3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
3E8FA 3LDDA 5EC1C 4F4LA 4LP8A 1R3KC 4G28B 1XL6A 2WLNA 2W0FC 4MVRA 2A79B 2BOCC 4QE7A 2YEVA 4WFEA 2KB1A 3LDCA 3ZJZA 4RUEA 3OUSA 3VOUA 1OCCC 2QKSA 3X2QC 1G4YB 3IFXA 1KKDA 2A9HA 1S5HC 2Q6AA 1R3JC 5KUMA 3RVZA 5EC2C 1ORQC 3K0GA 4MS2A 3STZC 4RUFA 2EIKC 4J9ZB 4JTAB 3FB6C 4MSWC 3E8HA 3RBZA 4PDRA 3R65A 4PA7A 2X6CA 5KUKA 1QLEC 4JTDB 3K08A 1ZWIC 5EBLC 3FB5C 1R3LC 2AHYA 4P2ZA 3RW0A 1K4CC 3SYCA 5EBWC 3OR7C 2AHZA 3UM7A 3WG7C 2ZD9A 3OUFA 3SPJA 4XDKA 3SYPA 5B1BC 4GX5A 3E89A 1V54C 2WLJA 4JTCB 3AG2C 4R8CA 4R7CA 1M57C 1OCZC 2A0LA 4LCUC 4MTGA 4XDJA 4ZBMA 1R3IC 2EIMC 4QNHB 1P7BA 3T2MA 3SYQA 2ITCC 4RO2A 3SYOA 1JVMA 1OCRC 1K4DC 3AG4C 2X6BA 4MW3A 4MVZA 2DWEC 3SJQC 2WLIA 2WLMA 3ABLC 4I9WA 4EKWA 2H8PC 4P9PA 2EILC 4WFHA 2Y69C 3UKMA 3F5WC 2IH1C 3K06A 2HJFC 3T4DA 2DYSC 3LDEA 5E1AC 3K0DA 4BW5A 3ABMC 3LUTB 4H33A 2OCCC 3E8BA 4PA3A 1J95A 2ATKC 3AG3C 4PDLA 3TCUA 1BL8A 3FB7C 4QE9A 3STLC 3T4ZA 5CBGA 2K1EA 4X88A 2HVKC 4PA4A 1V55C 3SPCA 4HYOA 4LBEC 5J9PC 3ABKC 4XDLA 3OR6C 3EFFK 4DXWA 2NLJC 2HVJC 3BEHA 5IY5C 4HZ3A 2WLHA 4J9YB 2WLKA 2EIJC 1OCOC 2P7TC 3F7YC 4X89A 2QTOA 3FB8C 4KFMA 5EK0A 3E8GA 4TWKA 1M56C 4UUJC 4MVSA 2Q68A 4P9OA 3ASNC 4MTFA 1XL4A 2EINC 2ZXWC 2ITDC 2X6AA 4OXSA 5CBFA 5EBMC 3OGCC 3SPIA 2DWDC 3KG2A 3PJSK 4MVUA 2JK5C 2IH3C 5B3SC 2WLIB 4R50A 3SPHA 3SYAA 2HFEC 3TETA 5CBHA 4MVMA 4GX2A 4PDMA 4H37A 5B1AC 2DYRC 3K03A 4GX0A 4PA9A 3RVYA 3IGAC 3ASOC 3SPGA 4WFFA 5BZBA 1LNQA 4CBCA 2WLLA 3HPLC 2WLLB 3JYCA 4RAIA 3ZRSA 2BOBC 4P30A 3E83A 3LNMB 3AG1C 4MW8A 4MVOA 3T1CA 3E86A 4PDVA 4G27B 3GB7C 2Q67A 2HG5C 2Q69A 4PA6A 4R6ZA 3K04A 4X8AA 4MVQA 2R9RB 3F7VC 4GX1A 4WFGA 4MTOA
chains in the Genus database with same CATH superfamily
4ABMA 4LNUB 1IZ3A 1YXBA 4LP8A 4MT8A 4MVRA 2BOCC 3IC7A 4FLZA 4BIOA 4LF5B 5GONA 2ADPA 5KUMA 4JV5O 1Q81W 5JCOC 3K0GA 3QO5A 4DV0B 1JFFB 3ABKB 1E1QG 1YEWA 4O4HB 3RBZA 2E75B 4PDRA 5KAIZ 1Q7YW 4KXRA 2DN9A 3OGIB 3P3PA 4WBNB 4X20B 1V54C 1JPXA 1RPOA 3JAKA 1SS3A 5L3EA 3SYQA 1K4DC 2LP7A 5F2VO 1WPXA 1JJ2U 1TGOA 5IE9A 1OCCB 3OD4A 5CA0B 4LF8B 1XMQB 2GV9A 4UV8A 1JCHA 4J80A 3AG3C 1AB3A 5CBGA 3RYFA 3RYIB 1Q6HA 5LA6B 3CSXA 2EIKB 2QKCA 5JJNB 2R9AA 2NR5A 4I4TB 1SERA 3FB8C 5IWAO 5LP6A 4FZ1A 1TAEA 4UCSA 1GO3F 2BSKA 5H6QA 2WSSG 3L70H 1ZL8A 1RPRA 2HFEC 2CTPA 3P3NA 2L35A 3TJTA 2UU9B 4WFFA 3JYCA 5B1BB 3MDSA 3AK3A 5LMUO 2BOBC 3JATB 2ZE8A 5IYBO 1QVGU 3AK1A 1XBLA 3ZIAG 4JI5B 5JQGB 4DR6O 4U3JA 4X1KB 3KCYA 4OGQB 2H3OA 1OCRB 1IXMA 3ZMSA 2Q0AA 4JAVA 4G28B 1IBKO 4I9QA 1D2DA 4UCRA 4TV8B 1EM1A 5LL6Y 2Q6AA 4ZI7B 1TUBA 1SA0B 2YI8A 2C2AA 3FFQA 5JJJB 2R72A 4JAAA 1I94O 2VS0A 3AG3B 3QO7A 3M7MX 3UO3A 1XNRB 1WAZA 1KMIZ 1AROP 2A06H 1ZWIC 2ZR3A 1R3LC 3RGBA 3BCCH 3S3XA 3W7UA 1NJIW 4ZKIA 4GX5A 1THZA 4BW9A 4R8CA 4ZBMA 3K5MA 4X1YA 1R3IC 3QVNA 2AGAA 2XAHA 2CGOA 3QF7A 1XDCA 4WFHA 3WFVA 4O2AB 3ABMC 4B3SB 3MHSC 3KKYA 3J81N 3A0RA 3ZRWA 3DC5A 5LHIA 4LF8O 5B5EZ 1H2MA 1AR5A 4DR5B 2EZOA 1L0LH 4DXWA 4KHPO 2B1IA 4JI1B 4B3TO 5IY5C 1LUWA 1ZAUA 4HZ3A 2WLHA 4HAMA 4J9YB 1QLEB 3F7YC 3TK1A 3I55V 1GM9A 1YZBA 1VQ9V 3L74H 2UXCO 5KA6A 5LGUA 2ITDC 4MVUA 1HR0O 4JI2O 1F51A 4LH7A 5LBQA 1U97A 3K03A 3SGIA 1DGSA 3U0ZA 4DW1A 4X20A 3E86A 1GAXA 4GKJB 1PL4A 2G38A 4R6ZA 1VQMV 4LF4O 3DSQA 5C8YA 3AG4B 3HKDB 2A79B 1XEQA 4WFBV 3SR2C 4LFBO 1COWG 4DR6B 1OCCC 1G4YB 2IU3A 1GN3A 3ML0A 3P30A 3CCEV 4BAYA 5C93A 4NR1A 2YXHA 5LMUB 5IY5B 2JEXA 2ZDIC 3T1HO 3T1YB 4DRXB 1DK1A 1NQTA 3FB5C 3JARB 1SQVH 4IHJA 1H38A 1TVKA 1KYOF 1Y66A 4TT3G 5B1BC 2P6JA 4J42A 4OPAA 4FM0A 3K59A 5CB4B 2JGDA 2JIZG 2VWJA 3OT7A 4YJ3B 2Q4PA 3GWKC 3OFNG 1IBMB 4LF9B 3K06A 2F95B 3D8CA 3F5TA 5LP6C 1AR1B 1HNZO 4DYLA 5D5QA 1GM7A 2OCCC 1KD1W 5J2UA 1YTFD 1SA0A 4DR3O 1NH2D 2GUZA 3RT3C 4J11A 4CH4A 5LOVA 2HVKC 1V55C 4Z1VA 3QTCA 2CAZC 3W7TA 1PM9A 2YUAA 1BQ0A 1TUEB 1GN4A 1OCOC 1YTFB 2V1DA 3RYIA 2LFRA 1BHAA 1FFTB 2ZE5A 1F4NA 5J2UB 2X6AA 4KP4A 1KU9A 5JQGA 4O2BA 5L3GA 1H2SB 1AI5A 1ZL8B 2QA4V 4LF4B 4LF7B 2UXBO 3IGAC 2X0LA 2Z3YA 3K58A 1N8RW 2WA4A 3AG2B 4JI0B 4DV5B 2NNUA 4KUMA 4CS2A 5EYPA 3FX7A 3W7SA 4OX9B 2UUBO 2Z5UA 2BSKB 2OWOA 2Y48A 3T1YO 2AZ2A 4QE7A 3RWRD 4RUEA 4DV6O 2QTSA 1S5JA 4YHHB 4BWAA 4LF9O 2FKXA 2QKAA 1WLEA 3ZRXA 2UU9O 3DGEA 5FPRA 4Q6GA 3B2EE 3R65A 4KL1A 2R70A 5KUKA 1OCOB 3ZMVA 3AG1B 2OTJV 3OEHG 1XNQO 4GKKO 3WG7C 2QJ1A 1Z5VA 1VQ5V 2QEXV 2A3QA 1BE3H 2HEPA 4XDJA 1QBZA 1L8DA 4RO2A 3APOA 2Q7HA 5B1NA 2E76B 3SJBC 2DYRB 4TQDA 1DTOA 2KQXA 4QPJA 4CH6A 2UXBB 3VQVA 1PP9H 2JDIG 4JI3B 2YIBA 3UQ8A 2RCVA 4GCZA 2XUMA 1SZTA 2IU0A 5KHKA 4NTWA 2DMXA 1GMGA 2HVJC 3BEHA 4LFCO 2VRZA 3ZMTA 4X89A 2EIMB 4FJCC 2Q0OC 1M56C 3ZHRA 4UUJC 4J7JA 1IX9A 3CP1A 3E22B 3OGCC 2DWDC 2JK5C 3SPHA 4B3SO 2LQTA 1K92A 3B8MA 4PJ0Z 1FXHA 1GRJA 2XAJA 2CTRA 2B5UA 3H1KH 2CGNA 4CBCA 2F1MA 2WLLB 3B4SA 3AK2A 5KA5A 1K9MW 3VBBA 3A0HZ 1CP9A 1XI1A 4DR4B 5ITZA 1FJGB 4NXNO 1ROPA 3AG7A 3Q4HB 4ZIBA 4IGGA 4I7ZB 4B7KA 2P4KA 3JCUZ 3N2KB 2LFSA 3JARA 4F6RA 4TOIA 3RVZA 1FXVA 3DTUB 2PUSA 3WB0A 5IJ9B 2EIKC 4EB6A 4PA7A 3C90A 3ABTA 2QE7G 2EX3A 4JI6B 2CE4A 5LGTA 1EN4A 1MZEA 3RW0A 3N2KA 4PHZA 1TA8A 4K3AA 4YY3O 1NT2B 2D3OW 2WLJA 3AG2C 1AI6A 4YXWG 3JALA 2YICA 1EBOA 2ZIMA 5CN0A 1JVMA 3EVKA 1KP2A 1YF2A 3ABLC 4DR7O 4KHPB 4LH6A 1ZX3A 2DE0X 2H8PC 2IH1C 1G6UA 3LDEA 1SQQH 1EN5A 1R6NA 2W6JG 2E3CA 1XUQA 3FB7C 1D5AA 4GKKB 3SPCA 2Z0AA 1NZ6A 3THOA 3ABUA 4GUNA 4JI7B 2GDSA 1IURA 4Z2WA 4JYAO 1SQFA 4FLXA 5JVDB 5LYJA 2Y0PA 4DR2B 1L0NH 4B3RO 2QGNA 1FKAO 1Y76A 2JGUA 1M4UA 1SZXA 4DRXA 4B7EA 1EFRG 3O65A 3GWOA 4CC5A 4WFAV 3E83A 1OZ0A 4G27B 5GTIZ 5CMUA 4DV3B 3G6EV 3F7VC 4LF7O 2UXXA 4EEQA 1QCEA 4ICGA 2EIJB 4EKWA 2GHYA 3X2QC 2XHBA 1FYJA 4UCTA 4X65O 4CS4A 2M6YA 3CCJV 1BQZA 5GTHZ 4LF6O 4NB5A 1N32B 2O57A 1FFXA 3CS5A 2PTMA 2AW9A 2QSAA 4NXNB 2EIMC 3BA8A 1NTKH 1S5LZ 3NXSA 4IL6Z 1IDSA 2QWQB 2WLIA 3CXCU 1PKXA 2EILC 4G2KA 2PYJA 5EZYB 5E1AC 4O4JA 5IJ9A 3SJCC 1I5YA 1NS1A 3STLC 1FD9A 5DECA 1P4RA 4EB6B 4HYOA 4LBEC 1Z5WA 4XDLA 1HDJA 4IIJB 2PI4A 4NXMO 1S0VA 2WLKA 5ITZB 1EZJA 3W7WA 4DV5O 2ZT9B 4I5SA 2LO1A 1CEZA 3SPIA 4LFBB 4DW0A 3X2QB 2UUAB 4R50A 4UCVA 2UXDB 2F23A 1MA1A 2YXYA 4X64O 2EZPA 3RVYA 3ASOC 1LNQA 5FPOA 2F93B 4MW8A 5FLXN 3OTOB 4UXNA 2YXLA 2OIGA 2K9PA 2HG5C 5EIBC 2IJJA 4QJFB 4ZHQB 3ZHSA 2P06A 3GVMA 1GKFA 4UVBA 1SESA 2FL4A 3OUSA 3CWBH 4CS3A 1JJOA 3JSLA 1Y6XA 3BPZA 3STZC 4NTYA 1KB9F 3ZHVA 2GSMB 5HFMA 4I50A 2V4DA 4QGPA 5DM6V 1AP6A 3C3SA 3OM3B 5EBLC 5EBWC 1ZTEA 2CH7B 4K8ZA 2N05A 2D2CB 1YHQV 1HNZB 4JTCB 4WF9V 1UFIA 4LF6B 4JI3O 1G8MA 5JCOA 2ITCC 3AG4C 4FPPA 3L71H 3N27A 4O2AA 4YIPA 2DWEC 1H2NA 1WA8B 4JZGA 4P9PA 5IJ0A 3F5WC 1SQPH 1RM1C 4UCUA 5E79Z 5LHHA 1OJHA 3VQYA 3E8BA 3UCSC 1H8EG 1NTZH 5EIBD 1WP8A 2P4VA 1R73A 2ZKOA 4X88A 1Y67A 4CC6A 1K33A 2YIAA 3G6BA 1SQBH 1V54B 3ZRWB 3G71V 2JVDA 1K5SA 4JI0O 2OTLV 5BMVA 4DV7O 5EBMC 3FYEB 2UUCO 1IBKB 1Y76B 2Y69B 5IDJA 2GBOA 3H1IH 2ZM6O 2HHHO 4DR4O 3HB3B 5A9GA 3DXRB 4PA9A 3SPGA 1RP3B 2IJHA 5EYPB 1N36O 4JV5B 1AI4A 1WB8A 1SC5B 4OPHA 3CCQV 1VEWA 3D36A 3E8FA 3FAVB 5EC1C 3HKEB 4JI4O 3K9AA 3OMNB 4PI2A 3LDCA 4B3RB 4U3FH 2IM9A 1GM8A 1F4MA 4Q20A 4F6RB 1RM1B 2B9ZA 1BMFG 3H9VA 1M93A 3HKBA 4FLTA 4ZOLA 1X4TA 1K34A 1YSCA 3CMAV 1XHXA 2WWWA 3ICXA 4FM2A 1K5QA 3E89A 2GUZB 4TV9A 1SETA 1R6TA 3T2MA 4D7SA 2RQ6A 1OCRC 4MW3A 5H6RA 2FYUH 1TVKB 2EINB 3CCMV 4I9WA 4TQFA 2Y69C 5B1OA 4LFCB 1KUQA 2HJFC 2VQEO 1M1KW 4A5UB 1ZLZA 3ASOB 3TCUA 2OCHA 1N32O 1XNQB 4FMTA 1Q86W 3WG7B 3KCXA 2Q9LA 5CA1A 3P32A 1PL0A 1YITV 1M5IA 4O4HA 3E8GA 3CRRA 4JF3A 1PNLA 3CYOA 3OTFA 1VMGA 4MVSA 5CA0A 1VF7A 2ZXWC 1Q6UA 2DJVA 3PJSK 3LSUA 1HNWO 3ZMUA 5LGNA 2YS8A 2XT9A 4DR5O 2P22C 2GTSA 1PNMA 4FFBB 3JD4A 4PDMA 5BR8B 4YJ2B 4LFAO 1VQ4V 1Y74A 2WLLA 3A2FA 4DV0O 1XILA 4PD4F 4JI6O 2UXNA 1VQNV 3ZHUA 2XAQA 3ZHTA 4UCOA 1N33O 1QLNA 2KKWA 1K8AW 3JAWB 2YIBD 2W0FC 1VQ8V 1NU1H 2EJ7A 3VOUA 2QKSA 3A8TA 2KG7B 1HW7A 4LNUA 1X59A 1V9PA 3FB6C 4GZRB 1A32A 3R66A 1QLEC 1WB7A 3DXRA 4U7OA 1W2BU 2AHYA 4P2ZA 4H44B 3L9DA 4L8JA 1LR1A 5L3DA 3SPJA 1J5EO 4JI5O 4YHHO 4DUZB 2QDOA 3ZS8C 2RDCA 5BMVB 4X1YB 1P7BA 2ZE7A 5JWPA 2HLDG 1IBMO 1GH6A 2LW1A 5LMNO 2ZXWB 4JI1O 2F43G 1L1FA 4NTXA 1T5EA 4GT1A 4BW5A 1O9HA 3AEIA 2CTQA 5AG2A 1BZKA 1FS0G 3T4ZA 3ZX6A 1P49A 4RQFA 2DOSA 1N34B 2YEVB 3EFFK 3IJ4A 1TUBB 4FLUA 1YJ9V 1URFA 2EIJC 1WA8A 4KFMA 5KMGB 1UPGA 1XMOO 3BA9A 1AI7A 1GK9A 4P9OA 4U7NA 2EINC 2MW2B 5CA1B 4FFKA 2VQFO 2YDEA 2QM4A 2ZDIA 2N74A 2VWKA 4DV2O 2QWOB 1Q82W 4X65B 3T1CA 4PDVA 4D7TA 1Y4MA 4LFAB 4JYBA 4ZOLB 1HWYA 2JEUA 4AQYB 5KMGA 1G1XB 5KLVH 2DQ3A 4JI2B 3BVOA 5LP6B 1D5NA 2YEVA 2ETNA 4DUZO 5LA6A 1J5EB 4FZ0A 2UXCB 4X1IA 1S5HC 1NH2B 3FAVA 3OMAB 2ODMA 1FPOA 2OIEA 5B3SB 2QWRB 3RYFB 1ZUQA 1NTMH 4JTDB 2L6LA 4HNAB 1N34O 2H94A 1ENVA 1VF5B 2W6IG 1W59A 4X62O 3H1LH 1OCZC 4MTGA 4YJ3A 3JCZA 3D3QA 4DUYO 3J7AU 4W4KA 3NR7A 3H1JH 3TGUH 4IHJB 2XAGA 3MHHC 4JASA 3OEEG 2K1EA 1MG1A 3IC9A 2EBOA 2VQFB 3K5OA 3CB2A 4X66O 2NLJC 4WCEV 1H2KA 4K35A 5FNVA 4JGSA 1HNXO 4TUYA 3JAWA 1WP7A 1BSMA 1F7YA 4F6EA 1S3JA 3ETDA 1Q5OA 2Y4UA 3H01A 4B08A 2IH3C 4O4LA 2EILB 1XHZA 3HKCB 4EFEA 4JAUA 4YIOA 4YJ2A 1NI8A 5JJEB 1Y74B 3ZRSA 5KHGA 2Q73A 4D6TH 3L72H 3LNMB 1NBMG 1AR4A 4O4LB 2OCCB 1ZSPA 1B06A 3O9OA 2HKOA 5JH7A 1FXKB 3U10A 4DUYB 4FFBA 4RWUA 1XL6A 2BTQA 1RFYA 4WFEA 1AJNA 1F23A 1MNGA 1KKDA 4TUYB 2CDYA 2A9HA 3J80N 1ORQC 4CZZA 4TV8A 1KC8W 4J7KA 4DV6B 2YIDA 1EN6A 3UO2A 2X6CA 3CPWU 2XNDG 4X1KA 1JMKC 4I0XA 1DLBA 1M56B 1K97A 3EXAA 3Q4HA 3K5LA 3G67A 1JOYA 4TV9B 5KAFZ 5LYJB 2N04A 1QHTA 4LWSA 4MVZA 3CCVV 1I94B 3ZCCA 2ZIOA 1AJQA 5IYDO 5TISZ 4AILC 2PF4E 4X1IB 4JI7O 4UVAA 2ZM6B 1SKVA 4B3MB 1XQ8A 3LUTB 1QR9A 1I08A 2ATKC 4PA3A 1WN7A 4O4IB 4UVCA 3TXSA 1B6QA 1HNWB 4AHCA 2QR4A 4I55A 4DV1O 1WJZA 3RN4A 2P7TC 3HKBB 3JAMN 2MK3A 4BR6A 4TWKA 3S3WA 1WNSA 5EZYA 1MZFA 1FXKC 2Q68A 2ZR2A 4MTFA 4DV4O 3ZEDA 3W7XA 2ZNJA 1GN6A 2WLIB 4QIWF 1BT8A 1KECA 5IYCO 3K5NA 5K1XA 4H37A 1OHHG 4GYCB 1KBHA 4O4JB 2JGDB 1OV9A 3E35A 4MVOA 3JSNA 3MAQA 3BRCA 1B04A 3K3WA 3U11A 4E4EA 2P90A 2PZSA 2AXTZ 4I0XB 4X8AA 2FMLA 4DO2A 3ETQA 1QU7A 1VQ7V 2GTAA 3LDDA 1VP7A 3K9SA 1R3KC 1QNMA 4PV1B 1KQSU 2QM8A 1KKCA 1AJPA 3FYIB 1W0KG 3CHXA 1R3JC 1FAFA 3RFRA 1NR7A 3ABMB 4RUFA 2BTQB 3E8HA 2ILMA 4C7UA 4H13B 3SYCA 3CRQA 1K4CC 5IYZA 2ZQMA 3UM7A 3OMIB 1GTOA 2ZD9A 3H1HH 3OUFA 4XDKA 1E79G 5K1PA 3EHBB 2CH7A 3I5DA 3CXHF 3OW2U 4JYCA 3T4DA 3CCLV 1Q43A 1YJWV 3HKDA 1EZVH 4PDLA 3CEIA 4PI0A 2QWNB 4YY3B 1K7DA 5KHIA 4PA4A 1DF5A 1NR1A 1SF9A 5KX5B 5GONB 4I50B 4ZHQA 5EK0A 4LR3A 1AILA 2BE3A 1JA8A 2Q8VA 4JI4B 3HKCA 4UFZA 3ZN0A 1Q3EA 3BY6A 5H9CA 4GX2A 5DEDA 1S77D 1HR0B 2Y4TA 3JD0A 3UT5B 3KZIZ 3JD1A 3LSQA 3JD2A 1V55B 1JQ0A 1K73W 2Q67A 3CRCA 5IWAB 3K04A 4W4LA 2PI5A 1N0NA 2R9RB 4IT5A 3UT5A 1JR9A 4MTOA 2JJ2G 1AP5A 4X64B 3ZMZA 5GW7A 4DR2O 2WLNA 3WB2A 2UUCB 2AZ0A 2A7WA 3ZJZA 2KB1A 4ZI7A 2WA3A 3E22A 2HP8A 1GN2A 3LSSA 4MS2A 4FM1A 2E5LO 2XTAA 2B1GA 4J9ZB 3TXQA 4MSWC 1HNXB 2YC0A 3K79A 4J10A 4CH5A 4O2BB 4UB6Z 1H8HG 2A0LA 3CJHA 2YI9A 3APQA 3CE2A 4J41A 2LGQA 2ZCEA 3RYCB 3BAAA 1PNKA 2M7WA 2RJZA 5L3CA 1NVPB 3CRMA 5LXTB 2ZNIA 1SRYA 2P67A 1CXZB 1BL8A 3JD3A 1Q90D 1H2GA 2UUAO 1NVPD 3CX5F 4N21A 1N36B 2QWPB 2ZINA 3IAYA 1M57B 4DV7B 2QTOA 3M99B 1MOFA 2PGGA 2OT5A 3OE7G 3OTOO 1CPYA 5CB4A 1YVWA 3ASNC 4OXSA 5CBFA 1IBLB 5B3SC 3N2GA 4TSFG 4DV1B 3CCSV 2QM7A 1MMMA 3TETA 4RQEA 1RSOB 2KSDA 3BFRA 3G4SV 2RMKB 1U96A 2F4VB 4P30A 3AG1C 1QVFU 4DK0A 4FK5C 2WAMA 4L87A 3L73H 1YJNV 3ZN1A 4PA6A 4N23A 4DV2B 4DK1A 3FKSG 1OCZB 2UXDO 4WFGA 4UB8Z 4NYKA 1E1RG 1R6KA 3BHPA 5IT9N 2DYSB 2F66C 5JVDA 4OX9O 4JI8B 2Q7GA 5H2FZ 3IFXA 2XASA 4LC1A 4UV9A 1VQOV 2IJKA 2JS5A 2KG7A 1QQCA 3G80A 3D3IA 4MTXA 2HJDA 3CC2V 4B3TB 1UJWB 5IJ0B 5A2QN 3K08A 1FJGO 1YI2V 2BTOA 1W0JG 2AHZA 1N33B 3HR0A 2EULA 3MD0A 4JPRA 1M57C 4LCUC 4JZ2A 3CJHB 4QNHB 3RYHA 4X9QA 3SYOA 1JFFA 1WPBA 2WLMA 1XNRO 1PV0A 2JRIA 5BR8O 4ASUG 3SDLA 1B3QA 4HBNA 4K0KB 4QE9A 1IBLO 3D36C 3OR6C 5KHHA 1MSDA 1BGYH 3ETEA 4GKJO 4E2LA 4PELA 1M9NA 5FL7G 5L3FA 4I4TA 5BY1A 1MSWD 4JI8O 2ZE6A 4BIUA 2CK3G 4I55B 1LUVA 2PY5A 5DN6G 1VF6C 2FTKA 3ABLB 4MVMA 4O4IA 2DYRC 1MABG 1I0HA 3HPLC 1I5XA 4DR1O 4LF5O 3E2EA 3CC7V 1YCIA 2PYLA 1N0JA 1S76D 4BIZA 2LGWA 2HHHB 5L3BA 2CTWA 1K3EA 3B40A 3CRAA 3ZRVA 1VARA 4IYHA 2RN9A 4QPKA 1FXKA 4NVPA 3ASNB 5EC2C 1US6A 4B3MO 1BCCH 2CUGA 1I7FA 4JTAB 2F4VO 1VIBA 2DW4A 3CCUV 3RYHB 4DR7B 4NXMB 1BHBA 1QR8A 5J2TB 1P84F 3VQXA 3CCRV 2UUBB 4K8XA 3SYPA 1IXBA 5JH7B 1VQLV 1PPJH 1FFXB 1IVSA 3SJQC 3ETGA 3B77A 3I56V 5IYZB 1RSOA 3VQWA 3WU2Z 1BS3A 5CA3A 2DYSC 3K0DA 1YIJV 2JJ1G 4H33A 3DC6A 2IBZH 3PN1A 1H2LA 1J95A 3HKEA 2Q7EA 4CH3A 4DV4B 2VQEB 1SQXH 2XAFA 4FVMA 5J9PC 2DQ0A 4K0KO 4HNAA 1P7GA 1VQKV 2EJRA 2JS3A 1O9GA 3BABA 4DR1B 2FB5A 1XL4A 3C3TA 4DR3B 1R1BA 5FNVB 3KG2A 5LXTA 5D5PA 5B66Z 4Z1MG 1VQ6V 5HFLA 3ZHQA 5BZBA 4RAIA 3N2GB 3CMEV 3ZBHA 3GB7C 2Q69A 3JATA 3B09A 2V7QG 4EFBA 2X7RB 1PD3A 4GX1A 3FD9A 4F4LA 1SQGA 5H5NA 2WPDG 4FLWA 5LOVB 1XOUA 3SJAC 2OYQA 1S72V 4IYIA 3RYCA 1JX9A 4AI8A 4X66B 1M90W 2W0XA 2XOKG 3A0BZ 5B1AB 3OR7C 2ADQB 1NKDA 2E74B 3JASA 1Z2GA 4R7CA 3JALB 2IJIA 4FLYA 5J2TA 4U3JB 3WB1A 2ARHA 2HR3A 2X6BA 1Q8IA 4XBFA 3LNNA 1YDXA 2R9IA 2LJ2A 3UKMA 5LMNB 3OAAG 1XMOB 4JYAB 4LWSB 3QNEA 4X62B 1AVMA 2YSUB 4GLXA 1KP3A 2LW7A 1VF6A 1N4CA 4WBNA 3ABKC 5BXZA 3T1HB 2NN4A 4AQYO 3L75H 3CD6V 4DV3O 1XMQO 3M8AA 1XREA 2BCCH 3CC4V 2Y0IA 3QG5A 5C8YB 4NKGB 3JASB 2Q5ZA 3SYAA 5CBHA 5B1AC 4GX0A 1VQPV 3JAKB 4FIPC 1DF4A 1HP8A 4FLVA 3QO8A 3K57A 2IW5A 4J7ZA 5KX5A 2P5OA 3B8NA 4IIJA 5KHJA 1Q6IA 2E5LB 4H0LB 4JYYA 4MVQA 2RNBA 5LHGA
chains in the Genus database with same CATH topology
2JJ2G 1K8AW 1ROPA 4LP8A 4MT8A 5GW7A 2WLNA 3ZMZA 2W0FC 4MVRA 2BOCC 1VQ8V 3ZJZA 2KB1A 3IC7A 3VOUA 2QKSA 2LFSA 5KUMA 3RVZA 1FXVA 3DTUB 1Q81W 3K0GA 3LSSA 4MS2A 3QO5A 3ABKB 2EIKC 2B1GA 4J9ZB 1E1QG 3FB6C 4MSWC 3RBZA 4PDRA 4PA7A 3ABTA 1Q7YW 1QLEC 2QE7G 4U7OA 1W2BU 5LGTA 2AHYA 4P2ZA 3RW0A 3K79A 5L3DA 3SPJA 2D3OW 1V54C 1JPXA 2WLJA 3AG2C 1RPOA 1H8HG 2A0LA 1AI6A 4YXWG 5L3EA 1P7BA 1EBOA 3SYQA 5CN0A 1JVMA 2HLDG 1K4DC 2LP7A 1WPXA 1JJ2U 1KP2A 3ABLC 2ZXWB 1PNKA 2F43G 1OCCB 2M7WA 2H8PC 5L3CA 1L1FA 1NVPB 2IH1C 3LDEA 4UV8A 4GT1A 4BW5A 1SRYA 3AEIA 1R6NA 2P67A 1JCHA 2W6JG 3AG3C 1FS0G 1BL8A 3FB7C 3T4ZA 3JD3A 5CBGA 1H2GA 4RQFA 3SPCA 1NVPD 2EIKB 2YEVB 3EFFK 1YJ9V 4N21A 3ABUA 2EIJC 1M57B 1SERA 2QTOA 3FB8C 4KFMA 3M99B 1MOFA 2OT5A 3OE7G 1AI7A 1CPYA 1GK9A 3ASNC 1GO3F 4P9OA 4U7NA 2EINC 4OXSA 5CBFA 5H6QA 2WSSG 5B3SC 4TSFG 1RPRA 2ZDIA 2HFEC 3CCSV 2QM7A 3TETA 4RQEA 1EFRG 4WFFA 3G4SV 3JYCA 5B1BB 3GWOA 4WFAV 2BOBC 4P30A 3E83A 1Q82W 3AG1C 1QVFU 3T1CA 4PDVA 4FK5C 2WAMA 1OZ0A 1Y4MA 4G27B 4L87A 1YJNV 3ZN1A 4JYBA 4PA6A 5CMUA 4N23A 5IYBO 1HWYA 2JEUA 1QVGU 3ZIAG 3FKSG 3G6EV 1OCZB 3F7VC 2UXXA 4WFGA 1E1RG 1QCEA 1R6KA 1OCRB 1IXMA 3ZMSA 4JAVA 2DYSB 2DQ3A 4G28B 2EIJB 4EKWA 2YEVA 2GHYA 3X2QC 3IFXA 2XASA 4LC1A 4UV9A 1VQOV 2IJKA 1S5HC 2Q6AA 1NH2B 2C2AA 3CCJV 3OMAB 3D3IA 4MTXA 5B3SB 3CC2V 3AG3B 3QO7A 1UJWB 4JTDB 1AROP 3K08A 1ZWIC 2ZR3A 1R3LC 1YI2V 1W0JG 3W7UA 2AHZA 2H94A 4ZKIA 1NJIW 1ENVA 2W6IG 4GX5A 1THZA 4R8CA 3MD0A 4JPRA 1M57C 1OCZC 4LCUC 4MTGA 4ZBMA 3JCZA 1R3IC 2EIMC 4QNHB 3SYOA 3NXSA 2XAHA 2WLIA 2WLMA 3CXCU 1PKXA 4WFHA 2EILC 4ASUG 4G2KA 3WFVA 5E1AC 3ABMC 3MHSC 1I5YA 2XAGA 3A0RA 3ZRWA 3STLC 3MHHC 4QE9A 5LHIA 4JASA 3OEEG 1P4RA 2K1EA 1MG1A 2EBOA 4HYOA 4LBEC 2EZOA 4XDLA 3OR6C 4DXWA 2NLJC 4WCEV 2B1IA 2PI4A 3ETEA 5IY5C 4JGSA 4HZ3A 2WLHA 4HAMA 4J9YB 2WLKA 4E2LA 1S0VA 1QLEB 3F7YC 4PELA 3TK1A 3I55V 1M9NA 1GM9A 5FL7G 1VQ9V 1S3JA 3ETDA 5L3FA 1EZJA 3W7WA 4I5SA 1CEZA 5KA6A 5LGUA 2ITDC 1MSWD 3SPIA 4BIUA 4MVUA 2CK3G 3H01A 2IH3C 1F51A 3X2QB 2EILB 5DN6G 4R50A 2FTKA 4JAUA 5LBQA 3ABLB 4MVMA 2EZPA 2DYRC 3K03A 3RVYA 1MABG 3ASOC 1LNQA 3HPLC 3ZRSA 3LNMB 1I5XA 1NBMG 4MW8A 4UXNA 3E86A 2OCCB 3E2EA 2HG5C 3CC7V 4R6ZA 1S76D 4BIZA 1VQMV 2IJJA 2HKOA 5L3BA 4QJFB 1FXKB 1GKFA 3AG4B 1K3EA 1SESA 4UVBA 1XL6A 2A79B 4WFEA 4WFBV 1COWG 1AJNA 1F23A 3OUSA 3ZRVA 1OCCC 1G4YB 1KKDA 2IU3A 2A9HA 4QPKA 3ML0A 3P30A 3CCEV 1FXKA 3ASNB 5EC2C 1ORQC 4CZZA 4BAYA 5C93A 3STZC 1KC8W 4JTAB 1BHBA 2DW4A 2GSMB 5HFMA 5IY5B 2JEXA 3CCUV 1QR8A 2ZDIC 2X6CA 5DM6V 3CPWU 2XNDG 3OM3B 1NQTA 5EBLC 3FB5C 5EBWC 3CCRV 1H38A 1DLBA 1M56B 1K97A 1Y66A 3SYPA 4TT3G 5B1BC 1YHQV 4JTCB 4WF9V 1JOYA 2P6JA 1G8MA 1VQLV 2ITCC 2JIZG 3AG4C 4FPPA 4MVZA 3CCVV 2DWEC 3SJQC 3ETGA 3ZCCA 3B77A 3I56V 1AJQA 5IYDO 4P9PA 3OFNG 3F5WC 4UVAA 3K06A 1RM1C 5CA3A 2DYSC 3K0DA 1AR1B 1YIJV 5LHHA 3LUTB 2JJ1G 4H33A 1GM7A 2OCCC 3E8BA 1KD1W 1QR9A 4PA3A 1J95A 2ATKC 1YTFD 1H8EG 4UVCA 1NH2D 1R73A 1B6QA 4X88A 2HVKC 1V55C 2XAFA 5J9PC 1K33A 2DQ0A 3W7TA 1V54B 1VQKV 2EJRA 1TUEB 1OCOC 2P7TC 3ZRWB 1YTFB 3G71V 2MK3A 4TWKA 2V1DA 1K5SA 2LFRA 1BHAA 2OTLV 1FXKC 1FFTB 2Q68A 2ZR2A 4MTFA 1XL4A 1F4NA 2X6AA 4KP4A 5EBMC 3W7XA 3KG2A 5L3GA 3FYEB 2Y69B 2WLIB 1AI5A 5IDJA 4QIWF 2QA4V 1KECA 3HB3B 5IYCO 4H37A 4Z1MG 1OHHG 4PA9A 1VQ6V 5HFLA 3IGAC 3SPGA 5BZBA 2X0LA 2Z3YA 1N8RW 4RAIA 3AG2B 3E35A 3CMEV 4MVOA 2NNUA 4KUMA 2IJHA 3GB7C 2Q69A 1AI4A 3K3WA 3W7SA 2P90A 3CCQV 2V7QG 4X8AA 2X7RB 4DO2A 1PD3A 2Z5UA 3D36A 4GX1A 1VQ7V 3E8FA 3LDDA 2Y48A 5EC1C 4F4LA 1R3KC 1KQSU 3K9AA 3OMNB 4QE7A 2QM8A 3LDCA 4RUEA 2WPDG 1GM8A 1F4MA 4Q20A 1AJPA 3FYIB 1W0KG 1S72V 1R3JC 1RM1B 1BMFG 1NR7A 3ABMB 1JX9A 4RUFA 1WLEA 3ZRXA 1M90W 3DGEA 3E8HA 2XOKG 3R65A 5KUKA 1K34A 1OCOB 3ZMVA 3AG1B 1YSCA 3SYCA 2OTJV 1K4CC 3OEHG 3CMAV 5B1AB 2ZQMA 3OR7C 3UM7A 3WG7C 2WWWA 3OMIB 1GTOA 2ZD9A 3OUFA 4XDKA 1NKDA 1K5QA 3E89A 4R7CA 1VQ5V 2QEXV 4XDJA 2IJIA 1QBZA 1SETA 3T2MA 4RO2A 1OCRC 4MW3A 1E79G 2HR3A 2X6BA 5B1NA 5H6RA 4XBFA 3EHBB 2EINB 2R9IA 3CCMV 2DYRB 4I9WA 1DTOA 2Y69C 5B1OA 3UKMA 3OW2U 2HJFC 3OAAG 4JYCA 3T4DA 1M1KW 3CCLV 1YJWV 3QNEA 4QPJA 2JDIG 4PDLA 2YSUB 3ASOB 3TCUA 4GCZA 1SZTA 1KP3A 2IU0A 1K7DA 4FMTA 4PA4A 1Q86W 1GMGA 3ABKC 3WG7B 1DF5A 2HVJC 3BEHA 1NR1A 3P32A 3ZMTA 4X89A 1PL0A 1YITV 5EK0A 3CD6V 3E8GA 2EIMB 4FJCC 4JF3A 1PNLA 1M56C 3CYOA 4MVSA 4UUJC 3CC4V 2ZXWC 3CP1A 3OGCC 2DWDC 3PJSK 2JK5C 3ZMUA 3SPHA 3SYAA 5LGNA 1K92A 3B8MA 3ZN0A 1PNMA 1FXHA 3BY6A 5H9CA 5CBHA 3JD4A 4GX2A 4PDMA 1S77D 2XAJA 4GX0A 5B1AC 2B5UA 1VQPV 3JD0A 1VQ4V 4CBCA 2WLLA 2WLLB 4FIPC 3JD1A 1DF4A 3QO8A 3LSQA 3JD2A 1V55B 2IW5A 5KA5A 2UXNA 1JQ0A 1K73W 1K9MW 2Q67A 1VQNV 2XAQA 3B8NA 3VBBA 3K04A 2PI5A 1CP9A 4MVQA 1QLNA 2R9RB 4MTOA 5LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8F A;  3LDD A;  5EC1 C;  4F4L A;  4LP8 A;  1R3K C;  4G28 B;  1XL6 A;  2WLN A;  2W0F C;  4MVR A;  2A79 B;  2BOC C;  4QE7 A;  2YEV A;  4WFE A;  2KB1 A;  3LDC A;  3ZJZ A;  4RUE A;  3OUS A;  3VOU A;  1OCC C;  2QKS A;  3X2Q C;  1G4Y B;  3IFX A;  1KKD A;  2A9H A;  1S5H C;  2Q6A A;  1R3J C;  5KUM A;  3RVZ A;  5EC2 C;  1ORQ C;  3K0G A;  4MS2 A;  3STZ C;  4RUF A;  2EIK C;  4J9Z B;  4JTA B;  3FB6 C;  4MSW C;  3E8H A;  3RBZ A;  4PDR A;  3R65 A;  4PA7 A;  2X6C A;  5KUK A;  1QLE C;  4JTD B;  3K08 A;  1ZWI C;  5EBL C;  3FB5 C;  1R3L C;  2AHY A;  4P2Z A;  3RW0 A;  1K4C C;  3SYC A;  5EBW C;  3OR7 C;  2AHZ A;  3UM7 A;  3WG7 C;  2ZD9 A;  3OUF A;  3SPJ A;  4XDK A;  3SYP A;  5B1B C;  4GX5 A;  3E89 A;  1V54 C;  2WLJ A;  4JTC B;  3AG2 C;  4R8C A;  4R7C A;  1M57 C;  1OCZ C;  2A0L A;  4LCU C;  4MTG A;  4XDJ A;  4ZBM A;  1R3I C;  2EIM C;  4QNH B;  1P7B A;  3T2M A;  3SYQ A;  2ITC C;  4RO2 A;  3SYO A;  1JVM A;  1OCR C;  1K4D C;  3AG4 C;  2X6B A;  4MW3 A;  4MVZ A;  2DWE C;  3SJQ C;  2WLI A;  2WLM A;  3ABL C;  4I9W A;  4EKW A;  2H8P C;  4P9P A;  2EIL C;  4WFH A;  2Y69 C;  3UKM A;  3F5W C;  2IH1 C;  3K06 A;  2HJF C;  3T4D A;  2DYS C;  3LDE A;  5E1A C;  3K0D A;  4BW5 A;  3ABM C;  3LUT B;  4H33 A;  2OCC C;  3E8B A;  4PA3 A;  1J95 A;  2ATK C;  3AG3 C;  4PDL A;  3TCU A;  1BL8 A;  3FB7 C;  4QE9 A;  3STL C;  3T4Z A;  5CBG A;  2K1E A;  4X88 A;  2HVK C;  4PA4 A;  1V55 C;  3SPC A;  4HYO A;  4LBE C;  5J9P C;  3ABK C;  4XDL A;  3OR6 C;  3EFF K;  4DXW A;  2NLJ C;  2HVJ C;  3BEH A;  5IY5 C;  4HZ3 A;  2WLH A;  4J9Y B;  2WLK A;  2EIJ C;  1OCO C;  2P7T C;  3F7Y C;  4X89 A;  2QTO A;  3FB8 C;  4KFM A;  5EK0 A;  3E8G A;  4TWK A;  1M56 C;  4UUJ C;  4MVS A;  2Q68 A;  4P9O A;  3ASN C;  4MTF A;  1XL4 A;  2EIN C;  2ZXW C;  2ITD C;  2X6A A;  4OXS A;  5CBF A;  5EBM C;  3OGC C;  3SPI A;  2DWD C;  3KG2 A;  3PJS K;  4MVU A;  2JK5 C;  2IH3 C;  5B3S C;  2WLI B;  4R50 A;  3SPH A;  3SYA A;  2HFE C;  3TET A;  5CBH A;  4MVM A;  4GX2 A;  4PDM A;  4H37 A;  5B1A C;  2DYR C;  3K03 A;  4GX0 A;  4PA9 A;  3RVY A;  3IGA C;  3ASO C;  3SPG A;  4WFF A;  5BZB A;  1LNQ A;  4CBC A;  2WLL A;  3HPL C;  2WLL B;  3JYC A;  4RAI A;  3ZRS A;  2BOB C;  4P30 A;  3E83 A;  3LNM B;  3AG1 C;  4MW8 A;  4MVO A;  3T1C A;  3E86 A;  4PDV A;  4G27 B;  3GB7 C;  2Q67 A;  2HG5 C;  2Q69 A;  4PA6 A;  4R6Z A;  3K04 A;  4X8A A;  4MVQ A;  2R9R B;  3F7V C;  4GX1 A;  4WFG A;  4MTO A; 
#chains in the Genus database with same CATH topology
 4ABM A;  4LNU B;  1IZ3 A;  1YXB A;  4LP8 A;  4MT8 A;  4MVR A;  2BOC C;  3IC7 A;  4FLZ A;  4BIO A;  4LF5 B;  5GON A;  2ADP A;  5KUM A;  4JV5 O;  1Q81 W;  5JCO C;  3K0G A;  3QO5 A;  4DV0 B;  1JFF B;  3ABK B;  1E1Q G;  1YEW A;  4O4H B;  3RBZ A;  2E75 B;  4PDR A;  5KAI Z;  1Q7Y W;  4KXR A;  2DN9 A;  3OGI B;  3P3P A;  4WBN B;  4X20 B;  1V54 C;  1JPX A;  1RPO A;  3JAK A;  1SS3 A;  5L3E A;  3SYQ A;  1K4D C;  2LP7 A;  5F2V O;  1WPX A;  1JJ2 U;  1TGO A;  5IE9 A;  1OCC B;  3OD4 A;  5CA0 B;  4LF8 B;  1XMQ B;  2GV9 A;  4UV8 A;  1JCH A;  4J80 A;  3AG3 C;  1AB3 A;  5CBG A;  3RYF A;  3RYI B;  1Q6H A;  5LA6 B;  3CSX A;  2EIK B;  2QKC A;  5JJN B;  2R9A A;  2NR5 A;  4I4T B;  1SER A;  3FB8 C;  5IWA O;  5LP6 A;  4FZ1 A;  1TAE A;  4UCS A;  1GO3 F;  2BSK A;  5H6Q A;  2WSS G;  3L70 H;  1ZL8 A;  1RPR A;  2HFE C;  2CTP A;  3P3N A;  2L35 A;  3TJT A;  2UU9 B;  4WFF A;  3JYC A;  5B1B B;  3MDS A;  3AK3 A;  5LMU O;  2BOB C;  3JAT B;  2ZE8 A;  5IYB O;  1QVG U;  3AK1 A;  1XBL A;  3ZIA G;  4JI5 B;  5JQG B;  4DR6 O;  4U3J A;  4X1K B;  3KCY A;  4OGQ B;  2H3O A;  1OCR B;  1IXM A;  3ZMS A;  2Q0A A;  4JAV A;  4G28 B;  1IBK O;  4I9Q A;  1D2D A;  4UCR A;  4TV8 B;  1EM1 A;  5LL6 Y;  2Q6A A;  4ZI7 B;  1TUB A;  1SA0 B;  2YI8 A;  2C2A A;  3FFQ A;  5JJJ B;  2R72 A;  4JAA A;  1I94 O;  2VS0 A;  3AG3 B;  3QO7 A;  3M7M X;  3UO3 A;  1XNR B;  1WAZ A;  1KMI Z;  1ARO P;  2A06 H;  1ZWI C;  2ZR3 A;  1R3L C;  3RGB A;  3BCC H;  3S3X A;  3W7U A;  1NJI W;  4ZKI A;  4GX5 A;  1THZ A;  4BW9 A;  4R8C A;  4ZBM A;  3K5M A;  4X1Y A;  1R3I C;  3QVN A;  2AGA A;  2XAH A;  2CGO A;  3QF7 A;  1XDC A;  4WFH A;  3WFV A;  4O2A B;  3ABM C;  4B3S B;  3MHS C;  3KKY A;  3J81 N;  3A0R A;  3ZRW A;  3DC5 A;  5LHI A;  4LF8 O;  5B5E Z;  1H2M A;  1AR5 A;  4DR5 B;  2EZO A;  1L0L H;  4DXW A;  4KHP O;  2B1I A;  4JI1 B;  4B3T O;  5IY5 C;  1LUW A;  1ZAU A;  4HZ3 A;  2WLH A;  4HAM A;  4J9Y B;  1QLE B;  3F7Y C;  3TK1 A;  3I55 V;  1GM9 A;  1YZB A;  1VQ9 V;  3L74 H;  2UXC O;  5KA6 A;  5LGU A;  2ITD C;  4MVU A;  1HR0 O;  4JI2 O;  1F51 A;  4LH7 A;  5LBQ A;  1U97 A;  3K03 A;  3SGI A;  1DGS A;  3U0Z A;  4DW1 A;  4X20 A;  3E86 A;  1GAX A;  4GKJ B;  1PL4 A;  2G38 A;  4R6Z A;  1VQM V;  4LF4 O;  3DSQ A;  5C8Y A;  3AG4 B;  3HKD B;  2A79 B;  1XEQ A;  4WFB V;  3SR2 C;  4LFB O;  1COW G;  4DR6 B;  1OCC C;  1G4Y B;  2IU3 A;  1GN3 A;  3ML0 A;  3P30 A;  3CCE V;  4BAY A;  5C93 A;  4NR1 A;  2YXH A;  5LMU B;  5IY5 B;  2JEX A;  2ZDI C;  3T1H O;  3T1Y B;  4DRX B;  1DK1 A;  1NQT A;  3FB5 C;  3JAR B;  1SQV H;  4IHJ A;  1H38 A;  1TVK A;  1KYO F;  1Y66 A;  4TT3 G;  5B1B C;  2P6J A;  4J42 A;  4OPA A;  4FM0 A;  3K59 A;  5CB4 B;  2JGD A;  2JIZ G;  2VWJ A;  3OT7 A;  4YJ3 B;  2Q4P A;  3GWK C;  3OFN G;  1IBM B;  4LF9 B;  3K06 A;  2F95 B;  3D8C A;  3F5T A;  5LP6 C;  1AR1 B;  1HNZ O;  4DYL A;  5D5Q A;  1GM7 A;  2OCC C;  1KD1 W;  5J2U A;  1YTF D;  1SA0 A;  4DR3 O;  1NH2 D;  2GUZ A;  3RT3 C;  4J11 A;  4CH4 A;  5LOV A;  2HVK C;  1V55 C;  4Z1V A;  3QTC A;  2CAZ C;  3W7T A;  1PM9 A;  2YUA A;  1BQ0 A;  1TUE B;  1GN4 A;  1OCO C;  1YTF B;  2V1D A;  3RYI A;  2LFR A;  1BHA A;  1FFT B;  2ZE5 A;  1F4N A;  5J2U B;  2X6A A;  4KP4 A;  1KU9 A;  5JQG A;  4O2B A;  5L3G A;  1H2S B;  1AI5 A;  1ZL8 B;  2QA4 V;  4LF4 B;  4LF7 B;  2UXB O;  3IGA C;  2X0L A;  2Z3Y A;  3K58 A;  1N8R W;  2WA4 A;  3AG2 B;  4JI0 B;  4DV5 B;  2NNU A;  4KUM A;  4CS2 A;  5EYP A;  3FX7 A;  3W7S A;  4OX9 B;  2UUB O;  2Z5U A;  2BSK B;  2OWO A;  2Y48 A;  3T1Y O;  2AZ2 A;  4QE7 A;  3RWR D;  4RUE A;  4DV6 O;  2QTS A;  1S5J A;  4YHH B;  4BWA A;  4LF9 O;  2FKX A;  2QKA A;  1WLE A;  3ZRX A;  2UU9 O;  3DGE A;  5FPR A;  4Q6G A;  3B2E E;  3R65 A;  4KL1 A;  2R70 A;  5KUK A;  1OCO B;  3ZMV A;  3AG1 B;  2OTJ V;  3OEH G;  1XNQ O;  4GKK O;  3WG7 C;  2QJ1 A;  1Z5V A;  1VQ5 V;  2QEX V;  2A3Q A;  1BE3 H;  2HEP A;  4XDJ A;  1QBZ A;  1L8D A;  4RO2 A;  3APO A;  2Q7H A;  5B1N A;  2E76 B;  3SJB C;  2DYR B;  4TQD A;  1DTO A;  2KQX A;  4QPJ A;  4CH6 A;  2UXB B;  3VQV A;  1PP9 H;  2JDI G;  4JI3 B;  2YIB A;  3UQ8 A;  2RCV A;  4GCZ A;  2XUM A;  1SZT A;  2IU0 A;  5KHK A;  4NTW A;  2DMX A;  1GMG A;  2HVJ C;  3BEH A;  4LFC O;  2VRZ A;  3ZMT A;  4X89 A;  2EIM B;  4FJC C;  2Q0O C;  1M56 C;  3ZHR A;  4UUJ C;  4J7J A;  1IX9 A;  3CP1 A;  3E22 B;  3OGC C;  2DWD C;  2JK5 C;  3SPH A;  4B3S O;  2LQT A;  1K92 A;  3B8M A;  4PJ0 Z;  1FXH A;  1GRJ A;  2XAJ A;  2CTR A;  2B5U A;  3H1K H;  2CGN A;  4CBC A;  2F1M A;  2WLL B;  3B4S A;  3AK2 A;  5KA5 A;  1K9M W;  3VBB A;  3A0H Z;  1CP9 A;  1XI1 A;  4DR4 B;  5ITZ A;  1FJG B;  4NXN O;  1ROP A;  3AG7 A;  3Q4H B;  4ZIB A;  4IGG A;  4I7Z B;  4B7K A;  2P4K A;  3JCU Z;  3N2K B;  2LFS A;  3JAR A;  4F6R A;  4TOI A;  3RVZ A;  1FXV A;  3DTU B;  2PUS A;  3WB0 A;  5IJ9 B;  2EIK C;  4EB6 A;  4PA7 A;  3C90 A;  3ABT A;  2QE7 G;  2EX3 A;  4JI6 B;  2CE4 A;  5LGT A;  1EN4 A;  1MZE A;  3RW0 A;  3N2K A;  4PHZ A;  1TA8 A;  4K3A A;  4YY3 O;  1NT2 B;  2D3O W;  2WLJ A;  3AG2 C;  1AI6 A;  4YXW G;  3JAL A;  2YIC A;  1EBO A;  2ZIM A;  5CN0 A;  1JVM A;  3EVK A;  1KP2 A;  1YF2 A;  3ABL C;  4DR7 O;  4KHP B;  4LH6 A;  1ZX3 A;  2DE0 X;  2H8P C;  2IH1 C;  1G6U A;  3LDE A;  1SQQ H;  1EN5 A;  1R6N A;  2W6J G;  2E3C A;  1XUQ A;  3FB7 C;  1D5A A;  4GKK B;  3SPC A;  2Z0A A;  1NZ6 A;  3THO A;  3ABU A;  4GUN A;  4JI7 B;  2GDS A;  1IUR A;  4Z2W A;  4JYA O;  1SQF A;  4FLX A;  5JVD B;  5LYJ A;  2Y0P A;  4DR2 B;  1L0N H;  4B3R O;  2QGN A;  1FKA O;  1Y76 A;  2JGU A;  1M4U A;  1SZX A;  4DRX A;  4B7E A;  1EFR G;  3O65 A;  3GWO A;  4CC5 A;  4WFA V;  3E83 A;  1OZ0 A;  4G27 B;  5GTI Z;  5CMU A;  4DV3 B;  3G6E V;  3F7V C;  4LF7 O;  2UXX A;  4EEQ A;  1QCE A;  4ICG A;  2EIJ B;  4EKW A;  2GHY A;  3X2Q C;  2XHB A;  1FYJ A;  4UCT A;  4X65 O;  4CS4 A;  2M6Y A;  3CCJ V;  1BQZ A;  5GTH Z;  4LF6 O;  4NB5 A;  1N32 B;  2O57 A;  1FFX A;  3CS5 A;  2PTM A;  2AW9 A;  2QSA A;  4NXN B;  2EIM C;  3BA8 A;  1NTK H;  1S5L Z;  3NXS A;  4IL6 Z;  1IDS A;  2QWQ B;  2WLI A;  3CXC U;  1PKX A;  2EIL C;  4G2K A;  2PYJ A;  5EZY B;  5E1A C;  4O4J A;  5IJ9 A;  3SJC C;  1I5Y A;  1NS1 A;  3STL C;  1FD9 A;  5DEC A;  1P4R A;  4EB6 B;  4HYO A;  4LBE C;  1Z5W A;  4XDL A;  1HDJ A;  4IIJ B;  2PI4 A;  4NXM O;  1S0V A;  2WLK A;  5ITZ B;  1EZJ A;  3W7W A;  4DV5 O;  2ZT9 B;  4I5S A;  2LO1 A;  1CEZ A;  3SPI A;  4LFB B;  4DW0 A;  3X2Q B;  2UUA B;  4R50 A;  4UCV A;  2UXD B;  2F23 A;  1MA1 A;  2YXY A;  4X64 O;  2EZP A;  3RVY A;  3ASO C;  1LNQ A;  5FPO A;  2F93 B;  4MW8 A;  5FLX N;  3OTO B;  4UXN A;  2YXL A;  2OIG A;  2K9P A;  2HG5 C;  5EIB C;  2IJJ A;  4QJF B;  4ZHQ B;  3ZHS A;  2P06 A;  3GVM A;  1GKF A;  4UVB A;  1SES A;  2FL4 A;  3OUS A;  3CWB H;  4CS3 A;  1JJO A;  3JSL A;  1Y6X A;  3BPZ A;  3STZ C;  4NTY A;  1KB9 F;  3ZHV A;  2GSM B;  5HFM A;  4I50 A;  2V4D A;  4QGP A;  5DM6 V;  1AP6 A;  3C3S A;  3OM3 B;  5EBL C;  5EBW C;  1ZTE A;  2CH7 B;  4K8Z A;  2N05 A;  2D2C B;  1YHQ V;  1HNZ B;  4JTC B;  4WF9 V;  1UFI A;  4LF6 B;  4JI3 O;  1G8M A;  5JCO A;  2ITC C;  3AG4 C;  4FPP A;  3L71 H;  3N27 A;  4O2A A;  4YIP A;  2DWE C;  1H2N A;  1WA8 B;  4JZG A;  4P9P A;  5IJ0 A;  3F5W C;  1SQP H;  1RM1 C;  4UCU A;  5E79 Z;  5LHH A;  1OJH A;  3VQY A;  3E8B A;  3UCS C;  1H8E G;  1NTZ H;  5EIB D;  1WP8 A;  2P4V A;  1R73 A;  2ZKO A;  4X88 A;  1Y67 A;  4CC6 A;  1K33 A;  2YIA A;  3G6B A;  1SQB H;  1V54 B;  3ZRW B;  3G71 V;  2JVD A;  1K5S A;  4JI0 O;  2OTL V;  5BMV A;  4DV7 O;  5EBM C;  3FYE B;  2UUC O;  1IBK B;  1Y76 B;  2Y69 B;  5IDJ A;  2GBO A;  3H1I H;  2ZM6 O;  2HHH O;  4DR4 O;  3HB3 B;  5A9G A;  3DXR B;  4PA9 A;  3SPG A;  1RP3 B;  2IJH A;  5EYP B;  1N36 O;  4JV5 B;  1AI4 A;  1WB8 A;  1SC5 B;  4OPH A;  3CCQ V;  1VEW A;  3D36 A;  3E8F A;  3FAV B;  5EC1 C;  3HKE B;  4JI4 O;  3K9A A;  3OMN B;  4PI2 A;  3LDC A;  4B3R B;  4U3F H;  2IM9 A;  1GM8 A;  1F4M A;  4Q20 A;  4F6R B;  1RM1 B;  2B9Z A;  1BMF G;  3H9V A;  1M93 A;  3HKB A;  4FLT A;  4ZOL A;  1X4T A;  1K34 A;  1YSC A;  3CMA V;  1XHX A;  2WWW A;  3ICX A;  4FM2 A;  1K5Q A;  3E89 A;  2GUZ B;  4TV9 A;  1SET A;  1R6T A;  3T2M A;  4D7S A;  2RQ6 A;  1OCR C;  4MW3 A;  5H6R A;  2FYU H;  1TVK B;  2EIN B;  3CCM V;  4I9W A;  4TQF A;  2Y69 C;  5B1O A;  4LFC B;  1KUQ A;  2HJF C;  2VQE O;  1M1K W;  4A5U B;  1ZLZ A;  3ASO B;  3TCU A;  2OCH A;  1N32 O;  1XNQ B;  4FMT A;  1Q86 W;  3WG7 B;  3KCX A;  2Q9L A;  5CA1 A;  3P32 A;  1PL0 A;  1YIT V;  1M5I A;  4O4H A;  3E8G A;  3CRR A;  4JF3 A;  1PNL A;  3CYO A;  3OTF A;  1VMG A;  4MVS A;  5CA0 A;  1VF7 A;  2ZXW C;  1Q6U A;  2DJV A;  3PJS K;  3LSU A;  1HNW O;  3ZMU A;  5LGN A;  2YS8 A;  2XT9 A;  4DR5 O;  2P22 C;  2GTS A;  1PNM A;  4FFB B;  3JD4 A;  4PDM A;  5BR8 B;  4YJ2 B;  4LFA O;  1VQ4 V;  1Y74 A;  2WLL A;  3A2F A;  4DV0 O;  1XIL A;  4PD4 F;  4JI6 O;  2UXN A;  1VQN V;  3ZHU A;  2XAQ A;  3ZHT A;  4UCO A;  1N33 O;  1QLN A;  2KKW A;  1K8A W;  3JAW B;  2YIB D;  2W0F C;  1VQ8 V;  1NU1 H;  2EJ7 A;  3VOU A;  2QKS A;  3A8T A;  2KG7 B;  1HW7 A;  4LNU A;  1X59 A;  1V9P A;  3FB6 C;  4GZR B;  1A32 A;  3R66 A;  1QLE C;  1WB7 A;  3DXR A;  4U7O A;  1W2B U;  2AHY A;  4P2Z A;  4H44 B;  3L9D A;  4L8J A;  1LR1 A;  5L3D A;  3SPJ A;  1J5E O;  4JI5 O;  4YHH O;  4DUZ B;  2QDO A;  3ZS8 C;  2RDC A;  5BMV B;  4X1Y B;  1P7B A;  2ZE7 A;  5JWP A;  2HLD G;  1IBM O;  1GH6 A;  2LW1 A;  5LMN O;  2ZXW B;  4JI1 O;  2F43 G;  1L1F A;  4NTX A;  1T5E A;  4GT1 A;  4BW5 A;  1O9H A;  3AEI A;  2CTQ A;  5AG2 A;  1BZK A;  1FS0 G;  3T4Z A;  3ZX6 A;  1P49 A;  4RQF A;  2DOS A;  1N34 B;  2YEV B;  3EFF K;  3IJ4 A;  1TUB B;  4FLU A;  1YJ9 V;  1URF A;  2EIJ C;  1WA8 A;  4KFM A;  5KMG B;  1UPG A;  1XMO O;  3BA9 A;  1AI7 A;  1GK9 A;  4P9O A;  4U7N A;  2EIN C;  2MW2 B;  5CA1 B;  4FFK A;  2VQF O;  2YDE A;  2QM4 A;  2ZDI A;  2N74 A;  2VWK A;  4DV2 O;  2QWO B;  1Q82 W;  4X65 B;  3T1C A;  4PDV A;  4D7T A;  1Y4M A;  4LFA B;  4JYB A;  4ZOL B;  1HWY A;  2JEU A;  4AQY B;  5KMG A;  1G1X B;  5KLV H;  2DQ3 A;  4JI2 B;  3BVO A;  5LP6 B;  1D5N A;  2YEV A;  2ETN A;  4DUZ O;  5LA6 A;  1J5E B;  4FZ0 A;  2UXC B;  4X1I A;  1S5H C;  1NH2 B;  3FAV A;  3OMA B;  2ODM A;  1FPO A;  2OIE A;  5B3S B;  2QWR B;  3RYF B;  1ZUQ A;  1NTM H;  4JTD B;  2L6L A;  4HNA B;  1N34 O;  2H94 A;  1ENV A;  1VF5 B;  2W6I G;  1W59 A;  4X62 O;  3H1L H;  1OCZ C;  4MTG A;  4YJ3 A;  3JCZ A;  3D3Q A;  4DUY O;  3J7A U;  4W4K A;  3NR7 A;  3H1J H;  3TGU H;  4IHJ B;  2XAG A;  3MHH C;  4JAS A;  3OEE G;  2K1E A;  1MG1 A;  3IC9 A;  2EBO A;  2VQF B;  3K5O A;  3CB2 A;  4X66 O;  2NLJ C;  4WCE V;  1H2K A;  4K35 A;  5FNV A;  4JGS A;  1HNX O;  4TUY A;  3JAW A;  1WP7 A;  1BSM A;  1F7Y A;  4F6E A;  1S3J A;  3ETD A;  1Q5O A;  2Y4U A;  3H01 A;  4B08 A;  2IH3 C;  4O4L A;  2EIL B;  1XHZ A;  3HKC B;  4EFE A;  4JAU A;  4YIO A;  4YJ2 A;  1NI8 A;  5JJE B;  1Y74 B;  3ZRS A;  5KHG A;  2Q73 A;  4D6T H;  3L72 H;  3LNM B;  1NBM G;  1AR4 A;  4O4L B;  2OCC B;  1ZSP A;  1B06 A;  3O9O A;  2HKO A;  5JH7 A;  1FXK B;  3U10 A;  4DUY B;  4FFB A;  4RWU A;  1XL6 A;  2BTQ A;  1RFY A;  4WFE A;  1AJN A;  1F23 A;  1MNG A;  1KKD A;  4TUY B;  2CDY A;  2A9H A;  3J80 N;  1ORQ C;  4CZZ A;  4TV8 A;  1KC8 W;  4J7K A;  4DV6 B;  2YID A;  1EN6 A;  3UO2 A;  2X6C A;  3CPW U;  2XND G;  4X1K A;  1JMK C;  4I0X A;  1DLB A;  1M56 B;  1K97 A;  3EXA A;  3Q4H A;  3K5L A;  3G67 A;  1JOY A;  4TV9 B;  5KAF Z;  5LYJ B;  2N04 A;  1QHT A;  4LWS A;  4MVZ A;  3CCV V;  1I94 B;  3ZCC A;  2ZIO A;  1AJQ A;  5IYD O;  5TIS Z;  4AIL C;  2PF4 E;  4X1I B;  4JI7 O;  4UVA A;  2ZM6 B;  1SKV A;  4B3M B;  1XQ8 A;  3LUT B;  1QR9 A;  1I08 A;  2ATK C;  4PA3 A;  1WN7 A;  4O4I B;  4UVC A;  3TXS A;  1B6Q A;  1HNW B;  4AHC A;  2QR4 A;  4I55 A;  4DV1 O;  1WJZ A;  3RN4 A;  2P7T C;  3HKB B;  3JAM N;  2MK3 A;  4BR6 A;  4TWK A;  3S3W A;  1WNS A;  5EZY A;  1MZF A;  1FXK C;  2Q68 A;  2ZR2 A;  4MTF A;  4DV4 O;  3ZED A;  3W7X A;  2ZNJ A;  1GN6 A;  2WLI B;  4QIW F;  1BT8 A;  1KEC A;  5IYC O;  3K5N A;  5K1X A;  4H37 A;  1OHH G;  4GYC B;  1KBH A;  4O4J B;  2JGD B;  1OV9 A;  3E35 A;  4MVO A;  3JSN A;  3MAQ A;  3BRC A;  1B04 A;  3K3W A;  3U11 A;  4E4E A;  2P90 A;  2PZS A;  2AXT Z;  4I0X B;  4X8A A;  2FML A;  4DO2 A;  3ETQ A;  1QU7 A;  1VQ7 V;  2GTA A;  3LDD A;  1VP7 A;  3K9S A;  1R3K C;  1QNM A;  4PV1 B;  1KQS U;  2QM8 A;  1KKC A;  1AJP A;  3FYI B;  1W0K G;  3CHX A;  1R3J C;  1FAF A;  3RFR A;  1NR7 A;  3ABM B;  4RUF A;  2BTQ B;  3E8H A;  2ILM A;  4C7U A;  4H13 B;  3SYC A;  3CRQ A;  1K4C C;  5IYZ A;  2ZQM A;  3UM7 A;  3OMI B;  1GTO A;  2ZD9 A;  3H1H H;  3OUF A;  4XDK A;  1E79 G;  5K1P A;  3EHB B;  2CH7 A;  3I5D A;  3CXH F;  3OW2 U;  4JYC A;  3T4D A;  3CCL V;  1Q43 A;  1YJW V;  3HKD A;  1EZV H;  4PDL A;  3CEI A;  4PI0 A;  2QWN B;  4YY3 B;  1K7D A;  5KHI A;  4PA4 A;  1DF5 A;  1NR1 A;  1SF9 A;  5KX5 B;  5GON B;  4I50 B;  4ZHQ A;  5EK0 A;  4LR3 A;  1AIL A;  2BE3 A;  1JA8 A;  2Q8V A;  4JI4 B;  3HKC A;  4UFZ A;  3ZN0 A;  1Q3E A;  3BY6 A;  5H9C A;  4GX2 A;  5DED A;  1S77 D;  1HR0 B;  2Y4T A;  3JD0 A;  3UT5 B;  3KZI Z;  3JD1 A;  3LSQ A;  3JD2 A;  1V55 B;  1JQ0 A;  1K73 W;  2Q67 A;  3CRC A;  5IWA B;  3K04 A;  4W4L A;  2PI5 A;  1N0N A;  2R9R B;  4IT5 A;  3UT5 A;  1JR9 A;  4MTO A;  2JJ2 G;  1AP5 A;  4X64 B;  3ZMZ A;  5GW7 A;  4DR2 O;  2WLN A;  3WB2 A;  2UUC B;  2AZ0 A;  2A7W A;  3ZJZ A;  2KB1 A;  4ZI7 A;  2WA3 A;  3E22 A;  2HP8 A;  1GN2 A;  3LSS A;  4MS2 A;  4FM1 A;  2E5L O;  2XTA A;  2B1G A;  4J9Z B;  3TXQ A;  4MSW C;  1HNX B;  2YC0 A;  3K79 A;  4J10 A;  4CH5 A;  4O2B B;  4UB6 Z;  1H8H G;  2A0L A;  3CJH A;  2YI9 A;  3APQ A;  3CE2 A;  4J41 A;  2LGQ A;  2ZCE A;  3RYC B;  3BAA A;  1PNK A;  2M7W A;  2RJZ A;  5L3C A;  1NVP B;  3CRM A;  5LXT B;  2ZNI A;  1SRY A;  2P67 A;  1CXZ B;  1BL8 A;  3JD3 A;  1Q90 D;  1H2G A;  2UUA O;  1NVP D;  3CX5 F;  4N21 A;  1N36 B;  2QWP B;  2ZIN A;  3IAY A;  1M57 B;  4DV7 B;  2QTO A;  3M99 B;  1MOF A;  2PGG A;  2OT5 A;  3OE7 G;  3OTO O;  1CPY A;  5CB4 A;  1YVW A;  3ASN C;  4OXS A;  5CBF A;  1IBL B;  5B3S C;  3N2G A;  4TSF G;  4DV1 B;  3CCS V;  2QM7 A;  1MMM A;  3TET A;  4RQE A;  1RSO B;  2KSD A;  3BFR A;  3G4S V;  2RMK B;  1U96 A;  2F4V B;  4P30 A;  3AG1 C;  1QVF U;  4DK0 A;  4FK5 C;  2WAM A;  4L87 A;  3L73 H;  1YJN V;  3ZN1 A;  4PA6 A;  4N23 A;  4DV2 B;  4DK1 A;  3FKS G;  1OCZ B;  2UXD O;  4WFG A;  4UB8 Z;  4NYK A;  1E1R G;  1R6K A;  3BHP A;  5IT9 N;  2DYS B;  2F66 C;  5JVD A;  4OX9 O;  4JI8 B;  2Q7G A;  5H2F Z;  3IFX A;  2XAS A;  4LC1 A;  4UV9 A;  1VQO V;  2IJK A;  2JS5 A;  2KG7 A;  1QQC A;  3G80 A;  3D3I A;  4MTX A;  2HJD A;  3CC2 V;  4B3T B;  1UJW B;  5IJ0 B;  5A2Q N;  3K08 A;  1FJG O;  1YI2 V;  2BTO A;  1W0J G;  2AHZ A;  1N33 B;  3HR0 A;  2EUL A;  3MD0 A;  4JPR A;  1M57 C;  4LCU C;  4JZ2 A;  3CJH B;  4QNH B;  3RYH A;  4X9Q A;  3SYO A;  1JFF A;  1WPB A;  2WLM A;  1XNR O;  1PV0 A;  2JRI A;  5BR8 O;  4ASU G;  3SDL A;  1B3Q A;  4HBN A;  4K0K B;  4QE9 A;  1IBL O;  3D36 C;  3OR6 C;  5KHH A;  1MSD A;  1BGY H;  3ETE A;  4GKJ O;  4E2L A;  4PEL A;  1M9N A;  5FL7 G;  5L3F A;  4I4T A;  5BY1 A;  1MSW D;  4JI8 O;  2ZE6 A;  4BIU A;  2CK3 G;  4I55 B;  1LUV A;  2PY5 A;  5DN6 G;  1VF6 C;  2FTK A;  3ABL B;  4MVM A;  4O4I A;  2DYR C;  1MAB G;  1I0H A;  3HPL C;  1I5X A;  4DR1 O;  4LF5 O;  3E2E A;  3CC7 V;  1YCI A;  2PYL A;  1N0J A;  1S76 D;  4BIZ A;  2LGW A;  2HHH B;  5L3B A;  2CTW A;  1K3E A;  3B40 A;  3CRA A;  3ZRV A;  1VAR A;  4IYH A;  2RN9 A;  4QPK A;  1FXK A;  4NVP A;  3ASN B;  5EC2 C;  1US6 A;  4B3M O;  1BCC H;  2CUG A;  1I7F A;  4JTA B;  2F4V O;  1VIB A;  2DW4 A;  3CCU V;  3RYH B;  4DR7 B;  4NXM B;  1BHB A;  1QR8 A;  5J2T B;  1P84 F;  3VQX A;  3CCR V;  2UUB B;  4K8X A;  3SYP A;  1IXB A;  5JH7 B;  1VQL V;  1PPJ H;  1FFX B;  1IVS A;  3SJQ C;  3ETG A;  3B77 A;  3I56 V;  5IYZ B;  1RSO A;  3VQW A;  3WU2 Z;  1BS3 A;  5CA3 A;  2DYS C;  3K0D A;  1YIJ V;  2JJ1 G;  4H33 A;  3DC6 A;  2IBZ H;  3PN1 A;  1H2L A;  1J95 A;  3HKE A;  2Q7E A;  4CH3 A;  4DV4 B;  2VQE B;  1SQX H;  2XAF A;  4FVM A;  5J9P C;  2DQ0 A;  4K0K O;  4HNA A;  1P7G A;  1VQK V;  2EJR A;  2JS3 A;  1O9G A;  3BAB A;  4DR1 B;  2FB5 A;  1XL4 A;  3C3T A;  4DR3 B;  1R1B A;  5FNV B;  3KG2 A;  5LXT A;  5D5P A;  5B66 Z;  4Z1M G;  1VQ6 V;  5HFL A;  3ZHQ A;  5BZB A;  4RAI A;  3N2G B;  3CME V;  3ZBH A;  3GB7 C;  2Q69 A;  3JAT A;  3B09 A;  2V7Q G;  4EFB A;  2X7R B;  1PD3 A;  4GX1 A;  3FD9 A;  4F4L A;  1SQG A;  5H5N A;  2WPD G;  4FLW A;  5LOV B;  1XOU A;  3SJA C;  2OYQ A;  1S72 V;  4IYI A;  3RYC A;  1JX9 A;  4AI8 A;  4X66 B;  1M90 W;  2W0X A;  2XOK G;  3A0B Z;  5B1A B;  3OR7 C;  2ADQ B;  1NKD A;  2E74 B;  3JAS A;  1Z2G A;  4R7C A;  3JAL B;  2IJI A;  4FLY A;  5J2T A;  4U3J B;  3WB1 A;  2ARH A;  2HR3 A;  2X6B A;  1Q8I A;  4XBF A;  3LNN A;  1YDX A;  2R9I A;  2LJ2 A;  3UKM A;  5LMN B;  3OAA G;  1XMO B;  4JYA B;  4LWS B;  3QNE A;  4X62 B;  1AVM A;  2YSU B;  4GLX A;  1KP3 A;  2LW7 A;  1VF6 A;  1N4C A;  4WBN A;  3ABK C;  5BXZ A;  3T1H B;  2NN4 A;  4AQY O;  3L75 H;  3CD6 V;  4DV3 O;  1XMQ O;  3M8A A;  1XRE A;  2BCC H;  3CC4 V;  2Y0I A;  3QG5 A;  5C8Y B;  4NKG B;  3JAS B;  2Q5Z A;  3SYA A;  5CBH A;  5B1A C;  4GX0 A;  1VQP V;  3JAK B;  4FIP C;  1DF4 A;  1HP8 A;  4FLV A;  3QO8 A;  3K57 A;  2IW5 A;  4J7Z A;  5KX5 A;  2P5O A;  3B8N A;  4IIJ A;  5KHJ A;  1Q6I A;  2E5L B;  4H0L B;  4JYY A;  4MVQ A;  2RNB A;  5LHG A; 
#chains in the Genus database with same CATH homology
 2JJ2 G;  1K8A W;  1ROP A;  4LP8 A;  4MT8 A;  5GW7 A;  2WLN A;  3ZMZ A;  2W0F C;  4MVR A;  2BOC C;  1VQ8 V;  3ZJZ A;  2KB1 A;  3IC7 A;  3VOU A;  2QKS A;  2LFS A;  5KUM A;  3RVZ A;  1FXV A;  3DTU B;  1Q81 W;  3K0G A;  3LSS A;  4MS2 A;  3QO5 A;  3ABK B;  2EIK C;  2B1G A;  4J9Z B;  1E1Q G;  3FB6 C;  4MSW C;  3RBZ A;  4PDR A;  4PA7 A;  3ABT A;  1Q7Y W;  1QLE C;  2QE7 G;  4U7O A;  1W2B U;  5LGT A;  2AHY A;  4P2Z A;  3RW0 A;  3K79 A;  5L3D A;  3SPJ A;  2D3O W;  1V54 C;  1JPX A;  2WLJ A;  3AG2 C;  1RPO A;  1H8H G;  2A0L A;  1AI6 A;  4YXW G;  5L3E A;  1P7B A;  1EBO A;  3SYQ A;  5CN0 A;  1JVM A;  2HLD G;  1K4D C;  2LP7 A;  1WPX A;  1JJ2 U;  1KP2 A;  3ABL C;  2ZXW B;  1PNK A;  2F43 G;  1OCC B;  2M7W A;  2H8P C;  5L3C A;  1L1F A;  1NVP B;  2IH1 C;  3LDE A;  4UV8 A;  4GT1 A;  4BW5 A;  1SRY A;  3AEI A;  1R6N A;  2P67 A;  1JCH A;  2W6J G;  3AG3 C;  1FS0 G;  1BL8 A;  3FB7 C;  3T4Z A;  3JD3 A;  5CBG A;  1H2G A;  4RQF A;  3SPC A;  1NVP D;  2EIK B;  2YEV B;  3EFF K;  1YJ9 V;  4N21 A;  3ABU A;  2EIJ C;  1M57 B;  1SER A;  2QTO A;  3FB8 C;  4KFM A;  3M99 B;  1MOF A;  2OT5 A;  3OE7 G;  1AI7 A;  1CPY A;  1GK9 A;  3ASN C;  1GO3 F;  4P9O A;  4U7N A;  2EIN C;  4OXS A;  5CBF A;  5H6Q A;  2WSS G;  5B3S C;  4TSF G;  1RPR A;  2ZDI A;  2HFE C;  3CCS V;  2QM7 A;  3TET A;  4RQE A;  1EFR G;  4WFF A;  3G4S V;  3JYC A;  5B1B B;  3GWO A;  4WFA V;  2BOB C;  4P30 A;  3E83 A;  1Q82 W;  3AG1 C;  1QVF U;  3T1C A;  4PDV A;  4FK5 C;  2WAM A;  1OZ0 A;  1Y4M A;  4G27 B;  4L87 A;  1YJN V;  3ZN1 A;  4JYB A;  4PA6 A;  5CMU A;  4N23 A;  5IYB O;  1HWY A;  2JEU A;  1QVG U;  3ZIA G;  3FKS G;  3G6E V;  1OCZ B;  3F7V C;  2UXX A;  4WFG A;  1E1R G;  1QCE A;  1R6K A;  1OCR B;  1IXM A;  3ZMS A;  4JAV A;  2DYS B;  2DQ3 A;  4G28 B;  2EIJ B;  4EKW A;  2YEV A;  2GHY A;  3X2Q C;  3IFX A;  2XAS A;  4LC1 A;  4UV9 A;  1VQO V;  2IJK A;  1S5H C;  2Q6A A;  1NH2 B;  2C2A A;  3CCJ V;  3OMA B;  3D3I A;  4MTX A;  5B3S B;  3CC2 V;  3AG3 B;  3QO7 A;  1UJW B;  4JTD B;  1ARO P;  3K08 A;  1ZWI C;  2ZR3 A;  1R3L C;  1YI2 V;  1W0J G;  3W7U A;  2AHZ A;  2H94 A;  4ZKI A;  1NJI W;  1ENV A;  2W6I G;  4GX5 A;  1THZ A;  4R8C A;  3MD0 A;  4JPR A;  1M57 C;  1OCZ C;  4LCU C;  4MTG A;  4ZBM A;  3JCZ A;  1R3I C;  2EIM C;  4QNH B;  3SYO A;  3NXS A;  2XAH A;  2WLI A;  2WLM A;  3CXC U;  1PKX A;  4WFH A;  2EIL C;  4ASU G;  4G2K A;  3WFV A;  5E1A C;  3ABM C;  3MHS C;  1I5Y A;  2XAG A;  3A0R A;  3ZRW A;  3STL C;  3MHH C;  4QE9 A;  5LHI A;  4JAS A;  3OEE G;  1P4R A;  2K1E A;  1MG1 A;  2EBO A;  4HYO A;  4LBE C;  2EZO A;  4XDL A;  3OR6 C;  4DXW A;  2NLJ C;  4WCE V;  2B1I A;  2PI4 A;  3ETE A;  5IY5 C;  4JGS A;  4HZ3 A;  2WLH A;  4HAM A;  4J9Y B;  2WLK A;  4E2L A;  1S0V A;  1QLE B;  3F7Y C;  4PEL A;  3TK1 A;  3I55 V;  1M9N A;  1GM9 A;  5FL7 G;  1VQ9 V;  1S3J A;  3ETD A;  5L3F A;  1EZJ A;  3W7W A;  4I5S A;  1CEZ A;  5KA6 A;  5LGU A;  2ITD C;  1MSW D;  3SPI A;  4BIU A;  4MVU A;  2CK3 G;  3H01 A;  2IH3 C;  1F51 A;  3X2Q B;  2EIL B;  5DN6 G;  4R50 A;  2FTK A;  4JAU A;  5LBQ A;  3ABL B;  4MVM A;  2EZP A;  2DYR C;  3K03 A;  3RVY A;  1MAB G;  3ASO C;  1LNQ A;  3HPL C;  3ZRS A;  3LNM B;  1I5X A;  1NBM G;  4MW8 A;  4UXN A;  3E86 A;  2OCC B;  3E2E A;  2HG5 C;  3CC7 V;  4R6Z A;  1S76 D;  4BIZ A;  1VQM V;  2IJJ A;  2HKO A;  5L3B A;  4QJF B;  1FXK B;  1GKF A;  3AG4 B;  1K3E A;  1SES A;  4UVB A;  1XL6 A;  2A79 B;  4WFE A;  4WFB V;  1COW G;  1AJN A;  1F23 A;  3OUS A;  3ZRV A;  1OCC C;  1G4Y B;  1KKD A;  2IU3 A;  2A9H A;  4QPK A;  3ML0 A;  3P30 A;  3CCE V;  1FXK A;  3ASN B;  5EC2 C;  1ORQ C;  4CZZ A;  4BAY A;  5C93 A;  3STZ C;  1KC8 W;  4JTA B;  1BHB A;  2DW4 A;  2GSM B;  5HFM A;  5IY5 B;  2JEX A;  3CCU V;  1QR8 A;  2ZDI C;  2X6C A;  5DM6 V;  3CPW U;  2XND G;  3OM3 B;  1NQT A;  5EBL C;  3FB5 C;  5EBW C;  3CCR V;  1H38 A;  1DLB A;  1M56 B;  1K97 A;  1Y66 A;  3SYP A;  4TT3 G;  5B1B C;  1YHQ V;  4JTC B;  4WF9 V;  1JOY A;  2P6J A;  1G8M A;  1VQL V;  2ITC C;  2JIZ G;  3AG4 C;  4FPP A;  4MVZ A;  3CCV V;  2DWE C;  3SJQ C;  3ETG A;  3ZCC A;  3B77 A;  3I56 V;  1AJQ A;  5IYD O;  4P9P A;  3OFN G;  3F5W C;  4UVA A;  3K06 A;  1RM1 C;  5CA3 A;  2DYS C;  3K0D A;  1AR1 B;  1YIJ V;  5LHH A;  3LUT B;  2JJ1 G;  4H33 A;  1GM7 A;  2OCC C;  3E8B A;  1KD1 W;  1QR9 A;  4PA3 A;  1J95 A;  2ATK C;  1YTF D;  1H8E G;  4UVC A;  1NH2 D;  1R73 A;  1B6Q A;  4X88 A;  2HVK C;  1V55 C;  2XAF A;  5J9P C;  1K33 A;  2DQ0 A;  3W7T A;  1V54 B;  1VQK V;  2EJR A;  1TUE B;  1OCO C;  2P7T C;  3ZRW B;  1YTF B;  3G71 V;  2MK3 A;  4TWK A;  2V1D A;  1K5S A;  2LFR A;  1BHA A;  2OTL V;  1FXK C;  1FFT B;  2Q68 A;  2ZR2 A;  4MTF A;  1XL4 A;  1F4N A;  2X6A A;  4KP4 A;  5EBM C;  3W7X A;  3KG2 A;  5L3G A;  3FYE B;  2Y69 B;  2WLI B;  1AI5 A;  5IDJ A;  4QIW F;  2QA4 V;  1KEC A;  3HB3 B;  5IYC O;  4H37 A;  4Z1M G;  1OHH G;  4PA9 A;  1VQ6 V;  5HFL A;  3IGA C;  3SPG A;  5BZB A;  2X0L A;  2Z3Y A;  1N8R W;  4RAI A;  3AG2 B;  3E35 A;  3CME V;  4MVO A;  2NNU A;  4KUM A;  2IJH A;  3GB7 C;  2Q69 A;  1AI4 A;  3K3W A;  3W7S A;  2P90 A;  3CCQ V;  2V7Q G;  4X8A A;  2X7R B;  4DO2 A;  1PD3 A;  2Z5U A;  3D36 A;  4GX1 A;  1VQ7 V;  3E8F A;  3LDD A;  2Y48 A;  5EC1 C;  4F4L A;  1R3K C;  1KQS U;  3K9A A;  3OMN B;  4QE7 A;  2QM8 A;  3LDC A;  4RUE A;  2WPD G;  1GM8 A;  1F4M A;  4Q20 A;  1AJP A;  3FYI B;  1W0K G;  1S72 V;  1R3J C;  1RM1 B;  1BMF G;  1NR7 A;  3ABM B;  1JX9 A;  4RUF A;  1WLE A;  3ZRX A;  1M90 W;  3DGE A;  3E8H A;  2XOK G;  3R65 A;  5KUK A;  1K34 A;  1OCO B;  3ZMV A;  3AG1 B;  1YSC A;  3SYC A;  2OTJ V;  1K4C C;  3OEH G;  3CMA V;  5B1A B;  2ZQM A;  3OR7 C;  3UM7 A;  3WG7 C;  2WWW A;  3OMI B;  1GTO A;  2ZD9 A;  3OUF A;  4XDK A;  1NKD A;  1K5Q A;  3E89 A;  4R7C A;  1VQ5 V;  2QEX V;  4XDJ A;  2IJI A;  1QBZ A;  1SET A;  3T2M A;  4RO2 A;  1OCR C;  4MW3 A;  1E79 G;  2HR3 A;  2X6B A;  5B1N A;  5H6R A;  4XBF A;  3EHB B;  2EIN B;  2R9I A;  3CCM V;  2DYR B;  4I9W A;  1DTO A;  2Y69 C;  5B1O A;  3UKM A;  3OW2 U;  2HJF C;  3OAA G;  4JYC A;  3T4D A;  1M1K W;  3CCL V;  1YJW V;  3QNE A;  4QPJ A;  2JDI G;  4PDL A;  2YSU B;  3ASO B;  3TCU A;  4GCZ A;  1SZT A;  1KP3 A;  2IU0 A;  1K7D A;  4FMT A;  4PA4 A;  1Q86 W;  1GMG A;  3ABK C;  3WG7 B;  1DF5 A;  2HVJ C;  3BEH A;  1NR1 A;  3P32 A;  3ZMT A;  4X89 A;  1PL0 A;  1YIT V;  5EK0 A;  3CD6 V;  3E8G A;  2EIM B;  4FJC C;  4JF3 A;  1PNL A;  1M56 C;  3CYO A;  4MVS A;  4UUJ C;  3CC4 V;  2ZXW C;  3CP1 A;  3OGC C;  2DWD C;  3PJS K;  2JK5 C;  3ZMU A;  3SPH A;  3SYA A;  5LGN A;  1K92 A;  3B8M A;  3ZN0 A;  1PNM A;  1FXH A;  3BY6 A;  5H9C A;  5CBH A;  3JD4 A;  4GX2 A;  4PDM A;  1S77 D;  2XAJ A;  4GX0 A;  5B1A C;  2B5U A;  1VQP V;  3JD0 A;  1VQ4 V;  4CBC A;  2WLL A;  2WLL B;  4FIP C;  3JD1 A;  1DF4 A;  3QO8 A;  3LSQ A;  3JD2 A;  1V55 B;  2IW5 A;  5KA5 A;  2UXN A;  1JQ0 A;  1K73 W;  1K9M W;  2Q67 A;  1VQN V;  2XAQ A;  3B8N A;  3VBB A;  3K04 A;  2PI5 A;  1CP9 A;  4MVQ A;  1QLN A;  2R9R B;  4MTO A;  5LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...