3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
4F4LA 2R9RB 4ZBMA 3UKMA 5B1AC 2WLJA 3FB8C 2EIKC 2QKSA 4I9WA 4J9YB 4RUEA 1XL4A 3E8GA 2KB1A 4MVMA 3AG3C 3SPHA 4JTAB 1LNQA 3E89A 2ZD9A 2AHYA 3LNMB 4X89A 2Q6AA 3HPLC 4OXSA 4R8CA 1R3IC 5EBWC 4PDMA 1V55C 3PJSK 4GX0A 5CBHA 2QTOA 2IH1C 4MVRA 3OUSA 1XL6A 4XDLA 2H8PC 1ZWIC 3OR6C 4HYOA 4MVSA 3KG2A 2Q68A 5KUMA 3FB6C 3OUFA 3FB5C 2X6BA 2EIMC 3IGAC 4MVUA 3SPGA 1S5HC 2Y69C 1BL8A 4GX5A 4X8AA 4G28B 4P30A 3AG4C 3STLC 2IH3C 3F7VC 3JYCA 3WG7C 1ORQC 3ABMC 3EFFK 3X2QC 1OCOC 2EILC 2NLJC 2Q67A 3ZRSA 4X88A 4PA6A 4J9ZB 2ZXWC 4MTFA 4PA3A 1KKDA 4PDLA 5CBGA 3LDDA 3RVZA 5EBLC 2HVJC 1OCRC 4RO2A 2X6AA 2DWEC 3T2MA 2EINC 2W0FC 4PDRA 4P9PA 3SYPA 4QNHB 4GX2A 2BOBC 3FB7C 4WFGA 3E8FA 4H37A 3TCUA 4BW5A 2WLLB 5B1BC 3RBZA 2WLNA 4MVQA 1G4YB 4CBCA 2WLIB 3AG1C 4GX1A 4XDKA 5EC2C 2HG5C 3T4DA 4DXWA 3K0GA 4RUFA 2Q69A 5E1AC 4EKWA 3RVYA 5IY5C 2A9HA 2JK5C 4LCUC 4P2ZA 3F5WC 3BEHA 5J9PC 4LBEC 4MTGA 3STZC 1V54C 3K08A 3RW0A 3T4ZA 3OR7C 1R3LC 3LUTB 4H33A 4RAIA 3ZJZA 2ATKC 1QLEC 3R65A 2A79B 4PA7A 2HJFC 4PA4A 4PDVA 4MTOA 4G27B 1K4CC 2HVKC 2OCCC 1R3KC 1R3JC 1P7BA 2WLMA 3LDEA 4LP8A 5KUKA 2WLKA 5BZBA 3F7YC 4UUJC 2WLHA 3ASNC 3GB7C 4HZ3A 3ABLC 4MS2A 3SYOA 2DYRC 3AG2C 1OCCC 3LDCA 3SJQC 4PA9A 4P9OA 4MVOA 4QE9A 3SYCA 5EC1C 3E8BA 4MSWC 3SYAA 3E83A 3SPJA 3K04A 2DYSC 3K03A 3TETA 5EBMC 5B3SC 2BOCC 4TWKA 4JTCB 4MW3A 2DWDC 4WFHA 3UM7A 2X6CA 3K06A 2ITCC 1M56C 1K4DC 2P7TC 1OCZC 2EIJC 2WLLA 3E8HA 4WFFA 4XDJA 3T1CA 3ASOC 4MW8A 3SPIA 5CBFA 2YEVA 5EK0A 3VOUA 4MVZA 1M57C 2WLIA 2A0LA 3SPCA 3OGCC 4KFMA 4WFEA 2AHZA 3E86A 1J95A 1JVMA 4R50A 4R7CA 4QE7A 2K1EA 2HFEC 4R6ZA 3IFXA 3SYQA 3ABKC 4JTDB 3K0DA 2ITDC
chains in the Genus database with same CATH superfamily
1E1RG 2P90A 5H6RA 3THOA 2BCCH 3H1LH 5IDJA 1W59A 5B1OA 2W6JG 5EIBD 3LNMB 2QDOA 4X89A 1AI7A 3JD0A 4GX0A 5CBHA 1MA1A 4KL1A 4MVRA 3H1HH 5HFLA 2RNBA 5IJ0A 4WFBV 3D3IA 3J80N 3CD6V 2X6BA 1FXHA 1AJQA 4N21A 2ZXWB 1W0JG 3JAWA 4LFCB 3CCSV 2EINB 1OCOC 1UPGA 2NLJC 3AK1A 3HR0A 5J2TA 4X88A 1KKDA 1QHTA 4B7EA 3ZN1A 5CBGA 3RVZA 5EBLC 4DV7B 1B3QA 5LHIA 5L3DA 1KD1W 1TUEB 3AG1B 2WSSG 1FXKA 4J7ZA 2RCVA 2DW4A 5C8YB 1AR1B 2BTQA 2Q69A 1FJGO 4I50A 3BRCA 1TVKA 4JI0O 1JJOA 3ZJZA 3ZHVA 2UXCB 4JI6B 1B6QA 3KCXA 4X62B 4B3MO 2WLMA 2Q7HA 5LGUA 2VS0A 1G8MA 1NI8A 4YHHO 3A0BZ 2N04A 3ZHSA 4HAMA 3BY6A 5K1PA 3AK2A 1Q8IA 3SPJA 2CE4A 1HP8A 1WA8A 4O4HA 4MW3A 2GHYA 2ZT9B 1VF7A 5FPRA 1KP2A 3JCUZ 4K35A 5IYZB 2WLIA 1FPOA 1SRYA 4QE7A 3ZRWA 4B3TB 3K0DA 1SA0A 4WBNB 5LP6C 3HKEB 1WLEA 3N2GB 1V55B 4K3AA 1Y74B 5KA5A 1Y76B 5LGTA 5JQGB 4N23A 3ETGA 3OMAB 4X64O 5H9CA 1DLBA 1XL6A 4ZIBA 1W2BU 3WFVA 5KUMA 3CEIA 4FJCC 4GX5A 3B8NA 4X8AA 5CMUA 3ZMZA 2VWJA 4X1IA 3JYCA 3W7XA 1N33O 1XREA 1M1KW 3QO5A 5BMVA 2F93B 1SC5B 3CHXA 5LXTA 3K57A 1AJNA 1SZTA 3VBBA 1AVMA 2LFRA 1SQQH 2FKXA 1G4YB 4KXRA 4NKGB 5EZYB 2ZE7A 3BCCH 2BTOA 1KQSU 5IE9A 3K5MA 4ZI7A 1AI4A 1TUBA 1V54C 3CJHB 4H33A 4FFBB 4I4TB 1NH2D 2HHHB 4CH6A 2Z3YA 1KKCA 3OGIB 1K4CC 1NS1A 2AXTZ 3A0RA 1XQ8A 2GUZB 2GV9A 3DXRB 3AG7A 2VRZA 1GN2A 1EBOA 4DR4O 2CH7B 2H94A 3UCSC 3ETQA 1N8RW 4YY3B 4UCRA 4JTCB 3CS5A 4WFHA 1CEZA 1K4DC 4XDJA 3OTOB 2JGDB 1YITV 3CCQV 5JH7A 4KFMA 1MZFA 3JALA 5KHGA 1JVMA 5IYBO 2AZ0A 1WNSA 3JAMN 3W7WA 3ABKC 4NXMO 5CA0B 4F4LA 1GKFA 1G1XB 5LP6A 1NKDA 2N74A 1YF2A 1JA8A 3QG5A 4JTAB 4OXSA 2B9ZA 4R8CA 2EIMB 2QTOA 3K9AA 4IIJA 4PD4F 3T1HO 1O9HA 4I55A 4O4LA 3APOA 2B1IA 3E35A 3G80A 4FM1A 2OT5A 2HKOA 2YUAA 4DR7B 4DV2O 2KG7B 3GVMA 4UCOA 3RYFA 1HNWO 4FMTA 1Q90D 1FFXB 3CYOA 4H0LB 2QM8A 4UB6Z 4P9PA 1A32A 2WA4A 3ZEDA 2ADQB 5L3FA 1VF6C 4LWSA 4B3SO 3ZMUA 3ZX6A 5KHIA 2YIBA 2Q73A 1P4RA 2UUCB 3UT5B 3LNNA 3JASA 5JVDA 5CB4A 2FYUH 4X1KB 2RN9A 1VQ9V 3O9OA 4X66B 5LBQA 2LW7A 1BMFG 2WLHA 4HZ3A 1QVGU 4BR6A 4JAAA 4BIUA 3DGEA 1D5AA 3ZMTA 1B06A 1Q6UA 2D2CB 2DYSC 4LF5B 4U7NA 1AROP 3DC5A 4B08A 1PNKA 2R70A 4KUMA 4X65O 4DV7O 4YXWG 4K8XA 2KQXA 3U11A 1THZA 5KLVH 1VQ5V 2K9PA 3HKBA 1N34O 3BAAA 1Q86W 2BSKB 5KMGB 4RQFA 5GONA 3IAYA 1I7FA 1VQLV 4JI2O 4DYLA 2UXCO 4JI6O 1AI6A 1VEWA 4X62O 1NT2B 2YI8A 4JYBA 2HLDG 1HR0O 5L3EA 4DR3B 5CA1A 2ZNJA 3VQXA 2KSDA 5KHKA 1RSOA 1EM1A 5GW7A 1ORQC 4PA6A 4FLYA 4DUZB 4UVCA 3N2KB 5B1BB 3P30A 3W7SA 3CXCU 1K8AW 4RO2A 3OT7A 2QEXV 1PL0A 1COWG 1L8DA 3FYIB 5IT9N 2ZKOA 1NTKH 1QLEB 3OD4A 2JEXA 1ENVA 5J9PC 1Z5WA 1T5EA 3T1YB 4DV4B 4LF9B 2UXDB 3ASNB 2F95B 1WPXA 2JRIA 3I56V 1H8EG 1R3KC 1L1FA 2OTLV 3GB7C 2E3CA 4O4IB 1KBHA 2QWPB 2UXNA 4JYCA 2YIDA 2PGGA 2EIJB 2UU9B 2LP7A 5B3SC 1SF9A 1S77D 4JV5B 1GTOA 4X1YB 3P32A 3JSNA 2LO1A 4U3JA 1PKXA 2A0LA 4GT1A 3K79A 2XHBA 3E86A 4J80A 2IM9A 1JFFB 2CTQA 1GN3A 5F2VO 3HKDA 1NVPD 5L3GA 2KB1A 4CS3A 4F6RB 2HHHO 3E22B 2FB5A 4CC5A 1YJWV 4XDLA 3OR6C 3BA8A 3FB6C 1VMGA 2GDSA 1EN5A 4Z1VA 3C90A 1QQCA 4ZHQA 2P6JA 1IDSA 1PNMA 5BXZA 2ZXWC 4CS2A 4CH3A 4TV8B 4IHJA 2DWEC 3MDSA 2EINC 3SYPA 3JCZA 2Q7EA 1IBLB 1ROPA 3E8FA 5A9GA 1GM8A 1Q82W 2WLLB 3L72H 3KCYA 2ZR2A 3WB1A 3AG1C 1Z5VA 4GX1A 2F43G 4YJ2B 3RVYA 4Z1MG 3F5WC 1K92A 3K08A 4RAIA 2KKWA 2YIBD 4ZKIA 2DYRB 1MNGA 1OCCB 3I55V 1BHBA 3OM3B 5H6QA 1AI5A 4I0XA 3B09A 1PV0A 1NR1A 3LDCA 3OW2U 5ITZB 2NN4A 1H2NA 2Q0AA 4GKKO 4B7KA 2WA3A 3TETA 2BOCC 1RPOA 4JZ2A 4DR7O 5K1XA 2GSMB 4FIPC 2ZDIC 1K5SA 4L8JA 2YXHA 1QBZA 4FK5C 5DEDA 1J95A 3IFXA 2EIKB 4DR1B 3OEHG 1NZ6A 3TJTA 3BFRA 1XL4A 3H9VA 2ETNA 1SQFA 1GRJA 1LNQA 4BWAA 4JZGA 3ZRXA 4ZOLA 1V55C 4DV5O 4FLZA 4IT5A 4X66O 2JS5A 2EJ7A 2H8PC 2EULA 4GYCB 1YI2V 3K58A 3HKCA 3K5NA 4G28B 4LF5O 3RFRA 2VQFB 4GLXA 1OJHA 1QNMA 4MTFA 1SQVH 4PDLA 1VQOV 2YS8A 1SKVA 2YC0A 3L71H 1M90W 2XUMA 4NTYA 3K59A 4QNHB 2LGQA 1RPRA 4PDRA 3ETDA 4LF8O 4BW9A 4X20A 4FLTA 1DK1A 3T4DA 4DRXB 1Q5OA 5FNVB 4P2ZA 2CUGA 2OCCB 1IURA 4MTGA 3T4ZA 4RWUA 4JI8B 4TV9A 3UO3A 3R65A 1SQBH 3QO8A 3QO7A 4BAYA 4LP8A 1XNQO 1XBLA 3CCEV 1TGOA 3MAQA 5BY1A 1VQNV 4JI5B 3K9SA 1IXBA 4MVOA 5EC1C 2F4VB 1VQ7V 1E79G 2YIAA 3SYAA 4JPRA 1IBKO 3ASOB 3D8CA 5IJ0B 3G4SV 1YEWA 2RQ6A 3K06A 4EFBA 1NJIW 4FM2A 2XAHA 3NXSA 5LHHA 3SPIA 3SJCC 5LA6A 4DUZO 2C2AA 3JAWB 4MVZA 1XDCA 5J2TB 2JDIG 2E5LB 4I7ZB 4NTWA 4DUYB 1M5IA 1P7GA 3ICXA 1VQPV 3FKSG 1BQ0A 2JJ2G 1FXKB 4DV0B 2YXYA 3LSSA 3UKMA 5D5QA 4FLUA 1EN6A 1WJZA 1S5JA 3SGIA 1R73A 4DV4O 3T1YO 1NTMH 1KU9A 2BTQB 4LF9O 2UXDO 4I50B 5KAIZ 1TVKB 2PUSA 2RJZA 4U7OA 4UCTA 3X2QB 3WG7B 4LF4B 1YJ9V 2EIMC 3D3QA 2X0LA 4GZRB 2Q4PA 5JCOA 2LQTA 2Q8VA 1XHXA 4UVAA 2UU9O 3RYIA 1GH6A 5LHGA 5IYCO 3AK3A 4JV5O 3D36C 5FL7G 2HVJC 2M6YA 1KC8W 1WA8B 1Q6IA 4O4HB 2ZM6O 1WAZA 2BOBC 1EZVH 4BIOA 2XNDG 3CRAA 1YXBA 1N4CA 2WLIB 3UQ8A 5J2UA 4EKWA 5E1AC 3ZRWB 4WCEV 2R9AA 4PELA 5DECA 1SA0B 2PY5A 3EVKA 3TXSA 1YTFB 3ZHRA 1I0HA 1P7BA 5BZBA 2HR3A 2YSUB 3SYOA 2RDCA 3SJQC 2LGWA 1FD9A 1V9PA 4YIPA 1XNRB 2UUAB 1K97A 1S5LZ 4GUNA 2P7TC 1AR4A 3VQWA 1KUQA 3CC2V 2YEVA 2PZSA 5EK0A 4X1IB 2NNUA 4NYKA 1Q43A 1IBMB 1BZKA 2CTRA 3CX5F 5B1AB 5BMVB 1IBLO 3ZN0A 5LXTB 4DV6B 2JGDA 3CCVV 5IYDO 2G38A 1YZBA 4JI7B 3OAAG 4RUEA 2MW2B 3ABTA 2AHYA 2Q6AA 5L3BA 3SJBC 4ZI7B 3IJ4A 4J42A 1YJNV 1TUBB 4GKJB 1GM7A 4CH4A 4MVSA 3AG4B 1GK9A 2P4VA 4K0KO 3FB5C 3ZRVA 1AJPA 2O57A 1PD3A 1HNZB 2Y4UA 3MD0A 1F51A 4J41A 2Z0AA 3ETEA 2UUBB 4K8ZA 1OV9A 4OX9B 4DR5B 1UFIA 2A3QA 2QE7G 2JEUA 3JATA 3GWOA 5B1BC 2WLNA 2P67A 3RYCA 1MABG 3A2FA 3RYHA 1D2DA 1NU1H 4DR1O 5JH7B 1VP7A 3JALB 3ZHQA 5IWAO 2A9HA 2Y4TA 3BEHA 1WB8A 1R3LC 2F23A 4O4JA 1QLEC 2XAGA 3QTCA 3OFNG 1RFYA 4UVBA 2YDEA 3CRQA 3CRRA 4UUJC 3ASNC 3EHBB 1JR9A 1SQGA 1J5EB 2IJJA 2AZ2A 1HNXB 2IW5A 3FX7A 1OCZB 4IIJB 3SJAC 4I55B 4O4LB 2EIJC 2QWRB 1QVFU 2IU0A 4JF3A 2OIEA 4ABMA 1VQ6V 2AHZA 1N32B 1YVWA 2DMXA 3RYFB 5LL6Y 3LSUA 4UXNA 2HFEC 1B04A 1OHHG 3OMIB 3M99B 4ZBMA 4LC1A 2P4KA 5D5PA 1L0LH 4LWSB 4LFCO 2QTSA 5JJNB 4J10A 4JI8O 2ZD9A 4YJ3A 2UXBB 3JASB 5JVDB 2Y69B 4LFBB 4TT3G 3OUSA 5CB4B 1JOYA 3F5TA 4Q6GA 5DN6G 3U0ZA 5KMGA 3KG2A 4JI5O 2EILB 1KECA 3N27A 2F4VO 4BIZA 1OCRB 2IJKA 1FS0G 2FTKA 1U96A 3ZRSA 4J9ZB 4UV9A 2CTWA 2X6AA 1QCEA 2F1MA 4WFGA 2XAFA 4TQDA 2E5LO 2NR5A 1EFRG 1H2GA 4JASA 3K0GA 1R1BA 2QR4A 5TISZ 5LYJA 4DV0O 2AGAA 2CTPA 3STZC 4UV8A 3L9DA 4HNAA 1JQ0A 1I94B 3HKBB 1XILA 5EYPA 3JAKB 1JMKC 2VQEB 4CC6A 2A79B 2JJ1G 2ZNIA 3C3TA 4ICGA 3CCRV 2FMLA 5GONB 4E4EA 4IYIA 4MS2A 2DYRC 1OCCC 2QKAA 2GTAA 2E76B 4LF4O 1FFTB 2ADPA 2EBOA 3M8AA 4MSWC 1XMOB 4B3TO 1VF6A 3TXQA 2B5UA 2HP8A 4TSFG 5CA1B 2OCHA 5IJ9A 1RSOB 2ZE5A 3JD1A 1RM1B 1GAXA 4YHHB 2ZINA 4IL6Z 4U3FH 3QF7A 4JTDB 1U97A 4DR2B 4JYYA 1SS3A 2WLJA 4UCUA 4TUYA 2EIKC 4J9YB 1R6NA 1F4MA 3B8MA 3QNEA 3BVOA 5LMUB 4LF7B 1XHZA 1MSWD 1K5QA 1BGYH 4W4LA 1K73W 3TK1A 3RGBA 1NTZH 3ABUA 2DQ0A 3R66A 4TOIA 2PI4A 4NXNB 2BE3A 1XNRO 2UUAO 4FZ1A 4FM0A 2Q67A 1WP8A 4A5UB 3M7MX 1YCIA 3OMNB 4WF9V 3CC7V 2HEPA 4I5SA 3TGUH 5B5EZ 4QPKA 1E1QG 1YIJV 1SERA 3TCUA 2ODMA 4DV3B 1M4UA 4U3JB 1QU7A 3L70H 4LNUA 4XDKA 2ZE8A 5E79Z 3IC7A 4L87A 2Q7GA 3CMEV 4UB8Z 1XUQA 4NTXA 4JI7O 4YY3O 3HKDB 1ZX3A 2EJRA 2GTSA 4DW0A 2XTAA 2HJFC 4PDVA 1FYJA 3S3WA 2OCCC 3OTOO 3SR2C 3L73H 1IZ3A 4GKJO 2QSAA 4KP4A 1YSCA 1M56B 1R6TA 2WWWA 3FYEB 1M57B 2OIGA 1N36B 1UJWB 1AP6A 1ZL8A 3ASOC 4MW8A 4ZHQB 3VQYA 2UUBO 1VF5B 2WPDG 4OX9O 5C93A 4DR5O 1WN7A 4NB5A 4MTXA 3RWRD 4IHJB 1BSMA 2H3OA 3AG3B 2ZIOA 1DF4A 3JARA 5LMNB 2EZOA 1CXZB 2VWKA 1LUWA 3WB2A 1FXKC 3FAVA 5KX5A 4JI3B 1OZ0A 2Y0PA 1VQMV 3H1KH 3NR7A 5LGNA 2OTJV 4AI8A 4LR3A 3ABMB 4EB6B 4UFZA 2A7WA 4O2BA 3IGAC 5FLXN 1J5EO 4I0XB 1HNXO 1BL8A 3Q4HA 2UUCO 3X2QC 3WG7C 1MOFA 4FPPA 4YIOA 1ZTEA 4O2AA 3HB3B 1KB9F 1NH2B 2FL4A 1D5NA 3CCLV 1IVSA 5KAFZ 1KYOF 3FB7C 4AILC 4H37A 1QR9A 2XOKG 3RBZA 1N32O 1X59A 1LR1A 5EC2C 4FZ0A 4RUFA 3CCUV 2QA4V 5B1NA 3U10A 5CN0A 1HNWB 5GTIZ 3ABLB 3AG2B 4PHZA 1Q81W 2UXBO 3BA9A 4LFBO 3GWKC 4P9OA 4G2KA 2GBOA 3RN4A 4ZOLB 5KHHA 1H2LA 1I5XA 3K04A 3APQA 4RQEA 4AQYB 5LOVB 3OTFA 2DWDC 3C3SA 3PN1A 3HKCB 1SQPH 5JJJB 3MHSC 3A8TA 5C8YA 1M9NA 3KZIZ 5AG2A 2M7WA 5L3CA 4LH7A 4DR3O 1JPXA 4I9QA 2CGNA 4FLWA 4QGPA 5B1AC 2E74B 5KA6A 4X20B 1N0JA 4X65B 3SPHA 1BHAA 1I94O 3HPLC 2LW1A 4PDMA 2VQEO 2QWQB 1YDXA 4TV9B 1Q3EA 2CAZC 1ZWIC 2ZDIA 1N34B 1TAEA 2XASA 2WAMA 1Y4MA 1Q7YW 1SETA 2EZPA 1F23A 1GN6A 5IYZA 1XMOO 1K34A 3AG4C 1FKAO 1Y6XA 4JI2B 1VARA 4CZZA 3ZMSA 1WPBA 3CCMV 1HWYA 1HR0B 4J7KA 1W0KG 2LJ2A 4WBNA 3HKEA 3CRMA 5IY5B 4BW5A 3FFQA 1KP3A 3N2GA 1MMMA 1Y74A 2QJ1A 5LA6B 2R72A 1Y76A 1H2SB 1K7DA 5JQGA 2QWOB 4DR2O 2ZQMA 2Z5UA 3B40A 5BR8B 4JI1B 1WP7A 3ZIAG 4G27B 4DW1A 4DK0A 2HVKC 3CB2A 1K33A 5LMUO 2ZCEA 4LF7O 2PF4E 1AP5A 2V4DA 4J11A 4LF6B 3I5DA 2Y0IA 4NXNO 1LUVA 1NBMG 1Q6HA 4WFFA 1OCZC 3E8HA 5DM6V 3H01A 2XAJA 1I08A 3RYIB 5EZYA 2IJHA 4AHCA 4WFAV 3OGCC 2IJIA 4WFEA 4R50A 1GMGA 3RT3C 4NVPA 1S76D 1IXMA 4DV3O 3CE2A 3CJHA 4FFBA 4I4TA 2R9RB 3MHHC 2CK3G 4PI2A 3E8GA 1XI1A 5FPOA 2GUZA 5J2UB 1SESA 3DC6A 1F7YA 3DXRA 1R3IC 2PYLA 4LFAB 3L74H 1CPYA 2QKCA 2CH7A 2Q68A 1OCOB 5A2QN 4MVUA 3SPGA 2Y69C 1L0NH 1CP9A 4P30A 2EILC 3E2EA 4W4KA 4OGQB 1N36O 1DGSA 1OCRC 2XT9A 3T2MA 1H38A 1Z2GA 4PI0A 3CRCA 2Q0OC 1XEQA 5CA0A 4B3RB 4LH6A 1ZLZA 1GM9A 2YEVB 4MVQA 3K5OA 4CBCA 3CMAV 4DXWA 1VQ4V 1MZEA 3J7AU 1G6UA 1RP3B 2E75B 4GCZA 1X4TA 5LMNO 2QM4A 3B2EE 3OR7C 4DV1B 2ATKC 4JI3O 1ZUQA 1VIBA 3VQVA 2LFSA 3D36A 3CPWU 3K3WA 1GO3F 3G71V 1SZXA 3ZS8C 2KG7A 4D6TH 2QWNB 4UCSA 4FLXA 3ZHTA 1GN4A 1FFXA 1DF5A 2Q5ZA 3B4SA 1NVPB 4KHPB 2ZE6A 1H2KA 3G6BA 3T1CA 3VOUA 1QLNA 4CS4A 1ZSPA 5LP6B 3P3PA 3UT5A 3FD9A 5EIBC 4H13B 4R7CA 1H8HG 3CSXA 4JAUA 3SYQA 4NR1A 4QPJA 4JYAB 4DR6B 4GKKB 2QM7A 4CH5A 1RM1C 2ITDC 4X1KA 1Y66A 2X7RB 4TQFA 3JATB 3RYCB 3RYHB 1AR5A 1KMIZ 2IU3A 3E89A 2VQFO 2DOSA 4PJ0Z 3S3XA 3PJSK 5H5NA 2IH1C 5HFMA 4O4JB 4HYOA 1VQKV 1PL4A 4JI4B 2Y48A 3UO2A 2IH3C 3F7VC 3EFFK 4AQYO 2YI9A 2P06A 4H44B 1JCHA 3CC4V 3BABA 1S3JA 1TA8A 4DV5B 1JX9A 1XMQB 2XAQA 2UXXA 1JJ2U 2AW9A 4IGGA 3G6EV 3K5LA 1YHQV 3AEIA 4ASUG 2IBZH 2BSKA 1V54B 4QIWF 3ML0A 3ZHUA 1BS3A 4LBEC 2DE0X 3RW0A 2L6LA 3ZBHA 4FLVA 4MTOA 2QGNA 2MK3A 3LDEA 4X9QA 5KUKA 4LF8B 2WLKA 2DQ3A 3F7YC 2L35A 2OWOA 2DN9A 4YJ3B 4OPAA 3G67A 4DUYO 3JAKA 3N2KA 3WU2Z 4TWKA 3B77A 2ZR3A 3UM7A 2X6CA 1EZJA 1M56C 5CBFA 1YTFD 1XNQB 1M57C 3ABKB 1I5YA 5JJEB 4JAVA 3WB0A 3ZMVA 1PM9A 1NR7A 2Q9LA 4R6ZA 1IBKB 1FJGB 2PTMA 1Y67A 4JI0B 4D7TA 1K9MW 1ZAUA 4EEQA 2P5OA 2QKSA 4I9WA 1S72V 4MVMA 1VQ8V 5B66Z 4B3MB 3AG3C 4O4IA 5BR8O 5EBWC 1MG1A 3JD4A 5LYJB 4JI1O 1IX9A 2R9IA 4HNAB 2F66C 3H1IH 3BPZA 2PYJA 5EYPB 4J7JA 3OUFA 4X1YA 2EX3A 4XBFA 4LF6O 1P49A 4FVMA 1BT8A 3ABMC 2JS3A 2N05A 1SQXH 1JFFA 3LDDA 3OEEG 3QVNA 1N0NA 2W0FC 4D7SA 3DSQA 5IJ9B 1US6A 4F6RA 3E22A 2JK5C 3CP1A 2P22C 4X64B 1H2MA 2ZM6B 4PA7A 2OYQA 4PA4A 4TUYB 5GTHZ 1R3JC 2ILMA 5JWPA 4LFAO 4MT8A 3ABLC 2DYSB 3AG2C 3DTUB 2JVDA 5H2FZ 1IBMO 2CDYA 2HJDA 3BHPA 4DV6O 3CCJV 4TV8A 3K03A 1N33B 2W6IG 5CA3A 1XOUA 1HDJA 4IYHA 1MSDA 2ITCC 2WLLA 1PNLA 2YICA 2B1GA 3H1JH 4Z2WA 1K3EA 4YJ2A 3IC9A 4B3RO 4QJFB 2K1EA 1AILA 3EXAA 3CXHF 4HBNA 1FAFA 3FB8C 1HNZO 4C7UA 1DTOA 2PI5A 2A06H 4LNUB 4UCVA 5ITZA 4DV1O 5KHJA 3A0HZ 3JD2A 3SDLA 4JGSA 3P3NA 4FFKA 1F4NA 4DR4B 1S5HC 2CGOA 3OE7G 1PPJH 3STLC 4KHPO 2DJVA 3W7UA 4PA3A 1BQZA 4EB6A 1AB3A 2YXLA 2ARHA 4DO2A 1HW7A 4GX2A 4EFEA 1R6KA 1PP9H 4K0KB 1ZL8B 2JGUA 4DK1A 4NXMB 4E2LA 4DR6O 4JYAO 4OPHA 2HG5C 1BE3H 5IY5C 3J81N 4LCUC 3JSLA 1M93A 3LUTB 1NQTA 1FXVA 3W7TA 3JARB 2W0XA 1S0VA 3T1HB 4Q20A 2JIZG 3FAVB 2RMKB 1O9GA 4PA9A 5B3SB 5KX5B 1EN4A 4QE9A 3SYCA 3JD3A 3E8BA 5IWAB 4PV1B 4JI4O 2V7QG 3E83A 3L75H 2D3OW 4DV2B 5EBMC 1WB7A 3O65A 3LSQA 4O2BB 1QR8A 4F6EA 3ZCCA 3Q4HB 3CWBH 2ZIMA 1XMQO 3SPCA 4O2AB 3KKYA 2V1DA 4DRXA 4B3SB 5FNVA 5LOVA 1BCCH 5JCOC 1URFA 1P84F
chains in the Genus database with same CATH topology
3OMIB 1NVPD 3M99B 2R9RB 3MHHC 4LC1A 4ZBMA 1E1RG 2P90A 5H6RA 5L3GA 2CK3G 3E8GA 2KB1A 5IDJA 5B1OA 2W6JG 1SESA 2ZD9A 3LNMB 4X89A 1R3IC 1AI7A 3JD0A 4GX0A 5CBHA 1YJWV 2Y69B 1CPYA 4TT3G 4MVRA 3OUSA 5HFLA 1JOYA 4XDLA 5DN6G 3OR6C 3KG2A 2Q68A 3FB6C 3D3IA 4WFBV 3CD6V 1OCOB 2EILB 2X6BA 1FXHA 4MVUA 1AJQA 3SPGA 4N21A 2Y69C 1KECA 2ZXWB 1W0JG 4BIZA 1CP9A 1OCRB 2P6JA 4P30A 2IJKA 1FS0G 2FTKA 3CCSV 2EINB 1OCOC 1PNMA 2EILC 2NLJC 3ZRSA 3E2EA 4X88A 4J9ZB 2ZXWC 1KKDA 5CBGA 3ZN1A 4UV9A 3RVZA 5EBLC 1OCRC 5LHIA 2X6AA 2DWEC 3T2MA 1QCEA 2EINC 5L3DA 3JCZA 3SYPA 1H38A 1KD1W 1TUEB 3AG1B 1ROPA 2WSSG 2XAFA 1FXKA 3E8FA 4WFGA 1GM8A 1Q82W 2WLLB 2DW4A 1GM9A 2YEVB 1EFRG 1H2GA 4MVQA 4CBCA 2ZR2A 3CMAV 4JASA 3AG1C 4GX1A 4DXWA 2F43G 1AR1B 3K0GA 1VQ4V 2Q69A 3RVYA 4GCZA 4Z1MG 3F5WC 1K92A 3STZC 3K08A 4UV8A 3ZJZA 3OR7C 1JQ0A 4RAIA 1B6QA 4ZKIA 2ATKC 2DYRB 1OCCB 3I55V 2A79B 1BHBA 2JJ1G 3OM3B 5H6QA 1AI5A 3CCRV 2WLMA 5LGUA 2LFSA 3D36A 1NR1A 4MS2A 1G8MA 2DYRC 3CPWU 1OCCC 3K3WA 3LDCA 1GO3F 3G71V 3OW2U 4HAMA 1FFTB 3BY6A 4MSWC 2EBOA 3SPJA 1DF5A 1NVPB 3TETA 2BOCC 1RPOA 4MW3A 2B5UA 2GHYA 4TSFG 2GSMB 3T1CA 4FIPC 1KP2A 3VOUA 1QLNA 3JD1A 1RM1B 2WLIA 2ZDIC 1K5SA 1SRYA 1QBZA 4FK5C 1J95A 4R7CA 4QE7A 3IFXA 3ZRWA 1H8HG 2EIKB 4JAUA 3SYQA 4QPJA 2QM7A 4JTDB 3K0DA 3OEHG 1RM1C 2ITDC 1Y66A 2X7RB 1WLEA 2WLJA 2EIKC 1V55B 5KA5A 4J9YB 1R6NA 1XL4A 1F4MA 2IU3A 3B8MA 5LGTA 1LNQA 3E89A 4N23A 3QNEA 3ZRXA 3ETGA 3OMAB 1V55C 3PJSK 5H9CA 2IH1C 1DLBA 1MSWD 1K5QA 1XL6A 2H8PC 1W2BU 5HFMA 1K73W 4HYOA 3WFVA 1VQKV 5KUMA 1YI2V 2Y48A 3TK1A 2PI4A 3ABUA 2DQ0A 4FJCC 4GX5A 3B8NA 4X8AA 5CMUA 3ZMZA 4G28B 2IH3C 3F7VC 3JYCA 3W7XA 3EFFK 2Q67A 3CC4V 1JCHA 4MTFA 3OMNB 1M1KW 4WF9V 1S3JA 3QO5A 4PDLA 3CC7V 1VQOV 1JX9A 4I5SA 1M90W 2XAQA 2UXXA 1JJ2U 4QPKA 1E1QG 1YIJV 4QNHB 4PDRA 1RPRA 1AJNA 1SERA 3G6EV 1SZTA 3ETDA 3TCUA 3VBBA 1YHQV 3AEIA 2LFRA 4ASUG 1G4YB 1V54B 4QIWF 4XDKA 3T4DA 1KQSU 3IC7A 3ML0A 4L87A 4P2ZA 3CMEV 2OCCB 1AI4A 4LBEC 4MTGA 1V54C 3RW0A 3T4ZA 4H33A 1NH2D 2EJRA 3R65A 2HJFC 4PDVA 4MTOA 2Z3YA 1K4CC 2OCCC 3QO8A 3QO7A 4BAYA 2MK3A 3LDEA 4LP8A 3A0RA 5KUKA 2WLKA 3CCEV 2DQ3A 3F7YC 1VQNV 4KP4A 4MVOA 5EC1C 1YSCA 1VQ7V 1E79G 3SYAA 1EBOA 1M56B 4JPRA 3ASOB 2H94A 2WWWA 1N8RW 3FYEB 4TWKA 1M57B 4JTCB 3B77A 2ZR3A 4WFHA 3UM7A 2X6CA 3G4SV 1CEZA 3K06A 1UJWB 1EZJA 1K4DC 1M56C 4XDJA 1NJIW 5CBFA 2XAHA 3NXSA 1YTFD 5LHHA 3ASOC 4MW8A 3SPIA 2C2AA 4MVZA 1M57C 3ABKB 1YITV 3CCQV 2JDIG 1I5YA 2WPDG 4KFMA 5C93A 4JAVA 1JVMA 3ZMVA 5IYBO 1NR7A 4R6ZA 4MTXA 1VQPV 3FKSG 3W7WA 3ABKC 2JJ2G 3AG3B 4F4LA 1DF4A 1FXKB 1GKFA 3LSSA 3UKMA 1K9MW 2EZOA 2QKSA 4I9WA 1NKDA 1S72V 4MVMA 1VQ8V 3AG3C 1R73A 4JTAB 1FXKC 1OZ0A 4OXSA 4R8CA 5EBWC 1MG1A 3JD4A 1VQMV 2EIMB 2R9IA 2QTOA 3K9AA 2OTJV 5LGNA 4U7OA 3X2QB 3WG7B 3ABMB 3OUFA 1YJ9V 4XBFA 2EIMC 3IGAC 2B1IA 3E35A 2OT5A 2X0LA 1BL8A 2HKOA 4UVAA 3X2QC 5LHGA 3WG7C 1MOFA 3ABMC 4FPPA 5IYCO 3HB3B 1NH2B 3LDDA 3OEEG 4FMTA 3CYOA 5FL7G 2HVJC 1KC8W 2QM8A 2W0FC 3CCLV 4P9PA 2BOBC 3FB7C 4H37A 1QR9A 2XOKG 2XNDG 5L3FA 3RBZA 3ZMUA 2WLIB 1P4RA 5EC2C 4EKWA 4RUFA 5E1AC 3CCUV 2QA4V 5B1NA 2JK5C 3CP1A 5CN0A 3ZRWB 4WCEV 4PELA 3ABLB 1VQ9V 3AG2B 1YTFB 4PA7A 4PA4A 1R3JC 5LBQA 1P7BA 5BZBA 1BMFG 2HR3A 2YSUB 2WLHA 4HZ3A 4MT8A 1Q81W 1QVGU 3ABLC 3SYOA 2DYSB 3AG2C 3DTUB 3SJQC 4BIUA 3DGEA 4P9OA 4G2KA 3ZMTA 1I5XA 3CCJV 3K04A 4RQEA 2DYSC 3K03A 1K97A 2W6IG 4U7NA 5CA3A 1AROP 2DWDC 2ITCC 2P7TC 2WLLA 1PNKA 1PNLA 3CC2V 2YEVA 4KUMA 5EK0A 3MHSC 2NNUA 2B1GA 4YXWG 1K3EA 1M9NA 1THZA 5B1AB 4QJFB 2K1EA 2M7WA 3ZN0A 5L3CA 1VQ5V 1JPXA 3CCVV 5IYDO 5B1AC 3FB8C 1Q86W 4RQFA 5KA6A 3OAAG 4RUEA 1DTOA 2PI5A 3ABTA 1VQLV 3SPHA 1BHAA 2AHYA 1AI6A 2Q6AA 3HPLC 5L3BA 4PDMA 4JYBA 1YJNV 2HLDG 3JD2A 1GM7A 1ZWIC 4MVSA 5L3EA 3AG4B 1GK9A 4JGSA 2ZDIA 3FB5C 3ZRVA 1AJPA 1F4NA 2XASA 1S5HC 2WAMA 1PD3A 1Y4MA 1Q7YW 1SETA 3OE7G 1VQ6V 2EZPA 1F23A 5GW7A 1K34A 3AG4C 3STLC 1ORQC 3MD0A 1F51A 4PA6A 3W7UA 4PA3A 4CZZA 4UVCA 5B1BB 3W7SA 3ETEA 3P30A 3CXCU 1K8AW 4RO2A 3ZMSA 3CCMV 1HWYA 4DO2A 1W0KG 2QEXV 1PL0A 4GX2A 2QE7G 1COWG 2JEUA 1R6KA 4BW5A 1KP3A 3GWOA 3FYIB 5B1BC 5IY5B 2WLNA 2P67A 1MABG 4E2LA 1K7DA 2HG5C 1QLEB 5IY5C 2ZQMA 2A9HA 4LCUC 2JEXA 1ENVA 3BEHA 5J9PC 2Z5UA 1R3LC 3LUTB 3ASNB 1WPXA 1NQTA 1QLEC 2XAGA 1FXVA 3W7TA 3I56V 1H8EG 3ZIAG 4G27B 2HVKC 3OFNG 1K33A 1R3KC 4UVBA 1L1FA 2OTLV 1S0VA 4UUJC 3ASNC 3GB7C 3EHBB 4Q20A 2JIZG 4PA9A 5B3SB 2UXNA 4JYCA 2IJJA 4QE9A 3SYCA 2IW5A 3E8BA 3JD3A 2V7QG 3E83A 1OCZB 2EIJB 2D3OW 2LP7A 5EBMC 5B3SC 1S77D 3LSQA 1GTOA 1NBMG 3P32A 1QR8A 4WFFA 1OCZC 2EIJC 3E8HA 3ZCCA 5DM6V 3H01A 2XAJA 1QVFU 2IU0A 2IJHA 4JF3A 1PKXA 2A0LA 4GT1A 3K79A 3OGCC 3SPCA 4WFAV 2IJIA 2V1DA 4WFEA 2AHZA 3E86A 4R50A 4UXNA 1GMGA 2HFEC 1S76D 1IXMA 1OHHG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F4L A;  2R9R B;  4ZBM A;  3UKM A;  5B1A C;  2WLJ A;  3FB8 C;  2EIK C;  2QKS A;  4I9W A;  4J9Y B;  4RUE A;  1XL4 A;  3E8G A;  2KB1 A;  4MVM A;  3AG3 C;  3SPH A;  4JTA B;  1LNQ A;  3E89 A;  2ZD9 A;  2AHY A;  3LNM B;  4X89 A;  2Q6A A;  3HPL C;  4OXS A;  4R8C A;  1R3I C;  5EBW C;  4PDM A;  1V55 C;  3PJS K;  4GX0 A;  5CBH A;  2QTO A;  2IH1 C;  4MVR A;  3OUS A;  1XL6 A;  4XDL A;  2H8P C;  1ZWI C;  3OR6 C;  4HYO A;  4MVS A;  3KG2 A;  2Q68 A;  5KUM A;  3FB6 C;  3OUF A;  3FB5 C;  2X6B A;  2EIM C;  3IGA C;  4MVU A;  3SPG A;  1S5H C;  2Y69 C;  1BL8 A;  4GX5 A;  4X8A A;  4G28 B;  4P30 A;  3AG4 C;  3STL C;  2IH3 C;  3F7V C;  3JYC A;  3WG7 C;  1ORQ C;  3ABM C;  3EFF K;  3X2Q C;  1OCO C;  2EIL C;  2NLJ C;  2Q67 A;  3ZRS A;  4X88 A;  4PA6 A;  4J9Z B;  2ZXW C;  4MTF A;  4PA3 A;  1KKD A;  4PDL A;  5CBG A;  3LDD A;  3RVZ A;  5EBL C;  2HVJ C;  1OCR C;  4RO2 A;  2X6A A;  2DWE C;  3T2M A;  2EIN C;  2W0F C;  4PDR A;  4P9P A;  3SYP A;  4QNH B;  4GX2 A;  2BOB C;  3FB7 C;  4WFG A;  3E8F A;  4H37 A;  3TCU A;  4BW5 A;  2WLL B;  5B1B C;  3RBZ A;  2WLN A;  4MVQ A;  1G4Y B;  4CBC A;  2WLI B;  3AG1 C;  4GX1 A;  4XDK A;  5EC2 C;  2HG5 C;  3T4D A;  4DXW A;  3K0G A;  4RUF A;  2Q69 A;  5E1A C;  4EKW A;  3RVY A;  5IY5 C;  2A9H A;  2JK5 C;  4LCU C;  4P2Z A;  3F5W C;  3BEH A;  5J9P C;  4LBE C;  4MTG A;  3STZ C;  1V54 C;  3K08 A;  3RW0 A;  3T4Z A;  3OR7 C;  1R3L C;  3LUT B;  4H33 A;  4RAI A;  3ZJZ A;  2ATK C;  1QLE C;  3R65 A;  2A79 B;  4PA7 A;  2HJF C;  4PA4 A;  4PDV A;  4MTO A;  4G27 B;  1K4C C;  2HVK C;  2OCC C;  1R3K C;  1R3J C;  1P7B A;  2WLM A;  3LDE A;  4LP8 A;  5KUK A;  2WLK A;  5BZB A;  3F7Y C;  4UUJ C;  2WLH A;  3ASN C;  3GB7 C;  4HZ3 A;  3ABL C;  4MS2 A;  3SYO A;  2DYR C;  3AG2 C;  1OCC C;  3LDC A;  3SJQ C;  4PA9 A;  4P9O A;  4MVO A;  4QE9 A;  3SYC A;  5EC1 C;  3E8B A;  4MSW C;  3SYA A;  3E83 A;  3SPJ A;  3K04 A;  2DYS C;  3K03 A;  3TET A;  5EBM C;  5B3S C;  2BOC C;  4TWK A;  4JTC B;  4MW3 A;  2DWD C;  4WFH A;  3UM7 A;  2X6C A;  3K06 A;  2ITC C;  1M56 C;  1K4D C;  2P7T C;  1OCZ C;  2EIJ C;  2WLL A;  3E8H A;  4WFF A;  4XDJ A;  3T1C A;  3ASO C;  4MW8 A;  3SPI A;  5CBF A;  2YEV A;  5EK0 A;  3VOU A;  4MVZ A;  1M57 C;  2WLI A;  2A0L A;  3SPC A;  3OGC C;  4KFM A;  4WFE A;  2AHZ A;  3E86 A;  1J95 A;  1JVM A;  4R50 A;  4R7C A;  4QE7 A;  2K1E A;  2HFE C;  4R6Z A;  3IFX A;  3SYQ A;  3ABK C;  4JTD B;  3K0D A;  2ITD C; 
#chains in the Genus database with same CATH topology
 1E1R G;  2P90 A;  5H6R A;  3THO A;  2BCC H;  3H1L H;  5IDJ A;  1W59 A;  5B1O A;  2W6J G;  5EIB D;  3LNM B;  2QDO A;  4X89 A;  1AI7 A;  3JD0 A;  4GX0 A;  5CBH A;  1MA1 A;  4KL1 A;  4MVR A;  3H1H H;  5HFL A;  2RNB A;  5IJ0 A;  4WFB V;  3D3I A;  3J80 N;  3CD6 V;  2X6B A;  1FXH A;  1AJQ A;  4N21 A;  2ZXW B;  1W0J G;  3JAW A;  4LFC B;  3CCS V;  2EIN B;  1OCO C;  1UPG A;  2NLJ C;  3AK1 A;  3HR0 A;  5J2T A;  4X88 A;  1KKD A;  1QHT A;  4B7E A;  3ZN1 A;  5CBG A;  3RVZ A;  5EBL C;  4DV7 B;  1B3Q A;  5LHI A;  5L3D A;  1KD1 W;  1TUE B;  3AG1 B;  2WSS G;  1FXK A;  4J7Z A;  2RCV A;  2DW4 A;  5C8Y B;  1AR1 B;  2BTQ A;  2Q69 A;  1FJG O;  4I50 A;  3BRC A;  1TVK A;  4JI0 O;  1JJO A;  3ZJZ A;  3ZHV A;  2UXC B;  4JI6 B;  1B6Q A;  3KCX A;  4X62 B;  4B3M O;  2WLM A;  2Q7H A;  5LGU A;  2VS0 A;  1G8M A;  1NI8 A;  4YHH O;  3A0B Z;  2N04 A;  3ZHS A;  4HAM A;  3BY6 A;  5K1P A;  3AK2 A;  1Q8I A;  3SPJ A;  2CE4 A;  1HP8 A;  1WA8 A;  4O4H A;  4MW3 A;  2GHY A;  2ZT9 B;  1VF7 A;  5FPR A;  1KP2 A;  3JCU Z;  4K35 A;  5IYZ B;  2WLI A;  1FPO A;  1SRY A;  4QE7 A;  3ZRW A;  4B3T B;  3K0D A;  1SA0 A;  4WBN B;  5LP6 C;  3HKE B;  1WLE A;  3N2G B;  1V55 B;  4K3A A;  1Y74 B;  5KA5 A;  1Y76 B;  5LGT A;  5JQG B;  4N23 A;  3ETG A;  3OMA B;  4X64 O;  5H9C A;  1DLB A;  1XL6 A;  4ZIB A;  1W2B U;  3WFV A;  5KUM A;  3CEI A;  4FJC C;  4GX5 A;  3B8N A;  4X8A A;  5CMU A;  3ZMZ A;  2VWJ A;  4X1I A;  3JYC A;  3W7X A;  1N33 O;  1XRE A;  1M1K W;  3QO5 A;  5BMV A;  2F93 B;  1SC5 B;  3CHX A;  5LXT A;  3K57 A;  1AJN A;  1SZT A;  3VBB A;  1AVM A;  2LFR A;  1SQQ H;  2FKX A;  1G4Y B;  4KXR A;  4NKG B;  5EZY B;  2ZE7 A;  3BCC H;  2BTO A;  1KQS U;  5IE9 A;  3K5M A;  4ZI7 A;  1AI4 A;  1TUB A;  1V54 C;  3CJH B;  4H33 A;  4FFB B;  4I4T B;  1NH2 D;  2HHH B;  4CH6 A;  2Z3Y A;  1KKC A;  3OGI B;  1K4C C;  1NS1 A;  2AXT Z;  3A0R A;  1XQ8 A;  2GUZ B;  2GV9 A;  3DXR B;  3AG7 A;  2VRZ A;  1GN2 A;  1EBO A;  4DR4 O;  2CH7 B;  2H94 A;  3UCS C;  3ETQ A;  1N8R W;  4YY3 B;  4UCR A;  4JTC B;  3CS5 A;  4WFH A;  1CEZ A;  1K4D C;  4XDJ A;  3OTO B;  2JGD B;  1YIT V;  3CCQ V;  5JH7 A;  4KFM A;  1MZF A;  3JAL A;  5KHG A;  1JVM A;  5IYB O;  2AZ0 A;  1WNS A;  3JAM N;  3W7W A;  3ABK C;  4NXM O;  5CA0 B;  4F4L A;  1GKF A;  1G1X B;  5LP6 A;  1NKD A;  2N74 A;  1YF2 A;  1JA8 A;  3QG5 A;  4JTA B;  4OXS A;  2B9Z A;  4R8C A;  2EIM B;  2QTO A;  3K9A A;  4IIJ A;  4PD4 F;  3T1H O;  1O9H A;  4I55 A;  4O4L A;  3APO A;  2B1I A;  3E35 A;  3G80 A;  4FM1 A;  2OT5 A;  2HKO A;  2YUA A;  4DR7 B;  4DV2 O;  2KG7 B;  3GVM A;  4UCO A;  3RYF A;  1HNW O;  4FMT A;  1Q90 D;  1FFX B;  3CYO A;  4H0L B;  2QM8 A;  4UB6 Z;  4P9P A;  1A32 A;  2WA4 A;  3ZED A;  2ADQ B;  5L3F A;  1VF6 C;  4LWS A;  4B3S O;  3ZMU A;  3ZX6 A;  5KHI A;  2YIB A;  2Q73 A;  1P4R A;  2UUC B;  3UT5 B;  3LNN A;  3JAS A;  5JVD A;  5CB4 A;  2FYU H;  4X1K B;  2RN9 A;  1VQ9 V;  3O9O A;  4X66 B;  5LBQ A;  2LW7 A;  1BMF G;  2WLH A;  4HZ3 A;  1QVG U;  4BR6 A;  4JAA A;  4BIU A;  3DGE A;  1D5A A;  3ZMT A;  1B06 A;  1Q6U A;  2D2C B;  2DYS C;  4LF5 B;  4U7N A;  1ARO P;  3DC5 A;  4B08 A;  1PNK A;  2R70 A;  4KUM A;  4X65 O;  4DV7 O;  4YXW G;  4K8X A;  2KQX A;  3U11 A;  1THZ A;  5KLV H;  1VQ5 V;  2K9P A;  3HKB A;  1N34 O;  3BAA A;  1Q86 W;  2BSK B;  5KMG B;  4RQF A;  5GON A;  3IAY A;  1I7F A;  1VQL V;  4JI2 O;  4DYL A;  2UXC O;  4JI6 O;  1AI6 A;  1VEW A;  4X62 O;  1NT2 B;  2YI8 A;  4JYB A;  2HLD G;  1HR0 O;  5L3E A;  4DR3 B;  5CA1 A;  2ZNJ A;  3VQX A;  2KSD A;  5KHK A;  1RSO A;  1EM1 A;  5GW7 A;  1ORQ C;  4PA6 A;  4FLY A;  4DUZ B;  4UVC A;  3N2K B;  5B1B B;  3P30 A;  3W7S A;  3CXC U;  1K8A W;  4RO2 A;  3OT7 A;  2QEX V;  1PL0 A;  1COW G;  1L8D A;  3FYI B;  5IT9 N;  2ZKO A;  1NTK H;  1QLE B;  3OD4 A;  2JEX A;  1ENV A;  5J9P C;  1Z5W A;  1T5E A;  3T1Y B;  4DV4 B;  4LF9 B;  2UXD B;  3ASN B;  2F95 B;  1WPX A;  2JRI A;  3I56 V;  1H8E G;  1R3K C;  1L1F A;  2OTL V;  3GB7 C;  2E3C A;  4O4I B;  1KBH A;  2QWP B;  2UXN A;  4JYC A;  2YID A;  2PGG A;  2EIJ B;  2UU9 B;  2LP7 A;  5B3S C;  1SF9 A;  1S77 D;  4JV5 B;  1GTO A;  4X1Y B;  3P32 A;  3JSN A;  2LO1 A;  4U3J A;  1PKX A;  2A0L A;  4GT1 A;  3K79 A;  2XHB A;  3E86 A;  4J80 A;  2IM9 A;  1JFF B;  2CTQ A;  1GN3 A;  5F2V O;  3HKD A;  1NVP D;  5L3G A;  2KB1 A;  4CS3 A;  4F6R B;  2HHH O;  3E22 B;  2FB5 A;  4CC5 A;  1YJW V;  4XDL A;  3OR6 C;  3BA8 A;  3FB6 C;  1VMG A;  2GDS A;  1EN5 A;  4Z1V A;  3C90 A;  1QQC A;  4ZHQ A;  2P6J A;  1IDS A;  1PNM A;  5BXZ A;  2ZXW C;  4CS2 A;  4CH3 A;  4TV8 B;  4IHJ A;  2DWE C;  3MDS A;  2EIN C;  3SYP A;  3JCZ A;  2Q7E A;  1IBL B;  1ROP A;  3E8F A;  5A9G A;  1GM8 A;  1Q82 W;  2WLL B;  3L72 H;  3KCY A;  2ZR2 A;  3WB1 A;  3AG1 C;  1Z5V A;  4GX1 A;  2F43 G;  4YJ2 B;  3RVY A;  4Z1M G;  3F5W C;  1K92 A;  3K08 A;  4RAI A;  2KKW A;  2YIB D;  4ZKI A;  2DYR B;  1MNG A;  1OCC B;  3I55 V;  1BHB A;  3OM3 B;  5H6Q A;  1AI5 A;  4I0X A;  3B09 A;  1PV0 A;  1NR1 A;  3LDC A;  3OW2 U;  5ITZ B;  2NN4 A;  1H2N A;  2Q0A A;  4GKK O;  4B7K A;  2WA3 A;  3TET A;  2BOC C;  1RPO A;  4JZ2 A;  4DR7 O;  5K1X A;  2GSM B;  4FIP C;  2ZDI C;  1K5S A;  4L8J A;  2YXH A;  1QBZ A;  4FK5 C;  5DED A;  1J95 A;  3IFX A;  2EIK B;  4DR1 B;  3OEH G;  1NZ6 A;  3TJT A;  3BFR A;  1XL4 A;  3H9V A;  2ETN A;  1SQF A;  1GRJ A;  1LNQ A;  4BWA A;  4JZG A;  3ZRX A;  4ZOL A;  1V55 C;  4DV5 O;  4FLZ A;  4IT5 A;  4X66 O;  2JS5 A;  2EJ7 A;  2H8P C;  2EUL A;  4GYC B;  1YI2 V;  3K58 A;  3HKC A;  3K5N A;  4G28 B;  4LF5 O;  3RFR A;  2VQF B;  4GLX A;  1OJH A;  1QNM A;  4MTF A;  1SQV H;  4PDL A;  1VQO V;  2YS8 A;  1SKV A;  2YC0 A;  3L71 H;  1M90 W;  2XUM A;  4NTY A;  3K59 A;  4QNH B;  2LGQ A;  1RPR A;  4PDR A;  3ETD A;  4LF8 O;  4BW9 A;  4X20 A;  4FLT A;  1DK1 A;  3T4D A;  4DRX B;  1Q5O A;  5FNV B;  4P2Z A;  2CUG A;  2OCC B;  1IUR A;  4MTG A;  3T4Z A;  4RWU A;  4JI8 B;  4TV9 A;  3UO3 A;  3R65 A;  1SQB H;  3QO8 A;  3QO7 A;  4BAY A;  4LP8 A;  1XNQ O;  1XBL A;  3CCE V;  1TGO A;  3MAQ A;  5BY1 A;  1VQN V;  4JI5 B;  3K9S A;  1IXB A;  4MVO A;  5EC1 C;  2F4V B;  1VQ7 V;  1E79 G;  2YIA A;  3SYA A;  4JPR A;  1IBK O;  3ASO B;  3D8C A;  5IJ0 B;  3G4S V;  1YEW A;  2RQ6 A;  3K06 A;  4EFB A;  1NJI W;  4FM2 A;  2XAH A;  3NXS A;  5LHH A;  3SPI A;  3SJC C;  5LA6 A;  4DUZ O;  2C2A A;  3JAW B;  4MVZ A;  1XDC A;  5J2T B;  2JDI G;  2E5L B;  4I7Z B;  4NTW A;  4DUY B;  1M5I A;  1P7G A;  3ICX A;  1VQP V;  3FKS G;  1BQ0 A;  2JJ2 G;  1FXK B;  4DV0 B;  2YXY A;  3LSS A;  3UKM A;  5D5Q A;  4FLU A;  1EN6 A;  1WJZ A;  1S5J A;  3SGI A;  1R73 A;  4DV4 O;  3T1Y O;  1NTM H;  1KU9 A;  2BTQ B;  4LF9 O;  2UXD O;  4I50 B;  5KAI Z;  1TVK B;  2PUS A;  2RJZ A;  4U7O A;  4UCT A;  3X2Q B;  3WG7 B;  4LF4 B;  1YJ9 V;  2EIM C;  3D3Q A;  2X0L A;  4GZR B;  2Q4P A;  5JCO A;  2LQT A;  2Q8V A;  1XHX A;  4UVA A;  2UU9 O;  3RYI A;  1GH6 A;  5LHG A;  5IYC O;  3AK3 A;  4JV5 O;  3D36 C;  5FL7 G;  2HVJ C;  2M6Y A;  1KC8 W;  1WA8 B;  1Q6I A;  4O4H B;  2ZM6 O;  1WAZ A;  2BOB C;  1EZV H;  4BIO A;  2XND G;  3CRA A;  1YXB A;  1N4C A;  2WLI B;  3UQ8 A;  5J2U A;  4EKW A;  5E1A C;  3ZRW B;  4WCE V;  2R9A A;  4PEL A;  5DEC A;  1SA0 B;  2PY5 A;  3EVK A;  3TXS A;  1YTF B;  3ZHR A;  1I0H A;  1P7B A;  5BZB A;  2HR3 A;  2YSU B;  3SYO A;  2RDC A;  3SJQ C;  2LGW A;  1FD9 A;  1V9P A;  4YIP A;  1XNR B;  2UUA B;  1K97 A;  1S5L Z;  4GUN A;  2P7T C;  1AR4 A;  3VQW A;  1KUQ A;  3CC2 V;  2YEV A;  2PZS A;  5EK0 A;  4X1I B;  2NNU A;  4NYK A;  1Q43 A;  1IBM B;  1BZK A;  2CTR A;  3CX5 F;  5B1A B;  5BMV B;  1IBL O;  3ZN0 A;  5LXT B;  4DV6 B;  2JGD A;  3CCV V;  5IYD O;  2G38 A;  1YZB A;  4JI7 B;  3OAA G;  4RUE A;  2MW2 B;  3ABT A;  2AHY A;  2Q6A A;  5L3B A;  3SJB C;  4ZI7 B;  3IJ4 A;  4J42 A;  1YJN V;  1TUB B;  4GKJ B;  1GM7 A;  4CH4 A;  4MVS A;  3AG4 B;  1GK9 A;  2P4V A;  4K0K O;  3FB5 C;  3ZRV A;  1AJP A;  2O57 A;  1PD3 A;  1HNZ B;  2Y4U A;  3MD0 A;  1F51 A;  4J41 A;  2Z0A A;  3ETE A;  2UUB B;  4K8Z A;  1OV9 A;  4OX9 B;  4DR5 B;  1UFI A;  2A3Q A;  2QE7 G;  2JEU A;  3JAT A;  3GWO A;  5B1B C;  2WLN A;  2P67 A;  3RYC A;  1MAB G;  3A2F A;  3RYH A;  1D2D A;  1NU1 H;  4DR1 O;  5JH7 B;  1VP7 A;  3JAL B;  3ZHQ A;  5IWA O;  2A9H A;  2Y4T A;  3BEH A;  1WB8 A;  1R3L C;  2F23 A;  4O4J A;  1QLE C;  2XAG A;  3QTC A;  3OFN G;  1RFY A;  4UVB A;  2YDE A;  3CRQ A;  3CRR A;  4UUJ C;  3ASN C;  3EHB B;  1JR9 A;  1SQG A;  1J5E B;  2IJJ A;  2AZ2 A;  1HNX B;  2IW5 A;  3FX7 A;  1OCZ B;  4IIJ B;  3SJA C;  4I55 B;  4O4L B;  2EIJ C;  2QWR B;  1QVF U;  2IU0 A;  4JF3 A;  2OIE A;  4ABM A;  1VQ6 V;  2AHZ A;  1N32 B;  1YVW A;  2DMX A;  3RYF B;  5LL6 Y;  3LSU A;  4UXN A;  2HFE C;  1B04 A;  1OHH G;  3OMI B;  3M99 B;  4ZBM A;  4LC1 A;  2P4K A;  5D5P A;  1L0L H;  4LWS B;  4LFC O;  2QTS A;  5JJN B;  4J10 A;  4JI8 O;  2ZD9 A;  4YJ3 A;  2UXB B;  3JAS B;  5JVD B;  2Y69 B;  4LFB B;  4TT3 G;  3OUS A;  5CB4 B;  1JOY A;  3F5T A;  4Q6G A;  5DN6 G;  3U0Z A;  5KMG A;  3KG2 A;  4JI5 O;  2EIL B;  1KEC A;  3N27 A;  2F4V O;  4BIZ A;  1OCR B;  2IJK A;  1FS0 G;  2FTK A;  1U96 A;  3ZRS A;  4J9Z B;  4UV9 A;  2CTW A;  2X6A A;  1QCE A;  2F1M A;  4WFG A;  2XAF A;  4TQD A;  2E5L O;  2NR5 A;  1EFR G;  1H2G A;  4JAS A;  3K0G A;  1R1B A;  2QR4 A;  5TIS Z;  5LYJ A;  4DV0 O;  2AGA A;  2CTP A;  3STZ C;  4UV8 A;  3L9D A;  4HNA A;  1JQ0 A;  1I94 B;  3HKB B;  1XIL A;  5EYP A;  3JAK B;  1JMK C;  2VQE B;  4CC6 A;  2A79 B;  2JJ1 G;  2ZNI A;  3C3T A;  4ICG A;  3CCR V;  2FML A;  5GON B;  4E4E A;  4IYI A;  4MS2 A;  2DYR C;  1OCC C;  2QKA A;  2GTA A;  2E76 B;  4LF4 O;  1FFT B;  2ADP A;  2EBO A;  3M8A A;  4MSW C;  1XMO B;  4B3T O;  1VF6 A;  3TXQ A;  2B5U A;  2HP8 A;  4TSF G;  5CA1 B;  2OCH A;  5IJ9 A;  1RSO B;  2ZE5 A;  3JD1 A;  1RM1 B;  1GAX A;  4YHH B;  2ZIN A;  4IL6 Z;  4U3F H;  3QF7 A;  4JTD B;  1U97 A;  4DR2 B;  4JYY A;  1SS3 A;  2WLJ A;  4UCU A;  4TUY A;  2EIK C;  4J9Y B;  1R6N A;  1F4M A;  3B8M A;  3QNE A;  3BVO A;  5LMU B;  4LF7 B;  1XHZ A;  1MSW D;  1K5Q A;  1BGY H;  4W4L A;  1K73 W;  3TK1 A;  3RGB A;  1NTZ H;  3ABU A;  2DQ0 A;  3R66 A;  4TOI A;  2PI4 A;  4NXN B;  2BE3 A;  1XNR O;  2UUA O;  4FZ1 A;  4FM0 A;  2Q67 A;  1WP8 A;  4A5U B;  3M7M X;  1YCI A;  3OMN B;  4WF9 V;  3CC7 V;  2HEP A;  4I5S A;  3TGU H;  5B5E Z;  4QPK A;  1E1Q G;  1YIJ V;  1SER A;  3TCU A;  2ODM A;  4DV3 B;  1M4U A;  4U3J B;  1QU7 A;  3L70 H;  4LNU A;  4XDK A;  2ZE8 A;  5E79 Z;  3IC7 A;  4L87 A;  2Q7G A;  3CME V;  4UB8 Z;  1XUQ A;  4NTX A;  4JI7 O;  4YY3 O;  3HKD B;  1ZX3 A;  2EJR A;  2GTS A;  4DW0 A;  2XTA A;  2HJF C;  4PDV A;  1FYJ A;  3S3W A;  2OCC C;  3OTO O;  3SR2 C;  3L73 H;  1IZ3 A;  4GKJ O;  2QSA A;  4KP4 A;  1YSC A;  1M56 B;  1R6T A;  2WWW A;  3FYE B;  1M57 B;  2OIG A;  1N36 B;  1UJW B;  1AP6 A;  1ZL8 A;  3ASO C;  4MW8 A;  4ZHQ B;  3VQY A;  2UUB O;  1VF5 B;  2WPD G;  4OX9 O;  5C93 A;  4DR5 O;  1WN7 A;  4NB5 A;  4MTX A;  3RWR D;  4IHJ B;  1BSM A;  2H3O A;  3AG3 B;  2ZIO A;  1DF4 A;  3JAR A;  5LMN B;  2EZO A;  1CXZ B;  2VWK A;  1LUW A;  3WB2 A;  1FXK C;  3FAV A;  5KX5 A;  4JI3 B;  1OZ0 A;  2Y0P A;  1VQM V;  3H1K H;  3NR7 A;  5LGN A;  2OTJ V;  4AI8 A;  4LR3 A;  3ABM B;  4EB6 B;  4UFZ A;  2A7W A;  4O2B A;  3IGA C;  5FLX N;  1J5E O;  4I0X B;  1HNX O;  1BL8 A;  3Q4H A;  2UUC O;  3X2Q C;  3WG7 C;  1MOF A;  4FPP A;  4YIO A;  1ZTE A;  4O2A A;  3HB3 B;  1KB9 F;  1NH2 B;  2FL4 A;  1D5N A;  3CCL V;  1IVS A;  5KAF Z;  1KYO F;  3FB7 C;  4AIL C;  4H37 A;  1QR9 A;  2XOK G;  3RBZ A;  1N32 O;  1X59 A;  1LR1 A;  5EC2 C;  4FZ0 A;  4RUF A;  3CCU V;  2QA4 V;  5B1N A;  3U10 A;  5CN0 A;  1HNW B;  5GTI Z;  3ABL B;  3AG2 B;  4PHZ A;  1Q81 W;  2UXB O;  3BA9 A;  4LFB O;  3GWK C;  4P9O A;  4G2K A;  2GBO A;  3RN4 A;  4ZOL B;  5KHH A;  1H2L A;  1I5X A;  3K04 A;  3APQ A;  4RQE A;  4AQY B;  5LOV B;  3OTF A;  2DWD C;  3C3S A;  3PN1 A;  3HKC B;  1SQP H;  5JJJ B;  3MHS C;  3A8T A;  5C8Y A;  1M9N A;  3KZI Z;  5AG2 A;  2M7W A;  5L3C A;  4LH7 A;  4DR3 O;  1JPX A;  4I9Q A;  2CGN A;  4FLW A;  4QGP A;  5B1A C;  2E74 B;  5KA6 A;  4X20 B;  1N0J A;  4X65 B;  3SPH A;  1BHA A;  1I94 O;  3HPL C;  2LW1 A;  4PDM A;  2VQE O;  2QWQ B;  1YDX A;  4TV9 B;  1Q3E A;  2CAZ C;  1ZWI C;  2ZDI A;  1N34 B;  1TAE A;  2XAS A;  2WAM A;  1Y4M A;  1Q7Y W;  1SET A;  2EZP A;  1F23 A;  1GN6 A;  5IYZ A;  1XMO O;  1K34 A;  3AG4 C;  1FKA O;  1Y6X A;  4JI2 B;  1VAR A;  4CZZ A;  3ZMS A;  1WPB A;  3CCM V;  1HWY A;  1HR0 B;  4J7K A;  1W0K G;  2LJ2 A;  4WBN A;  3HKE A;  3CRM A;  5IY5 B;  4BW5 A;  3FFQ A;  1KP3 A;  3N2G A;  1MMM A;  1Y74 A;  2QJ1 A;  5LA6 B;  2R72 A;  1Y76 A;  1H2S B;  1K7D A;  5JQG A;  2QWO B;  4DR2 O;  2ZQM A;  2Z5U A;  3B40 A;  5BR8 B;  4JI1 B;  1WP7 A;  3ZIA G;  4G27 B;  4DW1 A;  4DK0 A;  2HVK C;  3CB2 A;  1K33 A;  5LMU O;  2ZCE A;  4LF7 O;  2PF4 E;  1AP5 A;  2V4D A;  4J11 A;  4LF6 B;  3I5D A;  2Y0I A;  4NXN O;  1LUV A;  1NBM G;  1Q6H A;  4WFF A;  1OCZ C;  3E8H A;  5DM6 V;  3H01 A;  2XAJ A;  1I08 A;  3RYI B;  5EZY A;  2IJH A;  4AHC A;  4WFA V;  3OGC C;  2IJI A;  4WFE A;  4R50 A;  1GMG A;  3RT3 C;  4NVP A;  1S76 D;  1IXM A;  4DV3 O;  3CE2 A;  3CJH A;  4FFB A;  4I4T A;  2R9R B;  3MHH C;  2CK3 G;  4PI2 A;  3E8G A;  1XI1 A;  5FPO A;  2GUZ A;  5J2U B;  1SES A;  3DC6 A;  1F7Y A;  3DXR A;  1R3I C;  2PYL A;  4LFA B;  3L74 H;  1CPY A;  2QKC A;  2CH7 A;  2Q68 A;  1OCO B;  5A2Q N;  4MVU A;  3SPG A;  2Y69 C;  1L0N H;  1CP9 A;  4P30 A;  2EIL C;  3E2E A;  4W4K A;  4OGQ B;  1N36 O;  1DGS A;  1OCR C;  2XT9 A;  3T2M A;  1H38 A;  1Z2G A;  4PI0 A;  3CRC A;  2Q0O C;  1XEQ A;  5CA0 A;  4B3R B;  4LH6 A;  1ZLZ A;  1GM9 A;  2YEV B;  4MVQ A;  3K5O A;  4CBC A;  3CMA V;  4DXW A;  1VQ4 V;  1MZE A;  3J7A U;  1G6U A;  1RP3 B;  2E75 B;  4GCZ A;  1X4T A;  5LMN O;  2QM4 A;  3B2E E;  3OR7 C;  4DV1 B;  2ATK C;  4JI3 O;  1ZUQ A;  1VIB A;  3VQV A;  2LFS A;  3D36 A;  3CPW U;  3K3W A;  1GO3 F;  3G71 V;  1SZX A;  3ZS8 C;  2KG7 A;  4D6T H;  2QWN B;  4UCS A;  4FLX A;  3ZHT A;  1GN4 A;  1FFX A;  1DF5 A;  2Q5Z A;  3B4S A;  1NVP B;  4KHP B;  2ZE6 A;  1H2K A;  3G6B A;  3T1C A;  3VOU A;  1QLN A;  4CS4 A;  1ZSP A;  5LP6 B;  3P3P A;  3UT5 A;  3FD9 A;  5EIB C;  4H13 B;  4R7C A;  1H8H G;  3CSX A;  4JAU A;  3SYQ A;  4NR1 A;  4QPJ A;  4JYA B;  4DR6 B;  4GKK B;  2QM7 A;  4CH5 A;  1RM1 C;  2ITD C;  4X1K A;  1Y66 A;  2X7R B;  4TQF A;  3JAT B;  3RYC B;  3RYH B;  1AR5 A;  1KMI Z;  2IU3 A;  3E89 A;  2VQF O;  2DOS A;  4PJ0 Z;  3S3X A;  3PJS K;  5H5N A;  2IH1 C;  5HFM A;  4O4J B;  4HYO A;  1VQK V;  1PL4 A;  4JI4 B;  2Y48 A;  3UO2 A;  2IH3 C;  3F7V C;  3EFF K;  4AQY O;  2YI9 A;  2P06 A;  4H44 B;  1JCH A;  3CC4 V;  3BAB A;  1S3J A;  1TA8 A;  4DV5 B;  1JX9 A;  1XMQ B;  2XAQ A;  2UXX A;  1JJ2 U;  2AW9 A;  4IGG A;  3G6E V;  3K5L A;  1YHQ V;  3AEI A;  4ASU G;  2IBZ H;  2BSK A;  1V54 B;  4QIW F;  3ML0 A;  3ZHU A;  1BS3 A;  4LBE C;  2DE0 X;  3RW0 A;  2L6L A;  3ZBH A;  4FLV A;  4MTO A;  2QGN A;  2MK3 A;  3LDE A;  4X9Q A;  5KUK A;  4LF8 B;  2WLK A;  2DQ3 A;  3F7Y C;  2L35 A;  2OWO A;  2DN9 A;  4YJ3 B;  4OPA A;  3G67 A;  4DUY O;  3JAK A;  3N2K A;  3WU2 Z;  4TWK A;  3B77 A;  2ZR3 A;  3UM7 A;  2X6C A;  1EZJ A;  1M56 C;  5CBF A;  1YTF D;  1XNQ B;  1M57 C;  3ABK B;  1I5Y A;  5JJE B;  4JAV A;  3WB0 A;  3ZMV A;  1PM9 A;  1NR7 A;  2Q9L A;  4R6Z A;  1IBK B;  1FJG B;  2PTM A;  1Y67 A;  4JI0 B;  4D7T A;  1K9M W;  1ZAU A;  4EEQ A;  2P5O A;  2QKS A;  4I9W A;  1S72 V;  4MVM A;  1VQ8 V;  5B66 Z;  4B3M B;  3AG3 C;  4O4I A;  5BR8 O;  5EBW C;  1MG1 A;  3JD4 A;  5LYJ B;  4JI1 O;  1IX9 A;  2R9I A;  4HNA B;  2F66 C;  3H1I H;  3BPZ A;  2PYJ A;  5EYP B;  4J7J A;  3OUF A;  4X1Y A;  2EX3 A;  4XBF A;  4LF6 O;  1P49 A;  4FVM A;  1BT8 A;  3ABM C;  2JS3 A;  2N05 A;  1SQX H;  1JFF A;  3LDD A;  3OEE G;  3QVN A;  1N0N A;  2W0F C;  4D7S A;  3DSQ A;  5IJ9 B;  1US6 A;  4F6R A;  3E22 A;  2JK5 C;  3CP1 A;  2P22 C;  4X64 B;  1H2M A;  2ZM6 B;  4PA7 A;  2OYQ A;  4PA4 A;  4TUY B;  5GTH Z;  1R3J C;  2ILM A;  5JWP A;  4LFA O;  4MT8 A;  3ABL C;  2DYS B;  3AG2 C;  3DTU B;  2JVD A;  5H2F Z;  1IBM O;  2CDY A;  2HJD A;  3BHP A;  4DV6 O;  3CCJ V;  4TV8 A;  3K03 A;  1N33 B;  2W6I G;  5CA3 A;  1XOU A;  1HDJ A;  4IYH A;  1MSD A;  2ITC C;  2WLL A;  1PNL A;  2YIC A;  2B1G A;  3H1J H;  4Z2W A;  1K3E A;  4YJ2 A;  3IC9 A;  4B3R O;  4QJF B;  2K1E A;  1AIL A;  3EXA A;  3CXH F;  4HBN A;  1FAF A;  3FB8 C;  1HNZ O;  4C7U A;  1DTO A;  2PI5 A;  2A06 H;  4LNU B;  4UCV A;  5ITZ A;  4DV1 O;  5KHJ A;  3A0H Z;  3JD2 A;  3SDL A;  4JGS A;  3P3N A;  4FFK A;  1F4N A;  4DR4 B;  1S5H C;  2CGO A;  3OE7 G;  1PPJ H;  3STL C;  4KHP O;  2DJV A;  3W7U A;  4PA3 A;  1BQZ A;  4EB6 A;  1AB3 A;  2YXL A;  2ARH A;  4DO2 A;  1HW7 A;  4GX2 A;  4EFE A;  1R6K A;  1PP9 H;  4K0K B;  1ZL8 B;  2JGU A;  4DK1 A;  4NXM B;  4E2L A;  4DR6 O;  4JYA O;  4OPH A;  2HG5 C;  1BE3 H;  5IY5 C;  3J81 N;  4LCU C;  3JSL A;  1M93 A;  3LUT B;  1NQT A;  1FXV A;  3W7T A;  3JAR B;  2W0X A;  1S0V A;  3T1H B;  4Q20 A;  2JIZ G;  3FAV B;  2RMK B;  1O9G A;  4PA9 A;  5B3S B;  5KX5 B;  1EN4 A;  4QE9 A;  3SYC A;  3JD3 A;  3E8B A;  5IWA B;  4PV1 B;  4JI4 O;  2V7Q G;  3E83 A;  3L75 H;  2D3O W;  4DV2 B;  5EBM C;  1WB7 A;  3O65 A;  3LSQ A;  4O2B B;  1QR8 A;  4F6E A;  3ZCC A;  3Q4H B;  3CWB H;  2ZIM A;  1XMQ O;  3SPC A;  4O2A B;  3KKY A;  2V1D A;  4DRX A;  4B3S B;  5FNV A;  5LOV A;  1BCC H;  5JCO C;  1URF A;  1P84 F; 
#chains in the Genus database with same CATH homology
 3OMI B;  1NVP D;  3M99 B;  2R9R B;  3MHH C;  4LC1 A;  4ZBM A;  1E1R G;  2P90 A;  5H6R A;  5L3G A;  2CK3 G;  3E8G A;  2KB1 A;  5IDJ A;  5B1O A;  2W6J G;  1SES A;  2ZD9 A;  3LNM B;  4X89 A;  1R3I C;  1AI7 A;  3JD0 A;  4GX0 A;  5CBH A;  1YJW V;  2Y69 B;  1CPY A;  4TT3 G;  4MVR A;  3OUS A;  5HFL A;  1JOY A;  4XDL A;  5DN6 G;  3OR6 C;  3KG2 A;  2Q68 A;  3FB6 C;  3D3I A;  4WFB V;  3CD6 V;  1OCO B;  2EIL B;  2X6B A;  1FXH A;  4MVU A;  1AJQ A;  3SPG A;  4N21 A;  2Y69 C;  1KEC A;  2ZXW B;  1W0J G;  4BIZ A;  1CP9 A;  1OCR B;  2P6J A;  4P30 A;  2IJK A;  1FS0 G;  2FTK A;  3CCS V;  2EIN B;  1OCO C;  1PNM A;  2EIL C;  2NLJ C;  3ZRS A;  3E2E A;  4X88 A;  4J9Z B;  2ZXW C;  1KKD A;  5CBG A;  3ZN1 A;  4UV9 A;  3RVZ A;  5EBL C;  1OCR C;  5LHI A;  2X6A A;  2DWE C;  3T2M A;  1QCE A;  2EIN C;  5L3D A;  3JCZ A;  3SYP A;  1H38 A;  1KD1 W;  1TUE B;  3AG1 B;  1ROP A;  2WSS G;  2XAF A;  1FXK A;  3E8F A;  4WFG A;  1GM8 A;  1Q82 W;  2WLL B;  2DW4 A;  1GM9 A;  2YEV B;  1EFR G;  1H2G A;  4MVQ A;  4CBC A;  2ZR2 A;  3CMA V;  4JAS A;  3AG1 C;  4GX1 A;  4DXW A;  2F43 G;  1AR1 B;  3K0G A;  1VQ4 V;  2Q69 A;  3RVY A;  4GCZ A;  4Z1M G;  3F5W C;  1K92 A;  3STZ C;  3K08 A;  4UV8 A;  3ZJZ A;  3OR7 C;  1JQ0 A;  4RAI A;  1B6Q A;  4ZKI A;  2ATK C;  2DYR B;  1OCC B;  3I55 V;  2A79 B;  1BHB A;  2JJ1 G;  3OM3 B;  5H6Q A;  1AI5 A;  3CCR V;  2WLM A;  5LGU A;  2LFS A;  3D36 A;  1NR1 A;  4MS2 A;  1G8M A;  2DYR C;  3CPW U;  1OCC C;  3K3W A;  3LDC A;  1GO3 F;  3G71 V;  3OW2 U;  4HAM A;  1FFT B;  3BY6 A;  4MSW C;  2EBO A;  3SPJ A;  1DF5 A;  1NVP B;  3TET A;  2BOC C;  1RPO A;  4MW3 A;  2B5U A;  2GHY A;  4TSF G;  2GSM B;  3T1C A;  4FIP C;  1KP2 A;  3VOU A;  1QLN A;  3JD1 A;  1RM1 B;  2WLI A;  2ZDI C;  1K5S A;  1SRY A;  1QBZ A;  4FK5 C;  1J95 A;  4R7C A;  4QE7 A;  3IFX A;  3ZRW A;  1H8H G;  2EIK B;  4JAU A;  3SYQ A;  4QPJ A;  2QM7 A;  4JTD B;  3K0D A;  3OEH G;  1RM1 C;  2ITD C;  1Y66 A;  2X7R B;  1WLE A;  2WLJ A;  2EIK C;  1V55 B;  5KA5 A;  4J9Y B;  1R6N A;  1XL4 A;  1F4M A;  2IU3 A;  3B8M A;  5LGT A;  1LNQ A;  3E89 A;  4N23 A;  3QNE A;  3ZRX A;  3ETG A;  3OMA B;  1V55 C;  3PJS K;  5H9C A;  2IH1 C;  1DLB A;  1MSW D;  1K5Q A;  1XL6 A;  2H8P C;  1W2B U;  5HFM A;  1K73 W;  4HYO A;  3WFV A;  1VQK V;  5KUM A;  1YI2 V;  2Y48 A;  3TK1 A;  2PI4 A;  3ABU A;  2DQ0 A;  4FJC C;  4GX5 A;  3B8N A;  4X8A A;  5CMU A;  3ZMZ A;  4G28 B;  2IH3 C;  3F7V C;  3JYC A;  3W7X A;  3EFF K;  2Q67 A;  3CC4 V;  1JCH A;  4MTF A;  3OMN B;  1M1K W;  4WF9 V;  1S3J A;  3QO5 A;  4PDL A;  3CC7 V;  1VQO V;  1JX9 A;  4I5S A;  1M90 W;  2XAQ A;  2UXX A;  1JJ2 U;  4QPK A;  1E1Q G;  1YIJ V;  4QNH B;  4PDR A;  1RPR A;  1AJN A;  1SER A;  3G6E V;  1SZT A;  3ETD A;  3TCU A;  3VBB A;  1YHQ V;  3AEI A;  2LFR A;  4ASU G;  1G4Y B;  1V54 B;  4QIW F;  4XDK A;  3T4D A;  1KQS U;  3IC7 A;  3ML0 A;  4L87 A;  4P2Z A;  3CME V;  2OCC B;  1AI4 A;  4LBE C;  4MTG A;  1V54 C;  3RW0 A;  3T4Z A;  4H33 A;  1NH2 D;  2EJR A;  3R65 A;  2HJF C;  4PDV A;  4MTO A;  2Z3Y A;  1K4C C;  2OCC C;  3QO8 A;  3QO7 A;  4BAY A;  2MK3 A;  3LDE A;  4LP8 A;  3A0R A;  5KUK A;  2WLK A;  3CCE V;  2DQ3 A;  3F7Y C;  1VQN V;  4KP4 A;  4MVO A;  5EC1 C;  1YSC A;  1VQ7 V;  1E79 G;  3SYA A;  1EBO A;  1M56 B;  4JPR A;  3ASO B;  2H94 A;  2WWW A;  1N8R W;  3FYE B;  4TWK A;  1M57 B;  4JTC B;  3B77 A;  2ZR3 A;  4WFH A;  3UM7 A;  2X6C A;  3G4S V;  1CEZ A;  3K06 A;  1UJW B;  1EZJ A;  1K4D C;  1M56 C;  4XDJ A;  1NJI W;  5CBF A;  2XAH A;  3NXS A;  1YTF D;  5LHH A;  3ASO C;  4MW8 A;  3SPI A;  2C2A A;  4MVZ A;  1M57 C;  3ABK B;  1YIT V;  3CCQ V;  2JDI G;  1I5Y A;  2WPD G;  4KFM A;  5C93 A;  4JAV A;  1JVM A;  3ZMV A;  5IYB O;  1NR7 A;  4R6Z A;  4MTX A;  1VQP V;  3FKS G;  3W7W A;  3ABK C;  2JJ2 G;  3AG3 B;  4F4L A;  1DF4 A;  1FXK B;  1GKF A;  3LSS A;  3UKM A;  1K9M W;  2EZO A;  2QKS A;  4I9W A;  1NKD A;  1S72 V;  4MVM A;  1VQ8 V;  3AG3 C;  1R73 A;  4JTA B;  1FXK C;  1OZ0 A;  4OXS A;  4R8C A;  5EBW C;  1MG1 A;  3JD4 A;  1VQM V;  2EIM B;  2R9I A;  2QTO A;  3K9A A;  2OTJ V;  5LGN A;  4U7O A;  3X2Q B;  3WG7 B;  3ABM B;  3OUF A;  1YJ9 V;  4XBF A;  2EIM C;  3IGA C;  2B1I A;  3E35 A;  2OT5 A;  2X0L A;  1BL8 A;  2HKO A;  4UVA A;  3X2Q C;  5LHG A;  3WG7 C;  1MOF A;  3ABM C;  4FPP A;  5IYC O;  3HB3 B;  1NH2 B;  3LDD A;  3OEE G;  4FMT A;  3CYO A;  5FL7 G;  2HVJ C;  1KC8 W;  2QM8 A;  2W0F C;  3CCL V;  4P9P A;  2BOB C;  3FB7 C;  4H37 A;  1QR9 A;  2XOK G;  2XND G;  5L3F A;  3RBZ A;  3ZMU A;  2WLI B;  1P4R A;  5EC2 C;  4EKW A;  4RUF A;  5E1A C;  3CCU V;  2QA4 V;  5B1N A;  2JK5 C;  3CP1 A;  5CN0 A;  3ZRW B;  4WCE V;  4PEL A;  3ABL B;  1VQ9 V;  3AG2 B;  1YTF B;  4PA7 A;  4PA4 A;  1R3J C;  5LBQ A;  1P7B A;  5BZB A;  1BMF G;  2HR3 A;  2YSU B;  2WLH A;  4HZ3 A;  4MT8 A;  1Q81 W;  1QVG U;  3ABL C;  3SYO A;  2DYS B;  3AG2 C;  3DTU B;  3SJQ C;  4BIU A;  3DGE A;  4P9O A;  4G2K A;  3ZMT A;  1I5X A;  3CCJ V;  3K04 A;  4RQE A;  2DYS C;  3K03 A;  1K97 A;  2W6I G;  4U7N A;  5CA3 A;  1ARO P;  2DWD C;  2ITC C;  2P7T C;  2WLL A;  1PNK A;  1PNL A;  3CC2 V;  2YEV A;  4KUM A;  5EK0 A;  3MHS C;  2NNU A;  2B1G A;  4YXW G;  1K3E A;  1M9N A;  1THZ A;  5B1A B;  4QJF B;  2K1E A;  2M7W A;  3ZN0 A;  5L3C A;  1VQ5 V;  1JPX A;  3CCV V;  5IYD O;  5B1A C;  3FB8 C;  1Q86 W;  4RQF A;  5KA6 A;  3OAA G;  4RUE A;  1DTO A;  2PI5 A;  3ABT A;  1VQL V;  3SPH A;  1BHA A;  2AHY A;  1AI6 A;  2Q6A A;  3HPL C;  5L3B A;  4PDM A;  4JYB A;  1YJN V;  2HLD G;  3JD2 A;  1GM7 A;  1ZWI C;  4MVS A;  5L3E A;  3AG4 B;  1GK9 A;  4JGS A;  2ZDI A;  3FB5 C;  3ZRV A;  1AJP A;  1F4N A;  2XAS A;  1S5H C;  2WAM A;  1PD3 A;  1Y4M A;  1Q7Y W;  1SET A;  3OE7 G;  1VQ6 V;  2EZP A;  1F23 A;  5GW7 A;  1K34 A;  3AG4 C;  3STL C;  1ORQ C;  3MD0 A;  1F51 A;  4PA6 A;  3W7U A;  4PA3 A;  4CZZ A;  4UVC A;  5B1B B;  3W7S A;  3ETE A;  3P30 A;  3CXC U;  1K8A W;  4RO2 A;  3ZMS A;  3CCM V;  1HWY A;  4DO2 A;  1W0K G;  2QEX V;  1PL0 A;  4GX2 A;  2QE7 G;  1COW G;  2JEU A;  1R6K A;  4BW5 A;  1KP3 A;  3GWO A;  3FYI B;  5B1B C;  5IY5 B;  2WLN A;  2P67 A;  1MAB G;  4E2L A;  1K7D A;  2HG5 C;  1QLE B;  5IY5 C;  2ZQM A;  2A9H A;  4LCU C;  2JEX A;  1ENV A;  3BEH A;  5J9P C;  2Z5U A;  1R3L C;  3LUT B;  3ASN B;  1WPX A;  1NQT A;  1QLE C;  2XAG A;  1FXV A;  3W7T A;  3I56 V;  1H8E G;  3ZIA G;  4G27 B;  2HVK C;  3OFN G;  1K33 A;  1R3K C;  4UVB A;  1L1F A;  2OTL V;  1S0V A;  4UUJ C;  3ASN C;  3GB7 C;  3EHB B;  4Q20 A;  2JIZ G;  4PA9 A;  5B3S B;  2UXN A;  4JYC A;  2IJJ A;  4QE9 A;  3SYC A;  2IW5 A;  3E8B A;  3JD3 A;  2V7Q G;  3E83 A;  1OCZ B;  2EIJ B;  2D3O W;  2LP7 A;  5EBM C;  5B3S C;  1S77 D;  3LSQ A;  1GTO A;  1NBM G;  3P32 A;  1QR8 A;  4WFF A;  1OCZ C;  2EIJ C;  3E8H A;  3ZCC A;  5DM6 V;  3H01 A;  2XAJ A;  1QVF U;  2IU0 A;  2IJH A;  4JF3 A;  1PKX A;  2A0L A;  4GT1 A;  3K79 A;  3OGC C;  3SPC A;  4WFA V;  2IJI A;  2V1D A;  4WFE A;  2AHZ A;  3E86 A;  4R50 A;  4UXN A;  1GMG A;  2HFE C;  1S76 D;  1IXM A;  1OHH G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...