IA 2YI8A 1SF9A 1KECA 3ETEA 1H2GA 4JI1O 2Y48A 3LNNA 3B2EE 3CCSV 2DN9A 4JI2B 4HAMA 5TISZ 2MW2B 1DGSA 4O4LA 2PI5A 4P9OA 5H6RA 2JGDA 1CP9A 3EXAA 1JJOA 4LH7A 1BHBA 3AG3B 1OV9A 4X88A 1NT2B 4R8CA 1OCCB 5LXTB 1XNQO 5D5QA 1KP3A 5LMUB 1M93A 3ZHTA 4RQEA 2OIEA 3CC2V 4MTFA 3OFNG 2ZDIA 2KG7A 5EC1C 4RAIA 5LL6Y 1ZL8A 2JIZG 1S3JA 4HBNA 3RT3C 4H44B 4XBFA 3UO3A 3ZMTA 2GHYA 2RQ6A 4RUFA 3M8AA 3CWBH 4NTWA 2VQFB 1IX9A 1Q5OA 1L8DA 1WJZA 2FB5A 4GX2A 3P3PA 3OUSA 3K5LA 3RYFB 1KBHA 2Y69B 3RYIA 4JI7O 4LFBB 4UCVA 2UXCO 4X66O 1M90W 2JRIA 2ZE6A 1PNMA 1QU7A 3CXHF 2IU3A 3CRQA 2ZINA 4PDMA 4X62B 4PA3A 4Q20A 1P7GA 4PDVA 3ZRXA 2JGDB 4O2AB 4DR3B 2QDOA 3K79A 5FL7G 5KA5A 5L3EA 5JJNB 3C3SA 4PA7A 1FPOA 2YXLA 2Q9LA 4WBNA 2QWPB 3I5DA 3K0GA 1NI8A 1R3LC 4H13B 1J5EB 1R1BA 3CYOA 1VP7A 4Z1MG 3DGEA 2UUBB 1U96A 1OCZC 4LF5O 2AGAA 1LR1A 5KA6A 2UUAB 2GUZA 1TVKA 2YXHA 5EBLC 4U7OA 4CC6A 3A0RA 1N36O 1EM1A 2QWOB 4KUMA 1YVWA 5IYBO 4R6ZA 4ZOLB 2CTQA 4X89A 1R3JC 3G6EV 2DQ0A 1OHHG 1GKFA 3E83A 4LP8A 3PN1A 5KX5A 4O4HB 2WPDG 1FJGB 3I56V 4J9ZB 4JASA 3D8CA 2UU9O 3H01A 4DV7B 1AROP 2KKWA 3JASB 5BY1A 4IIJB 1RSOB 2F4VB 4CBCA 2ARHA 5CBFA 1RP3B 2P4VA 5K1PA 4F6RB 4DR2B 4JAUA 2YDEA 3OMIB 4CH3A 2EIMB 3CP1A 3SPHA 1QHTA 1V9PA 2ZR2A 4PI0A 3STZC 5IY5B 4HYOA 5LHHA 2XAGA 2UU9B 2EIKC 3EFFK 4JI5B 1Q86W 3N2GA 5J2TB 3CRAA 4IL6Z 3F5TA 3FD9A 2YICA 1LUVA 5JH7A 1TUBA 3OEEG 2P5OA 2G38A 3MDSA 2VWKA 1HW7A 3JAKB 2VQEB 4JI6B 1JX9A 3SDLA 4JYAO 1WN7A 4P2ZA 1SZXA 1QCEA 2IJIA 2DYRC 4FLTA 1SS3A 4LCUC 4DRXA 2EINC 3A2FA 4DR3O 1E79G 4DR1B 2YS8A 4O4IA 4LNUA 2EINB 5DECA 4RWUA 3SR2C 1MA1A 3BA9A 3X2QC 1DK1A 2DWEC 1KQSU 5JWPA 3CMEV 5LMNO 2JEXA 3LSSA 4LBEC 2CH7A 5GW7A 1WA8B 1W0KG 2VS0A 1K5SA 3ZHUA 5E79Z 4BIZA 3VOUA 3OAAG 5LMUO 1LUWA 4JF3A 2ZE8A 2LW7A 4JV5B 1IZ3A 2Q5ZA 4ZOLA 3G67A 5IY5C 2QM8A 3JSLA 1Y4MA 3OEHG 1AR1B 4ZKIA 2EILC 3G6BA 1VQ4V 1M56C 1I0HA 4DR5B 1TVKB 1K92A 4LFAB 1GN4A 3G4SV 1MSDA 4GCZA 1DF5A 2CE4A 2Q0AA 1VQ5V 3UQ8A 2QWNB 1BCCH 1IBKB 3ABMB 1N32O 1PL0A 3T1HO 3CS5A 5LOVA 5CMUA 2RNBA 1G4YB 5ITZA 1SQXH 3OTFA 1NH2D 2R9IA 1Z5VA 4BWAA 3K06A 1AI6A 4UFZA 5DN6G 5BR8O 1YTFD 3JSNA 4X66B 3SYQA 1IBMB 2ZT9B 4FJCC 3K57A 3IFXA 2WA3A 2BOBC 2PY5A 2GV9A 1O9GA 1IXBA 3FB6C 1SESA 2E75B 1COWG 4GKJO 2OIGA 2YXYA 3CB2A 1FXKB 2ADPA 2P90A 1PNKA 1VQ7V 1FAFA 3J81N 4CS2A 5KAFZ 4UCOA 4N23A 4NB5A 3QF7A 4NXMO 1J5EO 5LA6A 1XMOO 1MZEA 1NU1H 5JCOC 3VBBA 3U0ZA 3ETQA 4CH5A 3AK2A 1YZBA 4JGSA 5JJJB 4LF5B 3OW2U 1BQZA 4LWSA 4TV9A 2UUAO 1IDSA 5EC2C 1HNXB 2DW4A 3GWOA 1N34B 3AG3C 2Q8VA 2EX3A 2UXXA 1FD9A 5IJ0A 1TGOA 3CRMA 3RYHA 4MVMA 2P7TC 2Q7GA 4E4EA 4IHJA 4I9QA 2A3QA 4JI3O 2LGWA 2W6IG 3FX7A 4LWSB 4DV2O 5DEDA 3ZMUA 3THOA 4QGPA 3UO2A 2Z0AA 4U7NA 2P67A 5LXTA 4PA6A 4CS3A 4EFEA 3L73H 1KMIZ 1N34O 1B04A 4DV5B 5A9GA 3RYCA 4MVQA 1DF4A 4JV5O 5BMVB 4JI2O 1KUQA 4DXWA 3FKSG 1FXKA 3QO5A 1P7BA 3FYEB 3K9AA 3TGUH 1O9HA 2D3OW 1NR7A 4DUYB 2M6YA 1OCRB 2X6AA 4Q6GA 2NLJC 3LUTB 5LHGA 3QVNA 1YITV 3EVKA 3CE2A 2W6JG 4GZRB 2XAJA 5JVDB 4EB6A 5B1BB 4YHHO 4IYHA 4NTYA 1KP2A 3OM3B 2CUGA 5JQGA 4FLXA 1GM8A 1AJPA 3K03A 2OTJV 2AHZA 3N2KB 2EZPA 1PL4A 1JPXA 5B1AB 1MZFA 3WFVA 1SERA 4YHHB 1I94B 2WLIB 4KHPO 3CCQV 3HKEB 3OUFA 4UVAA 3VQVA 2LO1A 3JCUZ 4I0XB 2UXCB 3RYHB 2DMXA 3LSUA 3A0BZ 1XMOB 5H6QA 3W7UA 3IC9A 3HKDA 4NTXA 5EIBC 1K97A 3RW0A 2JJ2G 1BMFG 2PUSA 1Q6HA 3FAVA 4KHPB 2RJZA 2NNUA 4JI4O 3H1KH 1HWYA 2BSKB 4LNUB 3UCSC 1WPBA 3ZN0A 5LP6C 1R3KC 3W7TA 3JALB 3CXCU 3DC6A 3D3QA 1VF6C 4DV0B 2X0LA 3SYOA 1V55B 5EK0A 2Q73A 3E89A 3OR6C 5B1BC 1VARA 2B1GA 2HVJC 3NXSA 3SGIA 3L72H 1V55C 3CCEV 3ZHSA 5KLVH 3I55V 1WPXA 3ETGA 3OD4A 4YJ3A 1R6NA 4JTDB 4I50A 2A0LA 1XHZA 4CC5A 2QTSA 4X1YA 4J11A 1AP6A 1TA8A 3BAAA 2YEVB 5ITZB 2YEVA 2ZE7A 3TCUA 3UT5B 2ZM6O 1OCCC 2QKAA 1XREA 4QPJA 5IYCO 1FYJA 1QR8A 4MVUA 5FNVB 4BW5A 2CTPA 4X20A 1G6UA 2VRZA 3OMAB 4GKKO 4UV9A 4X62O 4DUZB 2ITDC 3VQXA 4AILC 3R66A 3W7XA 1GRJA 4L8JA 4MT8A 2OTLV 3BY6A 3KCXA 4JAVA 2LFRA 4FZ0A 2BCCH 3WU2Z 2B5UA 3F5WC 3ZEDA 1PP9H 2XAFA 1R6TA 3L74H 1B3QA 3WB0A 2GSMB 3FFQA 2LW1A 3ZN1A 2N05A 1BSMA 4X9QA 4NXMB 2ATKC 4TOIA 2JEUA 2Q0OC 5KUMA 1FXVA 1YJ9V 3O65A 2XOKG 1XDCA 2NN4A 1SQFA 2WA4A 4AQYB 3GWKC 3IGAC 1H2KA 4JPRA 4E2LA 3CPWU 5B5EZ 2Q4PA 3L71H 3QO8A 2E5LB 4I0XA 5KMGA 3HKEA 4I4TB 4MTXA 4O4IB 4OGQB 2OCCC 2ZIOA 1H2NA 3VQYA 4X65O 5BXZA 2EIMC 2E3CA 1S5JA 4FFBA 2FKXA 4WFEA 2ITCC 1TAEA 2HLDG 4DR4B 1JJ2U 2F4VO 1BQ0A 1HNZB 3GB7C 4R7CA 1CEZA 5FLXN 4O2BA 3QG5A 3ABMC 3E22B 4O2AA 4DV0O 1TUBB 3Q4HB 3AG7A 4G27B 1W59A 5IDJA 5JVDA 1S76D 1Y6XA 5L3FA 1D5NA 2QWQB 4O4JA 4UCUA 4RQFA 3HB3B 5EBWC 5KHGA 1M4UA 4F6RA 1OCOC 3AG2C 4UB8Z 4MSWC 3QNEA 5KHIA 2ZXWB 2N74A 2PI4A 3T4DA 5BMVA 1JR9A 1GM7A 4JI6O 3ZIAG 1WP7A 5K1XA 1AI4A 4IIJA 2DJVA 4GKKB 1MOFA 1RFYA 4UCRA 3RFRA 4IGGA 1WNSA 1US6A 4RUEA 2KG7B 3ABTA 1VQ9V 4FLZA 4CS4A 4PA4A 4FLUA 1D5AA 3OTOO 5BR8B 1FKAO 5E1AC 1F7YA 1EFRG 2EIKB 1R6KA 5LYJB 3IJ4A 1S0VA 2CTRA 2A7WA 2Z3YA 2ZQMA 4HZ3A 3ABKC 4TV9B 2JDIG 4O4LB 5JQGB 3ZHQA 4DV3B 3CHXA 4J42A 4JZ2A 3LDDA 1A32A 2QKCA 5CB4B 1SKVA 3K5NA 2IJJA 4FIPC 3M99B 1YHQV 4J7KA 5B3SB 2DYRB 4BAYA 2ZKOA 3ZJZA 1YDXA 3KCYA 3AG4C 1YJWV 1WB8A 3JATB 3H1LH 3BCCH 1S5LZ 5D5PA 3STLC 3T4ZA 3SJAC 3JATA 3Q4HA 1R73A 4PDLA 3WG7C 1AILA 5LHIA 5IT9N 4FFKA 1RM1C 2DYSB 2LFSA 2P6JA 3E22A 1N36B 2X6BA 2A06H 4O2BB 2UXDO 3B77A 1AVMA 1QVFU 4K3AA 1UJWB 4GLXA 4J41A 4J7ZA 1YJNV 4TT3G 4DV2B 2ZD9A 3JD4A 3DXRA 4Z1VA 3BHPA 4PD4F 4JI8B 4K0KO 3OR7C 4ZBMA 1QLNA 1YI2V 1JVMA 3JD2A 5KMGB 4LF6B 2UXDB 4YJ2A 3H1IH 1KKCA 1PV0A 3ZRWA 4X64B 4LF4B 3CC7V 1XL6A 5LGNA 3TETA 2WLKA 2YSUB 1L0LH 2QGNA 5J9PC 3ABKB 4EEQA 4PHZA 2BTOA 2Y4TA 4WF9V 4LF8O 4JI8O 4MVOA 5GTIZ 4WFBV 3D36A 5GONA 2XTAA 5LA6B 4DK0A 3L9DA 1WAZA 1WLEA 5L3CA 2JJ1G 4LF6O 1K4CC 1Q90D 1FS0G 1JFFA 1VQNV 2XAQA 1HR0O 2WSSG 3JYCA 1XMQO 1EZVH 4WFHA 1I7FA 4O4JB 2CAZC 4YIPA 1NS1A 5IYZB 2DYSC 2QJ1A 1N33B 2KB1A 3ABLB 4DV4O 1P49A 2QA4V 2PZSA 3E8GA 4DV3O 1VQMV 1I94O 3CCMV 3AEIA 1BE3H 5GTHZ 4JI0B 4NVPA 4H33A 3E8FA 5LMNB 3UM7A 1XILA 3BABA 3KG2A 1M57C 4A5UB 1VF6A 4B3MB 1X4TA 4FM1A 4ZIBA 2QEXV 3JALA 4JI1B 3JAWB 2IU0A 1K3EA 2JS3A 3RGBA 3OE7G 3EHBB 1YXBA 3IC7A 4LFBO 4R50A 3JCZA 4TSFG 4DR5O 1XEQA 1M1KW 4GUNA 1WA8A 1BL8A 5KAIZ 2Q68A 3P32A 1RSOA 2ZR3A 2UUCB 2ILMA 4PI2A 1N8RW 3JASA 2AHYA 1F4NA 4MS2A 1IBKO 4D7TA 2MK3A 3SJQC 5H9CA 3ZHVA 4NR1A 2Z5UA 1BS3A 4FLVA 5KX5B 4D7SA 3NR7A 1SQBH 2GTAA 3TK1A 1URFA 3S3XA 2QTOA 4I55A 5F2VO 3ML0A 2V4DA 5EZYA 1R3IC 3ABLC 4DRXB 2WLNA 1EN5A 2H8PC 4TUYB 3MHHC 2YIAA 1YSCA 4MVRA 2DWDC 1SQQH 4DR6B 4FMTA 3J80N 2UXBO 1YF2A 1F4MA 5EYPA 2ZIMA 2BOCC 3AG1C 1L0NH 1QNMA 1T5EA 1VQKV 3E35A 3DSQA 3K3WA 4EB6B 3AG1B 3SYCA 1JQ0A 4I50B 3MAQA 1KU9A 2E74B 1ORQC 5AG2A 4U3FH 4NKGB 1N33O 2JVDA 4EKWA 2P22C 4DV7O 1OCZB 4MW3A 4AQYO 2B9ZA 5C8YB 2EBOA 1HDJA 1NJIW 1CXZB 2HG5C 1S5HC 4UCSA 5H2FZ 3UKMA 3OGIB 2ZNJA 4UB6Z 3SPIA 4K35A 2QWRB 3RYIB 1ZSPA 1JMKC 1NKDA 5GONB 4EFBA 4YY3B 4LH6A 1IBLB 5A2QN 4XDLA 2P4KA 3D36C 3WB1A 1E1QG 1EBOA 2NR5A 1GMGA 3L75H 4C7UA 5KHJA 1GN3A 2F43G 3CX5F 4KFMA 3T1HB 4OPHA 3OT7A 3ZRWB 5IJ0B 2HJDA 3F7VC 5CA3A 1GH6A 2QR4A 4YJ2B 3K9SA 5JJEB 4MW8A 4ICGA 2DQ3A 1SZTA 1SETA 2WLIA 4W4LA 3QO7A 1H38A 4K8XA 4MVZA 1NH2B 4YY3O 2LQTA 2UUCO 1QVGU 2WAMA 4LR3A 1QLEC 1Y74B 3N2KA 3CMAV 3U11A 1G8MA 2AZ0A 1H2MA 4WBNB 2ZNIA 4YXWG 4W4KA 1KYOF 4LC1A 1GN6A 2LP7A 1Q6IA 3H1JH 3BFRA 1NR1A 2GBOA 2IH1C 1Y74A 3BA8A 3PJSK 2AZ2A 4JI5O 1CPYA 3IAYA 4DR6O 1HNXO 3K08A 4QJFB 3K5MA 2V7QG 3CEIA 3O9OA 3HKCA 4ABMA 3RYFA 2ZXWC 4QE9A 5CB4A 5CA1B 3OTOB 1K34A 5LOVB 2XAHA 4QIWF 2RCVA 1ZUQA 2CK3G 4I7ZB 5FPOA 2L35A 2YC0A 3LSQA 3AG2B 2ETNA 3K04A 1GN2A 2XUMA 2VWJA 4FM0A 1GK9A 3D3IA 4LF7B 1ZL8B 3A8TA 1JCHA 1V54B 4ZI7B 3WB2A 3LDCA 3RVYA 5KUKA 2GTSA 4TV8A 4TQFA 4IHJB 4PA9A 1XNRO 5IJ9B 3TJTA 5J2UB 1WP8A 1BT8A 3P30A 2JS5A 1JA8A 2XT9A 2IH3C 2XASA 2H94A 1NZ6A 1PKXA 2CH7B 1NTZH 5EBMC 2VQFO 1VQOV 3VQWA 1ZWIC 3HPLC 1MNGA 4IT5A 2QSAA 1OJHA 4CZZA 3K0DA 1DLBA 2K1EA 4QNHB 5CA0A 3RN4A 2YIBA 2K9PA 2F66C 2V1DA 4X1KB 2R72A 3WG7B 5HFLA 1K9MW 5B3SC 4GX5A 3FYIB 1FXKC 4TUYA 5FPRA 4GYCB 1OCOB 4GT1A 4IYIA 1S72V 2W0FC 2Q67A 1MMMA 2RMKB 2IJKA 1IBMO 4B3RO 4FPPA 2HKOA 3MD0A 5LP6A 2VQEO 2HEPA 4HNAB 4BR6A 1SRYA 1J95A 2UUBO 3ZBHA 3L70H 3ICXA 4YIOA 5IE9A 1PM9A 2AW9A 2F95B 4I4TA 3ZMVA 2HVKC 4H37A 3CCVV 1Z5WA 4AI8A 2EIJB 2EILB 2Q6AA 4U3JA 4WFFA 4CH4A 2E5LO 3T1CA 2YI9A 1IXMA 1I5XA 3JAWA 3H9VA 5B66Z 2EZOA 1HNWO 1KKDA 4UCTA 3G80A 3ASNC 4LFCB 4OX9B 1FJGO 3T1YO 2BTQB 4KL1A 3ASOB 1Y67A 4O4HA 5EIBD 1H8EG 1YCIA 4DR4O 1N4CA 3FB7C 4G28B 1SQVH 3B8NA 5CBHA 2Y0PA 4DO2A 3ABUA 1AR5A 1XNRB 4DV6B 2ODMA 2WLMA 1I5YA 1NTMH 4GX0A 1VQLV 5H5NA 5LGUA 4UV8A 4MTOA
chains in the Genus database with same CATH topology
1MG1A 1FFTB 1KD1W 1YITV 2DYSC 2W6JG 3LDEA 1BHAA 1OCRC 2XAJA 2KB1A 3ABLB 2M7WA 1K5QA 1L1FA 2QA4V 3E8GA 1VQMV 3FB8C 3CCMV 5B1BB 1KECA 3AEIA 3ETEA 1AI5A 3B8MA 1H2GA 2Y48A 4JYCA 1KP2A 1H8HG 1ENVA 3CCSV 3OM3B 4HAMA 1Q81W 4H33A 1JOYA 3E8FA 2PI5A 1GM8A 1AJPA 1LNQA 4P9OA 5H6RA 3UM7A 3KG2A 1M57C 1CP9A 1Y66A 4JYBA 3K03A 2OTJV 1B6QA 5B1AC 1BHBA 4OXSA 1E1RG 2HJFC 3AG3B 4PDRA 2AHZA 4R8CA 4X88A 1OCCB 1M57B 2EZPA 2X7RB 1JPXA 2QEXV 1KP3A 5B1AB 1K33A 3LNMB 2QE7G 3WFVA 5CBGA 1SERA 3SPCA 1Q7YW 4RQEA 2WLIB 1DTOA 3CC2V 5LBQA 3CCQV 2IU0A 1K3EA 3OUFA 4MTFA 3OFNG 4UVAA 2ZDIA 3OE7G 3EHBB 3ASNB 5EC1C 4RAIA 4XDJA 3IC7A 2JIZG 3SPJA 5L3BA 1S3JA 3CCJV 5H6QA 3W7UA 3ZMTA 4R50A 4XBFA 1F51A 3JCZA 4TSFG 2GHYA 1RPRA 1M1KW 4RUFA 1BL8A 4MTGA 2Q68A 1K97A 3P32A 1ROPA 4I5SA 3OMNB 2JJ2G 4L87A 3RW0A 3ZMZA 2ZR3A 2WWWA 1BMFG 4QPKA 1N8RW 4GX2A 2AHYA 3OUSA 1F4NA 4MS2A 2MK3A 3BEHA 4UXNA 3SJQC 5H9CA 2Z5UA 1K8AW 2Y69B 2NNUA 1HWYA 3TK1A 2QM7A 3ZN0A 1P4RA 2QTOA 4ASUG 1R3KC 3W7TA 3CXCU 3ML0A 1M90W 1R3IC 2X0LA 3ABLC 3SYOA 2WLNA 1V55B 1PNMA 5IYDO 4P9PA 2IU3A 3FB5C 5EK0A 4PDMA 3E89A 1F23A 2H8PC 3OR6C 5B1BC 2B1GA 3MHHC 2HVJC 3NXSA 4PA3A 1YSCA 4MVRA 1V55C 3CCEV 2DWDC 4Q20A 3DTUB 4PDVA 3ZRXA 3I55V 1WPXA 3K79A 5KA5A 3ETGA 5FL7G 5L3EA 1R6NA 4PA7A 4FMTA 4JTDB 2A0LA 2JK5C 1F4MA 1QLEB 2BOCC 5L3GA 3AG1C 3E2EA 2QKSA 3K0GA 1FXHA 1VQKV 5HFMA 2YEVB 1R3LC 2YEVA 3E35A 2HR3A 1Q82W 3TCUA 3K3WA 3AG1B 3JD0A 3CYOA 1OCCC 1VQ8V 4QPJA 4Z1MG 3SYCA 1JQ0A 4KP4A 5IYCO 2HFEC 1QR8A 4MVUA 3DGEA 4BW5A 1ORQC 3OMAB 1VQPV 5LHGA 1OCZC 4UV9A 5KA6A 2XNDG 2ITDC 3JD1A 4EKWA 3W7XA 1OCZB 4MW3A 4MT8A 2OTLV 3BY6A 4JAVA 4F4LA 5EBLC 2EJRA 2EBOA 4U7OA 2LFRA 1NJIW 2B5UA 3F5WC 3A0RA 2HG5C 1S5HC 4WFAV 4KUMA 3ZRSA 3UKMA 4R6ZA 5IYBO 2XAFA 4XDKA 4X89A 1R3JC 2GSMB 3G6EV 2DQ0A 4WFGA 1OHHG 3ZN1A 1GKFA 3SPIA 2ATKC 3E83A 4LP8A 3ZRVA 2JEUA 1NKDA 3RVZA 2WPDG 5KUMA 3I56V 1FXVA 4J9ZB 1YJ9V 4JASA 2XOKG 3H01A 1AROP 4XDLA 3E86A 1E1QG 1EBOA 1GMGA 5BZBA 4G2KA 1YTFB 2IW5A 3IGAC 4KFMA 2F43G 4CBCA 5CBFA 3G71V 3SPGA 3ZRWB 4JPRA 4E2LA 1W0JG 3F7VC 1V54C 5CA3A 3CPWU 3QO8A 2ZDIC 1PD3A 4JAUA 4MW8A 3OMIB 2OT5A 2DQ3A 1SZTA 2EIMB 3CP1A 3SPHA 4MTXA 1SETA 2WLIA 3CCLV 2ZR2A 3F7YC 3QO7A 3CC4V 3STZC 2OCCC 5IY5B 4HYOA 5LHHA 3CCUV 1H38A 4MVZA 2XAGA 1NH2B 3ZCCA 1M9NA 1GTOA 4UUJC 2EIMC 1QVGU 3EFFK 2EIKC 1QLEC 2WAMA 1K4DC 1Q86W 4WFEA 1M56B 2ITCC 3CMAV 1XL4A 3RBZA 3CCRV 2HLDG 1VQ6V 1G8MA 3CD6V 1JJ2U 4X8AA 3GB7C 4R7CA 3OEEG 1CEZA 2WLLB 2IJHA 3ABMC 4YXWG 4LC1A 1AJNA 1PNLA 2LP7A 1JX9A 1NR1A 4G27B 2IH1C 4UVCA 5IDJA 4P2ZA 3PJSK 3JD3A 1QCEA 2IJIA 2DYRC 4LCUC 1W2BU 2EINC 1CPYA 1RPOA 1S76D 3K08A 4QJFB 1NVPD 1E79G 3AG4B 4BIUA 5L3FA 2Q69A 2V7QG 4N21A 2EINB 4JTAB 4RQFA 3HB3B 2ZXWC 1AJQA 1MSWD 2B1IA 4QE9A 5EBWC 1QBZA 5B1OA 1OCOC 1K34A 3X2QC 3AG2C 2XAHA 1K7DA 4I9WA 3SYPA 4MSWC 1RM1B 4QIWF 3QNEA 2DWEC 1KQSU 2ZXWB 2PI4A 2CK3G 3CMEV 3T4DA 3LSQA 3X2QB 3AG2B 1GM7A 2JEXA 3ZIAG 3K04A 3LSSA 3SYAA 1AI4A 4LBEC 1MOFA 5GW7A 3E8BA 1W0KG 1GK9A 3D3IA 1K5SA 1KC8W 5C93A 4RUEA 4RO2A 4BIZA 1JCHA 1V54B 3VOUA 2UXNA 2WLJA 2WLHA 3ABTA 3OAAG 4JF3A 3LDCA 1QR9A 1VQ9V 3RVYA 5KUKA 4JTCB 2OCCB 5IY5C 4PA4A 2QM8A 4PA9A 1NVPB 1Y4MA 1MABG 1THZA 3OEHG 5E1AC 1AR1B 4ZKIA 1EFRG 3P30A 2EIKB 1R6KA 2EILC 2IH3C 1S0VA 1VQ4V 1M56C 2XASA 1K92A 5B1NA 2H94A 2Z3YA 1PKXA 2ZQMA 4HZ3A 4QE7A 5EBMC 1VQOV 3G4SV 1ZWIC 4GCZA 3HPLC 1NQTA 1DF5A 3ABKC 4TWKA 4MVSA 1VQ5V 4FK5C 2JDIG 1S77D 3ABMB 1NBMG 1PL0A 4CZZA 3ASOC 3K0DA 1DLBA 2A79B 5CMUA 3LDDA 2K1EA 3OGCC 4QNHB 1G4YB 3W7SA 1GM9A 2R9RB 1NH2D 2R9IA 3K06A 2IJJA 1AI6A 3ZMSA 4FIPC 3M99B 5DN6G 1YHQV 1YTFD 5B3SB 2DYRB 3SYQA 2V1DA 4FJCC 5L3DA 3IFXA 4BAYA 2BOBC 2C2AA 3ZJZA 1K73W 3AG4C 3WG7B 5HFLA 1YJWV 1K9MW 4J9YB 5B3SC 3E8HA 3FB6C 4GX5A 1SESA 1FXKC 3FYIB 3STLC 3T4ZA 1COWG 1R73A 4PDLA 3WG7C 5LHIA 3ETDA 1OCOB 4GT1A 5LGTA 1RM1C 2DYSB 1S72V 1TUEB 2LFSA 2P6JA 1FXKB 2X6BA 2P90A 3B77A 1QVFU 2W0FC 1PNKA 2WLLA 1VQ7V 1UJWB 2Q67A 2X6CA 4N23A 5CN0A 2IJKA 1YJNV 1OZ0A 4TT3G 4FPPA 2HKOA 3MD0A 2ZD9A 3JD4A 4UVBA 1SRYA 1J95A 3VBBA 3R65A 4JGSA 3OW2U 1YIJV 3OR7C 5EC2C 2DW4A 4ZBMA 4MTOA 1QLNA 3T2MA 1YI2V 3GWOA 3ZMVA 1JVMA 3AG3C 2HVKC 3JD2A 4H37A 2UXXA 3CCVV 3W7WA 1EZJA 1GO3F 2EIJB 4GX1A 3ZRWA 2EILB 2Q6AA 4MVMA 4WFFA 3MHSC 3T1CA 2P7TC 3CC7V 1IXMA 1I5XA 1XL6A 5LGNA 3TETA 2EZOA 2EIJC 2WLKA 2W6IG 2YSUB 1KKDA 5J9PC 3ABKB 3ZMUA 4WF9V 3ASNC 4MVOA 4U7NA 2P67A 4PA6A 3ASOB 4WFBV 3D36A 2A9HA 1H8EG 1WLEA 5L3CA 2JJ1G 4P30A 3FB7C 1K4CC 4G28B 1FS0G 4MVQA 1DF4A 3B8NA 1VQNV 5CBHA 5DM6V 4DO2A 3ABUA 4DXWA 3FKSG 1FXKA 2XAQA 2WSSG 3QO5A 1P7BA 3FYEB 3JYCA 3K9AA 2WLMA 1I5YA 4PELA 4WCEV 2Y69C 4GX0A 1VQLV 2D3OW 1NR7A 4WFHA 5LGUA 1OCRB 2X6AA 1AI7A 4UV8A 2NLJC 3LUTB 2FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDV A;  4X8A A;  3GB7 C;  4R7C A;  2WLL B;  2DYS C;  3SYQ A;  4PA7 A;  3LDE A;  1OCR C;  3IFX A;  4JTD B;  2A0L A;  2BOB C;  2JK5 C;  2KB1 A;  3ABM C;  3ZJZ A;  3AG4 C;  2BOC C;  3E8G A;  3AG1 C;  4J9Y B;  2QKS A;  5B3S C;  3E8H A;  3FB6 C;  3FB8 C;  3K0G A;  4GX5 A;  1R3L C;  4G27 B;  2YEV A;  3STL C;  3T4Z A;  2IH1 C;  3TCU A;  4PDL A;  3WG7 C;  1OCC C;  3PJS K;  4P2Z A;  3SYC A;  2DYR C;  2HFE C;  4LCU C;  2EIN C;  4H33 A;  2X6B A;  3E8F A;  4MVU A;  4BW5 A;  1ORQ C;  2W0F C;  3K08 A;  1OCZ C;  2WLL A;  1LNQ A;  2Q69 A;  4P9O A;  2Q67 A;  3UM7 A;  2X6C A;  3KG2 A;  1M57 C;  2ITD C;  4EKW A;  4JTA B;  3K03 A;  2ZXW C;  5B1A C;  4OXS A;  2ZD9 A;  2HJF C;  4MW3 A;  4PDR A;  2AHZ A;  4QE9 A;  4R8C A;  4X88 A;  5EBW C;  4F4L A;  5EBL C;  1OCO C;  3X2Q C;  3AG2 C;  4I9W A;  3SYP A;  4MSW C;  3F5W C;  1J95 A;  2DWE C;  2HG5 C;  1S5H C;  3R65 A;  3LNM B;  3ZRS A;  5CBG A;  3UKM A;  4R6Z A;  3T4D A;  3SPC A;  3OR7 C;  5EC2 C;  4XDK A;  3K04 A;  1R3J C;  2WLI B;  4X89 A;  4WFG A;  4MTO A;  4ZBM A;  3SYA A;  3T2M A;  4LBE C;  3SPI A;  3E8B A;  2ATK C;  3E83 A;  3OUF A;  4LP8 A;  1JVM A;  3AG3 C;  2HVK C;  4H37 A;  4MTF A;  3RVZ A;  4RUE A;  5EC1 C;  4RAI A;  4RO2 A;  4XDJ A;  5KUM A;  3SPJ A;  4J9Z B;  4GX1 A;  4MVM A;  2Q6A A;  4R50 A;  3VOU A;  2WLJ A;  2WLH A;  4WFF A;  3T1C A;  4XDL A;  2P7T C;  4RUF A;  3LDC A;  1BL8 A;  3RVY A;  4MTG A;  5KUK A;  3E86 A;  1XL6 A;  2Q68 A;  4JTC B;  3TET A;  2EIJ C;  2WLK A;  3RW0 A;  4QNH B;  5BZB A;  1KKD A;  5J9P C;  5IY5 C;  4PA4 A;  4PA9 A;  3IGA C;  4KFM A;  4CBC A;  4GX2 A;  5CBF A;  5E1A C;  2AHY A;  3ASN C;  4MVO A;  3OUS A;  4MS2 A;  3SPG A;  3BEH A;  4PA6 A;  3SJQ C;  3F7V C;  2EIL C;  2IH3 C;  1V54 C;  1M56 C;  2A9H A;  4MW8 A;  4P30 A;  3FB7 C;  1K4C C;  4HZ3 A;  4G28 B;  3SPH A;  4QE7 A;  2WLI A;  5EBM C;  3F7Y C;  1ZWI C;  4MVQ A;  3HPL C;  3STZ C;  2OCC C;  3ABK C;  4HYO A;  2QTO A;  4MVS A;  4TWK A;  1R3K C;  4MVZ A;  5CBH A;  1R3I C;  4DXW A;  4UUJ C;  2EIM C;  3ABL C;  3SYO A;  2WLN A;  2EIK C;  3EFF K;  1QLE C;  3ASO C;  1P7B A;  1K4D C;  3FB5 C;  3JYC A;  2A79 B;  3K0D A;  4P9P A;  4WFE A;  3LDD A;  2WLM A;  5EK0 A;  2K1E A;  2ITC C;  3OGC C;  4PDM A;  3E89 A;  1G4Y B;  1XL4 A;  2H8P C;  2Y69 C;  3OR6 C;  4GX0 A;  2R9R B;  4WFH A;  5B1B C;  3RBZ A;  2HVJ C;  4PA3 A;  2X6A A;  4MVR A;  1V55 C;  3K06 A;  2DWD C;  2NLJ C;  3LUT B; 
#chains in the Genus database with same CATH topology
 1MG1 A;  4LFA O;  4LF8 B;  4X20 B;  1BHA A;  3KZI Z;  5FNV A;  1SQG A;  4X1K A;  4DUZ O;  2PYL A;  2M7W A;  1K5Q A;  1L1F A;  3ZX6 A;  3FB8 C;  2E76 B;  1N0N A;  3K5O A;  3UT5 A;  1AI5 A;  3B40 A;  3B8M A;  2N04 A;  4JYC A;  1H8H G;  1ENV A;  4X1Y B;  4DV6 O;  5KHH A;  1Q81 W;  1JOY A;  4FZ1 A;  1QQC A;  4YJ3 B;  4DV1 B;  1LNQ A;  4NYK A;  1XMQ B;  1JFF B;  4DYL A;  1ZTE A;  1SA0 B;  1Y66 A;  4JYB A;  1B6Q A;  4FVM A;  1XOU A;  5B1A C;  4OXS A;  1E1R G;  2HJF C;  2Y0I A;  4PDR A;  4DK1 A;  1UFI A;  3N2G B;  5J2T A;  1M57 B;  2X7R B;  4PV1 B;  1ZAU A;  4DV4 B;  1HP8 A;  5IJ9 A;  4GKJ B;  1K33 A;  3LNM B;  3SJB C;  2QE7 G;  5CBG A;  3SPC A;  1Q7Y W;  1EN4 A;  3TXS A;  1DTO A;  4TV8 B;  5LBQ A;  5IWA O;  1IUR A;  1XHX A;  3U10 A;  4JI0 O;  3HKB A;  3ASN B;  4XDJ A;  3GVM A;  3SPJ A;  5L3B A;  4FM2 A;  3CCJ V;  1SC5 B;  1Q8I A;  1F51 A;  4DR7 O;  1RPR A;  2D2C B;  4MTG A;  1Q3E A;  1ROP A;  4I5S A;  3OMN B;  4L87 A;  3ZMZ A;  2WWW A;  3HKD B;  4B3M O;  4QPK A;  2BE3 A;  4LF9 O;  3DXR B;  3BEH A;  4UXN A;  4B7E A;  5CA1 A;  1U97 A;  5IWA B;  3C90 A;  5LP6 B;  1K8A W;  2LGQ A;  2CGO A;  2QM7 A;  1P4R A;  4JI3 B;  4ASU G;  2FYU H;  4DR7 B;  4DW0 A;  2XHB A;  5IYD O;  4Z2W A;  4P9P A;  3FB5 C;  4ZHQ B;  4LFC O;  4OPA A;  3K58 A;  4JYY A;  4TQD A;  1F23 A;  2PYJ A;  2F1M A;  3DTU B;  2JK5 C;  1QLE B;  5L3G A;  3P3N A;  3E2E A;  1VMG A;  2QKS A;  1FXH A;  5HFM A;  2ZCE A;  2HR3 A;  1Q82 W;  3JD0 A;  1VQ8 V;  4KP4 A;  2HFE C;  4B08 A;  4NXN O;  1VQP V;  1IBL O;  1B06 A;  1Q6U A;  2XND G;  3JD1 A;  3CRR A;  1Q43 A;  3JAM N;  4F4L A;  2EJR A;  5LYJ A;  3B09 A;  3QTC A;  2RN9 A;  4CH6 A;  4WFA V;  4J7J A;  3ZRS A;  4DR2 O;  3B4S A;  4XDK A;  4WFG A;  4B3R B;  3RYC B;  3ZRV A;  2GDS A;  3RVZ A;  3HR0 A;  2FL4 A;  2YIB D;  3H1H H;  3E86 A;  1Z2G A;  5BZB A;  2H3O A;  1AR4 A;  1P84 F;  4G2K A;  1YTF B;  2IW5 A;  4B3S B;  2W0X A;  3G71 V;  3SPG A;  1W0J G;  1V54 C;  2PF4 E;  3HKB B;  2ZDI C;  1AB3 A;  1PD3 A;  2OT5 A;  2OWO A;  1HNW B;  3CCL V;  3F7Y C;  3CC4 V;  3CCU V;  2F93 B;  1ZX3 A;  2YID A;  3ZCC A;  2Q7E A;  1M9N A;  1GTO A;  4UUJ C;  2LJ2 A;  2IM9 A;  1K4D C;  3JAR B;  1M56 B;  4LF9 B;  1XL4 A;  2RDC A;  3RBZ A;  3CCR V;  1VQ6 V;  1NTK H;  1SA0 A;  1GAX A;  3CD6 V;  1D2D A;  4JI4 B;  4X8A A;  5EYP B;  2WLL B;  2IJH A;  1ZLZ A;  5KHK A;  2OYQ A;  1I08 A;  1AJN A;  1H2L A;  1PNL A;  1XQ8 A;  4UVC A;  4ZHQ A;  3JD3 A;  2YUA A;  1XBL A;  2OCH A;  4FFB B;  1IVS A;  1W2B U;  1XNQ B;  3K59 A;  5EZY B;  1RPO A;  1NVP D;  1Y76 B;  4I55 B;  4BIU A;  3AG4 B;  2Q69 A;  4FLY A;  4F6E A;  2EUL A;  4N21 A;  3SJC C;  1HNZ O;  4JTA B;  1AJQ A;  4JAA A;  1MSW D;  2B1I A;  3C3T A;  1QBZ A;  4J10 A;  5B1O A;  3RWR D;  4B3T O;  4X64 O;  3KKY A;  1K7D A;  3A0H Z;  4I9W A;  3SYP A;  1RM1 B;  4LF4 O;  4DV1 O;  2R70 A;  3X2Q B;  4NXN B;  2R9A A;  3SYA A;  4JYA B;  3E8B A;  4AHC A;  3CJH A;  3CSX A;  1KC8 W;  5C93 A;  4RO2 A;  2BTQ A;  2AXT Z;  1N32 B;  2PTM A;  1VEW A;  2UXN A;  2WLJ A;  2WLH A;  4DR1 O;  3BVO A;  1QR9 A;  4KXR A;  2KSD A;  4JTC B;  2CGN A;  2OCC B;  1HR0 B;  1NVP B;  2L6L A;  1MAB G;  1THZ A;  5C8Y A;  3CJH B;  2F23 A;  1N0J A;  4X1I B;  5B1N A;  1AP5 A;  1H2S B;  2HHH O;  2DE0 X;  4QE7 A;  4B7K A;  2IBZ H;  1NQT A;  4TWK A;  4MVS A;  1PPJ H;  4FK5 C;  1BZK A;  1S77 D;  4LF7 O;  4BIO A;  2UXB B;  2CDY A;  3APQ A;  1NBM G;  4B3S O;  3ASO C;  2KQX A;  2A79 B;  4HNA A;  1XUQ A;  3OGC C;  3W7S A;  3ZS8 C;  1GM9 A;  2R9R B;  1X59 A;  3ZMS A;  3M7M X;  3ZHR A;  1FFX B;  4K8Z A;  1Y76 A;  2QM4 A;  5L3D A;  2C2A A;  4X65 B;  1K73 W;  2O57 A;  1XI1 A;  1BGY H;  4J9Y B;  2FML A;  3E8H A;  4K0K B;  3JAK A;  3ETD A;  5LGT A;  1TUE B;  1YEW A;  1G1X B;  4PJ0 Z;  2WLL A;  1FFX A;  2X6C A;  5CN0 A;  2BSK A;  3BPZ A;  4FLW A;  2Y4U A;  5JH7 B;  1OZ0 A;  1UPG A;  5CA0 B;  2ZM6 B;  3S3W A;  4UVB A;  3JAR A;  1VIB A;  3FAV B;  2CTW A;  3T1Y B;  3R65 A;  2EJ7 A;  1SQP H;  3AK3 A;  1YIJ V;  4DV5 O;  3T2M A;  4X1I A;  4H0L B;  4U3J B;  2Q7H A;  3W7W A;  2P06 A;  1EZJ A;  1GO3 F;  4GX1 A;  4B3T B;  2DOS A;  5J2U A;  3MHS C;  4JI7 B;  4D6T H;  4JZG A;  1VF7 A;  2JGU A;  1EN6 A;  4DUY O;  2EIJ C;  4DW1 A;  3APO A;  3BRC A;  3N27 A;  3TXQ A;  3J7A U;  4ZI7 A;  1KB9 F;  2A9H A;  4P30 A;  3CRC A;  5JCO A;  3AK1 A;  5DM6 V;  4BW9 A;  4PEL A;  4WCE V;  2Y69 C;  1VF5 B;  2ADQ B;  1AI7 A;  2GUZ B;  3HKC B;  2FTK A;  2PGG A;  1FFT B;  1KD1 W;  2HHH B;  4OX9 O;  3LDE A;  1OCR C;  2HP8 A;  2ZE5 A;  5IYZ A;  3DC5 A;  1WB7 A;  4J80 A;  1M5I A;  2YI8 A;  1SF9 A;  1KEC A;  3ETE A;  1H2G A;  4JI1 O;  2Y48 A;  3LNN A;  3B2E E;  3CCS V;  2DN9 A;  4JI2 B;  4HAM A;  5TIS Z;  2MW2 B;  1DGS A;  4O4L A;  2PI5 A;  4P9O A;  5H6R A;  2JGD A;  1CP9 A;  3EXA A;  1JJO A;  4LH7 A;  1BHB A;  3AG3 B;  1OV9 A;  4X88 A;  1NT2 B;  4R8C A;  1OCC B;  5LXT B;  1XNQ O;  5D5Q A;  1KP3 A;  5LMU B;  1M93 A;  3ZHT A;  4RQE A;  2OIE A;  3CC2 V;  4MTF A;  3OFN G;  2ZDI A;  2KG7 A;  5EC1 C;  4RAI A;  5LL6 Y;  1ZL8 A;  2JIZ G;  1S3J A;  4HBN A;  3RT3 C;  4H44 B;  4XBF A;  3UO3 A;  3ZMT A;  2GHY A;  2RQ6 A;  4RUF A;  3M8A A;  3CWB H;  4NTW A;  2VQF B;  1IX9 A;  1Q5O A;  1L8D A;  1WJZ A;  2FB5 A;  4GX2 A;  3P3P A;  3OUS A;  3K5L A;  3RYF B;  1KBH A;  2Y69 B;  3RYI A;  4JI7 O;  4LFB B;  4UCV A;  2UXC O;  4X66 O;  1M90 W;  2JRI A;  2ZE6 A;  1PNM A;  1QU7 A;  3CXH F;  2IU3 A;  3CRQ A;  2ZIN A;  4PDM A;  4X62 B;  4PA3 A;  4Q20 A;  1P7G A;  4PDV A;  3ZRX A;  2JGD B;  4O2A B;  4DR3 B;  2QDO A;  3K79 A;  5FL7 G;  5KA5 A;  5L3E A;  5JJN B;  3C3S A;  4PA7 A;  1FPO A;  2YXL A;  2Q9L A;  4WBN A;  2QWP B;  3I5D A;  3K0G A;  1NI8 A;  1R3L C;  4H13 B;  1J5E B;  1R1B A;  3CYO A;  1VP7 A;  4Z1M G;  3DGE A;  2UUB B;  1U96 A;  1OCZ C;  4LF5 O;  2AGA A;  1LR1 A;  5KA6 A;  2UUA B;  2GUZ A;  1TVK A;  2YXH A;  5EBL C;  4U7O A;  4CC6 A;  3A0R A;  1N36 O;  1EM1 A;  2QWO B;  4KUM A;  1YVW A;  5IYB O;  4R6Z A;  4ZOL B;  2CTQ A;  4X89 A;  1R3J C;  3G6E V;  2DQ0 A;  1OHH G;  1GKF A;  3E83 A;  4LP8 A;  3PN1 A;  5KX5 A;  4O4H B;  2WPD G;  1FJG B;  3I56 V;  4J9Z B;  4JAS A;  3D8C A;  2UU9 O;  3H01 A;  4DV7 B;  1ARO P;  2KKW A;  3JAS B;  5BY1 A;  4IIJ B;  1RSO B;  2F4V B;  4CBC A;  2ARH A;  5CBF A;  1RP3 B;  2P4V A;  5K1P A;  4F6R B;  4DR2 B;  4JAU A;  2YDE A;  3OMI B;  4CH3 A;  2EIM B;  3CP1 A;  3SPH A;  1QHT A;  1V9P A;  2ZR2 A;  4PI0 A;  3STZ C;  5IY5 B;  4HYO A;  5LHH A;  2XAG A;  2UU9 B;  2EIK C;  3EFF K;  4JI5 B;  1Q86 W;  3N2G A;  5J2T B;  3CRA A;  4IL6 Z;  3F5T A;  3FD9 A;  2YIC A;  1LUV A;  5JH7 A;  1TUB A;  3OEE G;  2P5O A;  2G38 A;  3MDS A;  2VWK A;  1HW7 A;  3JAK B;  2VQE B;  4JI6 B;  1JX9 A;  3SDL A;  4JYA O;  1WN7 A;  4P2Z A;  1SZX A;  1QCE A;  2IJI A;  2DYR C;  4FLT A;  1SS3 A;  4LCU C;  4DRX A;  2EIN C;  3A2F A;  4DR3 O;  1E79 G;  4DR1 B;  2YS8 A;  4O4I A;  4LNU A;  2EIN B;  5DEC A;  4RWU A;  3SR2 C;  1MA1 A;  3BA9 A;  3X2Q C;  1DK1 A;  2DWE C;  1KQS U;  5JWP A;  3CME V;  5LMN O;  2JEX A;  3LSS A;  4LBE C;  2CH7 A;  5GW7 A;  1WA8 B;  1W0K G;  2VS0 A;  1K5S A;  3ZHU A;  5E79 Z;  4BIZ A;  3VOU A;  3OAA G;  5LMU O;  1LUW A;  4JF3 A;  2ZE8 A;  2LW7 A;  4JV5 B;  1IZ3 A;  2Q5Z A;  4ZOL A;  3G67 A;  5IY5 C;  2QM8 A;  3JSL A;  1Y4M A;  3OEH G;  1AR1 B;  4ZKI A;  2EIL C;  3G6B A;  1VQ4 V;  1M56 C;  1I0H A;  4DR5 B;  1TVK B;  1K92 A;  4LFA B;  1GN4 A;  3G4S V;  1MSD A;  4GCZ A;  1DF5 A;  2CE4 A;  2Q0A A;  1VQ5 V;  3UQ8 A;  2QWN B;  1BCC H;  1IBK B;  3ABM B;  1N32 O;  1PL0 A;  3T1H O;  3CS5 A;  5LOV A;  5CMU A;  2RNB A;  1G4Y B;  5ITZ A;  1SQX H;  3OTF A;  1NH2 D;  2R9I A;  1Z5V A;  4BWA A;  3K06 A;  1AI6 A;  4UFZ A;  5DN6 G;  5BR8 O;  1YTF D;  3JSN A;  4X66 B;  3SYQ A;  1IBM B;  2ZT9 B;  4FJC C;  3K57 A;  3IFX A;  2WA3 A;  2BOB C;  2PY5 A;  2GV9 A;  1O9G A;  1IXB A;  3FB6 C;  1SES A;  2E75 B;  1COW G;  4GKJ O;  2OIG A;  2YXY A;  3CB2 A;  1FXK B;  2ADP A;  2P90 A;  1PNK A;  1VQ7 V;  1FAF A;  3J81 N;  4CS2 A;  5KAF Z;  4UCO A;  4N23 A;  4NB5 A;  3QF7 A;  4NXM O;  1J5E O;  5LA6 A;  1XMO O;  1MZE A;  1NU1 H;  5JCO C;  3VBB A;  3U0Z A;  3ETQ A;  4CH5 A;  3AK2 A;  1YZB A;  4JGS A;  5JJJ B;  4LF5 B;  3OW2 U;  1BQZ A;  4LWS A;  4TV9 A;  2UUA O;  1IDS A;  5EC2 C;  1HNX B;  2DW4 A;  3GWO A;  1N34 B;  3AG3 C;  2Q8V A;  2EX3 A;  2UXX A;  1FD9 A;  5IJ0 A;  1TGO A;  3CRM A;  3RYH A;  4MVM A;  2P7T C;  2Q7G A;  4E4E A;  4IHJ A;  4I9Q A;  2A3Q A;  4JI3 O;  2LGW A;  2W6I G;  3FX7 A;  4LWS B;  4DV2 O;  5DED A;  3ZMU A;  3THO A;  4QGP A;  3UO2 A;  2Z0A A;  4U7N A;  2P67 A;  5LXT A;  4PA6 A;  4CS3 A;  4EFE A;  3L73 H;  1KMI Z;  1N34 O;  1B04 A;  4DV5 B;  5A9G A;  3RYC A;  4MVQ A;  1DF4 A;  4JV5 O;  5BMV B;  4JI2 O;  1KUQ A;  4DXW A;  3FKS G;  1FXK A;  3QO5 A;  1P7B A;  3FYE B;  3K9A A;  3TGU H;  1O9H A;  2D3O W;  1NR7 A;  4DUY B;  2M6Y A;  1OCR B;  2X6A A;  4Q6G A;  2NLJ C;  3LUT B;  5LHG A;  3QVN A;  1YIT V;  3EVK A;  3CE2 A;  2W6J G;  4GZR B;  2XAJ A;  5JVD B;  4EB6 A;  5B1B B;  4YHH O;  4IYH A;  4NTY A;  1KP2 A;  3OM3 B;  2CUG A;  5JQG A;  4FLX A;  1GM8 A;  1AJP A;  3K03 A;  2OTJ V;  2AHZ A;  3N2K B;  2EZP A;  1PL4 A;  1JPX A;  5B1A B;  1MZF A;  3WFV A;  1SER A;  4YHH B;  1I94 B;  2WLI B;  4KHP O;  3CCQ V;  3HKE B;  3OUF A;  4UVA A;  3VQV A;  2LO1 A;  3JCU Z;  4I0X B;  2UXC B;  3RYH B;  2DMX A;  3LSU A;  3A0B Z;  1XMO B;  5H6Q A;  3W7U A;  3IC9 A;  3HKD A;  4NTX A;  5EIB C;  1K97 A;  3RW0 A;  2JJ2 G;  1BMF G;  2PUS A;  1Q6H A;  3FAV A;  4KHP B;  2RJZ A;  2NNU A;  4JI4 O;  3H1K H;  1HWY A;  2BSK B;  4LNU B;  3UCS C;  1WPB A;  3ZN0 A;  5LP6 C;  1R3K C;  3W7T A;  3JAL B;  3CXC U;  3DC6 A;  3D3Q A;  1VF6 C;  4DV0 B;  2X0L A;  3SYO A;  1V55 B;  5EK0 A;  2Q73 A;  3E89 A;  3OR6 C;  5B1B C;  1VAR A;  2B1G A;  2HVJ C;  3NXS A;  3SGI A;  3L72 H;  1V55 C;  3CCE V;  3ZHS A;  5KLV H;  3I55 V;  1WPX A;  3ETG A;  3OD4 A;  4YJ3 A;  1R6N A;  4JTD B;  4I50 A;  2A0L A;  1XHZ A;  4CC5 A;  2QTS A;  4X1Y A;  4J11 A;  1AP6 A;  1TA8 A;  3BAA A;  2YEV B;  5ITZ B;  2YEV A;  2ZE7 A;  3TCU A;  3UT5 B;  2ZM6 O;  1OCC C;  2QKA A;  1XRE A;  4QPJ A;  5IYC O;  1FYJ A;  1QR8 A;  4MVU A;  5FNV B;  4BW5 A;  2CTP A;  4X20 A;  1G6U A;  2VRZ A;  3OMA B;  4GKK O;  4UV9 A;  4X62 O;  4DUZ B;  2ITD C;  3VQX A;  4AIL C;  3R66 A;  3W7X A;  1GRJ A;  4L8J A;  4MT8 A;  2OTL V;  3BY6 A;  3KCX A;  4JAV A;  2LFR A;  4FZ0 A;  2BCC H;  3WU2 Z;  2B5U A;  3F5W C;  3ZED A;  1PP9 H;  2XAF A;  1R6T A;  3L74 H;  1B3Q A;  3WB0 A;  2GSM B;  3FFQ A;  2LW1 A;  3ZN1 A;  2N05 A;  1BSM A;  4X9Q A;  4NXM B;  2ATK C;  4TOI A;  2JEU A;  2Q0O C;  5KUM A;  1FXV A;  1YJ9 V;  3O65 A;  2XOK G;  1XDC A;  2NN4 A;  1SQF A;  2WA4 A;  4AQY B;  3GWK C;  3IGA C;  1H2K A;  4JPR A;  4E2L A;  3CPW U;  5B5E Z;  2Q4P A;  3L71 H;  3QO8 A;  2E5L B;  4I0X A;  5KMG A;  3HKE A;  4I4T B;  4MTX A;  4O4I B;  4OGQ B;  2OCC C;  2ZIO A;  1H2N A;  3VQY A;  4X65 O;  5BXZ A;  2EIM C;  2E3C A;  1S5J A;  4FFB A;  2FKX A;  4WFE A;  2ITC C;  1TAE A;  2HLD G;  4DR4 B;  1JJ2 U;  2F4V O;  1BQ0 A;  1HNZ B;  3GB7 C;  4R7C A;  1CEZ A;  5FLX N;  4O2B A;  3QG5 A;  3ABM C;  3E22 B;  4O2A A;  4DV0 O;  1TUB B;  3Q4H B;  3AG7 A;  4G27 B;  1W59 A;  5IDJ A;  5JVD A;  1S76 D;  1Y6X A;  5L3F A;  1D5N A;  2QWQ B;  4O4J A;  4UCU A;  4RQF A;  3HB3 B;  5EBW C;  5KHG A;  1M4U A;  4F6R A;  1OCO C;  3AG2 C;  4UB8 Z;  4MSW C;  3QNE A;  5KHI A;  2ZXW B;  2N74 A;  2PI4 A;  3T4D A;  5BMV A;  1JR9 A;  1GM7 A;  4JI6 O;  3ZIA G;  1WP7 A;  5K1X A;  1AI4 A;  4IIJ A;  2DJV A;  4GKK B;  1MOF A;  1RFY A;  4UCR A;  3RFR A;  4IGG A;  1WNS A;  1US6 A;  4RUE A;  2KG7 B;  3ABT A;  1VQ9 V;  4FLZ A;  4CS4 A;  4PA4 A;  4FLU A;  1D5A A;  3OTO O;  5BR8 B;  1FKA O;  5E1A C;  1F7Y A;  1EFR G;  2EIK B;  1R6K A;  5LYJ B;  3IJ4 A;  1S0V A;  2CTR A;  2A7W A;  2Z3Y A;  2ZQM A;  4HZ3 A;  3ABK C;  4TV9 B;  2JDI G;  4O4L B;  5JQG B;  3ZHQ A;  4DV3 B;  3CHX A;  4J42 A;  4JZ2 A;  3LDD A;  1A32 A;  2QKC A;  5CB4 B;  1SKV A;  3K5N A;  2IJJ A;  4FIP C;  3M99 B;  1YHQ V;  4J7K A;  5B3S B;  2DYR B;  4BAY A;  2ZKO A;  3ZJZ A;  1YDX A;  3KCY A;  3AG4 C;  1YJW V;  1WB8 A;  3JAT B;  3H1L H;  3BCC H;  1S5L Z;  5D5P A;  3STL C;  3T4Z A;  3SJA C;  3JAT A;  3Q4H A;  1R73 A;  4PDL A;  3WG7 C;  1AIL A;  5LHI A;  5IT9 N;  4FFK A;  1RM1 C;  2DYS B;  2LFS A;  2P6J A;  3E22 A;  1N36 B;  2X6B A;  2A06 H;  4O2B B;  2UXD O;  3B77 A;  1AVM A;  1QVF U;  4K3A A;  1UJW B;  4GLX A;  4J41 A;  4J7Z A;  1YJN V;  4TT3 G;  4DV2 B;  2ZD9 A;  3JD4 A;  3DXR A;  4Z1V A;  3BHP A;  4PD4 F;  4JI8 B;  4K0K O;  3OR7 C;  4ZBM A;  1QLN A;  1YI2 V;  1JVM A;  3JD2 A;  5KMG B;  4LF6 B;  2UXD B;  4YJ2 A;  3H1I H;  1KKC A;  1PV0 A;  3ZRW A;  4X64 B;  4LF4 B;  3CC7 V;  1XL6 A;  5LGN A;  3TET A;  2WLK A;  2YSU B;  1L0L H;  2QGN A;  5J9P C;  3ABK B;  4EEQ A;  4PHZ A;  2BTO A;  2Y4T A;  4WF9 V;  4LF8 O;  4JI8 O;  4MVO A;  5GTI Z;  4WFB V;  3D36 A;  5GON A;  2XTA A;  5LA6 B;  4DK0 A;  3L9D A;  1WAZ A;  1WLE A;  5L3C A;  2JJ1 G;  4LF6 O;  1K4C C;  1Q90 D;  1FS0 G;  1JFF A;  1VQN V;  2XAQ A;  1HR0 O;  2WSS G;  3JYC A;  1XMQ O;  1EZV H;  4WFH A;  1I7F A;  4O4J B;  2CAZ C;  4YIP A;  1NS1 A;  5IYZ B;  2DYS C;  2QJ1 A;  1N33 B;  2KB1 A;  3ABL B;  4DV4 O;  1P49 A;  2QA4 V;  2PZS A;  3E8G A;  4DV3 O;  1VQM V;  1I94 O;  3CCM V;  3AEI A;  1BE3 H;  5GTH Z;  4JI0 B;  4NVP A;  4H33 A;  3E8F A;  5LMN B;  3UM7 A;  1XIL A;  3BAB A;  3KG2 A;  1M57 C;  4A5U B;  1VF6 A;  4B3M B;  1X4T A;  4FM1 A;  4ZIB A;  2QEX V;  3JAL A;  4JI1 B;  3JAW B;  2IU0 A;  1K3E A;  2JS3 A;  3RGB A;  3OE7 G;  3EHB B;  1YXB A;  3IC7 A;  4LFB O;  4R50 A;  3JCZ A;  4TSF G;  4DR5 O;  1XEQ A;  1M1K W;  4GUN A;  1WA8 A;  1BL8 A;  5KAI Z;  2Q68 A;  3P32 A;  1RSO A;  2ZR3 A;  2UUC B;  2ILM A;  4PI2 A;  1N8R W;  3JAS A;  2AHY A;  1F4N A;  4MS2 A;  1IBK O;  4D7T A;  2MK3 A;  3SJQ C;  5H9C A;  3ZHV A;  4NR1 A;  2Z5U A;  1BS3 A;  4FLV A;  5KX5 B;  4D7S A;  3NR7 A;  1SQB H;  2GTA A;  3TK1 A;  1URF A;  3S3X A;  2QTO A;  4I55 A;  5F2V O;  3ML0 A;  2V4D A;  5EZY A;  1R3I C;  3ABL C;  4DRX B;  2WLN A;  1EN5 A;  2H8P C;  4TUY B;  3MHH C;  2YIA A;  1YSC A;  4MVR A;  2DWD C;  1SQQ H;  4DR6 B;  4FMT A;  3J80 N;  2UXB O;  1YF2 A;  1F4M A;  5EYP A;  2ZIM A;  2BOC C;  3AG1 C;  1L0N H;  1QNM A;  1T5E A;  1VQK V;  3E35 A;  3DSQ A;  3K3W A;  4EB6 B;  3AG1 B;  3SYC A;  1JQ0 A;  4I50 B;  3MAQ A;  1KU9 A;  2E74 B;  1ORQ C;  5AG2 A;  4U3F H;  4NKG B;  1N33 O;  2JVD A;  4EKW A;  2P22 C;  4DV7 O;  1OCZ B;  4MW3 A;  4AQY O;  2B9Z A;  5C8Y B;  2EBO A;  1HDJ A;  1NJI W;  1CXZ B;  2HG5 C;  1S5H C;  4UCS A;  5H2F Z;  3UKM A;  3OGI B;  2ZNJ A;  4UB6 Z;  3SPI A;  4K35 A;  2QWR B;  3RYI B;  1ZSP A;  1JMK C;  1NKD A;  5GON B;  4EFB A;  4YY3 B;  4LH6 A;  1IBL B;  5A2Q N;  4XDL A;  2P4K A;  3D36 C;  3WB1 A;  1E1Q G;  1EBO A;  2NR5 A;  1GMG A;  3L75 H;  4C7U A;  5KHJ A;  1GN3 A;  2F43 G;  3CX5 F;  4KFM A;  3T1H B;  4OPH A;  3OT7 A;  3ZRW B;  5IJ0 B;  2HJD A;  3F7V C;  5CA3 A;  1GH6 A;  2QR4 A;  4YJ2 B;  3K9S A;  5JJE B;  4MW8 A;  4ICG A;  2DQ3 A;  1SZT A;  1SET A;  2WLI A;  4W4L A;  3QO7 A;  1H38 A;  4K8X A;  4MVZ A;  1NH2 B;  4YY3 O;  2LQT A;  2UUC O;  1QVG U;  2WAM A;  4LR3 A;  1QLE C;  1Y74 B;  3N2K A;  3CMA V;  3U11 A;  1G8M A;  2AZ0 A;  1H2M A;  4WBN B;  2ZNI A;  4YXW G;  4W4K A;  1KYO F;  4LC1 A;  1GN6 A;  2LP7 A;  1Q6I A;  3H1J H;  3BFR A;  1NR1 A;  2GBO A;  2IH1 C;  1Y74 A;  3BA8 A;  3PJS K;  2AZ2 A;  4JI5 O;  1CPY A;  3IAY A;  4DR6 O;  1HNX O;  3K08 A;  4QJF B;  3K5M A;  2V7Q G;  3CEI A;  3O9O A;  3HKC A;  4ABM A;  3RYF A;  2ZXW C;  4QE9 A;  5CB4 A;  5CA1 B;  3OTO B;  1K34 A;  5LOV B;  2XAH A;  4QIW F;  2RCV A;  1ZUQ A;  2CK3 G;  4I7Z B;  5FPO A;  2L35 A;  2YC0 A;  3LSQ A;  3AG2 B;  2ETN A;  3K04 A;  1GN2 A;  2XUM A;  2VWJ A;  4FM0 A;  1GK9 A;  3D3I A;  4LF7 B;  1ZL8 B;  3A8T A;  1JCH A;  1V54 B;  4ZI7 B;  3WB2 A;  3LDC A;  3RVY A;  5KUK A;  2GTS A;  4TV8 A;  4TQF A;  4IHJ B;  4PA9 A;  1XNR O;  5IJ9 B;  3TJT A;  5J2U B;  1WP8 A;  1BT8 A;  3P30 A;  2JS5 A;  1JA8 A;  2XT9 A;  2IH3 C;  2XAS A;  2H94 A;  1NZ6 A;  1PKX A;  2CH7 B;  1NTZ H;  5EBM C;  2VQF O;  1VQO V;  3VQW A;  1ZWI C;  3HPL C;  1MNG A;  4IT5 A;  2QSA A;  1OJH A;  4CZZ A;  3K0D A;  1DLB A;  2K1E A;  4QNH B;  5CA0 A;  3RN4 A;  2YIB A;  2K9P A;  2F66 C;  2V1D A;  4X1K B;  2R72 A;  3WG7 B;  5HFL A;  1K9M W;  5B3S C;  4GX5 A;  3FYI B;  1FXK C;  4TUY A;  5FPR A;  4GYC B;  1OCO B;  4GT1 A;  4IYI A;  1S72 V;  2W0F C;  2Q67 A;  1MMM A;  2RMK B;  2IJK A;  1IBM O;  4B3R O;  4FPP A;  2HKO A;  3MD0 A;  5LP6 A;  2VQE O;  2HEP A;  4HNA B;  4BR6 A;  1SRY A;  1J95 A;  2UUB O;  3ZBH A;  3L70 H;  3ICX A;  4YIO A;  5IE9 A;  1PM9 A;  2AW9 A;  2F95 B;  4I4T A;  3ZMV A;  2HVK C;  4H37 A;  3CCV V;  1Z5W A;  4AI8 A;  2EIJ B;  2EIL B;  2Q6A A;  4U3J A;  4WFF A;  4CH4 A;  2E5L O;  3T1C A;  2YI9 A;  1IXM A;  1I5X A;  3JAW A;  3H9V A;  5B66 Z;  2EZO A;  1HNW O;  1KKD A;  4UCT A;  3G80 A;  3ASN C;  4LFC B;  4OX9 B;  1FJG O;  3T1Y O;  2BTQ B;  4KL1 A;  3ASO B;  1Y67 A;  4O4H A;  5EIB D;  1H8E G;  1YCI A;  4DR4 O;  1N4C A;  3FB7 C;  4G28 B;  1SQV H;  3B8N A;  5CBH A;  2Y0P A;  4DO2 A;  3ABU A;  1AR5 A;  1XNR B;  4DV6 B;  2ODM A;  2WLM A;  1I5Y A;  1NTM H;  4GX0 A;  1VQL V;  5H5N A;  5LGU A;  4UV8 A;  4MTO A; 
#chains in the Genus database with same CATH homology
 1MG1 A;  1FFT B;  1KD1 W;  1YIT V;  2DYS C;  2W6J G;  3LDE A;  1BHA A;  1OCR C;  2XAJ A;  2KB1 A;  3ABL B;  2M7W A;  1K5Q A;  1L1F A;  2QA4 V;  3E8G A;  1VQM V;  3FB8 C;  3CCM V;  5B1B B;  1KEC A;  3AEI A;  3ETE A;  1AI5 A;  3B8M A;  1H2G A;  2Y48 A;  4JYC A;  1KP2 A;  1H8H G;  1ENV A;  3CCS V;  3OM3 B;  4HAM A;  1Q81 W;  4H33 A;  1JOY A;  3E8F A;  2PI5 A;  1GM8 A;  1AJP A;  1LNQ A;  4P9O A;  5H6R A;  3UM7 A;  3KG2 A;  1M57 C;  1CP9 A;  1Y66 A;  4JYB A;  3K03 A;  2OTJ V;  1B6Q A;  5B1A C;  1BHB A;  4OXS A;  1E1R G;  2HJF C;  3AG3 B;  4PDR A;  2AHZ A;  4R8C A;  4X88 A;  1OCC B;  1M57 B;  2EZP A;  2X7R B;  1JPX A;  2QEX V;  1KP3 A;  5B1A B;  1K33 A;  3LNM B;  2QE7 G;  3WFV A;  5CBG A;  1SER A;  3SPC A;  1Q7Y W;  4RQE A;  2WLI B;  1DTO A;  3CC2 V;  5LBQ A;  3CCQ V;  2IU0 A;  1K3E A;  3OUF A;  4MTF A;  3OFN G;  4UVA A;  2ZDI A;  3OE7 G;  3EHB B;  3ASN B;  5EC1 C;  4RAI A;  4XDJ A;  3IC7 A;  2JIZ G;  3SPJ A;  5L3B A;  1S3J A;  3CCJ V;  5H6Q A;  3W7U A;  3ZMT A;  4R50 A;  4XBF A;  1F51 A;  3JCZ A;  4TSF G;  2GHY A;  1RPR A;  1M1K W;  4RUF A;  1BL8 A;  4MTG A;  2Q68 A;  1K97 A;  3P32 A;  1ROP A;  4I5S A;  3OMN B;  2JJ2 G;  4L87 A;  3RW0 A;  3ZMZ A;  2ZR3 A;  2WWW A;  1BMF G;  4QPK A;  1N8R W;  4GX2 A;  2AHY A;  3OUS A;  1F4N A;  4MS2 A;  2MK3 A;  3BEH A;  4UXN A;  3SJQ C;  5H9C A;  2Z5U A;  1K8A W;  2Y69 B;  2NNU A;  1HWY A;  3TK1 A;  2QM7 A;  3ZN0 A;  1P4R A;  2QTO A;  4ASU G;  1R3K C;  3W7T A;  3CXC U;  3ML0 A;  1M90 W;  1R3I C;  2X0L A;  3ABL C;  3SYO A;  2WLN A;  1V55 B;  1PNM A;  5IYD O;  4P9P A;  2IU3 A;  3FB5 C;  5EK0 A;  4PDM A;  3E89 A;  1F23 A;  2H8P C;  3OR6 C;  5B1B C;  2B1G A;  3MHH C;  2HVJ C;  3NXS A;  4PA3 A;  1YSC A;  4MVR A;  1V55 C;  3CCE V;  2DWD C;  4Q20 A;  3DTU B;  4PDV A;  3ZRX A;  3I55 V;  1WPX A;  3K79 A;  5KA5 A;  3ETG A;  5FL7 G;  5L3E A;  1R6N A;  4PA7 A;  4FMT A;  4JTD B;  2A0L A;  2JK5 C;  1F4M A;  1QLE B;  2BOC C;  5L3G A;  3AG1 C;  3E2E A;  2QKS A;  3K0G A;  1FXH A;  1VQK V;  5HFM A;  2YEV B;  1R3L C;  2YEV A;  3E35 A;  2HR3 A;  1Q82 W;  3TCU A;  3K3W A;  3AG1 B;  3JD0 A;  3CYO A;  1OCC C;  1VQ8 V;  4QPJ A;  4Z1M G;  3SYC A;  1JQ0 A;  4KP4 A;  5IYC O;  2HFE C;  1QR8 A;  4MVU A;  3DGE A;  4BW5 A;  1ORQ C;  3OMA B;  1VQP V;  5LHG A;  1OCZ C;  4UV9 A;  5KA6 A;  2XND G;  2ITD C;  3JD1 A;  4EKW A;  3W7X A;  1OCZ B;  4MW3 A;  4MT8 A;  2OTL V;  3BY6 A;  4JAV A;  4F4L A;  5EBL C;  2EJR A;  2EBO A;  4U7O A;  2LFR A;  1NJI W;  2B5U A;  3F5W C;  3A0R A;  2HG5 C;  1S5H C;  4WFA V;  4KUM A;  3ZRS A;  3UKM A;  4R6Z A;  5IYB O;  2XAF A;  4XDK A;  4X89 A;  1R3J C;  2GSM B;  3G6E V;  2DQ0 A;  4WFG A;  1OHH G;  3ZN1 A;  1GKF A;  3SPI A;  2ATK C;  3E83 A;  4LP8 A;  3ZRV A;  2JEU A;  1NKD A;  3RVZ A;  2WPD G;  5KUM A;  3I56 V;  1FXV A;  4J9Z B;  1YJ9 V;  4JAS A;  2XOK G;  3H01 A;  1ARO P;  4XDL A;  3E86 A;  1E1Q G;  1EBO A;  1GMG A;  5BZB A;  4G2K A;  1YTF B;  2IW5 A;  3IGA C;  4KFM A;  2F43 G;  4CBC A;  5CBF A;  3G71 V;  3SPG A;  3ZRW B;  4JPR A;  4E2L A;  1W0J G;  3F7V C;  1V54 C;  5CA3 A;  3CPW U;  3QO8 A;  2ZDI C;  1PD3 A;  4JAU A;  4MW8 A;  3OMI B;  2OT5 A;  2DQ3 A;  1SZT A;  2EIM B;  3CP1 A;  3SPH A;  4MTX A;  1SET A;  2WLI A;  3CCL V;  2ZR2 A;  3F7Y C;  3QO7 A;  3CC4 V;  3STZ C;  2OCC C;  5IY5 B;  4HYO A;  5LHH A;  3CCU V;  1H38 A;  4MVZ A;  2XAG A;  1NH2 B;  3ZCC A;  1M9N A;  1GTO A;  4UUJ C;  2EIM C;  1QVG U;  3EFF K;  2EIK C;  1QLE C;  2WAM A;  1K4D C;  1Q86 W;  4WFE A;  1M56 B;  2ITC C;  3CMA V;  1XL4 A;  3RBZ A;  3CCR V;  2HLD G;  1VQ6 V;  1G8M A;  3CD6 V;  1JJ2 U;  4X8A A;  3GB7 C;  4R7C A;  3OEE G;  1CEZ A;  2WLL B;  2IJH A;  3ABM C;  4YXW G;  4LC1 A;  1AJN A;  1PNL A;  2LP7 A;  1JX9 A;  1NR1 A;  4G27 B;  2IH1 C;  4UVC A;  5IDJ A;  4P2Z A;  3PJS K;  3JD3 A;  1QCE A;  2IJI A;  2DYR C;  4LCU C;  1W2B U;  2EIN C;  1CPY A;  1RPO A;  1S76 D;  3K08 A;  4QJF B;  1NVP D;  1E79 G;  3AG4 B;  4BIU A;  5L3F A;  2Q69 A;  2V7Q G;  4N21 A;  2EIN B;  4JTA B;  4RQF A;  3HB3 B;  2ZXW C;  1AJQ A;  1MSW D;  2B1I A;  4QE9 A;  5EBW C;  1QBZ A;  5B1O A;  1OCO C;  1K34 A;  3X2Q C;  3AG2 C;  2XAH A;  1K7D A;  4I9W A;  3SYP A;  4MSW C;  1RM1 B;  4QIW F;  3QNE A;  2DWE C;  1KQS U;  2ZXW B;  2PI4 A;  2CK3 G;  3CME V;  3T4D A;  3LSQ A;  3X2Q B;  3AG2 B;  1GM7 A;  2JEX A;  3ZIA G;  3K04 A;  3LSS A;  3SYA A;  1AI4 A;  4LBE C;  1MOF A;  5GW7 A;  3E8B A;  1W0K G;  1GK9 A;  3D3I A;  1K5S A;  1KC8 W;  5C93 A;  4RUE A;  4RO2 A;  4BIZ A;  1JCH A;  1V54 B;  3VOU A;  2UXN A;  2WLJ A;  2WLH A;  3ABT A;  3OAA G;  4JF3 A;  3LDC A;  1QR9 A;  1VQ9 V;  3RVY A;  5KUK A;  4JTC B;  2OCC B;  5IY5 C;  4PA4 A;  2QM8 A;  4PA9 A;  1NVP B;  1Y4M A;  1MAB G;  1THZ A;  3OEH G;  5E1A C;  1AR1 B;  4ZKI A;  1EFR G;  3P30 A;  2EIK B;  1R6K A;  2EIL C;  2IH3 C;  1S0V A;  1VQ4 V;  1M56 C;  2XAS A;  1K92 A;  5B1N A;  2H94 A;  2Z3Y A;  1PKX A;  2ZQM A;  4HZ3 A;  4QE7 A;  5EBM C;  1VQO V;  3G4S V;  1ZWI C;  4GCZ A;  3HPL C;  1NQT A;  1DF5 A;  3ABK C;  4TWK A;  4MVS A;  1VQ5 V;  4FK5 C;  2JDI G;  1S77 D;  3ABM B;  1NBM G;  1PL0 A;  4CZZ A;  3ASO C;  3K0D A;  1DLB A;  2A79 B;  5CMU A;  3LDD A;  2K1E A;  3OGC C;  4QNH B;  1G4Y B;  3W7S A;  1GM9 A;  2R9R B;  1NH2 D;  2R9I A;  3K06 A;  2IJJ A;  1AI6 A;  3ZMS A;  4FIP C;  3M99 B;  5DN6 G;  1YHQ V;  1YTF D;  5B3S B;  2DYR B;  3SYQ A;  2V1D A;  4FJC C;  5L3D A;  3IFX A;  4BAY A;  2BOB C;  2C2A A;  3ZJZ A;  1K73 W;  3AG4 C;  3WG7 B;  5HFL A;  1YJW V;  1K9M W;  4J9Y B;  5B3S C;  3E8H A;  3FB6 C;  4GX5 A;  1SES A;  1FXK C;  3FYI B;  3STL C;  3T4Z A;  1COW G;  1R73 A;  4PDL A;  3WG7 C;  5LHI A;  3ETD A;  1OCO B;  4GT1 A;  5LGT A;  1RM1 C;  2DYS B;  1S72 V;  1TUE B;  2LFS A;  2P6J A;  1FXK B;  2X6B A;  2P90 A;  3B77 A;  1QVF U;  2W0F C;  1PNK A;  2WLL A;  1VQ7 V;  1UJW B;  2Q67 A;  2X6C A;  4N23 A;  5CN0 A;  2IJK A;  1YJN V;  1OZ0 A;  4TT3 G;  4FPP A;  2HKO A;  3MD0 A;  2ZD9 A;  3JD4 A;  4UVB A;  1SRY A;  1J95 A;  3VBB A;  3R65 A;  4JGS A;  3OW2 U;  1YIJ V;  3OR7 C;  5EC2 C;  2DW4 A;  4ZBM A;  4MTO A;  1QLN A;  3T2M A;  1YI2 V;  3GWO A;  3ZMV A;  1JVM A;  3AG3 C;  2HVK C;  3JD2 A;  4H37 A;  2UXX A;  3CCV V;  3W7W A;  1EZJ A;  1GO3 F;  2EIJ B;  4GX1 A;  3ZRW A;  2EIL B;  2Q6A A;  4MVM A;  4WFF A;  3MHS C;  3T1C A;  2P7T C;  3CC7 V;  1IXM A;  1I5X A;  1XL6 A;  5LGN A;  3TET A;  2EZO A;  2EIJ C;  2WLK A;  2W6I G;  2YSU B;  1KKD A;  5J9P C;  3ABK B;  3ZMU A;  4WF9 V;  3ASN C;  4MVO A;  4U7N A;  2P67 A;  4PA6 A;  3ASO B;  4WFB V;  3D36 A;  2A9H A;  1H8E G;  1WLE A;  5L3C A;  2JJ1 G;  4P30 A;  3FB7 C;  1K4C C;  4G28 B;  1FS0 G;  4MVQ A;  1DF4 A;  3B8N A;  1VQN V;  5CBH A;  5DM6 V;  4DO2 A;  3ABU A;  4DXW A;  3FKS G;  1FXK A;  2XAQ A;  2WSS G;  3QO5 A;  1P7B A;  3FYE B;  3JYC A;  3K9A A;  2WLM A;  1I5Y A;  4PEL A;  4WCE V;  2Y69 C;  4GX0 A;  1VQL V;  2D3O W;  1NR7 A;  4WFH A;  5LGU A;  1OCR B;  2X6A A;  1AI7 A;  4UV8 A;  2NLJ C;  3LUT B;  2FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...