3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
4J9ZB 2WLLB 4EKWA 3FB8C 1J95A 3K06A 1KKDA 2A9HA 2WLNA 2IH3C 3AG3C 2X6AA 3E86A 4PDLA 4WFHA 5J9PC 1R3IC 3E8GA 3ABKC 4MTGA 5CBGA 3FB6C 4JTAB 2WLHA 3AG2C 4RUFA 3F5WC 4QNHB 2BOCC 4H33A 2ATKC 3LNMB 4G28B 2A0LA 4R8CA 3TETA 3IFXA 2Q69A 3K03A 3ASNC 2X6BA 4MVOA 3K04A 2JK5C 3SJQC 4CBCA 2R9RB 4LP8A 4R50A 1V55C 3OR6C 4MTFA 4PDMA 2P7TC 4MVMA 1M56C 4G27B 4XDLA 1R3KC 3SPGA 2EILC 4MW8A 4WFGA 1P7BA 3LDCA 2HJFC 4J9YB 4MTOA 2Q68A 2BOBC 4QE7A 2WLIB 4PA7A 2ZXWC 3IGAC 2ITDC 3BEHA 4PA3A 5EK0A 3STLC 5CBHA 2A79B 3E8BA 3OGCC 4H37A 2ITCC 4TWKA 3ASOC 1ZWIC 3LDDA 3K0DA 2QKSA 2DWDC 4MS2A 3T1CA 1OCCC 1OCZC 1K4CC 1S5HC 4OXSA 4RUEA 5KUMA 3SPCA 3T4DA 3SPHA 1K4DC 2H8PC 2ZD9A 2YEVA 2AHZA 4P9PA 1LNQA 1R3JC 3SYQA 4JTCB 4BW5A 2WLLA 4PDRA 3VOUA 2WLKA 5KUKA 1M57C 2HG5C 2Y69C 4GX5A 4P2ZA 3JYCA 1JVMA 4MVQA 4X89A 3SYPA 2AHYA 2K1EA 5B1AC 3SYCA 3SYAA 3OUFA 3AG4C 2DYRC 4MVUA 4UUJC 4MVSA 2IH1C 1XL6A 3RVYA 2WLJA 2EINC 4WFEA 3E89A 3ZJZA 2DWEC 2X6CA 3RW0A 3KG2A 3F7VC 4P30A 3SYOA 2EIMC 5EC2C 2KB1A 2Q67A 3ABMC 3OR7C 4LCUC 4R6ZA 3AG1C 3PJSK 3OUSA 2WLIA 3E83A 4MVZA 4XDJA 5CBFA 2HFEC 3LDEA 2HVJC 1OCRC 5B1BC 4PA9A 4PDVA 4PA4A 4ZBMA 3STZC 5EBWC 3RBZA 4F4LA 2EIKC 4X88A 3SPIA 5E1AC 3X2QC 3TCUA 4GX2A 4KFMA 2NLJC 2OCCC 2QTOA 1OCOC 4MSWC 3T4ZA 3FB5C 4HZ3A 2Q6AA 2DYSC 2HVKC 2WLMA 3EFFK 4P9OA 4R7CA 5BZBA 5EBMC 3ZRSA 3K08A 3GB7C 3E8FA 1ORQC 5IY5C 4RAIA 3HPLC 4X8AA 5B3SC 4JTDB 3K0GA 4XDKA 1XL4A 4GX1A 4GX0A 5EBLC 4MW3A 1QLEC 4QE9A 3LUTB 1BL8A 1V54C 3R65A 4DXWA 4PA6A 4LBEC 3RVZA 4I9WA 3F7YC 1G4YB 3SPJA 3WG7C 4RO2A 4HYOA 5EC1C 3UKMA 2EIJC 3T2MA 3FB7C 3ABLC 3E8HA 2W0FC 1R3LC 3UM7A 4WFFA 4MVRA
chains in the Genus database with same CATH superfamily
1B6QA 2ZCEA 5L3DA 1R1BA 2V7QG 1H2LA 2ZXWB 4ZHQB 1CXZB 1N32O 4KUMA 4B7KA 4JGSA 2P7TC 3WB1A 1KECA 1R6KA 1RFYA 5L3GA 2ZDIA 1PNMA 4FZ1A 1P7BA 1VQMV 4QE7A 5ITZA 2H3OA 4NXNB 3RYIB 3JARB 2Q7HA 5EIBC 1S0VA 1KKCA 3OAAG 5KHKA 4O4LB 4HBNA 3OEEG 1Q43A 4D7TA 3ICXA 4YY3B 4TQFA 1JPXA 1ZLZA 4LC1A 4A5UB 1HNZO 1GN6A 1Y4MA 2LP7A 3H1KH 3JYCA 1NTMH 1OCRB 2QEXV 4JYAO 1RPRA 4FMTA 2Q8VA 3BRCA 5L3BA 1XMOB 1S5JA 1HNWB 4JYCA 4KHPB 3B4SA 3CEIA 5H6QA 3CS5A 3DC6A 3ABMC 2QWPB 4GKJB 4ZI7A 3KKYA 4ZBMA 5EBWC 1QU7A 1F7YA 1VARA 2EIJB 1VQ8V 2VQEO 4UV8A 1BQ0A 1BE3H 3R66A 4FVMA 3JD1A 2ARHA 3CCLV 2UUBO 5EIBD 3ZMTA 4I9QA 4PI2A 1I5XA 3FFQA 4YIPA 3JD4A 4RO2A 3UKMA 3LSSA 3HKBA 2YEVB 1HR0O 4QPJA 3E35A 3JASB 2LGWA 4EKWA 4YJ3A 4LR3A 4TV9A 1GKFA 1WJZA 1U97A 5CBGA 4TUYB 2ATKC 1EFRG 4LFBO 2YS8A 4CBCA 2PGGA 2HEPA 4EFEA 2JIZG 1WP8A 2L6LA 1HW7A 2HJFC 1NVPB 2WLIB 3QTCA 2WAMA 5IYBO 1IZ3A 1DTOA 3OGCC 4H37A 1NTKH 4TT3G 5IJ9A 1FXHA 4RUEA 1US6A 1WPBA 1RM1B 1L0NH 2AHZA 5LMNB 1LNQA 3FYIB 1XNQO 4JI7O 3O65A 3VOUA 1AR1B 2Y69C 1WN7A 4P2ZA 2CE4A 3JAKA 4UCUA 2FMLA 4PELA 3SYCA 3SYAA 4UUJC 2OTJV 5FPRA 5GONA 4X1IA 4HNAA 4IT5A 5L3CA 1EM1A 2F93B 1COWG 3SYOA 1SQFA 2Y0PA 1AJPA 3CB2A 3T1HB 4GUNA 3HR0A 2P90A 1AI6A 2M7WA 4I0XB 3BFRA 3RBZA 1O9HA 2YICA 4ASUG 1TUEB 5LP6C 4GX2A 4NTXA 1L0LH 2OCCC 4DUZB 3DXRB 1S77D 4JF3A 2W0XA 5BR8B 1V54C 2BE3A 2PY5A 1FFXA 3B77A 3UO2A 4LF8O 5D5QA 1P49A 1S76D 1M1KW 4UCVA 1ZAUA 4DV0B 1M56B 4JAUA 3ZHTA 1EN4A 3K3WA 2A9HA 5KHGA 5JJNB 4H0LB 3ABKC 4MTGA 4RUFA 4DV6B 2BOCC 4LH7A 1VF6C 1AR4A 2JK5C 1YTFB 1IDSA 3L71H 3K5OA 2E5LB 4JYYA 4KL1A 1XUQA 1YI2V 4MVMA 3H1LH 2RNBA 3A2FA 3U11A 4DV3O 1BZKA 4X20B 3F5TA 3G6BA 5LOVA 3D3QA 3S3WA 5F2VO 5KUMA 5FNVA 3ZN1A 4WFAV 3HB3B 1ZX3A 4FZ0A 2W6JG 2N05A 3DSQA 1K5SA 5GW7A 1EZVH 1VMGA 2QWQB 2DMXA 3SJAC 3FAVA 2DYRC 1MG1A 1Y74B 4JI1O 4ZOLA 2UXBO 3F7VC 3CC4V 1SQGA 1DLBA 3HKEA 2QWRB 3ZRWA 5CBFA 1Y76A 3CXHF 4D6TH 4B3TO 4PA9A 1P84F 3SPIA 2CTRA 3E22A 1Q6IA 3X2QC 2UUAB 1FXVA 2XTAA 3TGUH 1VQ6V 4LWSA 1TUBA 4TOIA 2Q6AA 2OTLV 2CGOA 2XHBA 1F4MA 2WSSG 4UB8Z 3FYEB 4I4TA 2UUBB 2PYJA 2FL4A 1BL8A 4HYOA 4J7KA 3OTOO 1WA8B 5J2TA 1HR0B 1YJNV 3UM7A 2WLLB 5KAFZ 1Z2GA 4B3RB 3L75H 2B1GA 4UB6Z 2DOSA 2HJDA 4BWAA 3TETA 4K0KB 1E1RG 4F6RA 2A06H 3AK2A 4MTFA 1JA8A 1MZEA 4DV4O 1MA1A 1H38A 2YDEA 1VP7A 5C8YA 3CRQA 1YJWV 1H8EG 1GK9A 3WU2Z 1NH2D 1GRJA 1H2MA 4I55A 3CCMV 3SPHA 2H8PC 3P32A 4NVPA 4J42A 1DGSA 1NU1H 4EB6A 4GX5A 3RN4A 1LR1A 3GWKC 4B08A 1IBMO 3OMAB 3D8CA 2AHYA 1GM9A 1KD1W 3JATB 2R9IA 3BHPA 2HKOA 1JMKC 2IH1C 4YHHB 4DR4B 5K1XA 3B8MA 2OIEA 3E89A 2DWEC 5HFLA 3ETQA 4P30A 2PF4E 2GTAA 3QO8A 4C7UA 1EN5A 3N27A 3PJSK 4DR3B 2RQ6A 5AG2A 3LDEA 2HVJC 1FD9A 4DV1B 2XAHA 4YY3O 2B5UA 4FLXA 1W59A 2NLJC 1J5EO 3D3IA 1B3QA 3PN1A 3OM3B 3K79A 1HNWO 4QJFB 1GN2A 1RP3B 1Y6XA 4EEQA 1XL4A 2ZE6A 1G8MA 4FPPA 2ZE8A 1SS3A 3LUTB 3W7TA 4IGGA 2ZR2A 4LBEC 4GKJO 4LF8B 3OMNB 1PL0A 2AW9A 3OTFA 2GBOA 3AG3C 3OFNG 2RCVA 1Q8IA 1WP7A 4UCRA 3JALA 2QA4V 5JQGA 2QTSA 1DK1A 2YC0A 2N04A 1R3KC 3N2GB 4CH5A 1I5YA 4DV3B 4PA7A 2ZXWC 2YIDA 3G6EV 1TVKA 3STLC 1NKDA 4J80A 5LL6Y 1GH6A 4DW1A 5B1AB 2QKSA 3ZS8C 3ZRXA 3JAWA 1VQLV 3DC5A 2UXCB 3SJBC 5J2UA 2JGDA 3CJHA 4LF4B 5LA6A 1NJIW 4RQEA 1MMMA 2JJ1G 2K1EA 3OUFA 4FK5C 2JS5A 3JSNA 2YI8A 1SRYA 5CA1A 1NZ6A 4DR1B 1CEZA 1WLEA 5EYPB 3QO7A 1Q3EA 1XNRB 4K8ZA 1H2NA 2ZE5A 3M99B 2HHHB 5LMNO 1I08A 1GO3F 4QPKA 1OCRC 1SQBH 4JAAA 3CRCA 5GTHZ 3ZHSA 5KHIA 2QGNA 5JJEB 3ABTA 1ZTEA 3VQYA 3GB7C 1VEWA 2C2AA 5KHHA 1N36B 1ZSPA 2QM4A 4UCSA 3R65A 3T1HO 1VQOV 5H9CA 5FPOA 3C3SA 2PI5A 2Y0IA 3OE7G 1N34B 3B40A 2XT9A 4L87A 2EIJC 3OTOB 3FB7C 4O2AB 3LNNA 1I7FA 1E1QG 3ZX6A 2PTMA 1DF4A 4DUZO 3NXSA 4PDLA 1THZA 5BXZA 1FKAO 3WB0A 3RYHB 1I0HA 4TV8B 1HNXB 2OYQA 3OR6C 4G27B 5TISZ 3LDCA 3CCUV 1AJQA 1OZ0A 2BOBC 4DV0O 1SESA 1FJGO 4O4IA 2Q0OC 2ITCC 5JH7B 4FFBB 4DR6B 2BTQA 2DWDC 3ZEDA 4DV6O 1R73A 4DR5B 4WF9V 2E5LO 3IC9A 2BSKB 3SJCC 1QHTA 2OWOA 1YCIA 4H44B 3JARA 1N4CA 3BA8A 1IBMB 4X89A 5HFMA 2GHYA 1RM1C 4X66B 2P4VA 1GM7A 4OX9B 2NNUA 4I5SA 1ZL8A 5IY5B 4NR1A 2AZ2A 2QWNB 3HKCA 1VIBA 1J5EB 1FXKA 2HVKC 5BMVA 1H2KA 5A9GA 2F4VO 4JI0B 5ITZB 5LGNA 1LUWA 1MOFA 1DF5A 2G38A 5IWAB 2Q73A 4DR7O 4W4LA 4K3AA 5EC1C 1NVPD 1KUQA 5DN6G 4WFFA 2UUAO 3ZRVA 5KAIZ 2X7RB 3AK1A 4U3JA 3HKDA 4X1YA 2YI9A 3E86A 4J10A 1EZJA 1Y66A 4X1KA 4FFKA 3CCQV 1WB7A 2ETNA 3CX5F 1WNSA 1L1FA 3C90A 2Q69A 4DV2B 1OCCB 1YIJV 1M56C 3VBBA 4CZZA 2CDYA 1K9MW 2MK3A 2QR4A 4J9YB 1AI5A 5CMUA 4ZI7B 4BIOA 3I5DA 1M57B 4UXNA 3CCRV 3CHXA 4B3RO 1BHBA 1AVMA 4TWKA 2Z0AA 1K4DC 2A7WA 2YXHA 4O2BA 3CXCU 1IBLB 4K0KO 2R70A 4LFAB 4LF7B 4IL6Z 5B1OA 1GAXA 1RPOA 2OT5A 3JD2A 3HKBB 5B5EZ 1PL4A 3L74H 1WPXA 2CH7A 4GLXA 5CN0A 3RVYA 1S3JA 4WFEA 4JZGA 3CCVV 1RSOA 2DYSB 4NTWA 3MDSA 4YJ3B 4TV9B 4MVZA 2FKXA 1ROPA 4PA4A 4FLVA 2CK3G 1IXBA 2AZ0A 2RJZA 5EZYA 1B06A 4YHHO 4DR4O 3SGIA 3ZMZA 1YTFD 3IAYA 2JS3A 3APOA 4IYHA 1KB9F 3ZCCA 4DR3O 1YSCA 1GN4A 1XMQB 3G4SV 4I50B 4DV1O 4DO2A 2W0FC 3UT5A 4MTXA 4N23A 4J9ZB 1YHQV 1AILA 1J95A 4DRXA 3E8GA 3JAKB 4AQYB 1VQPV 3F5WC 1XREA 1XBLA 3LNMB 1MNGA 4HAMA 3ASOB 2UUCB 2X6BA 3T1YB 4BR6A 3U0ZA 3P3NA 5GONB 1A32A 4X1IB 3FD9A 4HNAB 4D7SA 2Q4PA 3KCYA 1AP5A 4CH3A 2YIBD 1IURA 1G1XB 2JVDA 3IGAC 1FJGB 3I56V 3E8BA 3EVKA 5D5PA 3LDDA 2Y4TA 1QQCA 1HP8A 2FYUH 1R3JC 4JTCB 4X64B 1MABG 3TXQA 1JVMA 1GTOA 1G6UA 1FFXB 2EIKB 4PI0A 4MVUA 4DR2B 4B7EA 2H94A 4MVSA 1K5QA 4CS4A 5CB4A 2IJJA 1YJ9V 1M4UA 2QJ1A 5H5NA 5LGTA 2LO1A 2KB1A 5KLVH 5B3SB 2UXCO 3OGIB 4B3MB 4PDVA 3STZC 2EULA 4LF4O 1D5AA 4KFMA 2HLDG 4FLUA 1SQQH 1R6NA 4P9OA 2QSAA 4DV5B 3QVNA 1ENVA 1PKXA 4DR1O 2F4VB 4JI5B 4RAIA 2F66C 1XNRO 5LOVB 1XEQA 3NR7A 2HHHO 3AG2B 4DR7B 2DQ0A 4PA6A 4GYCB 5LGUA 1G4YB 4WBNA 5LP6A 5FNVB 4K8XA 4OPAA 3RYCA 4Q6GA 4CS3A 2JDIG 1V55B 1TAEA 2KSDA 5KX5A 1N33B 1UFIA 2GV9A 4JI6B 4WFHA 3RGBA 4JV5O 2O57A 2PYLA 4R8CA 3FAVB 1N36O 4LF9O 3JCZA 4ABMA 4LF6B 1FFTB 2UXXA 4ZOLB 4XDLA 5IJ0A 1N34O 2GUZA 4IHJA 3UO3A 1TA8A 3K5MA 3HKEB 2MW2B 4OPHA 3ZRWB 1KU9A 1Y76B 2XAFA 1VQ5V 2AGAA 3DTUB 3E22B 1QR9A 3ZBHA 4JI4O 4O4HA 1VF6A 4OXSA 2XAQA 4LWSB 1OHHG 1TUBB 4E2LA 1HNXO 3N2KA 1IX9A 4JAVA 2DE0X 2EIMB 4I4TB 4FIPC 1YXBA 2HG5C 3AG1B 3OMIB 2Q5ZA 3OT7A 3SYPA 3UQ8A 3H1JH 5B1AC 1GMGA 5J2TB 4DR6O 3FKSG 1OCOB 1K92A 2IM9A 3IJ4A 4DW0A 4FM0A 2K9PA 4DR5O 1JFFA 4LNUA 3APQA 5IYZA 3OEHG 1VQNV 3RYFA 1PD3A 1IXMA 2EZOA 1IVSA 4LF5O 3BPZA 1B04A 3I55V 2ZE7A 4F6RB 4B3SB 4BAYA 2QE7G 2VRZA 4FLWA 3T4ZA 3FB5C 3VQWA 5BZBA 3CCSV 4DK0A 2ZNJA 3ZRSA 5C8YB 3K08A 3D36C 4X66O 3ZMVA 4JTDB 1W0JG 4OX9O 5JCOC 1I94B 3ZMUA 5LBQA 3SPJA 4I55B 5IDJA 1CP9A 2GTSA 1EN6A 4IIJA 4Q20A 2XOKG 4I7ZB 3LSUA 4NKGB 2EILB 4EB6B 3VQVA 2R72A 2YXLA 4YXWG 1XDCA 3P30A 1PNLA 4FLYA 4JYBA 2KG7A 4JI0O 1SQXH 1Q5OA 2CGNA 1D5NA 3IFXA 3K03A 3W7SA 4MVOA 2YIAA 5CA3A 5IWAO 4WFGA 3CCJV 3JCUZ 2RDCA 3CD6V 3CCEV 2LQTA 2Q7GA 4PA3A 2JEXA 5CA0A 4U7OA 2E75B 3K0DA 3AG4B 1S5HC 1NR1A 2PUSA 4DV2O 2EINB 4PDRA 5IE9A 4CS2A 2EBOA 2B1IA 2P06A 3CWBH 4XBFA 2M6YA 5B1BB 4FLZA 1AJNA 3C3TA 2DJVA 5LYJA 5JVDA 3ZJZA 2F43G 4UFZA 3K9AA 1IBLO 4JI3O 3JALB 4LFAO 4U7NA 2ZIOA 4LF7O 5JQGB 2E3CA 3GWOA 2V1DA 3ZHVA 5L3EA 3L9DA 3CRMA 1EBOA 4JASA 4O4JA 5IY5C 2Q7EA 1NQTA 1TVKB 2GSMB 4UCOA 5LHGA 3MD0A 4DXWA 2JGUA 4Z1MG 1Q90D 5KMGA 1BS3A 3ASNB 2Z5UA 4X65B 3T2MA 3JAWB 1YEWA 4H13B 1NR7A 2ZDIC 4X62O 3MHSC 3QF7A 5J2UB 3K06A 2IH3C 2N74A 2JGDB 3CJHB 5LA6B 1NBMG 4JV5B 1O9GA 4JTAB 3G67A 2CUGA 2IJKA 2A0LA 1SA0A 5CA1B 4LF9B 4FM2A 4R50A 2ADPA 1CPYA 1XMQO 4YJ2A 5LXTA 2UU9O 2ZR3A 1QR8A 1VQ7V 3Q4HA 1VQ4V 4Z1VA 3H9VA 4TSFG 5CBHA 4GKKB 1E79G 1ZWIC 4JI4B 4AQYO 4MS2A 1BSMA 1OCCC 1QNMA 3SPCA 3CE2A 2UUCO 3T1YO 4UV9A 1OV9A 4PV1B 4JI2O 1QBZA 5KA5A 1M57C 3RFRA 3BY6A 5A2QN 1N0JA 4ZHQA 1S5LZ 3ZHUA 2LJ2A 1BGYH 4AILC 4G2KA 2HP8A 4J7JA 2IU0A 4R6ZA 2Z3YA 2IJHA 2Y4UA 2Q0AA 3QO5A 3H1HH 4OGQB 2HFEC 4ICGA 4X64O 4RQFA 4X88A 4LF5B 1YVWA 3RYIA 4J7ZA 3CMAV 4X9QA 3ABLB 5IT9N 2DYSC 4KP4A 4DR2O 4PD4F 1Z5VA 4O4LA 1D2DA 3KZIZ 3H01A 2IU3A 3J7AU 4O4IB 2PZSA 3CRAA 1GM8A 2BTQB 3F7YC 5LMUO 1VQ9V 2LFRA 4B3MO 3K59A 3E8HA 1Y67A 4ZKIA 2ADQB 1KBHA 1R3IC 4DV5O 2WLHA 1K97A 4JI5O 4G28B 4QIWF 3QG5A 3K04A 5BY1A 2DQ3A 3SR2C 4LP8A 5KA6A 1YDXA 4K35A 1V9PA 4MW8A 1KP2A 1ZL8B 3L73H 3ZIAG 1VQKV 3CYOA 1N33O 2A79B 4DUYB 4JI6O 2ZNIA 3UCSC 3ASOC 3THOA 1KP3A 3TXSA 3HKCB 1FXKB 1SZTA 2ZD9A 2YEVA 5BMVB 4P9PA 3DGEA 3BAAA 3JASA 4BW5A 2KKWA 3AK3A 3A0BZ 4LF6O 2L35A 2WLKA 4FM1A 4J11A 5H2FZ 1Q6HA 2KQXA 4TUYA 1QCEA 1F4NA 1JX9A 1M90W 2F95B 2XAJA 4PJ0Z 5C93A 2LW1A 2OIGA 3ETGA 4LH6A 5KHJA 4U3JB 3HKDB 4X1YB 1MSWD 1S72V 4X1KB 2VWJA 1U96A 4JI3B 4DK1A 2WLIA 1NTZH 3E83A 1AI4A 4J41A 2P4KA 5B1NA 5H6RA 5JWPA 2EIKC 4GCZA 3WG7B 1F23A 4MSWC 2P5OA 2QWOB 1FS0G 4DV7B 2JRIA 2ZM6B 2OCHA 3JD0A 3E8FA 4X8AA 3B09A 5B3SC 2CAZC 1UJWB 4GX0A 5EBLC 1K34A 1PP9H 2LFSA 4IYIA 2IW5A 4NYKA 1XOUA 3M8AA 5IYCO 2BTOA 4O2BB 1R3LC 4X62B 2JEUA 3L70H 2YUAA 4B3SO 5LHHA 5DEDA 4JI8O 1IBKB 1KMIZ 3FB6C 1L8DA 1JJOA 3AG2C 1P7GA 4QNHB 4H33A 2ILMA 3H1IH 4I50A 4BIZA 1Q81W 4I0XA 1XQ8A 2ODMA 2CH7B 2EJ7A 3BABA 1V55C 5K1PA 1I94O 3A0RA 1RSOB 5IJ9B 3JSLA 3BCCH 2UU9B 3DXRA 2QKCA 2Q68A 2CTQA 4CH4A 1YZBA 1T5EA 4LFCB 5FL7G 3O9OA 3T1CA 2F1MA 4KXRA 2F23A 2JJ2G 3W7UA 2EJRA 5EZYB 1BCCH 4CC5A 3SYQA 1LUVA 4JI2B 4NXMB 3ABMB 1BT8A 3GVMA 1GN3A 2CTWA 3TK1A 4UCTA 1KQSU 1JR9A 2B9ZA 3UT5B 1XL6A 2ZKOA 2X6CA 3JD3A 3RW0A 4DRXB 2EIMC 4LCUC 3AG1C 4AI8A 2UXDB 3G80A 3CRRA 4X20A 3MAQA 2CTPA 1K7DA 3U10A 2VWKA 1OCOC 5LHIA 2WLMA 1JOYA 4E4EA 4EFBA 3J80N 3LSQA 1N32B 4AHCA 1QLNA 1KYOF 4QE9A 3ABUA 1SQPH 5JJJB 1FPOA 1UPGA 3IC7A 5LMUB 2W6IG 2YIBA 2WA3A 4GT1A 1Y74A 4DYLA 2LGQA 1VF7A 2WLNA 2X6AA 3RT3C 3MHHC 2VQFO 1AROP 1JQ0A 3ETEA 2RN9A 2QM8A 5DM6V 3SJQC 1X59A 5CB4B 1XHZA 3ML0A 1K73W 4X65O 3SPGA 1HNZB 4RWUA 2EILC 1SZXA 3E2EA 4JYAB 1Z5WA 1SF9A 2Y69B 3BEHA 1PM9A 3JAMN 4CC6A 2AXTZ 3K57A 1OCZC 1WA8A 2YXYA 3K58A 4BIUA 2WLLA 3K5NA 2YSUB 4GZRB 5KUKA 2ZT9B 1F51A 2ZINA 4WFBV 4MVQA 4L8JA 2HR3A 3AG4C 3AG7A 4WBNB 4MT8A 5LP6B 3RYCB 2QDOA 2VQEB 1SC5B 1N8RW 4GKKO 2OCCB 5KX5B 2EINC 2P67A 4PHZA 3BVOA 3KG2A 3A0HZ 1M5IA 3W7XA 5EC2C 2DW4A 2Q67A 2WPDG 3QNEA 4XDJA 5B1BC 1FYJA 1V54B 4F4LA 3K9SA 3L72H 1M9NA 2V4DA 1AR5A 3J81N 5IJ0B 2XUMA 2GUZB 4IHJB 5EBMC 4TQDA 4LFBB 4XDKA 1K33A 1PPJH 3ABKB 4MW3A 1QLEC 3M7MX 4F6EA 3WFVA 5E79Z 4O4HB 3RVZA 3JATA 4NB5A 2WWWA 3N2KB 3TJTA 3CP1A 2P6JA 3P3PA 4MVRA 1AP6A 2BCCH 3FB8C 1TGOA 1W2BU 4JI8B 2D2CB 2Y48A 4Z2WA 1MZFA 2D3OW 2E74B 1AB3A 3ASNC 3OW2U 2R9RB 1XNQB 1QVGU 4JI7B 2A3QA 2XNDG 3CC2V 3CSXA 5FLXN 3KCXA 1FAFA 2IBZH 4QGPA 1W0KG 4MTOA 1AI7A 1JFFB 4LNUB 3A8TA 1QVFU 2NR5A 5IYZB 5B66Z 3CPWU 5EK0A 3RYFB 2FB5A 1PNKA 4UVCA 4NXNO 2DYRB 1XILA 2LW7A 1NT2B 3T4DA 5IYDO 3ZN0A 4UVAA 5L3FA 1YITV 1OCZB 3ETDA 4FLTA 2WA4A 4ZIBA 2EZPA 5GTIZ 1WB8A 2P22C 4JZ2A 2RMKB 1YF2A 4CH6A 2IJIA 1WAZA 2XAGA 3X2QB 1BQZA 1XMOO 1K8AW 4DUYO 2WLJA 4IIJB 4KHPO 1NH2B 3CMEV 1Q86W 3N2GA 3OR7C 2XASA 1SKVA 2Q9LA 3OUSA 2KG7B 1Q82W 4YIOA 2ZIMA 1Q7YW 3VQXA 1NS1A 5E1AC 3TCUA 2QTOA 3ZHRA 3FX7A 4U3FH 1SQVH 2UXNA 3HPLC 3K0GA 2QM7A 5CA0B 4I9WA 1KC8W 4W4KA 1QLEB 3ABLC 3S3XA 1XHXA 4UVBA 4JPRA 5EYPA 1H8HG 2E76B 1KKDA 3D36A 1PV0A 5J9PC 4DV7O 2VQFB 2GDSA 4NTYA 2ZM6O 3SDLA 3ZMSA 1JCHA 1Q6UA 5JCOA 3AEIA 2EX3A 1H2SB 1NI8A 2NN4A 1OJHA 2DN9A 1HDJA 5JVDB 5LYJB 2VS0A 3CC7V 4PDMA 5DECA 3WB2A 3OD4A 3B8NA 1XI1A 2ITDC 1P4RA 1URFA 3K5LA 1MSDA 3BA9A 4WCEV 4JI1B 1IBKO 2UXBB 1K4CC 1VF5B 4O2AA 2ZQMA 4O4JB 4B3TB 1ZUQA 4BW9A 4FJCC 4N21A 5KMGB 3RYHA 4TV8A 1FXKC 4LFCO 3RWRD 1BMFG 1X4TA 3ZHQA 1H2GA 1SERA 1HWYA 2QKAA 1BHAA 3EHBB 1JJ2U 3B2EE 4NXMO 2PI4A 1SA0B 5JH7A 4FFBA 2FTKA 1N0NA 1M93A 3EXAA 3W7WA 4HZ3A 4YJ2B 3EFFK 4R7CA 5LXTB 1K3EA 1ORQC 3AG3B 2BSKA 5BR8O 3Q4HB 2R9AA 3G71V 4GX1A 3WG7C 2UXDO 2X0LA 1SETA 4DV4B 1R6TA
chains in the Genus database with same CATH topology
1B6QA 2JEUA 5L3DA 5LHHA 2V7QG 3AG3C 3OFNG 4WFHA 2ZXWB 3FB6C 4QNHB 3AG2C 2QA4V 4H33A 4BIZA 4R8CA 1Q81W 4KUMA 3JCZA 1V55C 4JGSA 3A0RA 2P7TC 1FFTB 2UXXA 4XDLA 1R3KC 1KECA 1R6KA 5L3GA 2ZDIA 1PNMA 1P7BA 1VQMV 2Q68A 1I5YA 4QE7A 3ZRWB 4PA7A 2ZXWC 3G6EV 3STLC 1NKDA 2XAFA 1VQ5V 5FL7G 3DTUB 1QR9A 5B1AB 2QKSA 3T1CA 4OXSA 2XAQA 3ZRXA 4E2LA 1OHHG 2JJ2G 1S0VA 3W7UA 2EJRA 3OAAG 1VQLV 4JAVA 3SYQA 2EIMB 3OEEG 3ABMB 4FIPC 2HG5C 1JPXA 3AG1B 3OMIB 4LC1A 1NJIW 1Y4MA 2LP7A 3TK1A 3JYCA 4RQEA 3SYPA 1OCRB 2QEXV 2JJ1G 2K1EA 1KQSU 1RPRA 4FMTA 5B1AC 3OUFA 1GMGA 4FK5C 5L3BA 1SRYA 1XL6A 4JYCA 3FKSG 1OCOB 1CEZA 1WLEA 1K92A 3QO7A 2X6CA 3JD3A 3RW0A 5H6QA 2EIMC 3M99B 3ABMC 4LCUC 3AG1C 1GO3F 4QPKA 3OEHG 1VQNV 1OCRC 1PD3A 1IXMA 5EBWC 4ZBMA 2EZOA 1K7DA 3I55V 2EIJB 4BAYA 2QE7G 1OCOC 1VQ8V 3T4ZA 5LHIA 3FB5C 2WLMA 3ABTA 5BZBA 3CCSV 1JOYA 4UV8A 3ZRSA 3K08A 3GB7C 3JD1A 3CCLV 3LSQA 3ZMVA 2C2AA 4JTDB 1W0JG 3ZMTA 1I5XA 1QLNA 4QE9A 3ABUA 3JD4A 3R65A 1VQOV 3ZMUA 5LBQA 3SPJA 5H9CA 3IC7A 2PI5A 3OE7G 2W6IG 4RO2A 4L87A 3UKMA 2EIJC 3LSSA 5IDJA 3FB7C 1CP9A 2YEVB 1E1QG 4GT1A 4QPJA 1DF4A 3E35A 2XOKG 4Q20A 4EKWA 2EILB 2WLNA 3NXSA 2X6AA 4PDLA 1GKFA 3MHHC 1THZA 4YXWG 3P30A 1AROP 1JQ0A 3ETEA 1PNLA 5CBGA 2QM8A 4JYBA 5DM6V 2ATKC 1EFRG 3W7SA 3IFXA 3K03A 3SJQC 4MVOA 4CBCA 5CA3A 3OR6C 3ML0A 2JIZG 4G27B 1K73W 3SPGA 2EILC 4WFGA 3LDCA 3CCUV 1AJQA 2HJFC 1OZ0A 3CCJV 2BOBC 1NVPB 3E2EA 2WLIB 3CD6V 2WAMA 5IYBO 1SESA 3CCEV 2Y69B 3BEHA 4PA3A 2JEXA 1DTOA 3OGCC 4H37A 2ITCC 4U7OA 4TT3G 3K0DA 3AG4B 2DWDC 1FXHA 1OCZC 1S5HC 1NR1A 4RUEA 1RM1B 2AHZA 1R73A 2EINB 1LNQA 3FYIB 4WF9V 4BIUA 2WLLA 4PDRA 2YSUB 3VOUA 1AR1B 5KUKA 2EBOA 2Y69C 2B1IA 4P2ZA 1F51A 4XBFA 4WFBV 4MVQA 4X89A 5B1BB 4PELA 3SYCA 2HR3A 3SYAA 3AG4C 2GHYA 5HFMA 4MT8A 1AJNA 4UUJC 1RM1C 1N8RW 2OTJV 2OCCB 1GM7A 2EINC 2P67A 3ZJZA 5L3CA 2F43G 3KG2A 2NNUA 1COWG 3SYOA 3W7XA 3K9AA 4I5SA 1AJPA 2DW4A 5EC2C 2Q67A 5IY5B 2WPDG 2P90A 3QNEA 4U7NA 1AI6A 2M7WA 4XDJA 5B1BC 1V54B 3RBZA 4ASUG 4F4LA 3GWOA 1TUEB 1M9NA 4GX2A 2V1DA 2OCCC 5L3EA 1FXKA 2HVKC 5EBMC 1S77D 1EBOA 4JF3A 5LGNA 4JASA 5IY5C 1NQTA 1K33A 1DF5A 1MOFA 2GSMB 4XDKA 3ABKB 4MW3A 1QLEC 1V54C 5LHGA 3MD0A 3WFVA 4DXWA 4Z1MG 3RVZA 3B77A 3ASNB 2Z5UA 5EC1C 2WWWA 1NVPD 3T2MA 1S76D 1M1KW 5DN6G 1NR7A 2ZDIC 4WFFA 3CP1A 2P6JA 1M56B 3MHSC 4MVRA 4JAUA 3ZRVA 3FB8C 3K3WA 3K06A 1W2BU 2A9HA 2IH3C 2X7RB 3E86A 1EZJA 1Y66A 3ABKC 4MTGA 1NBMG 2Y48A 4JTAB 3CCQV 4RUFA 2BOCC 2D3OW 2IJKA 2A0LA 1L1FA 2Q69A 3ASNC 2JK5C 1YTFB 3OW2U 2R9RB 4R50A 1QVGU 1OCCB 2XNDG 1YI2V 1YIJV 3CC2V 4MVMA 1M56C 1CPYA 3VBBA 4CZZA 2ZR3A 1K9MW 2MK3A 1W0KG 4J9YB 1AI7A 1AI5A 1QR8A 4MTOA 5CMUA 1VQ7V 1QVFU 1M57B 4UXNA 3CPWU 3CCRV 1VQ4V 5EK0A 5CBHA 4TSFG 1PNKA 1BHBA 4TWKA 4UVCA 1E79G 1ZWIC 2DYRB 4MS2A 1OCCC 5KUMA 3ZN1A 3SPCA 3T4DA 1K4DC 4WFAV 3HB3B 3CXCU 4UV9A 5IYDO 3ZN0A 4UVAA 5L3FA 2W6JG 1YITV 1OCZB 1QBZA 3ETDA 5KA5A 1M57C 5B1OA 3BY6A 2EZPA 1K5SA 1RPOA 5GW7A 2OT5A 2DYRC 2IJIA 2XAGA 3JD2A 3X2QB 1K8AW 1WPXA 1MG1A 5CN0A 3RVYA 1S3JA 2WLJA 4WFEA 3CCVV 4G2KA 2DYSB 1NH2B 3F7VC 3CC4V 3CMEV 1Q86W 3OR7C 2IU0A 2XASA 1DLBA 4R6ZA 2Z3YA 3OUSA 2IJHA 3ZRWA 4MVZA 3QO5A 5CBFA 2HFEC 1Q82W 4PA9A 4RQFA 1ROPA 4PA4A 1Q7YW 4X88A 3SPIA 5E1AC 3X2QC 3CMAV 3TCUA 2CK3G 2QTOA 1FXVA 3ABLB 1VQ6V 2Q6AA 2DYSC 2OTLV 4KP4A 1F4MA 2UXNA 3H01A 2IU3A 2WSSG 3ZMZA 1YTFD 3HPLC 3K0GA 3FYEB 2QM7A 1BL8A 1GM8A 3ZCCA 4I9WA 3F7YC 1KC8W 1VQ9V 2LFRA 1YSCA 4HYOA 3G4SV 1QLEB 3ABLC 4DO2A 3E8HA 2W0FC 1YJNV 4MTXA 4UVBA 4N23A 3UM7A 4ZKIA 4JPRA 1H8HG 4J9ZB 1YHQV 2WLLB 1J95A 1KKDA 3D36A 5J9PC 1R3IC 3E8GA 2B1GA 3ZMSA 1VQPV 2WLHA 1JCHA 3F5WC 1K97A 3TETA 3LNMB 3AEIA 4G28B 4QIWF 4HAMA 3ASOB 2X6BA 3K04A 2DQ3A 1E1RG 4LP8A 5KA6A 3CC7V 4MTFA 4PDMA 1H38A 4MW8A 1KP2A 3B8NA 3IGAC 1VQKV 2ITDC 1P4RA 3CYOA 3ZIAG 1YJWV 3I56V 2A79B 1H8EG 3E8BA 1GK9A 3ASOC 4WCEV 3LDDA 1KP3A 1NH2D 1K4CC 3CCMV 1FXKB 1SZTA 2ZD9A 2H8PC 2YEVA 3SPHA 3P32A 4P9PA 3DGEA 1R3JC 4JTCB 4BW5A 2ZQMA 2WLKA 1MABG 4FJCC 4GX5A 1JVMA 4N21A 1GTOA 3OMAB 1QCEA 2AHYA 1GM9A 1KD1W 1F4NA 2EIKB 1PL0A 1JX9A 4MVUA 1M90W 2H94A 2R9IA 2HKOA 2XAJA 1K5QA 1FXKC 2IH1C 1BMFG 2IJJA 4MVSA 1YJ9V 1H2GA 5C93A 1SERA 1HWYA 3B8MA 3E89A 2DWEC 5HFLA 5LGTA 3ETGA 4P30A 3QO8A 1MSWD 2KB1A 1S72V 1BHAA 3PJSK 5B3SB 2WLIA 3E83A 1AI4A 3EHBB 1JJ2U 3LDEA 2HVJC 5B1NA 4PDVA 5H6RA 3STZC 2PI4A 2XAHA 2EIKC 4GCZA 2FTKA 2B5UA 3WG7B 1F23A 2NLJC 4KFMA 4MSWC 2HLDG 3D3IA 1FS0G 4HZ3A 1R6NA 4P9OA 3W7WA 3EFFK 4R7CA 3OM3B 1K3EA 3K79A 1ENVA 1PKXA 3JD0A 4QJFB 3E8FA 1ORQC 3AG3B 4RAIA 4X8AA 5B3SC 1UJWB 1XL4A 3G71V 1G8MA 4GX1A 4FPPA 4GX0A 5EBLC 3LUTB 1K34A 3W7TA 3AG2B 2DQ0A 2ZR2A 4LBEC 4PA6A 5LGUA 3WG7C 1G4YB 2LFSA 2X0LA 1SETA 2IW5A 3OMNB 5IYCO 2JDIG 1V55B 1R3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9Z B;  2WLL B;  4EKW A;  3FB8 C;  1J95 A;  3K06 A;  1KKD A;  2A9H A;  2WLN A;  2IH3 C;  3AG3 C;  2X6A A;  3E86 A;  4PDL A;  4WFH A;  5J9P C;  1R3I C;  3E8G A;  3ABK C;  4MTG A;  5CBG A;  3FB6 C;  4JTA B;  2WLH A;  3AG2 C;  4RUF A;  3F5W C;  4QNH B;  2BOC C;  4H33 A;  2ATK C;  3LNM B;  4G28 B;  2A0L A;  4R8C A;  3TET A;  3IFX A;  2Q69 A;  3K03 A;  3ASN C;  2X6B A;  4MVO A;  3K04 A;  2JK5 C;  3SJQ C;  4CBC A;  2R9R B;  4LP8 A;  4R50 A;  1V55 C;  3OR6 C;  4MTF A;  4PDM A;  2P7T C;  4MVM A;  1M56 C;  4G27 B;  4XDL A;  1R3K C;  3SPG A;  2EIL C;  4MW8 A;  4WFG A;  1P7B A;  3LDC A;  2HJF C;  4J9Y B;  4MTO A;  2Q68 A;  2BOB C;  4QE7 A;  2WLI B;  4PA7 A;  2ZXW C;  3IGA C;  2ITD C;  3BEH A;  4PA3 A;  5EK0 A;  3STL C;  5CBH A;  2A79 B;  3E8B A;  3OGC C;  4H37 A;  2ITC C;  4TWK A;  3ASO C;  1ZWI C;  3LDD A;  3K0D A;  2QKS A;  2DWD C;  4MS2 A;  3T1C A;  1OCC C;  1OCZ C;  1K4C C;  1S5H C;  4OXS A;  4RUE A;  5KUM A;  3SPC A;  3T4D A;  3SPH A;  1K4D C;  2H8P C;  2ZD9 A;  2YEV A;  2AHZ A;  4P9P A;  1LNQ A;  1R3J C;  3SYQ A;  4JTC B;  4BW5 A;  2WLL A;  4PDR A;  3VOU A;  2WLK A;  5KUK A;  1M57 C;  2HG5 C;  2Y69 C;  4GX5 A;  4P2Z A;  3JYC A;  1JVM A;  4MVQ A;  4X89 A;  3SYP A;  2AHY A;  2K1E A;  5B1A C;  3SYC A;  3SYA A;  3OUF A;  3AG4 C;  2DYR C;  4MVU A;  4UUJ C;  4MVS A;  2IH1 C;  1XL6 A;  3RVY A;  2WLJ A;  2EIN C;  4WFE A;  3E89 A;  3ZJZ A;  2DWE C;  2X6C A;  3RW0 A;  3KG2 A;  3F7V C;  4P30 A;  3SYO A;  2EIM C;  5EC2 C;  2KB1 A;  2Q67 A;  3ABM C;  3OR7 C;  4LCU C;  4R6Z A;  3AG1 C;  3PJS K;  3OUS A;  2WLI A;  3E83 A;  4MVZ A;  4XDJ A;  5CBF A;  2HFE C;  3LDE A;  2HVJ C;  1OCR C;  5B1B C;  4PA9 A;  4PDV A;  4PA4 A;  4ZBM A;  3STZ C;  5EBW C;  3RBZ A;  4F4L A;  2EIK C;  4X88 A;  3SPI A;  5E1A C;  3X2Q C;  3TCU A;  4GX2 A;  4KFM A;  2NLJ C;  2OCC C;  2QTO A;  1OCO C;  4MSW C;  3T4Z A;  3FB5 C;  4HZ3 A;  2Q6A A;  2DYS C;  2HVK C;  2WLM A;  3EFF K;  4P9O A;  4R7C A;  5BZB A;  5EBM C;  3ZRS A;  3K08 A;  3GB7 C;  3E8F A;  1ORQ C;  5IY5 C;  4RAI A;  3HPL C;  4X8A A;  5B3S C;  4JTD B;  3K0G A;  4XDK A;  1XL4 A;  4GX1 A;  4GX0 A;  5EBL C;  4MW3 A;  1QLE C;  4QE9 A;  3LUT B;  1BL8 A;  1V54 C;  3R65 A;  4DXW A;  4PA6 A;  4LBE C;  3RVZ A;  4I9W A;  3F7Y C;  1G4Y B;  3SPJ A;  3WG7 C;  4RO2 A;  4HYO A;  5EC1 C;  3UKM A;  2EIJ C;  3T2M A;  3FB7 C;  3ABL C;  3E8H A;  2W0F C;  1R3L C;  3UM7 A;  4WFF A;  4MVR A; 
#chains in the Genus database with same CATH topology
 1B6Q A;  2ZCE A;  5L3D A;  1R1B A;  2V7Q G;  1H2L A;  2ZXW B;  4ZHQ B;  1CXZ B;  1N32 O;  4KUM A;  4B7K A;  4JGS A;  2P7T C;  3WB1 A;  1KEC A;  1R6K A;  1RFY A;  5L3G A;  2ZDI A;  1PNM A;  4FZ1 A;  1P7B A;  1VQM V;  4QE7 A;  5ITZ A;  2H3O A;  4NXN B;  3RYI B;  3JAR B;  2Q7H A;  5EIB C;  1S0V A;  1KKC A;  3OAA G;  5KHK A;  4O4L B;  4HBN A;  3OEE G;  1Q43 A;  4D7T A;  3ICX A;  4YY3 B;  4TQF A;  1JPX A;  1ZLZ A;  4LC1 A;  4A5U B;  1HNZ O;  1GN6 A;  1Y4M A;  2LP7 A;  3H1K H;  3JYC A;  1NTM H;  1OCR B;  2QEX V;  4JYA O;  1RPR A;  4FMT A;  2Q8V A;  3BRC A;  5L3B A;  1XMO B;  1S5J A;  1HNW B;  4JYC A;  4KHP B;  3B4S A;  3CEI A;  5H6Q A;  3CS5 A;  3DC6 A;  3ABM C;  2QWP B;  4GKJ B;  4ZI7 A;  3KKY A;  4ZBM A;  5EBW C;  1QU7 A;  1F7Y A;  1VAR A;  2EIJ B;  1VQ8 V;  2VQE O;  4UV8 A;  1BQ0 A;  1BE3 H;  3R66 A;  4FVM A;  3JD1 A;  2ARH A;  3CCL V;  2UUB O;  5EIB D;  3ZMT A;  4I9Q A;  4PI2 A;  1I5X A;  3FFQ A;  4YIP A;  3JD4 A;  4RO2 A;  3UKM A;  3LSS A;  3HKB A;  2YEV B;  1HR0 O;  4QPJ A;  3E35 A;  3JAS B;  2LGW A;  4EKW A;  4YJ3 A;  4LR3 A;  4TV9 A;  1GKF A;  1WJZ A;  1U97 A;  5CBG A;  4TUY B;  2ATK C;  1EFR G;  4LFB O;  2YS8 A;  4CBC A;  2PGG A;  2HEP A;  4EFE A;  2JIZ G;  1WP8 A;  2L6L A;  1HW7 A;  2HJF C;  1NVP B;  2WLI B;  3QTC A;  2WAM A;  5IYB O;  1IZ3 A;  1DTO A;  3OGC C;  4H37 A;  1NTK H;  4TT3 G;  5IJ9 A;  1FXH A;  4RUE A;  1US6 A;  1WPB A;  1RM1 B;  1L0N H;  2AHZ A;  5LMN B;  1LNQ A;  3FYI B;  1XNQ O;  4JI7 O;  3O65 A;  3VOU A;  1AR1 B;  2Y69 C;  1WN7 A;  4P2Z A;  2CE4 A;  3JAK A;  4UCU A;  2FML A;  4PEL A;  3SYC A;  3SYA A;  4UUJ C;  2OTJ V;  5FPR A;  5GON A;  4X1I A;  4HNA A;  4IT5 A;  5L3C A;  1EM1 A;  2F93 B;  1COW G;  3SYO A;  1SQF A;  2Y0P A;  1AJP A;  3CB2 A;  3T1H B;  4GUN A;  3HR0 A;  2P90 A;  1AI6 A;  2M7W A;  4I0X B;  3BFR A;  3RBZ A;  1O9H A;  2YIC A;  4ASU G;  1TUE B;  5LP6 C;  4GX2 A;  4NTX A;  1L0L H;  2OCC C;  4DUZ B;  3DXR B;  1S77 D;  4JF3 A;  2W0X A;  5BR8 B;  1V54 C;  2BE3 A;  2PY5 A;  1FFX A;  3B77 A;  3UO2 A;  4LF8 O;  5D5Q A;  1P49 A;  1S76 D;  1M1K W;  4UCV A;  1ZAU A;  4DV0 B;  1M56 B;  4JAU A;  3ZHT A;  1EN4 A;  3K3W A;  2A9H A;  5KHG A;  5JJN B;  4H0L B;  3ABK C;  4MTG A;  4RUF A;  4DV6 B;  2BOC C;  4LH7 A;  1VF6 C;  1AR4 A;  2JK5 C;  1YTF B;  1IDS A;  3L71 H;  3K5O A;  2E5L B;  4JYY A;  4KL1 A;  1XUQ A;  1YI2 V;  4MVM A;  3H1L H;  2RNB A;  3A2F A;  3U11 A;  4DV3 O;  1BZK A;  4X20 B;  3F5T A;  3G6B A;  5LOV A;  3D3Q A;  3S3W A;  5F2V O;  5KUM A;  5FNV A;  3ZN1 A;  4WFA V;  3HB3 B;  1ZX3 A;  4FZ0 A;  2W6J G;  2N05 A;  3DSQ A;  1K5S A;  5GW7 A;  1EZV H;  1VMG A;  2QWQ B;  2DMX A;  3SJA C;  3FAV A;  2DYR C;  1MG1 A;  1Y74 B;  4JI1 O;  4ZOL A;  2UXB O;  3F7V C;  3CC4 V;  1SQG A;  1DLB A;  3HKE A;  2QWR B;  3ZRW A;  5CBF A;  1Y76 A;  3CXH F;  4D6T H;  4B3T O;  4PA9 A;  1P84 F;  3SPI A;  2CTR A;  3E22 A;  1Q6I A;  3X2Q C;  2UUA B;  1FXV A;  2XTA A;  3TGU H;  1VQ6 V;  4LWS A;  1TUB A;  4TOI A;  2Q6A A;  2OTL V;  2CGO A;  2XHB A;  1F4M A;  2WSS G;  4UB8 Z;  3FYE B;  4I4T A;  2UUB B;  2PYJ A;  2FL4 A;  1BL8 A;  4HYO A;  4J7K A;  3OTO O;  1WA8 B;  5J2T A;  1HR0 B;  1YJN V;  3UM7 A;  2WLL B;  5KAF Z;  1Z2G A;  4B3R B;  3L75 H;  2B1G A;  4UB6 Z;  2DOS A;  2HJD A;  4BWA A;  3TET A;  4K0K B;  1E1R G;  4F6R A;  2A06 H;  3AK2 A;  4MTF A;  1JA8 A;  1MZE A;  4DV4 O;  1MA1 A;  1H38 A;  2YDE A;  1VP7 A;  5C8Y A;  3CRQ A;  1YJW V;  1H8E G;  1GK9 A;  3WU2 Z;  1NH2 D;  1GRJ A;  1H2M A;  4I55 A;  3CCM V;  3SPH A;  2H8P C;  3P32 A;  4NVP A;  4J42 A;  1DGS A;  1NU1 H;  4EB6 A;  4GX5 A;  3RN4 A;  1LR1 A;  3GWK C;  4B08 A;  1IBM O;  3OMA B;  3D8C A;  2AHY A;  1GM9 A;  1KD1 W;  3JAT B;  2R9I A;  3BHP A;  2HKO A;  1JMK C;  2IH1 C;  4YHH B;  4DR4 B;  5K1X A;  3B8M A;  2OIE A;  3E89 A;  2DWE C;  5HFL A;  3ETQ A;  4P30 A;  2PF4 E;  2GTA A;  3QO8 A;  4C7U A;  1EN5 A;  3N27 A;  3PJS K;  4DR3 B;  2RQ6 A;  5AG2 A;  3LDE A;  2HVJ C;  1FD9 A;  4DV1 B;  2XAH A;  4YY3 O;  2B5U A;  4FLX A;  1W59 A;  2NLJ C;  1J5E O;  3D3I A;  1B3Q A;  3PN1 A;  3OM3 B;  3K79 A;  1HNW O;  4QJF B;  1GN2 A;  1RP3 B;  1Y6X A;  4EEQ A;  1XL4 A;  2ZE6 A;  1G8M A;  4FPP A;  2ZE8 A;  1SS3 A;  3LUT B;  3W7T A;  4IGG A;  2ZR2 A;  4LBE C;  4GKJ O;  4LF8 B;  3OMN B;  1PL0 A;  2AW9 A;  3OTF A;  2GBO A;  3AG3 C;  3OFN G;  2RCV A;  1Q8I A;  1WP7 A;  4UCR A;  3JAL A;  2QA4 V;  5JQG A;  2QTS A;  1DK1 A;  2YC0 A;  2N04 A;  1R3K C;  3N2G B;  4CH5 A;  1I5Y A;  4DV3 B;  4PA7 A;  2ZXW C;  2YID A;  3G6E V;  1TVK A;  3STL C;  1NKD A;  4J80 A;  5LL6 Y;  1GH6 A;  4DW1 A;  5B1A B;  2QKS A;  3ZS8 C;  3ZRX A;  3JAW A;  1VQL V;  3DC5 A;  2UXC B;  3SJB C;  5J2U A;  2JGD A;  3CJH A;  4LF4 B;  5LA6 A;  1NJI W;  4RQE A;  1MMM A;  2JJ1 G;  2K1E A;  3OUF A;  4FK5 C;  2JS5 A;  3JSN A;  2YI8 A;  1SRY A;  5CA1 A;  1NZ6 A;  4DR1 B;  1CEZ A;  1WLE A;  5EYP B;  3QO7 A;  1Q3E A;  1XNR B;  4K8Z A;  1H2N A;  2ZE5 A;  3M99 B;  2HHH B;  5LMN O;  1I08 A;  1GO3 F;  4QPK A;  1OCR C;  1SQB H;  4JAA A;  3CRC A;  5GTH Z;  3ZHS A;  5KHI A;  2QGN A;  5JJE B;  3ABT A;  1ZTE A;  3VQY A;  3GB7 C;  1VEW A;  2C2A A;  5KHH A;  1N36 B;  1ZSP A;  2QM4 A;  4UCS A;  3R65 A;  3T1H O;  1VQO V;  5H9C A;  5FPO A;  3C3S A;  2PI5 A;  2Y0I A;  3OE7 G;  1N34 B;  3B40 A;  2XT9 A;  4L87 A;  2EIJ C;  3OTO B;  3FB7 C;  4O2A B;  3LNN A;  1I7F A;  1E1Q G;  3ZX6 A;  2PTM A;  1DF4 A;  4DUZ O;  3NXS A;  4PDL A;  1THZ A;  5BXZ A;  1FKA O;  3WB0 A;  3RYH B;  1I0H A;  4TV8 B;  1HNX B;  2OYQ A;  3OR6 C;  4G27 B;  5TIS Z;  3LDC A;  3CCU V;  1AJQ A;  1OZ0 A;  2BOB C;  4DV0 O;  1SES A;  1FJG O;  4O4I A;  2Q0O C;  2ITC C;  5JH7 B;  4FFB B;  4DR6 B;  2BTQ A;  2DWD C;  3ZED A;  4DV6 O;  1R73 A;  4DR5 B;  4WF9 V;  2E5L O;  3IC9 A;  2BSK B;  3SJC C;  1QHT A;  2OWO A;  1YCI A;  4H44 B;  3JAR A;  1N4C A;  3BA8 A;  1IBM B;  4X89 A;  5HFM A;  2GHY A;  1RM1 C;  4X66 B;  2P4V A;  1GM7 A;  4OX9 B;  2NNU A;  4I5S A;  1ZL8 A;  5IY5 B;  4NR1 A;  2AZ2 A;  2QWN B;  3HKC A;  1VIB A;  1J5E B;  1FXK A;  2HVK C;  5BMV A;  1H2K A;  5A9G A;  2F4V O;  4JI0 B;  5ITZ B;  5LGN A;  1LUW A;  1MOF A;  1DF5 A;  2G38 A;  5IWA B;  2Q73 A;  4DR7 O;  4W4L A;  4K3A A;  5EC1 C;  1NVP D;  1KUQ A;  5DN6 G;  4WFF A;  2UUA O;  3ZRV A;  5KAI Z;  2X7R B;  3AK1 A;  4U3J A;  3HKD A;  4X1Y A;  2YI9 A;  3E86 A;  4J10 A;  1EZJ A;  1Y66 A;  4X1K A;  4FFK A;  3CCQ V;  1WB7 A;  2ETN A;  3CX5 F;  1WNS A;  1L1F A;  3C90 A;  2Q69 A;  4DV2 B;  1OCC B;  1YIJ V;  1M56 C;  3VBB A;  4CZZ A;  2CDY A;  1K9M W;  2MK3 A;  2QR4 A;  4J9Y B;  1AI5 A;  5CMU A;  4ZI7 B;  4BIO A;  3I5D A;  1M57 B;  4UXN A;  3CCR V;  3CHX A;  4B3R O;  1BHB A;  1AVM A;  4TWK A;  2Z0A A;  1K4D C;  2A7W A;  2YXH A;  4O2B A;  3CXC U;  1IBL B;  4K0K O;  2R70 A;  4LFA B;  4LF7 B;  4IL6 Z;  5B1O A;  1GAX A;  1RPO A;  2OT5 A;  3JD2 A;  3HKB B;  5B5E Z;  1PL4 A;  3L74 H;  1WPX A;  2CH7 A;  4GLX A;  5CN0 A;  3RVY A;  1S3J A;  4WFE A;  4JZG A;  3CCV V;  1RSO A;  2DYS B;  4NTW A;  3MDS A;  4YJ3 B;  4TV9 B;  4MVZ A;  2FKX A;  1ROP A;  4PA4 A;  4FLV A;  2CK3 G;  1IXB A;  2AZ0 A;  2RJZ A;  5EZY A;  1B06 A;  4YHH O;  4DR4 O;  3SGI A;  3ZMZ A;  1YTF D;  3IAY A;  2JS3 A;  3APO A;  4IYH A;  1KB9 F;  3ZCC A;  4DR3 O;  1YSC A;  1GN4 A;  1XMQ B;  3G4S V;  4I50 B;  4DV1 O;  4DO2 A;  2W0F C;  3UT5 A;  4MTX A;  4N23 A;  4J9Z B;  1YHQ V;  1AIL A;  1J95 A;  4DRX A;  3E8G A;  3JAK B;  4AQY B;  1VQP V;  3F5W C;  1XRE A;  1XBL A;  3LNM B;  1MNG A;  4HAM A;  3ASO B;  2UUC B;  2X6B A;  3T1Y B;  4BR6 A;  3U0Z A;  3P3N A;  5GON B;  1A32 A;  4X1I B;  3FD9 A;  4HNA B;  4D7S A;  2Q4P A;  3KCY A;  1AP5 A;  4CH3 A;  2YIB D;  1IUR A;  1G1X B;  2JVD A;  3IGA C;  1FJG B;  3I56 V;  3E8B A;  3EVK A;  5D5P A;  3LDD A;  2Y4T A;  1QQC A;  1HP8 A;  2FYU H;  1R3J C;  4JTC B;  4X64 B;  1MAB G;  3TXQ A;  1JVM A;  1GTO A;  1G6U A;  1FFX B;  2EIK B;  4PI0 A;  4MVU A;  4DR2 B;  4B7E A;  2H94 A;  4MVS A;  1K5Q A;  4CS4 A;  5CB4 A;  2IJJ A;  1YJ9 V;  1M4U A;  2QJ1 A;  5H5N A;  5LGT A;  2LO1 A;  2KB1 A;  5KLV H;  5B3S B;  2UXC O;  3OGI B;  4B3M B;  4PDV A;  3STZ C;  2EUL A;  4LF4 O;  1D5A A;  4KFM A;  2HLD G;  4FLU A;  1SQQ H;  1R6N A;  4P9O A;  2QSA A;  4DV5 B;  3QVN A;  1ENV A;  1PKX A;  4DR1 O;  2F4V B;  4JI5 B;  4RAI A;  2F66 C;  1XNR O;  5LOV B;  1XEQ A;  3NR7 A;  2HHH O;  3AG2 B;  4DR7 B;  2DQ0 A;  4PA6 A;  4GYC B;  5LGU A;  1G4Y B;  4WBN A;  5LP6 A;  5FNV B;  4K8X A;  4OPA A;  3RYC A;  4Q6G A;  4CS3 A;  2JDI G;  1V55 B;  1TAE A;  2KSD A;  5KX5 A;  1N33 B;  1UFI A;  2GV9 A;  4JI6 B;  4WFH A;  3RGB A;  4JV5 O;  2O57 A;  2PYL A;  4R8C A;  3FAV B;  1N36 O;  4LF9 O;  3JCZ A;  4ABM A;  4LF6 B;  1FFT B;  2UXX A;  4ZOL B;  4XDL A;  5IJ0 A;  1N34 O;  2GUZ A;  4IHJ A;  3UO3 A;  1TA8 A;  3K5M A;  3HKE B;  2MW2 B;  4OPH A;  3ZRW B;  1KU9 A;  1Y76 B;  2XAF A;  1VQ5 V;  2AGA A;  3DTU B;  3E22 B;  1QR9 A;  3ZBH A;  4JI4 O;  4O4H A;  1VF6 A;  4OXS A;  2XAQ A;  4LWS B;  1OHH G;  1TUB B;  4E2L A;  1HNX O;  3N2K A;  1IX9 A;  4JAV A;  2DE0 X;  2EIM B;  4I4T B;  4FIP C;  1YXB A;  2HG5 C;  3AG1 B;  3OMI B;  2Q5Z A;  3OT7 A;  3SYP A;  3UQ8 A;  3H1J H;  5B1A C;  1GMG A;  5J2T B;  4DR6 O;  3FKS G;  1OCO B;  1K92 A;  2IM9 A;  3IJ4 A;  4DW0 A;  4FM0 A;  2K9P A;  4DR5 O;  1JFF A;  4LNU A;  3APQ A;  5IYZ A;  3OEH G;  1VQN V;  3RYF A;  1PD3 A;  1IXM A;  2EZO A;  1IVS A;  4LF5 O;  3BPZ A;  1B04 A;  3I55 V;  2ZE7 A;  4F6R B;  4B3S B;  4BAY A;  2QE7 G;  2VRZ A;  4FLW A;  3T4Z A;  3FB5 C;  3VQW A;  5BZB A;  3CCS V;  4DK0 A;  2ZNJ A;  3ZRS A;  5C8Y B;  3K08 A;  3D36 C;  4X66 O;  3ZMV A;  4JTD B;  1W0J G;  4OX9 O;  5JCO C;  1I94 B;  3ZMU A;  5LBQ A;  3SPJ A;  4I55 B;  5IDJ A;  1CP9 A;  2GTS A;  1EN6 A;  4IIJ A;  4Q20 A;  2XOK G;  4I7Z B;  3LSU A;  4NKG B;  2EIL B;  4EB6 B;  3VQV A;  2R72 A;  2YXL A;  4YXW G;  1XDC A;  3P30 A;  1PNL A;  4FLY A;  4JYB A;  2KG7 A;  4JI0 O;  1SQX H;  1Q5O A;  2CGN A;  1D5N A;  3IFX A;  3K03 A;  3W7S A;  4MVO A;  2YIA A;  5CA3 A;  5IWA O;  4WFG A;  3CCJ V;  3JCU Z;  2RDC A;  3CD6 V;  3CCE V;  2LQT A;  2Q7G A;  4PA3 A;  2JEX A;  5CA0 A;  4U7O A;  2E75 B;  3K0D A;  3AG4 B;  1S5H C;  1NR1 A;  2PUS A;  4DV2 O;  2EIN B;  4PDR A;  5IE9 A;  4CS2 A;  2EBO A;  2B1I A;  2P06 A;  3CWB H;  4XBF A;  2M6Y A;  5B1B B;  4FLZ A;  1AJN A;  3C3T A;  2DJV A;  5LYJ A;  5JVD A;  3ZJZ A;  2F43 G;  4UFZ A;  3K9A A;  1IBL O;  4JI3 O;  3JAL B;  4LFA O;  4U7N A;  2ZIO A;  4LF7 O;  5JQG B;  2E3C A;  3GWO A;  2V1D A;  3ZHV A;  5L3E A;  3L9D A;  3CRM A;  1EBO A;  4JAS A;  4O4J A;  5IY5 C;  2Q7E A;  1NQT A;  1TVK B;  2GSM B;  4UCO A;  5LHG A;  3MD0 A;  4DXW A;  2JGU A;  4Z1M G;  1Q90 D;  5KMG A;  1BS3 A;  3ASN B;  2Z5U A;  4X65 B;  3T2M A;  3JAW B;  1YEW A;  4H13 B;  1NR7 A;  2ZDI C;  4X62 O;  3MHS C;  3QF7 A;  5J2U B;  3K06 A;  2IH3 C;  2N74 A;  2JGD B;  3CJH B;  5LA6 B;  1NBM G;  4JV5 B;  1O9G A;  4JTA B;  3G67 A;  2CUG A;  2IJK A;  2A0L A;  1SA0 A;  5CA1 B;  4LF9 B;  4FM2 A;  4R50 A;  2ADP A;  1CPY A;  1XMQ O;  4YJ2 A;  5LXT A;  2UU9 O;  2ZR3 A;  1QR8 A;  1VQ7 V;  3Q4H A;  1VQ4 V;  4Z1V A;  3H9V A;  4TSF G;  5CBH A;  4GKK B;  1E79 G;  1ZWI C;  4JI4 B;  4AQY O;  4MS2 A;  1BSM A;  1OCC C;  1QNM A;  3SPC A;  3CE2 A;  2UUC O;  3T1Y O;  4UV9 A;  1OV9 A;  4PV1 B;  4JI2 O;  1QBZ A;  5KA5 A;  1M57 C;  3RFR A;  3BY6 A;  5A2Q N;  1N0J A;  4ZHQ A;  1S5L Z;  3ZHU A;  2LJ2 A;  1BGY H;  4AIL C;  4G2K A;  2HP8 A;  4J7J A;  2IU0 A;  4R6Z A;  2Z3Y A;  2IJH A;  2Y4U A;  2Q0A A;  3QO5 A;  3H1H H;  4OGQ B;  2HFE C;  4ICG A;  4X64 O;  4RQF A;  4X88 A;  4LF5 B;  1YVW A;  3RYI A;  4J7Z A;  3CMA V;  4X9Q A;  3ABL B;  5IT9 N;  2DYS C;  4KP4 A;  4DR2 O;  4PD4 F;  1Z5V A;  4O4L A;  1D2D A;  3KZI Z;  3H01 A;  2IU3 A;  3J7A U;  4O4I B;  2PZS A;  3CRA A;  1GM8 A;  2BTQ B;  3F7Y C;  5LMU O;  1VQ9 V;  2LFR A;  4B3M O;  3K59 A;  3E8H A;  1Y67 A;  4ZKI A;  2ADQ B;  1KBH A;  1R3I C;  4DV5 O;  2WLH A;  1K97 A;  4JI5 O;  4G28 B;  4QIW F;  3QG5 A;  3K04 A;  5BY1 A;  2DQ3 A;  3SR2 C;  4LP8 A;  5KA6 A;  1YDX A;  4K35 A;  1V9P A;  4MW8 A;  1KP2 A;  1ZL8 B;  3L73 H;  3ZIA G;  1VQK V;  3CYO A;  1N33 O;  2A79 B;  4DUY B;  4JI6 O;  2ZNI A;  3UCS C;  3ASO C;  3THO A;  1KP3 A;  3TXS A;  3HKC B;  1FXK B;  1SZT A;  2ZD9 A;  2YEV A;  5BMV B;  4P9P A;  3DGE A;  3BAA A;  3JAS A;  4BW5 A;  2KKW A;  3AK3 A;  3A0B Z;  4LF6 O;  2L35 A;  2WLK A;  4FM1 A;  4J11 A;  5H2F Z;  1Q6H A;  2KQX A;  4TUY A;  1QCE A;  1F4N A;  1JX9 A;  1M90 W;  2F95 B;  2XAJ A;  4PJ0 Z;  5C93 A;  2LW1 A;  2OIG A;  3ETG A;  4LH6 A;  5KHJ A;  4U3J B;  3HKD B;  4X1Y B;  1MSW D;  1S72 V;  4X1K B;  2VWJ A;  1U96 A;  4JI3 B;  4DK1 A;  2WLI A;  1NTZ H;  3E83 A;  1AI4 A;  4J41 A;  2P4K A;  5B1N A;  5H6R A;  5JWP A;  2EIK C;  4GCZ A;  3WG7 B;  1F23 A;  4MSW C;  2P5O A;  2QWO B;  1FS0 G;  4DV7 B;  2JRI A;  2ZM6 B;  2OCH A;  3JD0 A;  3E8F A;  4X8A A;  3B09 A;  5B3S C;  2CAZ C;  1UJW B;  4GX0 A;  5EBL C;  1K34 A;  1PP9 H;  2LFS A;  4IYI A;  2IW5 A;  4NYK A;  1XOU A;  3M8A A;  5IYC O;  2BTO A;  4O2B B;  1R3L C;  4X62 B;  2JEU A;  3L70 H;  2YUA A;  4B3S O;  5LHH A;  5DED A;  4JI8 O;  1IBK B;  1KMI Z;  3FB6 C;  1L8D A;  1JJO A;  3AG2 C;  1P7G A;  4QNH B;  4H33 A;  2ILM A;  3H1I H;  4I50 A;  4BIZ A;  1Q81 W;  4I0X A;  1XQ8 A;  2ODM A;  2CH7 B;  2EJ7 A;  3BAB A;  1V55 C;  5K1P A;  1I94 O;  3A0R A;  1RSO B;  5IJ9 B;  3JSL A;  3BCC H;  2UU9 B;  3DXR A;  2QKC A;  2Q68 A;  2CTQ A;  4CH4 A;  1YZB A;  1T5E A;  4LFC B;  5FL7 G;  3O9O A;  3T1C A;  2F1M A;  4KXR A;  2F23 A;  2JJ2 G;  3W7U A;  2EJR A;  5EZY B;  1BCC H;  4CC5 A;  3SYQ A;  1LUV A;  4JI2 B;  4NXM B;  3ABM B;  1BT8 A;  3GVM A;  1GN3 A;  2CTW A;  3TK1 A;  4UCT A;  1KQS U;  1JR9 A;  2B9Z A;  3UT5 B;  1XL6 A;  2ZKO A;  2X6C A;  3JD3 A;  3RW0 A;  4DRX B;  2EIM C;  4LCU C;  3AG1 C;  4AI8 A;  2UXD B;  3G80 A;  3CRR A;  4X20 A;  3MAQ A;  2CTP A;  1K7D A;  3U10 A;  2VWK A;  1OCO C;  5LHI A;  2WLM A;  1JOY A;  4E4E A;  4EFB A;  3J80 N;  3LSQ A;  1N32 B;  4AHC A;  1QLN A;  1KYO F;  4QE9 A;  3ABU A;  1SQP H;  5JJJ B;  1FPO A;  1UPG A;  3IC7 A;  5LMU B;  2W6I G;  2YIB A;  2WA3 A;  4GT1 A;  1Y74 A;  4DYL A;  2LGQ A;  1VF7 A;  2WLN A;  2X6A A;  3RT3 C;  3MHH C;  2VQF O;  1ARO P;  1JQ0 A;  3ETE A;  2RN9 A;  2QM8 A;  5DM6 V;  3SJQ C;  1X59 A;  5CB4 B;  1XHZ A;  3ML0 A;  1K73 W;  4X65 O;  3SPG A;  1HNZ B;  4RWU A;  2EIL C;  1SZX A;  3E2E A;  4JYA B;  1Z5W A;  1SF9 A;  2Y69 B;  3BEH A;  1PM9 A;  3JAM N;  4CC6 A;  2AXT Z;  3K57 A;  1OCZ C;  1WA8 A;  2YXY A;  3K58 A;  4BIU A;  2WLL A;  3K5N A;  2YSU B;  4GZR B;  5KUK A;  2ZT9 B;  1F51 A;  2ZIN A;  4WFB V;  4MVQ A;  4L8J A;  2HR3 A;  3AG4 C;  3AG7 A;  4WBN B;  4MT8 A;  5LP6 B;  3RYC B;  2QDO A;  2VQE B;  1SC5 B;  1N8R W;  4GKK O;  2OCC B;  5KX5 B;  2EIN C;  2P67 A;  4PHZ A;  3BVO A;  3KG2 A;  3A0H Z;  1M5I A;  3W7X A;  5EC2 C;  2DW4 A;  2Q67 A;  2WPD G;  3QNE A;  4XDJ A;  5B1B C;  1FYJ A;  1V54 B;  4F4L A;  3K9S A;  3L72 H;  1M9N A;  2V4D A;  1AR5 A;  3J81 N;  5IJ0 B;  2XUM A;  2GUZ B;  4IHJ B;  5EBM C;  4TQD A;  4LFB B;  4XDK A;  1K33 A;  1PPJ H;  3ABK B;  4MW3 A;  1QLE C;  3M7M X;  4F6E A;  3WFV A;  5E79 Z;  4O4H B;  3RVZ A;  3JAT A;  4NB5 A;  2WWW A;  3N2K B;  3TJT A;  3CP1 A;  2P6J A;  3P3P A;  4MVR A;  1AP6 A;  2BCC H;  3FB8 C;  1TGO A;  1W2B U;  4JI8 B;  2D2C B;  2Y48 A;  4Z2W A;  1MZF A;  2D3O W;  2E74 B;  1AB3 A;  3ASN C;  3OW2 U;  2R9R B;  1XNQ B;  1QVG U;  4JI7 B;  2A3Q A;  2XND G;  3CC2 V;  3CSX A;  5FLX N;  3KCX A;  1FAF A;  2IBZ H;  4QGP A;  1W0K G;  4MTO A;  1AI7 A;  1JFF B;  4LNU B;  3A8T A;  1QVF U;  2NR5 A;  5IYZ B;  5B66 Z;  3CPW U;  5EK0 A;  3RYF B;  2FB5 A;  1PNK A;  4UVC A;  4NXN O;  2DYR B;  1XIL A;  2LW7 A;  1NT2 B;  3T4D A;  5IYD O;  3ZN0 A;  4UVA A;  5L3F A;  1YIT V;  1OCZ B;  3ETD A;  4FLT A;  2WA4 A;  4ZIB A;  2EZP A;  5GTI Z;  1WB8 A;  2P22 C;  4JZ2 A;  2RMK B;  1YF2 A;  4CH6 A;  2IJI A;  1WAZ A;  2XAG A;  3X2Q B;  1BQZ A;  1XMO O;  1K8A W;  4DUY O;  2WLJ A;  4IIJ B;  4KHP O;  1NH2 B;  3CME V;  1Q86 W;  3N2G A;  3OR7 C;  2XAS A;  1SKV A;  2Q9L A;  3OUS A;  2KG7 B;  1Q82 W;  4YIO A;  2ZIM A;  1Q7Y W;  3VQX A;  1NS1 A;  5E1A C;  3TCU A;  2QTO A;  3ZHR A;  3FX7 A;  4U3F H;  1SQV H;  2UXN A;  3HPL C;  3K0G A;  2QM7 A;  5CA0 B;  4I9W A;  1KC8 W;  4W4K A;  1QLE B;  3ABL C;  3S3X A;  1XHX A;  4UVB A;  4JPR A;  5EYP A;  1H8H G;  2E76 B;  1KKD A;  3D36 A;  1PV0 A;  5J9P C;  4DV7 O;  2VQF B;  2GDS A;  4NTY A;  2ZM6 O;  3SDL A;  3ZMS A;  1JCH A;  1Q6U A;  5JCO A;  3AEI A;  2EX3 A;  1H2S B;  1NI8 A;  2NN4 A;  1OJH A;  2DN9 A;  1HDJ A;  5JVD B;  5LYJ B;  2VS0 A;  3CC7 V;  4PDM A;  5DEC A;  3WB2 A;  3OD4 A;  3B8N A;  1XI1 A;  2ITD C;  1P4R A;  1URF A;  3K5L A;  1MSD A;  3BA9 A;  4WCE V;  4JI1 B;  1IBK O;  2UXB B;  1K4C C;  1VF5 B;  4O2A A;  2ZQM A;  4O4J B;  4B3T B;  1ZUQ A;  4BW9 A;  4FJC C;  4N21 A;  5KMG B;  3RYH A;  4TV8 A;  1FXK C;  4LFC O;  3RWR D;  1BMF G;  1X4T A;  3ZHQ A;  1H2G A;  1SER A;  1HWY A;  2QKA A;  1BHA A;  3EHB B;  1JJ2 U;  3B2E E;  4NXM O;  2PI4 A;  1SA0 B;  5JH7 A;  4FFB A;  2FTK A;  1N0N A;  1M93 A;  3EXA A;  3W7W A;  4HZ3 A;  4YJ2 B;  3EFF K;  4R7C A;  5LXT B;  1K3E A;  1ORQ C;  3AG3 B;  2BSK A;  5BR8 O;  3Q4H B;  2R9A A;  3G71 V;  4GX1 A;  3WG7 C;  2UXD O;  2X0L A;  1SET A;  4DV4 B;  1R6T A; 
#chains in the Genus database with same CATH homology
 1B6Q A;  2JEU A;  5L3D A;  5LHH A;  2V7Q G;  3AG3 C;  3OFN G;  4WFH A;  2ZXW B;  3FB6 C;  4QNH B;  3AG2 C;  2QA4 V;  4H33 A;  4BIZ A;  4R8C A;  1Q81 W;  4KUM A;  3JCZ A;  1V55 C;  4JGS A;  3A0R A;  2P7T C;  1FFT B;  2UXX A;  4XDL A;  1R3K C;  1KEC A;  1R6K A;  5L3G A;  2ZDI A;  1PNM A;  1P7B A;  1VQM V;  2Q68 A;  1I5Y A;  4QE7 A;  3ZRW B;  4PA7 A;  2ZXW C;  3G6E V;  3STL C;  1NKD A;  2XAF A;  1VQ5 V;  5FL7 G;  3DTU B;  1QR9 A;  5B1A B;  2QKS A;  3T1C A;  4OXS A;  2XAQ A;  3ZRX A;  4E2L A;  1OHH G;  2JJ2 G;  1S0V A;  3W7U A;  2EJR A;  3OAA G;  1VQL V;  4JAV A;  3SYQ A;  2EIM B;  3OEE G;  3ABM B;  4FIP C;  2HG5 C;  1JPX A;  3AG1 B;  3OMI B;  4LC1 A;  1NJI W;  1Y4M A;  2LP7 A;  3TK1 A;  3JYC A;  4RQE A;  3SYP A;  1OCR B;  2QEX V;  2JJ1 G;  2K1E A;  1KQS U;  1RPR A;  4FMT A;  5B1A C;  3OUF A;  1GMG A;  4FK5 C;  5L3B A;  1SRY A;  1XL6 A;  4JYC A;  3FKS G;  1OCO B;  1CEZ A;  1WLE A;  1K92 A;  3QO7 A;  2X6C A;  3JD3 A;  3RW0 A;  5H6Q A;  2EIM C;  3M99 B;  3ABM C;  4LCU C;  3AG1 C;  1GO3 F;  4QPK A;  3OEH G;  1VQN V;  1OCR C;  1PD3 A;  1IXM A;  5EBW C;  4ZBM A;  2EZO A;  1K7D A;  3I55 V;  2EIJ B;  4BAY A;  2QE7 G;  1OCO C;  1VQ8 V;  3T4Z A;  5LHI A;  3FB5 C;  2WLM A;  3ABT A;  5BZB A;  3CCS V;  1JOY A;  4UV8 A;  3ZRS A;  3K08 A;  3GB7 C;  3JD1 A;  3CCL V;  3LSQ A;  3ZMV A;  2C2A A;  4JTD B;  1W0J G;  3ZMT A;  1I5X A;  1QLN A;  4QE9 A;  3ABU A;  3JD4 A;  3R65 A;  1VQO V;  3ZMU A;  5LBQ A;  3SPJ A;  5H9C A;  3IC7 A;  2PI5 A;  3OE7 G;  2W6I G;  4RO2 A;  4L87 A;  3UKM A;  2EIJ C;  3LSS A;  5IDJ A;  3FB7 C;  1CP9 A;  2YEV B;  1E1Q G;  4GT1 A;  4QPJ A;  1DF4 A;  3E35 A;  2XOK G;  4Q20 A;  4EKW A;  2EIL B;  2WLN A;  3NXS A;  2X6A A;  4PDL A;  1GKF A;  3MHH C;  1THZ A;  4YXW G;  3P30 A;  1ARO P;  1JQ0 A;  3ETE A;  1PNL A;  5CBG A;  2QM8 A;  4JYB A;  5DM6 V;  2ATK C;  1EFR G;  3W7S A;  3IFX A;  3K03 A;  3SJQ C;  4MVO A;  4CBC A;  5CA3 A;  3OR6 C;  3ML0 A;  2JIZ G;  4G27 B;  1K73 W;  3SPG A;  2EIL C;  4WFG A;  3LDC A;  3CCU V;  1AJQ A;  2HJF C;  1OZ0 A;  3CCJ V;  2BOB C;  1NVP B;  3E2E A;  2WLI B;  3CD6 V;  2WAM A;  5IYB O;  1SES A;  3CCE V;  2Y69 B;  3BEH A;  4PA3 A;  2JEX A;  1DTO A;  3OGC C;  4H37 A;  2ITC C;  4U7O A;  4TT3 G;  3K0D A;  3AG4 B;  2DWD C;  1FXH A;  1OCZ C;  1S5H C;  1NR1 A;  4RUE A;  1RM1 B;  2AHZ A;  1R73 A;  2EIN B;  1LNQ A;  3FYI B;  4WF9 V;  4BIU A;  2WLL A;  4PDR A;  2YSU B;  3VOU A;  1AR1 B;  5KUK A;  2EBO A;  2Y69 C;  2B1I A;  4P2Z A;  1F51 A;  4XBF A;  4WFB V;  4MVQ A;  4X89 A;  5B1B B;  4PEL A;  3SYC A;  2HR3 A;  3SYA A;  3AG4 C;  2GHY A;  5HFM A;  4MT8 A;  1AJN A;  4UUJ C;  1RM1 C;  1N8R W;  2OTJ V;  2OCC B;  1GM7 A;  2EIN C;  2P67 A;  3ZJZ A;  5L3C A;  2F43 G;  3KG2 A;  2NNU A;  1COW G;  3SYO A;  3W7X A;  3K9A A;  4I5S A;  1AJP A;  2DW4 A;  5EC2 C;  2Q67 A;  5IY5 B;  2WPD G;  2P90 A;  3QNE A;  4U7N A;  1AI6 A;  2M7W A;  4XDJ A;  5B1B C;  1V54 B;  3RBZ A;  4ASU G;  4F4L A;  3GWO A;  1TUE B;  1M9N A;  4GX2 A;  2V1D A;  2OCC C;  5L3E A;  1FXK A;  2HVK C;  5EBM C;  1S77 D;  1EBO A;  4JF3 A;  5LGN A;  4JAS A;  5IY5 C;  1NQT A;  1K33 A;  1DF5 A;  1MOF A;  2GSM B;  4XDK A;  3ABK B;  4MW3 A;  1QLE C;  1V54 C;  5LHG A;  3MD0 A;  3WFV A;  4DXW A;  4Z1M G;  3RVZ A;  3B77 A;  3ASN B;  2Z5U A;  5EC1 C;  2WWW A;  1NVP D;  3T2M A;  1S76 D;  1M1K W;  5DN6 G;  1NR7 A;  2ZDI C;  4WFF A;  3CP1 A;  2P6J A;  1M56 B;  3MHS C;  4MVR A;  4JAU A;  3ZRV A;  3FB8 C;  3K3W A;  3K06 A;  1W2B U;  2A9H A;  2IH3 C;  2X7R B;  3E86 A;  1EZJ A;  1Y66 A;  3ABK C;  4MTG A;  1NBM G;  2Y48 A;  4JTA B;  3CCQ V;  4RUF A;  2BOC C;  2D3O W;  2IJK A;  2A0L A;  1L1F A;  2Q69 A;  3ASN C;  2JK5 C;  1YTF B;  3OW2 U;  2R9R B;  4R50 A;  1QVG U;  1OCC B;  2XND G;  1YI2 V;  1YIJ V;  3CC2 V;  4MVM A;  1M56 C;  1CPY A;  3VBB A;  4CZZ A;  2ZR3 A;  1K9M W;  2MK3 A;  1W0K G;  4J9Y B;  1AI7 A;  1AI5 A;  1QR8 A;  4MTO A;  5CMU A;  1VQ7 V;  1QVF U;  1M57 B;  4UXN A;  3CPW U;  3CCR V;  1VQ4 V;  5EK0 A;  5CBH A;  4TSF G;  1PNK A;  1BHB A;  4TWK A;  4UVC A;  1E79 G;  1ZWI C;  2DYR B;  4MS2 A;  1OCC C;  5KUM A;  3ZN1 A;  3SPC A;  3T4D A;  1K4D C;  4WFA V;  3HB3 B;  3CXC U;  4UV9 A;  5IYD O;  3ZN0 A;  4UVA A;  5L3F A;  2W6J G;  1YIT V;  1OCZ B;  1QBZ A;  3ETD A;  5KA5 A;  1M57 C;  5B1O A;  3BY6 A;  2EZP A;  1K5S A;  1RPO A;  5GW7 A;  2OT5 A;  2DYR C;  2IJI A;  2XAG A;  3JD2 A;  3X2Q B;  1K8A W;  1WPX A;  1MG1 A;  5CN0 A;  3RVY A;  1S3J A;  2WLJ A;  4WFE A;  3CCV V;  4G2K A;  2DYS B;  1NH2 B;  3F7V C;  3CC4 V;  3CME V;  1Q86 W;  3OR7 C;  2IU0 A;  2XAS A;  1DLB A;  4R6Z A;  2Z3Y A;  3OUS A;  2IJH A;  3ZRW A;  4MVZ A;  3QO5 A;  5CBF A;  2HFE C;  1Q82 W;  4PA9 A;  4RQF A;  1ROP A;  4PA4 A;  1Q7Y W;  4X88 A;  3SPI A;  5E1A C;  3X2Q C;  3CMA V;  3TCU A;  2CK3 G;  2QTO A;  1FXV A;  3ABL B;  1VQ6 V;  2Q6A A;  2DYS C;  2OTL V;  4KP4 A;  1F4M A;  2UXN A;  3H01 A;  2IU3 A;  2WSS G;  3ZMZ A;  1YTF D;  3HPL C;  3K0G A;  3FYE B;  2QM7 A;  1BL8 A;  1GM8 A;  3ZCC A;  4I9W A;  3F7Y C;  1KC8 W;  1VQ9 V;  2LFR A;  1YSC A;  4HYO A;  3G4S V;  1QLE B;  3ABL C;  4DO2 A;  3E8H A;  2W0F C;  1YJN V;  4MTX A;  4UVB A;  4N23 A;  3UM7 A;  4ZKI A;  4JPR A;  1H8H G;  4J9Z B;  1YHQ V;  2WLL B;  1J95 A;  1KKD A;  3D36 A;  5J9P C;  1R3I C;  3E8G A;  2B1G A;  3ZMS A;  1VQP V;  2WLH A;  1JCH A;  3F5W C;  1K97 A;  3TET A;  3LNM B;  3AEI A;  4G28 B;  4QIW F;  4HAM A;  3ASO B;  2X6B A;  3K04 A;  2DQ3 A;  1E1R G;  4LP8 A;  5KA6 A;  3CC7 V;  4MTF A;  4PDM A;  1H38 A;  4MW8 A;  1KP2 A;  3B8N A;  3IGA C;  1VQK V;  2ITD C;  1P4R A;  3CYO A;  3ZIA G;  1YJW V;  3I56 V;  2A79 B;  1H8E G;  3E8B A;  1GK9 A;  3ASO C;  4WCE V;  3LDD A;  1KP3 A;  1NH2 D;  1K4C C;  3CCM V;  1FXK B;  1SZT A;  2ZD9 A;  2H8P C;  2YEV A;  3SPH A;  3P32 A;  4P9P A;  3DGE A;  1R3J C;  4JTC B;  4BW5 A;  2ZQM A;  2WLK A;  1MAB G;  4FJC C;  4GX5 A;  1JVM A;  4N21 A;  1GTO A;  3OMA B;  1QCE A;  2AHY A;  1GM9 A;  1KD1 W;  1F4N A;  2EIK B;  1PL0 A;  1JX9 A;  4MVU A;  1M90 W;  2H94 A;  2R9I A;  2HKO A;  2XAJ A;  1K5Q A;  1FXK C;  2IH1 C;  1BMF G;  2IJJ A;  4MVS A;  1YJ9 V;  1H2G A;  5C93 A;  1SER A;  1HWY A;  3B8M A;  3E89 A;  2DWE C;  5HFL A;  5LGT A;  3ETG A;  4P30 A;  3QO8 A;  1MSW D;  2KB1 A;  1S72 V;  1BHA A;  3PJS K;  5B3S B;  2WLI A;  3E83 A;  1AI4 A;  3EHB B;  1JJ2 U;  3LDE A;  2HVJ C;  5B1N A;  4PDV A;  5H6R A;  3STZ C;  2PI4 A;  2XAH A;  2EIK C;  4GCZ A;  2FTK A;  2B5U A;  3WG7 B;  1F23 A;  2NLJ C;  4KFM A;  4MSW C;  2HLD G;  3D3I A;  1FS0 G;  4HZ3 A;  1R6N A;  4P9O A;  3W7W A;  3EFF K;  4R7C A;  3OM3 B;  1K3E A;  3K79 A;  1ENV A;  1PKX A;  3JD0 A;  4QJF B;  3E8F A;  1ORQ C;  3AG3 B;  4RAI A;  4X8A A;  5B3S C;  1UJW B;  1XL4 A;  3G71 V;  1G8M A;  4GX1 A;  4FPP A;  4GX0 A;  5EBL C;  3LUT B;  1K34 A;  3W7T A;  3AG2 B;  2DQ0 A;  2ZR2 A;  4LBE C;  4PA6 A;  5LGU A;  3WG7 C;  1G4Y B;  2LFS A;  2X0L A;  1SET A;  2IW5 A;  3OMN B;  5IYC O;  2JDI G;  1V55 B;  1R3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...