3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
3FB8C 5CBGA 4MSWC 1G4YB 4R6ZA 3AG3C 1V55C 3K08A 5CBHA 3STZC 3E86A 2A79B 2W0FC 2WLLA 4PDLA 3K06A 3ASNC 3IFXA 3UKMA 4UUJC 3OUFA 4X88A 3SYQA 5EBLC 5IY5C 2HVJC 3OR7C 4TWKA 4H37A 4KFMA 3FB7C 4LBEC 4X89A 2EILC 3FB6C 4MVUA 1K4CC 4GX1A 4MTFA 3EFFK 4XDLA 4PDRA 2HG5C 3AG2C 2ZXWC 4CBCA 3WG7C 2QTOA 1OCCC 4RAIA 2HVKC 3RW0A 3E8FA 4WFGA 3KG2A 2WLHA 4QE7A 3T1CA 2WLMA 4PA4A 4F4LA 1R3LC 1M57C 1QLEC 2Y69C 3K0DA 4GX0A 4JTAB 3STLC 3GB7C 3E8BA 2Q67A 3LDDA 3LUTB 2A9HA 2IH3C 4P30A 2DYRC 5E1AC 1P7BA 3T4DA 1S5HC 4BW5A 2X6AA 4GX2A 4PDMA 2EIJC 3ASOC 1J95A 3SYPA 3SYAA 2A0LA 3F7VC 2QKSA 2EINC 2ITDC 2ITCC 3E83A 3ZRSA 2WLNA 2YEVA 4MVQA 1V54C 1OCOC 2EIKC 4GX5A 5J9PC 4P2ZA 4XDKA 2DWEC 2ATKC 3K04A 3RVZA 4LP8A 4EKWA 3K03A 4J9YB 1R3IC 1ZWIC 3X2QC 3BEHA 2HJFC 4ZBMA 3SYOA 2NLJC 2P7TC 4MS2A 4P9PA 4R50A 3OUSA 3SPCA 4WFEA 4MVMA 2JK5C 3R65A 4XDJA 4RUEA 3UM7A 2EIMC 3LDCA 3F7YC 5EC1C 2H8PC 2Q6AA 3E8GA 2Q69A 3F5WC 3OGCC 4MW3A 4QE9A 5BZBA 4RUFA 1LNQA 2KB1A 3LDEA 4WFHA 3E8HA 2WLJA 5EC2C 3AG4C 4WFFA 2BOCC 2DYSC 4OXSA 1M56C 5KUMA 4G27B 1ORQC 1R3JC 4MVRA 1KKDA 4MVOA 4J9ZB 3SPIA 1K4DC 3ABKC 4JTDB 4LCUC 3RBZA 2ZD9A 3SPHA 4MW8A 3TETA 3K0GA 1BL8A 2X6BA 4HZ3A 2WLKA 4PA7A 3VOUA 5KUKA 5CBFA 1JVMA 2OCCC 2K1EA 1R3KC 4RO2A 5B1AC 2DWDC 2WLLB 2WLIB 5B3SC 4P9OA 2WLIA 2AHYA 1OCZC 4H33A 2AHZA 1XL4A 3AG1C 4G28B 5EBMC 1OCRC 4PA3A 3SJQC 4MTGA 4JTCB 4HYOA 4MVSA 3HPLC 4MVZA 4PA9A 3RVYA 3LNMB 3PJSK 2X6CA 3SPGA 3E89A 4X8AA 3ABMC 4R8CA 5B1BC 3JYCA 4PDVA 5EK0A 4R7CA 5EBWC 3ZJZA 3SYCA 4DXWA 3OR6C 2Q68A 4MTOA 2BOBC 3TCUA 4I9WA 4QNHB 3T2MA 4PA6A 3T4ZA 2HFEC 3ABLC 2R9RB 3IGAC 1XL6A 2IH1C 3FB5C 3SPJA
chains in the Genus database with same CATH superfamily
1S5LZ 5JH7A 4JYCA 2QEXV 1ENVA 1SKVA 4U3JA 3R66A 2OCCB 3FFQA 2HVJC 4IIJB 2EILC 1XREA 4YXWG 2OTLV 4CZZA 5IT9N 4GKJB 5FLXN 3OTOB 1SQGA 1XMQO 2WLHA 1OCZB 4UXNA 1K5SA 2QTSA 3CRQA 1YDXA 2QWPB 2W0XA 2P5OA 3BY6A 1WLEA 1PNKA 4JI1O 4H44B 2QKSA 3ZMSA 1OCOC 4JI3B 5D5QA 4J7KA 4K0KB 5L3FA 2JJ2G 2YI9A 5E79Z 1G1XB 2ZE5A 2EBOA 4MVMA 1LUVA 2BTOA 1R73A 4TSFG 1GN2A 5BZBA 2B1GA 2F66C 2Y0IA 3IAYA 3P3NA 1AR5A 3E22A 1DGSA 1H2GA 1SERA 4IL6Z 1N0NA 1M5IA 4U7OA 4JI6O 2CTWA 4TV8B 5IYZB 3L70H 2QWQB 2QWRB 3SJAC 5CBFA 2XHBA 5GONB 4X64O 4DR5B 2RNBA 2FKXA 3OFNG 1Q86W 2ZDIA 3K9AA 2WWWA 4TQFA 1NQTA 4LFAO 1NH2D 1VF5B 2JGDA 1SETA 3E22B 1AR1B 1AJPA 4MTOA 5CMUA 4QIWF 3TGUH 3CD6V 1JMKC 1SA0A 2JEXA 1AROP 2VQEB 3CCRV 1PL0A 1G4YB 3K08A 3ZRXA 2P4KA 4PDLA 2ZQMA 2UXBB 3ASNC 2IJIA 4NYKA 2H94A 4ZHQA 1NU1H 1N0JA 4G2KA 5LGUA 2PUSA 1IBMB 4XDLA 2Q73A 2QTOA 3ZBHA 4Q20A 2FB5A 4X9QA 3ZHTA 3T1HB 1N36O 1Y74A 1HR0B 4CH4A 2M7WA 3ZHSA 4K8ZA 2KKWA 3H01A 2PTMA 4P30A 1AI4A 3EXAA 2QWNB 1P7BA 3C90A 1R6NA 3G80A 4YJ2B 1GKFA 4JZGA 1SQQH 4P2ZA 2DWEC 5LGNA 4LP8A 4OGQB 4QPJA 3ZN0A 3OGIB 2NLJC 4JI0B 2OCHA 4B7EA 1HNWB 3H1IH 3OTOO 1FAFA 1O9HA 4IT5A 3ZRWB 1VQ6V 2AGAA 2QSAA 3I5DA 1HW7A 3CB2A 4J10A 3BVOA 3ASOB 4KP4A 3VQVA 5ITZB 3MDSA 2X6BA 4LF4B 5C8YA 1M4UA 2OCCC 3OMAB 3RFRA 3JAMN 3SJQC 4U7NA 3CRCA 2HEPA 1XDCA 3RVYA 2BSKA 3O65A 4FM1A 4J7ZA 4R8CA 3B8NA 4DV4B 3A0BZ 1QR9A 4CS4A 1XUQA 4X65B 5AG2A 1XEQA 1NJIW 4JI5O 1XBLA 4J7JA 4B3RB 2LGQA 4JYAO 2ARHA 4JAAA 1XOUA 3S3WA 2CTPA 5EBLC 1IXBA 3OM3B 2Y0PA 3K79A 1FD9A 2JVDA 2DQ0A 3EFFK 1QNMA 5IYBO 3CE2A 3AG2C 1JJOA 1BT8A 4FLYA 3AG1B 3SJCC 2CAZC 1N33O 1W0KG 3ZEDA 2IH3C 3T4DA 3FYEB 1ZX3A 3WB1A 1K5QA 3O9OA 4IYHA 2F4VB 3OMIB 3ZRSA 3CJHA 4JI7B 2YEVA 4OPHA 1PKXA 1YCIA 3DC6A 5JJNB 1K33A 1ZWIC 4DR7O 3BAAA 4YJ3B 4BWAA 1FFTB 4P9PA 1OCRB 4K3AA 2IM9A 4QE9A 4LF6O 2AXTZ 5B1NA 4X62O 2L35A 1YJNV 3NR7A 2DYSC 3JARB 3CCUV 4IGGA 5KMGA 5HFLA 4ZOLB 4ABMA 1Y67A 1IBKO 4HNAB 1Y4MA 4LR3A 1WP7A 1SQPH 5DEDA 5B1AC 1YXBA 3KCXA 1VQ4V 4Z1MG 4LF9O 3UO3A 4GKJO 1OCCB 5B5EZ 4LF5O 1Q6HA 2ZNIA 1OJHA 4X8AA 2PI5A 2PGGA 3ZRVA 4DXWA 3RYFA 1ROPA 4I9WA 3DXRA 4I9QA 4WFBV 2UUBB 2DOSA 5J2TA 2EIJB 3A2FA 3FB5C 1HNXB 1IBLO 4JI3O 3L74H 3SYQA 4RQFA 1RM1B 2V7QG 4MTFA 1F7YA 3RYHA 1AP5A 2XAGA 2ZXWB 2O57A 5K1PA 1M57C 1R3LC 1ZTEA 1DF4A 2Y48A 1K34A 2GDSA 4BW5A 1S5HC 2ZE7A 3W7TA 3ASOC 2DE0X 3AK2A 1S5JA 1GM8A 1GO3F 3E83A 3K04A 1VIBA 5B1BB 5BR8B 2Q0OC 5H2FZ 4B08A 5FNVA 5LXTB 3IJ4A 2VWJA 2ZDIC 1P4RA 2RJZA 2Q6AA 2VRZA 4JI2B 5LGTA 3VBBA 3OEHG 1I94B 5LP6C 2X0LA 5KAFZ 3BABA 3SJBC 1KYOF 1GTOA 5KUKA 1AJNA 2F4VO 4K35A 1YTFD 4O4JA 5IJ9B 1IBMO 5CA0B 3B8MA 4G28B 3L71H 5B66Z 3G6BA 3JCUZ 4LH7A 3CMAV 4ZKIA 3ZCCA 1BS3A 3DC5A 3LDCA 2HP8A 4JV5B 3OEEG 3W7WA 2W0FC 1VQNV 4O4HB 4UUJC 4H37A 4KFMA 1K4CC 4I4TB 4PHZA 4LF9B 2LFSA 4FFBB 1S72V 3B77A 1IVSA 3RW0A 1CPYA 1JFFB 4DV7O 2YSUB 4N21A 1L0LH 2YDEA 2HHHB 4DV2B 4UCSA 4DR6B 1VQMV 3STLC 2A9HA 2W6JG 4J42A 5TISZ 1QVGU 4DW0A 1NR7A 5LP6B 1F4NA 2K9PA 4DV1B 5IJ0A 1V54C 1SQXH 4J80A 1VQKV 4XDKA 1F23A 2A7WA 1I5XA 3BEHA 2N05A 4KUMA 1VQLV 2IJJA 1M1KW 5JH7B 2OWOA 4DV4O 4JPRA 1YVWA 1QLEB 2UXBO 1D2DA 3UCSC 3D36A 3E8HA 4FMTA 2KG7A 5KUMA 2WSSG 4G27B 1RPOA 4AQYB 5JCOC 4HAMA 1NTZH 5JJJB 2BCCH 4DV0B 2FL4A 4E2LA 3QG5A 4DR7B 3T1HO 1N36B 1NVPB 4GCZA 1HR0O 2HKOA 1OCZC 3ZS8C 3OAAG 4DR4B 1IDSA 4GZRB 4HYOA 2VQFO 3ABKB 4DV5B 1WA8B 4IHJB 3SPGA 3BA8A 5BMVB 3JAKB 1N33B 4I55A 4I5SA 4LWSA 4JYBA 3P32A 2EINB 2HFEC 1DTOA 3SR2C 1ZL8A 2CH7B 2R9RB 3APQA 3BCCH 3N27A 5CBGA 3LSUA 4TOIA 3HKBA 2PY5A 3ML0A 4O4JB 3UKMA 1SQBH 2DMXA 3BPZA 4B3SB 1TVKA 1WJZA 1J5EO 4LFBO 4O4IA 3C3TA 3JASB 4GX1A 1YSCA 4DW1A 3TJTA 1OCCC 3TXSA 1XI1A 3AG4B 4ZI7A 2WLMA 4PA4A 1H2NA 5FNVB 5LXTA 2HJDA 2Q67A 1OHHG 1ZAUA 2GBOA 4X1YA 3UT5B 1COWG 3CP1A 1AILA 1JPXA 4JYYA 2N74A 3MHSC 1WAZA 3H9VA 4X1KB 2JIZG 2WLNA 3B2EE 1GRJA 3IC7A 2ATKC 4EKWA 2Y4UA 2HJFC 4X65O 1GH6A 1URFA 5GW7A 3G4SV 2UUCO 1Z2GA 2N04A 1A32A 3RYHB 3HKDA 4MVRA 1AI6A 3RBZA 1FXKB 2EX3A 2ZD9A 3SPHA 3JD1A 1US6A 4DO2A 4FLWA 3Q4HB 1PM9A 1DK1A 2UU9O 2UXCO 2QM8A 2Y4TA 1R3KC 4RO2A 5CA0A 5CA3A 3AG1C 5F2VO 5J2UB 2R72A 3AG3B 3GWOA 4MVSA 1KKCA 4MVZA 2GUZB 4PA9A 3HKEA 4JI4B 1JOYA 1AP6A 4UVCA 3RYFB 1L0NH 3ABMC 1MABG 1K73W 3A8TA 2Q68A 1FFXB 4BIZA 4X66B 4DR1O 3RYCA 4LC1A 3IGAC 1YF2A 4TQDA 4JASA 5B1OA 5J2UA 1MZEA 1KB9F 3CHXA 2JEUA 5CBHA 3T1YO 2ZM6B 4LNUB 3J7AU 3OUFA 2RN9A 1MSDA 3OMNB 4DUYO 4I0XB 3BA9A 1QLNA 3RYIB 4NTWA 3JSNA 4ZOLA 4MVUA 1SZXA 1N34B 4UCRA 5KMGB 4PDRA 3HKDB 4YY3O 3JARA 3ZHQA 4RAIA 3HB3B 3KG2A 3ETEA 2P4VA 2Y69C 1H2SB 2XAQA 4KHPB 1NBMG 5LHGA 2E3CA 4JTAB 4GKKO 2XASA 2IU3A 1QR8A 2X6AA 4L87A 1H2KA 1WP8A 3ZMZA 3BHPA 4DYLA 3F7VC 1QHTA 1YJWV 5JQGB 2EILB 4X1KA 4B3SO 1HNZB 4YHHB 2CUGA 1K3EA 5L3CA 3K03A 3DSQA 4FFKA 4X1YB 1G8MA 4LF7O 4DV7B 1JA8A 2VS0A 1NTMH 4LF4O 1Y76A 2H8PC 5B3SB 5J2TB 4E4EA 1IBLB 2LJ2A 3RYCB 5IWAO 1Q90D 1FFXA 3JASA 3JALB 4OPAA 2Q7EA 1BL8A 2ODMA 4GLXA 5B3SC 4RQEA 2AHZA 3H1HH 4MTGA 2CH7A 4JTCB 1NKDA 3Q4HA 5KLVH 2PI4A 1P84F 3ZHUA 1R6TA 1IXMA 1FKAO 2BTQB 2QJ1A 4CC5A 5EK0A 2PYJA 4O2AA 4DV2O 2EIKB 4IHJA 4JI6B 3F5TA 3ABLC 4NVPA 1BQ0A 1KC8W 1B04A 3AK3A 1EN4A 1IZ3A 3STZC 1TUBA 3K06A 1NH2B 3IFXA 4YJ3A 5C8YB 2QKCA 1XMOB 5H6QA 5BXZA 5IY5C 5KHHA 2RQ6A 1CEZA 1EN5A 4LF8O 1AI7A 2DW4A 3CX5F 1BGYH 2ZKOA 2UUAB 4FLTA 1N32O 1GK9A 1B6QA 3W7UA 4NXMO 3VQXA 3CSXA 4TUYA 3P3PA 2YXLA 5JWPA 1NI8A 3LDDA 4DR1B 1L8DA 2Q4PA 4FLVA 3G6EV 4Z2WA 2HLDG 5JCOA 4JI8B 4MVQA 1RFYA 1VF6A 2R9IA 4O4LA 3ZN1A 4NXNO 2F95B 4J9YB 1TVKB 2P67A 5DM6V 3HKBB 3EVKA 1BZKA 1AVMA 2C2AA 1K97A 4FLUA 3U0ZA 1FJGB 1BCCH 1OCOB 2GTSA 4K8XA 4LWSB 2EJ7A 1VMGA 3H1JH 4I4TA 1KKDA 2YIAA 5JVDA 4L8JA 1M56B 4CH3A 1JJ2U 3TETA 3K59A 4WBNA 2ADPA 1K8AW 2PF4E 3KZIZ 1H2LA 1ZSPA 2ZE6A 3ZHVA 1AR4A 2F23A 3P30A 4DV3B 2Z3YA 3N2KA 4JAUA 3CCLV 1XILA 5LMNO 1XNRB 4YIPA 4N23A 1SZTA 1WB7A 1PP9H 1RSOA 2UXXA 2YI8A 2BOBC 1Q8IA 2CE4A 4IYIA 5IWAB 1XL6A 3CCMV 2Q9LA 4B7KA 2L6LA 2A79B 5LL6Y 4AILC 2ZT9B 2AW9A 2YICA 5LHHA 1TA8A 1O9GA 3EHBB 4B3MB 4NKGB 4YJ2A 1CP9A 4CBCA 5LP6A 1EN6A 3DGEA 4EFEA 2ZR3A 4BAYA 1NTKH 3K0DA 2XOKG 3I55V 2UXDO 1AI5A 5BR8O 3LUTB 3OT7A 2GTAA 4QJFB 4BW9A 1E79G 1F51A 1YIJV 2UXCB 4FFBA 2IJKA 1JCHA 1YI2V 3K3WA 2Q5ZA 4JZ2A 4ZHQB 3X2QC 4UV9A 1HDJA 5LMUO 2P7TC 2XUMA 1UFIA 3OUSA 3CCVV 3JSLA 3F7YC 2QR4A 5EZYB 4UB8Z 2Q69A 1VARA 1NZ6A 1VEWA 4WFFA 2BOCC 1M56C 2QWOB 1S3JA 1R3JC 2ZE8A 2M6YA 4DR3O 4NB5A 5LBQA 4FZ1A 5KAIZ 3MAQA 5EYPB 2WLKA 2ZIMA 2ZR2A 4JI8O 3K5LA 2WLLB 2WLIB 2YIBA 1XHXA 2MW2B 3TK1A 2H3OA 4I7ZB 5EYPA 1YJ9V 2X6CA 3MD0A 3JD3A 4FZ0A 3JYCA 1XNQO 2QDOA 2EIMB 4CS3A 3VOUA 5KA5A 1QU7A 2EZOA 3AG3C 2XAFA 3LSQA 2FMLA 2R9AA 1P7GA 4HNAA 3QNEA 2KSDA 1KMIZ 1VP7A 1Q5OA 3PN1A 1DLBA 1FXKC 3D36C 4MT8A 3UO2A 2UUCB 4LFCB 4FLZA 3JATB 3ZHRA 5L3GA 3W7XA 2DYRB 5EIBC 4DV1O 3CEIA 5IY5B 1M9NA 1TGOA 4GX0A 2OTJV 3L75H 3RN4A 3E8BA 1SQVH 2P22C 4PDMA 3WB2A 3WG7B 2Z5UA 5KX5B 2ITDC 4O4LB 4JAVA 2YIDA 1FYJA 2IJHA 2EIKC 4I50A 3ICXA 2CK3G 4CC6A 1W0JG 1N32B 2VQEO 4DK1A 3QTCA 2XAJA 2YIBD 1MMMA 4UCUA 2F93B 4X66O 2LFRA 4F6RA 1YTFB 2LP7A 4U3JB 4PV1B 1BE3H 4EEQA 1S0VA 3UM7A 2AZ0A 3J81N 2B1IA 5KHKA 5H5NA 2ZINA 1MSWD 2Q8VA 3DXRB 2B5UA 3G67A 3AG4C 1TUEB 3DTUB 1ORQC 2VQFB 4J9ZB 1JQ0A 4MW8A 4FK5C 4H13B 1Q81W 1VQ7V 1JVMA 4RWUA 2GHYA 4BIUA 4P9OA 2GV9A 4KHPO 1UJWB 1G6UA 1YZBA 3LNMB 2JRIA 3MHHC 4B3TB 3I56V 3CC4V 4PJ0Z 1KU9A 1XHZA 4R7CA 5EBWC 3BRCA 1GM7A 1XMQB 4PELA 3J80N 1NT2B 2ZNJA 1HNZO 4CS2A 5BY1A 2W6IG 4ZIBA 3SPJA 1V55C 1BHBA 3SGIA 4X88A 5K1XA 3FB7C 5ITZA 3BFRA 4LF6B 3M7MX 5DECA 2YEVB 3CJHB 1I7FA 4K0KO 4TT3G 3QO8A 3E8FA 1Y6XA 3ZRWA 5FPOA 1IBKB 1WB8A 2P90A 4TUYB 5LA6A 4F6RB 2DYRC 5A9GA 4GX2A 2EIJC 2E75B 4O2BB 2V4DA 1KQSU 3D8CA 4LF5B 2D2CB 3L72H 3ABMB 1MG1A 4DV3O 3QF7A 1SS3A 2WPDG 1FS0G 4JYAB 3U11A 2UUBO 4RUEA 2EIMC 3NXSA 2UXDB 3E8GA 3F5WC 4DUZB 5B1AB 2ILMA 1LNQA 1KP3A 1F4MA 4JGSA 4O2AB 5A2QN 4LCUC 3CXCU 4LNUA 5L3DA 1JX9A 3CCJV 5LMUB 1I94O 1W2BU 1Z5VA 2RMKB 1SA0B 4FIPC 1VQ8V 4JI7O 4B3RO 2RCVA 4QPKA 1PD3A 3ZJZA 1AB3A 1R1BA 2JGDB 3HKCA 3HKEB 4XBFA 2GUZA 3ABUA 1U97A 2IH1C 2A3QA 3E35A 2WLLA 5D5PA 3N2GB 4DR4O 1D5AA 4TWKA 3ZIAG 5IYZA 1SESA 4JI2O 1IX9A 1I5YA 1WNSA 3CWBH 5KX5A 1EM1A 3AG2B 3HR0A 2HVKC 4OX9B 4WFGA 3WB0A 1THZA 3AG7A 4QGPA 1SC5B 4WFAV 4FVMA 1XQ8A 1LUWA 1SF9A 1S77D 4PD4F 2JS3A 1FXHA 1I08A 1Y74B 3AEIA 1EFRG 3RT3C 4DV6B 1BHAA 3JATA 5LOVB 1X4TA 2EINC 1DF5A 3K5OA 1XNRO 1GMGA 4D6TH 2EZPA 3CS5A 4EB6B 1HNXO 1GN6A 4DRXA 3UQ8A 3OE7G 3W7SA 2QGNA 3C3SA 1IURA 5EC1C 4RUFA 1Q3EA 4ZI7B 2Z0AA 4CH6A 4UV8A 2RDCA 2JGUA 2OYQA 2OIEA 3FAVB 4MVOA 2YXYA 3CRMA 4B3MO 4IIJA 1RM1C 5KHIA 2DJVA 2WLIA 1PNLA 4LFCO 5GONA 2IU0A 1N8RW 1FXKA 3PJSK 4TV8A 2YUAA 3L9DA 1K7DA 2P6JA 1KP2A 2DN9A 2R70A 2EJRA 3ZMVA 1V54B 3OR6C 4DUZO 2AZ2A 3TCUA 4LH6A 5BMVA 4X64B 2WA4A 4DK0A 3WU2Z 3N2KB 3OW2U 4FM0A 5EZYA 2LQTA 3FB8C 3KKYA 3H1KH 2IBZH 4FM2A 3ETGA 3CCEV 1QVFU 3CXHF 4NTYA 4PI0A 4YIOA 1X59A 2F43G 4Q6GA 1KUQA 1OV9A 2DYSB 1YEWA 3T1CA 2BE3A 4DR3B 4TV9B 2PZSA 1BQZA 2Q7HA 3T1YB 2ETNA 1SRYA 4FPPA 2IW5A 1MNGA 2CTRA 1M93A 1P49A 1EBOA 2LW7A 3TXQA 1V9PA 3CC2V 2A06H 4AI8A 4UCOA 3CPWU 1B3QA 3FX7A 3IC9A 3JD2A 4CH5A 4JV5O 4ZBMA 2FTKA 3SYOA 1XNQB 1V55B 4B3TO 1KBHA 5JJEB 4WFEA 4XDJA 1PV0A 3D3QA 1H38A 1S76D 4WFHA 4BIOA 3GWKC 5IYDO 1RSOB 2X7RB 2EULA 2UXNA 4W4LA 3SPIA 1WA8A 3K0GA 5KA6A 1NS1A 2NNUA 4ICGA 5CN0A 2DWDC 4H33A 4D7TA 4WBNB 5FL7G 4J41A 3HPLC 1VQ9V 3JAWA 1ZLZA 3E89A 5JVDB 2G38A 5B1BC 2ADQB 1RPRA 2YS8A 2PYLA 1HP8A 2KG7B 3A0HZ 2BTQA 1MOFA 3CC7V 5CB4B 4PA6A 3T4ZA 1U96A 1R6KA 3CRAA 5IYCO 1HWYA 1Q6UA 3B40A 1E1RG 1WPXA 3E86A 2NN4A 5EIBD 3WFVA 4C7UA 3ZMTA 3FD9A 1MA1A 2HHHO 4X89A 4EFBA 1VQ5V 4DR6O 3JALA 3FAVA 2ZXWC 3WG7C 2FYUH 2WA3A 3CRRA 1Q43A 5FPRA 4X20B 1YHQV 1K92A 4DR5O 2MK3A 3JD0A 3RGBA 1QLEC 1Y76B 1WPBA 2LO1A 3CMEV 4DRXB 4DV5O 3T2MA 4TV9A 1GN3A 1QCEA 4YY3B 1T5EA 3K5MA 1JFFA 1E1QG 3SYPA 1EZJA 1Q6IA 4LF8B 5L3BA 1FPOA 4X1IB 4UVBA 5IDJA 1Q7YW 1ZUQA 3JCZA 5DN6G 3ETQA 5LOVA 3ZMUA 1VF6C 3K58A 4OX9O 1VF7A 4GKKB 2QKAA 5LYJB 4AQYO 2E5LO 1Z5WA 4UFZA 5CA1B 1TUBB 1W59A 3M99B 2V1DA 2JK5C 3D3IA 4DV0O 1J5EB 2KQXA 5H9CA 4MW3A 3E2EA 2Q7GA 2KB1A 4YHHO 2ZM6O 2YXHA 4W4KA 5EC2C 3ZX6A 3FYIB 1PPJH 4F6EA 3VQYA 4HZ3A 2DQ3A 3N2GA 3U10A 2QE7G 4DR2B 2JS5A 3ASNB 5IJ9A 5EBMC 1OCRC 2WAMA 3B4SA 3M8AA 1GM9A 4GYCB 3THOA 2ZCEA 4MTXA 1NVPD 3K9SA 3S3XA 4LFBB 2NR5A 1BSMA 4ASUG 1HNWO 4MSWC 4R6ZA 1D5NA 1QQCA 3L73H 1PL4A 3OR7C 4UCVA 4EB6A 3FB6C 3VQWA 2HG5C 1N4CA 5H6RA 5JQGA 1VQPV 1H8EG 2F1MA 2QM4A 4QE7A 1KD1W 1H2MA 1M90W 4UCTA 3QO5A 1EZVH 5CA1A 1CXZB 5HFMA 4KXRA 1GN4A 3CYOA 4J11A 5GTIZ 2A0LA 5C93A 2XT9A 2ITCC 1GAXA 5J9PC 2D3OW 4NXMB 3KCYA 1H8HG 3QVNA 3RYIA 4JI5B 3G71V 4I0XA 1B06A 4JF3A 4GT1A 4R50A 3SPCA 3R65A 2E76B 3OGCC 1M57B 4UB6Z 3CCSV 4X20A 3LDEA 3HKCB 2CDYA 4UVAA 3JD4A 2CGOA 4WF9V 3ABTA 4NR1A 2QM7A 3ABKC 4GUNA 1WN7A 4PA7A 4FJCC 2K1EA 5L3EA 2Y69B 1FJGO 2AHYA 2P06A 4H0LB 3K5NA 1BMFG 4NTXA 3FKSG 4PA3A 1ZL8B 3AK1A 4PDVA 4DV6O 4I55B 1PNMA 4DUYB 2LGWA 3JAKA 2HR3A 3SYCA 3SDLA 2CGNA 2YC0A 4LF7B 3APOA 3LNNA 4KL1A 3GVMA 4JI1B 3ETDA 5LMNB 2Q0AA 5LYJA 1KECA 4D7SA 1OZ0A 4LBEC 4DR2O 4AHCA 2ZIOA 3K57A 4X1IA 3B09A 4BR6A 2GSMB 4O2BA 4WCEV 1K9MW 3UT5A 4JI0O 4F4LA 5LA6B 3CCQV 4FLXA 5KHGA 5KHJA 2OIGA 3GB7C 5E1AC 4A5UB 2LW1A 1TAEA 2JJ1G 1J95A 3SYAA 1MZFA 1Q82W 4I50B 5IJ0B 1L1FA 4GX5A 3RVZA 4O4IB 1Y66A 1R3IC 2UU9B 1JR9A 2OT5A 4U3FH 4LFAB 4MS2A 1YITV 3X2QB 3ABLB 5IE9A 4JI4O 5CB4A 3LSSA 1VQOV 2WLJA 2XAHA 4OXSA 1FXVA 4PI2A 1I0HA 2XNDG 1K4DC 4JTDB 2XTAA 3JAWB 3A0RA 2BSKB 5LHIA 4O4HA 1NR1A 2E5LB 1UPGA 5GTHZ 1XL4A 1SQFA 2QA4V 3H1LH 3QO7A 1QBZA 1N34O 2CTQA 3OTFA 3RWRD 2B9ZA 2JDIG 4NXNB 1XMOO 2VWKA 2E74B 4QNHB 3OD4A 1LR1A 4Z1VA 4HBNA 1RP3B 2UUAO 4X62B 1AJQA
chains in the Genus database with same CATH topology
3FB8C 4JYCA 3OEEG 2QEXV 1ENVA 3W7WA 2A79B 2W0FC 1VQNV 3ETGA 4UUJC 3CCEV 1QVFU 2OCCB 2HVJC 4H37A 4KFMA 2EILC 5LHHA 1K4CC 2F43G 4YXWG 3EHBB 2OTLV 1CP9A 2LFSA 4CBCA 4CZZA 1S72V 3B77A 2DYSB 3RW0A 1CPYA 2WLHA 3T1CA 3DGEA 1OCZB 2ZR3A 4BAYA 4UXNA 2YSUB 1K5SA 3K0DA 4N21A 2XOKG 3I55V 1AI5A 1VQMV 3STLC 3LUTB 2A9HA 4QJFB 1SRYA 4FPPA 1E79G 2IW5A 3BY6A 2W6JG 1WLEA 1F51A 1YIJV 1PNKA 1QVGU 1NR7A 2QKSA 1F4NA 1EBOA 3ZMSA 1V54C 1OCOC 3CC2V 2IJKA 1JCHA 1VQKV 4XDKA 1YI2V 3K3WA 1F23A 5L3FA 3CPWU 3JD2A 2JJ2G 3X2QC 1I5XA 3BEHA 4KUMA 4ZBMA 2FTKA 4UV9A 3SYOA 1VQLV 1V55B 2EBOA 2P7TC 2IJJA 3OUSA 1M1KW 4WFEA 3CCVV 4MVMA 4XDJA 1R73A 3F7YC 4TSFG 4JPRA 2Q69A 1H38A 5BZBA 2B1GA 1QLEB 1S76D 4WFHA 3D36A 3E8HA 5IYDO 4WFFA 1H2GA 4FMTA 1SERA 2BOCC 1M56C 5KUMA 2WSSG 1S3JA 1R3JC 2X7RB 4G27B 2UXNA 1RPOA 4HAMA 3SPIA 4U7OA 5LBQA 3K0GA 2WLKA 4E2LA 5KA6A 5CBFA 2ZR2A 2NNUA 1NVPB 5CN0A 2DWDC 2WLLB 2WLIB 4GCZA 2HKOA 1OCZC 4H33A 3TK1A 5FL7G 3OAAG 3OFNG 1Q86W 2ZDIA 4HYOA 3K9AA 3HPLC 1VQ9V 3ABKB 2WWWA 1YJ9V 1NQTA 2X6CA 3SPGA 1NH2D 3E89A 3MD0A 3JD3A 5B1BC 3JYCA 1RPRA 1SETA 4I5SA 1AR1B 1AJPA 4MTOA 1MOFA 5CMUA 4JYBA 3P32A 4QIWF 3CC7V 2EINB 3CD6V 4PA6A 3T4ZA 2HFEC 1DTOA 1R6KA 2EIMB 2R9RB 5IYCO 1HWYA 3VOUA 2JEXA 5KA5A 3CCRV 1AROP 5CBGA 1PL0A 2EZOA 1G4YB 3AG3C 3K08A 3ZRXA 1E1RG 1WPXA 3E86A 4PDLA 2ZQMA 3WFVA 3ML0A 3ASNC 2XAFA 2IJIA 3UKMA 3LSQA 2H94A 3ZMTA 3QNEA 4X89A 4G2KA 5LGUA 1VQ5V 1DLBA 4GX1A 4XDLA 1FXKC 1YSCA 2ZXWC 4MT8A 3WG7C 2QTOA 1OCCC 5L3GA 4Q20A 3W7XA 2DYRB 3AG4B 1YHQV 1K92A 2WLMA 4PA4A 2MK3A 3JD0A 5IY5B 1QLEC 1M9NA 2M7WA 4GX0A 2OTJV 3CMEV 3H01A 1AI4A 2Q67A 3E8BA 1OHHG 4P30A 3T2MA 1QCEA 1P7BA 1COWG 1E1QG 3CP1A 4PDMA 1R6NA 3WG7B 1JPXA 3SYPA 3MHSC 2Z5UA 1EZJA 2ITDC 4JAVA 2JIZG 5L3BA 2WLNA 2IJHA 1GKFA 4UVBA 5IDJA 2EIKC 1Q7YW 3JCZA 4P2ZA 5DN6G 2CK3G 2ATKC 2DWEC 3IC7A 3ZMUA 5LGNA 4LP8A 4EKWA 1W0JG 4QPJA 3ZN0A 2XAJA 2HJFC 2NLJC 2LFRA 1YTFB 2LP7A 3M99B 2V1DA 2JK5C 3D3IA 5GW7A 3UM7A 3G4SV 1S0VA 5H9CA 4MW3A 3E2EA 2B1IA 2KB1A 3ZRWB 1VQ6V 1MSWD 2B5UA 5EC2C 3AG4C 1TUEB 3DTUB 1ORQC 3FYIB 4MVRA 4J9ZB 1JQ0A 3ASOB 1AI6A 4KP4A 3RBZA 1FXKB 2ZD9A 3SPHA 3JD1A 4MW8A 4FK5C 2X6BA 4HZ3A 4DO2A 1Q81W 2DQ3A 1VQ7V 1JVMA 2OCCC 2QE7G 2QM8A 3OMAB 2GHYA 1R3KC 4RO2A 4BIUA 4P9OA 3ASNB 5CA3A 3AG1C 5EBMC 4U7NA 3SJQC 1OCRC 2WAMA 3AG3B 3GWOA 4MVSA 1UJWB 4MVZA 4PA9A 3RVYA 3LNMB 1GM9A 3MHHC 1JOYA 4UVCA 3I56V 3CC4V 3ABMC 1MABG 4MTXA 4R8CA 1NVPD 4R7CA 5EBWC 3B8NA 1K73W 2Q68A 1QR9A 1GM7A 4BIZA 4ASUG 4PELA 4LC1A 3IGAC 2W6IG 4JASA 1NJIW 5B1OA 3SPJA 2JEUA 4MSWC 4R6ZA 5CBHA 1V55C 1BHBA 3OUFA 3OMNB 4X88A 5EBLC 3OM3B 3OR7C 1QLNA 3K79A 3FB7C 3FB6C 4MVUA 2DQ0A 3EFFK 5IYBO 4PDRA 2HG5C 3AG2C 2YEVB 5H6RA 4TT3G 3QO8A 4RAIA 1VQPV 3E8FA 3HB3B 3KG2A 1H8EG 3ZRWA 4QE7A 1KD1W 3AG1B 3ETEA 1M90W 3QO5A 2Y69C 2XAQA 2P90A 1NBMG 1W0KG 5LHGA 4JTAB 5HFMA 2XASA 2IU3A 2IH3C 1QR8A 3T4DA 3FYEB 2DYRC 2X6AA 4L87A 1K5QA 4GX2A 2EIJC 3CYOA 3ZMZA 2A0LA 3F7VC 5C93A 1KQSU 1YJWV 2ITCC 3OMIB 3ZRSA 2YEVA 2EILB 5J9PC 2D3OW 1H8HG 1K3EA 3ABMB 1MG1A 1PKXA 5L3CA 3K03A 3G71V 1K33A 1ZWIC 1FS0G 2WPDG 1G8MA 1FFTB 4JF3A 4GT1A 4P9PA 4R50A 3SPCA 1OCRB 3R65A 4RUEA 2EIMC 3NXSA 2H8PC 3E8GA 3F5WC 3OGCC 4QE9A 5B1AB 5B3SB 1M57B 1LNQA 1KP3A 3CCSV 3LDEA 5B1NA 1F4MA 4UVAA 1YJNV 4JGSA 2DYSC 3JD4A 3CCUV 4WF9V 3ABTA 5HFLA 2QM7A 3ABKC 4LCUC 1BL8A 3CXCU 4PA7A 1Y4MA 4FJCC 5L3DA 1JX9A 2K1EA 5B1AC 2Y69B 5B3SC 5L3EA 4RQEA 3CCJV 1W2BU 2AHYA 1VQ4V 2AHZA 1BMFG 4Z1MG 3FKSG 4PA3A 4MTGA 4JTCB 1NKDA 2PI4A 4FIPC 1OCCB 1VQ8V 4QPKA 1IXMA 1PD3A 4X8AA 2PI5A 4PDVA 5EK0A 3ZJZA 3ZRVA 1PNMA 2HR3A 3SYCA 2EIKB 4DXWA 1ROPA 4I9WA 4XBFA 4WFBV 3ABLC 3ABUA 1KC8W 2EIJB 2IH1C 3FB5C 3E35A 3ETDA 3STZC 2WLLA 3K06A 1NH2B 3IFXA 5H6QA 3SYQA 5IY5C 1KECA 1OZ0A 4TWKA 3ZIAG 1SESA 4LBEC 4RQFA 1CEZA 1RM1B 2V7QG 1AI7A 2DW4A 4MTFA 1I5YA 2GSMB 2XAGA 2ZXWB 3AG2B 4WCEV 2HVKC 1GK9A 4WFGA 1B6QA 1THZA 3W7UA 1K9MW 4F4LA 4WFAV 1M57C 1R3LC 1DF4A 2Y48A 3CCQV 1S77D 3GB7C 3LDDA 5E1AC 1K34A 4BW5A 1FXHA 1S5HC 3W7TA 3AEIA 3G6EV 1EFRG 2JJ1G 3ASOC 1J95A 3SYAA 1BHAA 1Q82W 2EINC 1GM8A 1GO3F 2HLDG 3E83A 1DF5A 4MVQA 2R9IA 1GMGA 1L1FA 4GX5A 3ZN1A 3K04A 3RVZA 2EZPA 1Y66A 5B1BB 4J9YB 1R3IC 2OT5A 2P67A 4MS2A 3OE7G 5DM6V 3W7SA 2C2AA 1YITV 1K97A 2ZDIC 3X2QB 1P4RA 3LDCA 3ABLB 5EC1C 2Q6AA 4RUFA 5LGTA 3VBBA 3OEHG 3LSSA 1OCOB 1VQOV 2WLJA 4UV8A 2XAHA 4OXSA 1FXVA 2X0LA 1KKDA 2XNDG 4MVOA 1K4DC 1M56B 4JTDB 1JJ2U 3A0RA 1RM1C 3TETA 5LHIA 1GTOA 5KUKA 1AJNA 1YTFD 1NR1A 1K8AW 2WLIA 3B8MA 1XL4A 4G28B 1PNLA 3P30A 2IU0A 2QA4V 2Z3YA 4JAUA 1N8RW 3QO7A 1FXKA 3PJSK 3CCLV 1QBZA 1K7DA 4N23A 2P6JA 3CMAV 1SZTA 1KP2A 2JDIG 4ZKIA 2EJRA 2UXXA 3ZCCA 1V54B 3OR6C 3ZMVA 4QNHB 2BOBC 3TCUA 3OW2U 1XL6A 1AJQA 3CCMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB8 C;  5CBG A;  4MSW C;  1G4Y B;  4R6Z A;  3AG3 C;  1V55 C;  3K08 A;  5CBH A;  3STZ C;  3E86 A;  2A79 B;  2W0F C;  2WLL A;  4PDL A;  3K06 A;  3ASN C;  3IFX A;  3UKM A;  4UUJ C;  3OUF A;  4X88 A;  3SYQ A;  5EBL C;  5IY5 C;  2HVJ C;  3OR7 C;  4TWK A;  4H37 A;  4KFM A;  3FB7 C;  4LBE C;  4X89 A;  2EIL C;  3FB6 C;  4MVU A;  1K4C C;  4GX1 A;  4MTF A;  3EFF K;  4XDL A;  4PDR A;  2HG5 C;  3AG2 C;  2ZXW C;  4CBC A;  3WG7 C;  2QTO A;  1OCC C;  4RAI A;  2HVK C;  3RW0 A;  3E8F A;  4WFG A;  3KG2 A;  2WLH A;  4QE7 A;  3T1C A;  2WLM A;  4PA4 A;  4F4L A;  1R3L C;  1M57 C;  1QLE C;  2Y69 C;  3K0D A;  4GX0 A;  4JTA B;  3STL C;  3GB7 C;  3E8B A;  2Q67 A;  3LDD A;  3LUT B;  2A9H A;  2IH3 C;  4P30 A;  2DYR C;  5E1A C;  1P7B A;  3T4D A;  1S5H C;  4BW5 A;  2X6A A;  4GX2 A;  4PDM A;  2EIJ C;  3ASO C;  1J95 A;  3SYP A;  3SYA A;  2A0L A;  3F7V C;  2QKS A;  2EIN C;  2ITD C;  2ITC C;  3E83 A;  3ZRS A;  2WLN A;  2YEV A;  4MVQ A;  1V54 C;  1OCO C;  2EIK C;  4GX5 A;  5J9P C;  4P2Z A;  4XDK A;  2DWE C;  2ATK C;  3K04 A;  3RVZ A;  4LP8 A;  4EKW A;  3K03 A;  4J9Y B;  1R3I C;  1ZWI C;  3X2Q C;  3BEH A;  2HJF C;  4ZBM A;  3SYO A;  2NLJ C;  2P7T C;  4MS2 A;  4P9P A;  4R50 A;  3OUS A;  3SPC A;  4WFE A;  4MVM A;  2JK5 C;  3R65 A;  4XDJ A;  4RUE A;  3UM7 A;  2EIM C;  3LDC A;  3F7Y C;  5EC1 C;  2H8P C;  2Q6A A;  3E8G A;  2Q69 A;  3F5W C;  3OGC C;  4MW3 A;  4QE9 A;  5BZB A;  4RUF A;  1LNQ A;  2KB1 A;  3LDE A;  4WFH A;  3E8H A;  2WLJ A;  5EC2 C;  3AG4 C;  4WFF A;  2BOC C;  2DYS C;  4OXS A;  1M56 C;  5KUM A;  4G27 B;  1ORQ C;  1R3J C;  4MVR A;  1KKD A;  4MVO A;  4J9Z B;  3SPI A;  1K4D C;  3ABK C;  4JTD B;  4LCU C;  3RBZ A;  2ZD9 A;  3SPH A;  4MW8 A;  3TET A;  3K0G A;  1BL8 A;  2X6B A;  4HZ3 A;  2WLK A;  4PA7 A;  3VOU A;  5KUK A;  5CBF A;  1JVM A;  2OCC C;  2K1E A;  1R3K C;  4RO2 A;  5B1A C;  2DWD C;  2WLL B;  2WLI B;  5B3S C;  4P9O A;  2WLI A;  2AHY A;  1OCZ C;  4H33 A;  2AHZ A;  1XL4 A;  3AG1 C;  4G28 B;  5EBM C;  1OCR C;  4PA3 A;  3SJQ C;  4MTG A;  4JTC B;  4HYO A;  4MVS A;  3HPL C;  4MVZ A;  4PA9 A;  3RVY A;  3LNM B;  3PJS K;  2X6C A;  3SPG A;  3E89 A;  4X8A A;  3ABM C;  4R8C A;  5B1B C;  3JYC A;  4PDV A;  5EK0 A;  4R7C A;  5EBW C;  3ZJZ A;  3SYC A;  4DXW A;  3OR6 C;  2Q68 A;  4MTO A;  2BOB C;  3TCU A;  4I9W A;  4QNH B;  3T2M A;  4PA6 A;  3T4Z A;  2HFE C;  3ABL C;  2R9R B;  3IGA C;  1XL6 A;  2IH1 C;  3FB5 C;  3SPJ A; 
#chains in the Genus database with same CATH topology
 1S5L Z;  5JH7 A;  4JYC A;  2QEX V;  1ENV A;  1SKV A;  4U3J A;  3R66 A;  2OCC B;  3FFQ A;  2HVJ C;  4IIJ B;  2EIL C;  1XRE A;  4YXW G;  2OTL V;  4CZZ A;  5IT9 N;  4GKJ B;  5FLX N;  3OTO B;  1SQG A;  1XMQ O;  2WLH A;  1OCZ B;  4UXN A;  1K5S A;  2QTS A;  3CRQ A;  1YDX A;  2QWP B;  2W0X A;  2P5O A;  3BY6 A;  1WLE A;  1PNK A;  4JI1 O;  4H44 B;  2QKS A;  3ZMS A;  1OCO C;  4JI3 B;  5D5Q A;  4J7K A;  4K0K B;  5L3F A;  2JJ2 G;  2YI9 A;  5E79 Z;  1G1X B;  2ZE5 A;  2EBO A;  4MVM A;  1LUV A;  2BTO A;  1R73 A;  4TSF G;  1GN2 A;  5BZB A;  2B1G A;  2F66 C;  2Y0I A;  3IAY A;  3P3N A;  1AR5 A;  3E22 A;  1DGS A;  1H2G A;  1SER A;  4IL6 Z;  1N0N A;  1M5I A;  4U7O A;  4JI6 O;  2CTW A;  4TV8 B;  5IYZ B;  3L70 H;  2QWQ B;  2QWR B;  3SJA C;  5CBF A;  2XHB A;  5GON B;  4X64 O;  4DR5 B;  2RNB A;  2FKX A;  3OFN G;  1Q86 W;  2ZDI A;  3K9A A;  2WWW A;  4TQF A;  1NQT A;  4LFA O;  1NH2 D;  1VF5 B;  2JGD A;  1SET A;  3E22 B;  1AR1 B;  1AJP A;  4MTO A;  5CMU A;  4QIW F;  3TGU H;  3CD6 V;  1JMK C;  1SA0 A;  2JEX A;  1ARO P;  2VQE B;  3CCR V;  1PL0 A;  1G4Y B;  3K08 A;  3ZRX A;  2P4K A;  4PDL A;  2ZQM A;  2UXB B;  3ASN C;  2IJI A;  4NYK A;  2H94 A;  4ZHQ A;  1NU1 H;  1N0J A;  4G2K A;  5LGU A;  2PUS A;  1IBM B;  4XDL A;  2Q73 A;  2QTO A;  3ZBH A;  4Q20 A;  2FB5 A;  4X9Q A;  3ZHT A;  3T1H B;  1N36 O;  1Y74 A;  1HR0 B;  4CH4 A;  2M7W A;  3ZHS A;  4K8Z A;  2KKW A;  3H01 A;  2PTM A;  4P30 A;  1AI4 A;  3EXA A;  2QWN B;  1P7B A;  3C90 A;  1R6N A;  3G80 A;  4YJ2 B;  1GKF A;  4JZG A;  1SQQ H;  4P2Z A;  2DWE C;  5LGN A;  4LP8 A;  4OGQ B;  4QPJ A;  3ZN0 A;  3OGI B;  2NLJ C;  4JI0 B;  2OCH A;  4B7E A;  1HNW B;  3H1I H;  3OTO O;  1FAF A;  1O9H A;  4IT5 A;  3ZRW B;  1VQ6 V;  2AGA A;  2QSA A;  3I5D A;  1HW7 A;  3CB2 A;  4J10 A;  3BVO A;  3ASO B;  4KP4 A;  3VQV A;  5ITZ B;  3MDS A;  2X6B A;  4LF4 B;  5C8Y A;  1M4U A;  2OCC C;  3OMA B;  3RFR A;  3JAM N;  3SJQ C;  4U7N A;  3CRC A;  2HEP A;  1XDC A;  3RVY A;  2BSK A;  3O65 A;  4FM1 A;  4J7Z A;  4R8C A;  3B8N A;  4DV4 B;  3A0B Z;  1QR9 A;  4CS4 A;  1XUQ A;  4X65 B;  5AG2 A;  1XEQ A;  1NJI W;  4JI5 O;  1XBL A;  4J7J A;  4B3R B;  2LGQ A;  4JYA O;  2ARH A;  4JAA A;  1XOU A;  3S3W A;  2CTP A;  5EBL C;  1IXB A;  3OM3 B;  2Y0P A;  3K79 A;  1FD9 A;  2JVD A;  2DQ0 A;  3EFF K;  1QNM A;  5IYB O;  3CE2 A;  3AG2 C;  1JJO A;  1BT8 A;  4FLY A;  3AG1 B;  3SJC C;  2CAZ C;  1N33 O;  1W0K G;  3ZED A;  2IH3 C;  3T4D A;  3FYE B;  1ZX3 A;  3WB1 A;  1K5Q A;  3O9O A;  4IYH A;  2F4V B;  3OMI B;  3ZRS A;  3CJH A;  4JI7 B;  2YEV A;  4OPH A;  1PKX A;  1YCI A;  3DC6 A;  5JJN B;  1K33 A;  1ZWI C;  4DR7 O;  3BAA A;  4YJ3 B;  4BWA A;  1FFT B;  4P9P A;  1OCR B;  4K3A A;  2IM9 A;  4QE9 A;  4LF6 O;  2AXT Z;  5B1N A;  4X62 O;  2L35 A;  1YJN V;  3NR7 A;  2DYS C;  3JAR B;  3CCU V;  4IGG A;  5KMG A;  5HFL A;  4ZOL B;  4ABM A;  1Y67 A;  1IBK O;  4HNA B;  1Y4M A;  4LR3 A;  1WP7 A;  1SQP H;  5DED A;  5B1A C;  1YXB A;  3KCX A;  1VQ4 V;  4Z1M G;  4LF9 O;  3UO3 A;  4GKJ O;  1OCC B;  5B5E Z;  4LF5 O;  1Q6H A;  2ZNI A;  1OJH A;  4X8A A;  2PI5 A;  2PGG A;  3ZRV A;  4DXW A;  3RYF A;  1ROP A;  4I9W A;  3DXR A;  4I9Q A;  4WFB V;  2UUB B;  2DOS A;  5J2T A;  2EIJ B;  3A2F A;  3FB5 C;  1HNX B;  1IBL O;  4JI3 O;  3L74 H;  3SYQ A;  4RQF A;  1RM1 B;  2V7Q G;  4MTF A;  1F7Y A;  3RYH A;  1AP5 A;  2XAG A;  2ZXW B;  2O57 A;  5K1P A;  1M57 C;  1R3L C;  1ZTE A;  1DF4 A;  2Y48 A;  1K34 A;  2GDS A;  4BW5 A;  1S5H C;  2ZE7 A;  3W7T A;  3ASO C;  2DE0 X;  3AK2 A;  1S5J A;  1GM8 A;  1GO3 F;  3E83 A;  3K04 A;  1VIB A;  5B1B B;  5BR8 B;  2Q0O C;  5H2F Z;  4B08 A;  5FNV A;  5LXT B;  3IJ4 A;  2VWJ A;  2ZDI C;  1P4R A;  2RJZ A;  2Q6A A;  2VRZ A;  4JI2 B;  5LGT A;  3VBB A;  3OEH G;  1I94 B;  5LP6 C;  2X0L A;  5KAF Z;  3BAB A;  3SJB C;  1KYO F;  1GTO A;  5KUK A;  1AJN A;  2F4V O;  4K35 A;  1YTF D;  4O4J A;  5IJ9 B;  1IBM O;  5CA0 B;  3B8M A;  4G28 B;  3L71 H;  5B66 Z;  3G6B A;  3JCU Z;  4LH7 A;  3CMA V;  4ZKI A;  3ZCC A;  1BS3 A;  3DC5 A;  3LDC A;  2HP8 A;  4JV5 B;  3OEE G;  3W7W A;  2W0F C;  1VQN V;  4O4H B;  4UUJ C;  4H37 A;  4KFM A;  1K4C C;  4I4T B;  4PHZ A;  4LF9 B;  2LFS A;  4FFB B;  1S72 V;  3B77 A;  1IVS A;  3RW0 A;  1CPY A;  1JFF B;  4DV7 O;  2YSU B;  4N21 A;  1L0L H;  2YDE A;  2HHH B;  4DV2 B;  4UCS A;  4DR6 B;  1VQM V;  3STL C;  2A9H A;  2W6J G;  4J42 A;  5TIS Z;  1QVG U;  4DW0 A;  1NR7 A;  5LP6 B;  1F4N A;  2K9P A;  4DV1 B;  5IJ0 A;  1V54 C;  1SQX H;  4J80 A;  1VQK V;  4XDK A;  1F23 A;  2A7W A;  1I5X A;  3BEH A;  2N05 A;  4KUM A;  1VQL V;  2IJJ A;  1M1K W;  5JH7 B;  2OWO A;  4DV4 O;  4JPR A;  1YVW A;  1QLE B;  2UXB O;  1D2D A;  3UCS C;  3D36 A;  3E8H A;  4FMT A;  2KG7 A;  5KUM A;  2WSS G;  4G27 B;  1RPO A;  4AQY B;  5JCO C;  4HAM A;  1NTZ H;  5JJJ B;  2BCC H;  4DV0 B;  2FL4 A;  4E2L A;  3QG5 A;  4DR7 B;  3T1H O;  1N36 B;  1NVP B;  4GCZ A;  1HR0 O;  2HKO A;  1OCZ C;  3ZS8 C;  3OAA G;  4DR4 B;  1IDS A;  4GZR B;  4HYO A;  2VQF O;  3ABK B;  4DV5 B;  1WA8 B;  4IHJ B;  3SPG A;  3BA8 A;  5BMV B;  3JAK B;  1N33 B;  4I55 A;  4I5S A;  4LWS A;  4JYB A;  3P32 A;  2EIN B;  2HFE C;  1DTO A;  3SR2 C;  1ZL8 A;  2CH7 B;  2R9R B;  3APQ A;  3BCC H;  3N27 A;  5CBG A;  3LSU A;  4TOI A;  3HKB A;  2PY5 A;  3ML0 A;  4O4J B;  3UKM A;  1SQB H;  2DMX A;  3BPZ A;  4B3S B;  1TVK A;  1WJZ A;  1J5E O;  4LFB O;  4O4I A;  3C3T A;  3JAS B;  4GX1 A;  1YSC A;  4DW1 A;  3TJT A;  1OCC C;  3TXS A;  1XI1 A;  3AG4 B;  4ZI7 A;  2WLM A;  4PA4 A;  1H2N A;  5FNV B;  5LXT A;  2HJD A;  2Q67 A;  1OHH G;  1ZAU A;  2GBO A;  4X1Y A;  3UT5 B;  1COW G;  3CP1 A;  1AIL A;  1JPX A;  4JYY A;  2N74 A;  3MHS C;  1WAZ A;  3H9V A;  4X1K B;  2JIZ G;  2WLN A;  3B2E E;  1GRJ A;  3IC7 A;  2ATK C;  4EKW A;  2Y4U A;  2HJF C;  4X65 O;  1GH6 A;  1URF A;  5GW7 A;  3G4S V;  2UUC O;  1Z2G A;  2N04 A;  1A32 A;  3RYH B;  3HKD A;  4MVR A;  1AI6 A;  3RBZ A;  1FXK B;  2EX3 A;  2ZD9 A;  3SPH A;  3JD1 A;  1US6 A;  4DO2 A;  4FLW A;  3Q4H B;  1PM9 A;  1DK1 A;  2UU9 O;  2UXC O;  2QM8 A;  2Y4T A;  1R3K C;  4RO2 A;  5CA0 A;  5CA3 A;  3AG1 C;  5F2V O;  5J2U B;  2R72 A;  3AG3 B;  3GWO A;  4MVS A;  1KKC A;  4MVZ A;  2GUZ B;  4PA9 A;  3HKE A;  4JI4 B;  1JOY A;  1AP6 A;  4UVC A;  3RYF B;  1L0N H;  3ABM C;  1MAB G;  1K73 W;  3A8T A;  2Q68 A;  1FFX B;  4BIZ A;  4X66 B;  4DR1 O;  3RYC A;  4LC1 A;  3IGA C;  1YF2 A;  4TQD A;  4JAS A;  5B1O A;  5J2U A;  1MZE A;  1KB9 F;  3CHX A;  2JEU A;  5CBH A;  3T1Y O;  2ZM6 B;  4LNU B;  3J7A U;  3OUF A;  2RN9 A;  1MSD A;  3OMN B;  4DUY O;  4I0X B;  3BA9 A;  1QLN A;  3RYI B;  4NTW A;  3JSN A;  4ZOL A;  4MVU A;  1SZX A;  1N34 B;  4UCR A;  5KMG B;  4PDR A;  3HKD B;  4YY3 O;  3JAR A;  3ZHQ A;  4RAI A;  3HB3 B;  3KG2 A;  3ETE A;  2P4V A;  2Y69 C;  1H2S B;  2XAQ A;  4KHP B;  1NBM G;  5LHG A;  2E3C A;  4JTA B;  4GKK O;  2XAS A;  2IU3 A;  1QR8 A;  2X6A A;  4L87 A;  1H2K A;  1WP8 A;  3ZMZ A;  3BHP A;  4DYL A;  3F7V C;  1QHT A;  1YJW V;  5JQG B;  2EIL B;  4X1K A;  4B3S O;  1HNZ B;  4YHH B;  2CUG A;  1K3E A;  5L3C A;  3K03 A;  3DSQ A;  4FFK A;  4X1Y B;  1G8M A;  4LF7 O;  4DV7 B;  1JA8 A;  2VS0 A;  1NTM H;  4LF4 O;  1Y76 A;  2H8P C;  5B3S B;  5J2T B;  4E4E A;  1IBL B;  2LJ2 A;  3RYC B;  5IWA O;  1Q90 D;  1FFX A;  3JAS A;  3JAL B;  4OPA A;  2Q7E A;  1BL8 A;  2ODM A;  4GLX A;  5B3S C;  4RQE A;  2AHZ A;  3H1H H;  4MTG A;  2CH7 A;  4JTC B;  1NKD A;  3Q4H A;  5KLV H;  2PI4 A;  1P84 F;  3ZHU A;  1R6T A;  1IXM A;  1FKA O;  2BTQ B;  2QJ1 A;  4CC5 A;  5EK0 A;  2PYJ A;  4O2A A;  4DV2 O;  2EIK B;  4IHJ A;  4JI6 B;  3F5T A;  3ABL C;  4NVP A;  1BQ0 A;  1KC8 W;  1B04 A;  3AK3 A;  1EN4 A;  1IZ3 A;  3STZ C;  1TUB A;  3K06 A;  1NH2 B;  3IFX A;  4YJ3 A;  5C8Y B;  2QKC A;  1XMO B;  5H6Q A;  5BXZ A;  5IY5 C;  5KHH A;  2RQ6 A;  1CEZ A;  1EN5 A;  4LF8 O;  1AI7 A;  2DW4 A;  3CX5 F;  1BGY H;  2ZKO A;  2UUA B;  4FLT A;  1N32 O;  1GK9 A;  1B6Q A;  3W7U A;  4NXM O;  3VQX A;  3CSX A;  4TUY A;  3P3P A;  2YXL A;  5JWP A;  1NI8 A;  3LDD A;  4DR1 B;  1L8D A;  2Q4P A;  4FLV A;  3G6E V;  4Z2W A;  2HLD G;  5JCO A;  4JI8 B;  4MVQ A;  1RFY A;  1VF6 A;  2R9I A;  4O4L A;  3ZN1 A;  4NXN O;  2F95 B;  4J9Y B;  1TVK B;  2P67 A;  5DM6 V;  3HKB B;  3EVK A;  1BZK A;  1AVM A;  2C2A A;  1K97 A;  4FLU A;  3U0Z A;  1FJG B;  1BCC H;  1OCO B;  2GTS A;  4K8X A;  4LWS B;  2EJ7 A;  1VMG A;  3H1J H;  4I4T A;  1KKD A;  2YIA A;  5JVD A;  4L8J A;  1M56 B;  4CH3 A;  1JJ2 U;  3TET A;  3K59 A;  4WBN A;  2ADP A;  1K8A W;  2PF4 E;  3KZI Z;  1H2L A;  1ZSP A;  2ZE6 A;  3ZHV A;  1AR4 A;  2F23 A;  3P30 A;  4DV3 B;  2Z3Y A;  3N2K A;  4JAU A;  3CCL V;  1XIL A;  5LMN O;  1XNR B;  4YIP A;  4N23 A;  1SZT A;  1WB7 A;  1PP9 H;  1RSO A;  2UXX A;  2YI8 A;  2BOB C;  1Q8I A;  2CE4 A;  4IYI A;  5IWA B;  1XL6 A;  3CCM V;  2Q9L A;  4B7K A;  2L6L A;  2A79 B;  5LL6 Y;  4AIL C;  2ZT9 B;  2AW9 A;  2YIC A;  5LHH A;  1TA8 A;  1O9G A;  3EHB B;  4B3M B;  4NKG B;  4YJ2 A;  1CP9 A;  4CBC A;  5LP6 A;  1EN6 A;  3DGE A;  4EFE A;  2ZR3 A;  4BAY A;  1NTK H;  3K0D A;  2XOK G;  3I55 V;  2UXD O;  1AI5 A;  5BR8 O;  3LUT B;  3OT7 A;  2GTA A;  4QJF B;  4BW9 A;  1E79 G;  1F51 A;  1YIJ V;  2UXC B;  4FFB A;  2IJK A;  1JCH A;  1YI2 V;  3K3W A;  2Q5Z A;  4JZ2 A;  4ZHQ B;  3X2Q C;  4UV9 A;  1HDJ A;  5LMU O;  2P7T C;  2XUM A;  1UFI A;  3OUS A;  3CCV V;  3JSL A;  3F7Y C;  2QR4 A;  5EZY B;  4UB8 Z;  2Q69 A;  1VAR A;  1NZ6 A;  1VEW A;  4WFF A;  2BOC C;  1M56 C;  2QWO B;  1S3J A;  1R3J C;  2ZE8 A;  2M6Y A;  4DR3 O;  4NB5 A;  5LBQ A;  4FZ1 A;  5KAI Z;  3MAQ A;  5EYP B;  2WLK A;  2ZIM A;  2ZR2 A;  4JI8 O;  3K5L A;  2WLL B;  2WLI B;  2YIB A;  1XHX A;  2MW2 B;  3TK1 A;  2H3O A;  4I7Z B;  5EYP A;  1YJ9 V;  2X6C A;  3MD0 A;  3JD3 A;  4FZ0 A;  3JYC A;  1XNQ O;  2QDO A;  2EIM B;  4CS3 A;  3VOU A;  5KA5 A;  1QU7 A;  2EZO A;  3AG3 C;  2XAF A;  3LSQ A;  2FML A;  2R9A A;  1P7G A;  4HNA A;  3QNE A;  2KSD A;  1KMI Z;  1VP7 A;  1Q5O A;  3PN1 A;  1DLB A;  1FXK C;  3D36 C;  4MT8 A;  3UO2 A;  2UUC B;  4LFC B;  4FLZ A;  3JAT B;  3ZHR A;  5L3G A;  3W7X A;  2DYR B;  5EIB C;  4DV1 O;  3CEI A;  5IY5 B;  1M9N A;  1TGO A;  4GX0 A;  2OTJ V;  3L75 H;  3RN4 A;  3E8B A;  1SQV H;  2P22 C;  4PDM A;  3WB2 A;  3WG7 B;  2Z5U A;  5KX5 B;  2ITD C;  4O4L B;  4JAV A;  2YID A;  1FYJ A;  2IJH A;  2EIK C;  4I50 A;  3ICX A;  2CK3 G;  4CC6 A;  1W0J G;  1N32 B;  2VQE O;  4DK1 A;  3QTC A;  2XAJ A;  2YIB D;  1MMM A;  4UCU A;  2F93 B;  4X66 O;  2LFR A;  4F6R A;  1YTF B;  2LP7 A;  4U3J B;  4PV1 B;  1BE3 H;  4EEQ A;  1S0V A;  3UM7 A;  2AZ0 A;  3J81 N;  2B1I A;  5KHK A;  5H5N A;  2ZIN A;  1MSW D;  2Q8V A;  3DXR B;  2B5U A;  3G67 A;  3AG4 C;  1TUE B;  3DTU B;  1ORQ C;  2VQF B;  4J9Z B;  1JQ0 A;  4MW8 A;  4FK5 C;  4H13 B;  1Q81 W;  1VQ7 V;  1JVM A;  4RWU A;  2GHY A;  4BIU A;  4P9O A;  2GV9 A;  4KHP O;  1UJW B;  1G6U A;  1YZB A;  3LNM B;  2JRI A;  3MHH C;  4B3T B;  3I56 V;  3CC4 V;  4PJ0 Z;  1KU9 A;  1XHZ A;  4R7C A;  5EBW C;  3BRC A;  1GM7 A;  1XMQ B;  4PEL A;  3J80 N;  1NT2 B;  2ZNJ A;  1HNZ O;  4CS2 A;  5BY1 A;  2W6I G;  4ZIB A;  3SPJ A;  1V55 C;  1BHB A;  3SGI A;  4X88 A;  5K1X A;  3FB7 C;  5ITZ A;  3BFR A;  4LF6 B;  3M7M X;  5DEC A;  2YEV B;  3CJH B;  1I7F A;  4K0K O;  4TT3 G;  3QO8 A;  3E8F A;  1Y6X A;  3ZRW A;  5FPO A;  1IBK B;  1WB8 A;  2P90 A;  4TUY B;  5LA6 A;  4F6R B;  2DYR C;  5A9G A;  4GX2 A;  2EIJ C;  2E75 B;  4O2B B;  2V4D A;  1KQS U;  3D8C A;  4LF5 B;  2D2C B;  3L72 H;  3ABM B;  1MG1 A;  4DV3 O;  3QF7 A;  1SS3 A;  2WPD G;  1FS0 G;  4JYA B;  3U11 A;  2UUB O;  4RUE A;  2EIM C;  3NXS A;  2UXD B;  3E8G A;  3F5W C;  4DUZ B;  5B1A B;  2ILM A;  1LNQ A;  1KP3 A;  1F4M A;  4JGS A;  4O2A B;  5A2Q N;  4LCU C;  3CXC U;  4LNU A;  5L3D A;  1JX9 A;  3CCJ V;  5LMU B;  1I94 O;  1W2B U;  1Z5V A;  2RMK B;  1SA0 B;  4FIP C;  1VQ8 V;  4JI7 O;  4B3R O;  2RCV A;  4QPK A;  1PD3 A;  3ZJZ A;  1AB3 A;  1R1B A;  2JGD B;  3HKC A;  3HKE B;  4XBF A;  2GUZ A;  3ABU A;  1U97 A;  2IH1 C;  2A3Q A;  3E35 A;  2WLL A;  5D5P A;  3N2G B;  4DR4 O;  1D5A A;  4TWK A;  3ZIA G;  5IYZ A;  1SES A;  4JI2 O;  1IX9 A;  1I5Y A;  1WNS A;  3CWB H;  5KX5 A;  1EM1 A;  3AG2 B;  3HR0 A;  2HVK C;  4OX9 B;  4WFG A;  3WB0 A;  1THZ A;  3AG7 A;  4QGP A;  1SC5 B;  4WFA V;  4FVM A;  1XQ8 A;  1LUW A;  1SF9 A;  1S77 D;  4PD4 F;  2JS3 A;  1FXH A;  1I08 A;  1Y74 B;  3AEI A;  1EFR G;  3RT3 C;  4DV6 B;  1BHA A;  3JAT A;  5LOV B;  1X4T A;  2EIN C;  1DF5 A;  3K5O A;  1XNR O;  1GMG A;  4D6T H;  2EZP A;  3CS5 A;  4EB6 B;  1HNX O;  1GN6 A;  4DRX A;  3UQ8 A;  3OE7 G;  3W7S A;  2QGN A;  3C3S A;  1IUR A;  5EC1 C;  4RUF A;  1Q3E A;  4ZI7 B;  2Z0A A;  4CH6 A;  4UV8 A;  2RDC A;  2JGU A;  2OYQ A;  2OIE A;  3FAV B;  4MVO A;  2YXY A;  3CRM A;  4B3M O;  4IIJ A;  1RM1 C;  5KHI A;  2DJV A;  2WLI A;  1PNL A;  4LFC O;  5GON A;  2IU0 A;  1N8R W;  1FXK A;  3PJS K;  4TV8 A;  2YUA A;  3L9D A;  1K7D A;  2P6J A;  1KP2 A;  2DN9 A;  2R70 A;  2EJR A;  3ZMV A;  1V54 B;  3OR6 C;  4DUZ O;  2AZ2 A;  3TCU A;  4LH6 A;  5BMV A;  4X64 B;  2WA4 A;  4DK0 A;  3WU2 Z;  3N2K B;  3OW2 U;  4FM0 A;  5EZY A;  2LQT A;  3FB8 C;  3KKY A;  3H1K H;  2IBZ H;  4FM2 A;  3ETG A;  3CCE V;  1QVF U;  3CXH F;  4NTY A;  4PI0 A;  4YIO A;  1X59 A;  2F43 G;  4Q6G A;  1KUQ A;  1OV9 A;  2DYS B;  1YEW A;  3T1C A;  2BE3 A;  4DR3 B;  4TV9 B;  2PZS A;  1BQZ A;  2Q7H A;  3T1Y B;  2ETN A;  1SRY A;  4FPP A;  2IW5 A;  1MNG A;  2CTR A;  1M93 A;  1P49 A;  1EBO A;  2LW7 A;  3TXQ A;  1V9P A;  3CC2 V;  2A06 H;  4AI8 A;  4UCO A;  3CPW U;  1B3Q A;  3FX7 A;  3IC9 A;  3JD2 A;  4CH5 A;  4JV5 O;  4ZBM A;  2FTK A;  3SYO A;  1XNQ B;  1V55 B;  4B3T O;  1KBH A;  5JJE B;  4WFE A;  4XDJ A;  1PV0 A;  3D3Q A;  1H38 A;  1S76 D;  4WFH A;  4BIO A;  3GWK C;  5IYD O;  1RSO B;  2X7R B;  2EUL A;  2UXN A;  4W4L A;  3SPI A;  1WA8 A;  3K0G A;  5KA6 A;  1NS1 A;  2NNU A;  4ICG A;  5CN0 A;  2DWD C;  4H33 A;  4D7T A;  4WBN B;  5FL7 G;  4J41 A;  3HPL C;  1VQ9 V;  3JAW A;  1ZLZ A;  3E89 A;  5JVD B;  2G38 A;  5B1B C;  2ADQ B;  1RPR A;  2YS8 A;  2PYL A;  1HP8 A;  2KG7 B;  3A0H Z;  2BTQ A;  1MOF A;  3CC7 V;  5CB4 B;  4PA6 A;  3T4Z A;  1U96 A;  1R6K A;  3CRA A;  5IYC O;  1HWY A;  1Q6U A;  3B40 A;  1E1R G;  1WPX A;  3E86 A;  2NN4 A;  5EIB D;  3WFV A;  4C7U A;  3ZMT A;  3FD9 A;  1MA1 A;  2HHH O;  4X89 A;  4EFB A;  1VQ5 V;  4DR6 O;  3JAL A;  3FAV A;  2ZXW C;  3WG7 C;  2FYU H;  2WA3 A;  3CRR A;  1Q43 A;  5FPR A;  4X20 B;  1YHQ V;  1K92 A;  4DR5 O;  2MK3 A;  3JD0 A;  3RGB A;  1QLE C;  1Y76 B;  1WPB A;  2LO1 A;  3CME V;  4DRX B;  4DV5 O;  3T2M A;  4TV9 A;  1GN3 A;  1QCE A;  4YY3 B;  1T5E A;  3K5M A;  1JFF A;  1E1Q G;  3SYP A;  1EZJ A;  1Q6I A;  4LF8 B;  5L3B A;  1FPO A;  4X1I B;  4UVB A;  5IDJ A;  1Q7Y W;  1ZUQ A;  3JCZ A;  5DN6 G;  3ETQ A;  5LOV A;  3ZMU A;  1VF6 C;  3K58 A;  4OX9 O;  1VF7 A;  4GKK B;  2QKA A;  5LYJ B;  4AQY O;  2E5L O;  1Z5W A;  4UFZ A;  5CA1 B;  1TUB B;  1W59 A;  3M99 B;  2V1D A;  2JK5 C;  3D3I A;  4DV0 O;  1J5E B;  2KQX A;  5H9C A;  4MW3 A;  3E2E A;  2Q7G A;  2KB1 A;  4YHH O;  2ZM6 O;  2YXH A;  4W4K A;  5EC2 C;  3ZX6 A;  3FYI B;  1PPJ H;  4F6E A;  3VQY A;  4HZ3 A;  2DQ3 A;  3N2G A;  3U10 A;  2QE7 G;  4DR2 B;  2JS5 A;  3ASN B;  5IJ9 A;  5EBM C;  1OCR C;  2WAM A;  3B4S A;  3M8A A;  1GM9 A;  4GYC B;  3THO A;  2ZCE A;  4MTX A;  1NVP D;  3K9S A;  3S3X A;  4LFB B;  2NR5 A;  1BSM A;  4ASU G;  1HNW O;  4MSW C;  4R6Z A;  1D5N A;  1QQC A;  3L73 H;  1PL4 A;  3OR7 C;  4UCV A;  4EB6 A;  3FB6 C;  3VQW A;  2HG5 C;  1N4C A;  5H6R A;  5JQG A;  1VQP V;  1H8E G;  2F1M A;  2QM4 A;  4QE7 A;  1KD1 W;  1H2M A;  1M90 W;  4UCT A;  3QO5 A;  1EZV H;  5CA1 A;  1CXZ B;  5HFM A;  4KXR A;  1GN4 A;  3CYO A;  4J11 A;  5GTI Z;  2A0L A;  5C93 A;  2XT9 A;  2ITC C;  1GAX A;  5J9P C;  2D3O W;  4NXM B;  3KCY A;  1H8H G;  3QVN A;  3RYI A;  4JI5 B;  3G71 V;  4I0X A;  1B06 A;  4JF3 A;  4GT1 A;  4R50 A;  3SPC A;  3R65 A;  2E76 B;  3OGC C;  1M57 B;  4UB6 Z;  3CCS V;  4X20 A;  3LDE A;  3HKC B;  2CDY A;  4UVA A;  3JD4 A;  2CGO A;  4WF9 V;  3ABT A;  4NR1 A;  2QM7 A;  3ABK C;  4GUN A;  1WN7 A;  4PA7 A;  4FJC C;  2K1E A;  5L3E A;  2Y69 B;  1FJG O;  2AHY A;  2P06 A;  4H0L B;  3K5N A;  1BMF G;  4NTX A;  3FKS G;  4PA3 A;  1ZL8 B;  3AK1 A;  4PDV A;  4DV6 O;  4I55 B;  1PNM A;  4DUY B;  2LGW A;  3JAK A;  2HR3 A;  3SYC A;  3SDL A;  2CGN A;  2YC0 A;  4LF7 B;  3APO A;  3LNN A;  4KL1 A;  3GVM A;  4JI1 B;  3ETD A;  5LMN B;  2Q0A A;  5LYJ A;  1KEC A;  4D7S A;  1OZ0 A;  4LBE C;  4DR2 O;  4AHC A;  2ZIO A;  3K57 A;  4X1I A;  3B09 A;  4BR6 A;  2GSM B;  4O2B A;  4WCE V;  1K9M W;  3UT5 A;  4JI0 O;  4F4L A;  5LA6 B;  3CCQ V;  4FLX A;  5KHG A;  5KHJ A;  2OIG A;  3GB7 C;  5E1A C;  4A5U B;  2LW1 A;  1TAE A;  2JJ1 G;  1J95 A;  3SYA A;  1MZF A;  1Q82 W;  4I50 B;  5IJ0 B;  1L1F A;  4GX5 A;  3RVZ A;  4O4I B;  1Y66 A;  1R3I C;  2UU9 B;  1JR9 A;  2OT5 A;  4U3F H;  4LFA B;  4MS2 A;  1YIT V;  3X2Q B;  3ABL B;  5IE9 A;  4JI4 O;  5CB4 A;  3LSS A;  1VQO V;  2WLJ A;  2XAH A;  4OXS A;  1FXV A;  4PI2 A;  1I0H A;  2XND G;  1K4D C;  4JTD B;  2XTA A;  3JAW B;  3A0R A;  2BSK B;  5LHI A;  4O4H A;  1NR1 A;  2E5L B;  1UPG A;  5GTH Z;  1XL4 A;  1SQF A;  2QA4 V;  3H1L H;  3QO7 A;  1QBZ A;  1N34 O;  2CTQ A;  3OTF A;  3RWR D;  2B9Z A;  2JDI G;  4NXN B;  1XMO O;  2VWK A;  2E74 B;  4QNH B;  3OD4 A;  1LR1 A;  4Z1V A;  4HBN A;  1RP3 B;  2UUA O;  4X62 B;  1AJQ A; 
#chains in the Genus database with same CATH homology
 3FB8 C;  4JYC A;  3OEE G;  2QEX V;  1ENV A;  3W7W A;  2A79 B;  2W0F C;  1VQN V;  3ETG A;  4UUJ C;  3CCE V;  1QVF U;  2OCC B;  2HVJ C;  4H37 A;  4KFM A;  2EIL C;  5LHH A;  1K4C C;  2F43 G;  4YXW G;  3EHB B;  2OTL V;  1CP9 A;  2LFS A;  4CBC A;  4CZZ A;  1S72 V;  3B77 A;  2DYS B;  3RW0 A;  1CPY A;  2WLH A;  3T1C A;  3DGE A;  1OCZ B;  2ZR3 A;  4BAY A;  4UXN A;  2YSU B;  1K5S A;  3K0D A;  4N21 A;  2XOK G;  3I55 V;  1AI5 A;  1VQM V;  3STL C;  3LUT B;  2A9H A;  4QJF B;  1SRY A;  4FPP A;  1E79 G;  2IW5 A;  3BY6 A;  2W6J G;  1WLE A;  1F51 A;  1YIJ V;  1PNK A;  1QVG U;  1NR7 A;  2QKS A;  1F4N A;  1EBO A;  3ZMS A;  1V54 C;  1OCO C;  3CC2 V;  2IJK A;  1JCH A;  1VQK V;  4XDK A;  1YI2 V;  3K3W A;  1F23 A;  5L3F A;  3CPW U;  3JD2 A;  2JJ2 G;  3X2Q C;  1I5X A;  3BEH A;  4KUM A;  4ZBM A;  2FTK A;  4UV9 A;  3SYO A;  1VQL V;  1V55 B;  2EBO A;  2P7T C;  2IJJ A;  3OUS A;  1M1K W;  4WFE A;  3CCV V;  4MVM A;  4XDJ A;  1R73 A;  3F7Y C;  4TSF G;  4JPR A;  2Q69 A;  1H38 A;  5BZB A;  2B1G A;  1QLE B;  1S76 D;  4WFH A;  3D36 A;  3E8H A;  5IYD O;  4WFF A;  1H2G A;  4FMT A;  1SER A;  2BOC C;  1M56 C;  5KUM A;  2WSS G;  1S3J A;  1R3J C;  2X7R B;  4G27 B;  2UXN A;  1RPO A;  4HAM A;  3SPI A;  4U7O A;  5LBQ A;  3K0G A;  2WLK A;  4E2L A;  5KA6 A;  5CBF A;  2ZR2 A;  2NNU A;  1NVP B;  5CN0 A;  2DWD C;  2WLL B;  2WLI B;  4GCZ A;  2HKO A;  1OCZ C;  4H33 A;  3TK1 A;  5FL7 G;  3OAA G;  3OFN G;  1Q86 W;  2ZDI A;  4HYO A;  3K9A A;  3HPL C;  1VQ9 V;  3ABK B;  2WWW A;  1YJ9 V;  1NQT A;  2X6C A;  3SPG A;  1NH2 D;  3E89 A;  3MD0 A;  3JD3 A;  5B1B C;  3JYC A;  1RPR A;  1SET A;  4I5S A;  1AR1 B;  1AJP A;  4MTO A;  1MOF A;  5CMU A;  4JYB A;  3P32 A;  4QIW F;  3CC7 V;  2EIN B;  3CD6 V;  4PA6 A;  3T4Z A;  2HFE C;  1DTO A;  1R6K A;  2EIM B;  2R9R B;  5IYC O;  1HWY A;  3VOU A;  2JEX A;  5KA5 A;  3CCR V;  1ARO P;  5CBG A;  1PL0 A;  2EZO A;  1G4Y B;  3AG3 C;  3K08 A;  3ZRX A;  1E1R G;  1WPX A;  3E86 A;  4PDL A;  2ZQM A;  3WFV A;  3ML0 A;  3ASN C;  2XAF A;  2IJI A;  3UKM A;  3LSQ A;  2H94 A;  3ZMT A;  3QNE A;  4X89 A;  4G2K A;  5LGU A;  1VQ5 V;  1DLB A;  4GX1 A;  4XDL A;  1FXK C;  1YSC A;  2ZXW C;  4MT8 A;  3WG7 C;  2QTO A;  1OCC C;  5L3G A;  4Q20 A;  3W7X A;  2DYR B;  3AG4 B;  1YHQ V;  1K92 A;  2WLM A;  4PA4 A;  2MK3 A;  3JD0 A;  5IY5 B;  1QLE C;  1M9N A;  2M7W A;  4GX0 A;  2OTJ V;  3CME V;  3H01 A;  1AI4 A;  2Q67 A;  3E8B A;  1OHH G;  4P30 A;  3T2M A;  1QCE A;  1P7B A;  1COW G;  1E1Q G;  3CP1 A;  4PDM A;  1R6N A;  3WG7 B;  1JPX A;  3SYP A;  3MHS C;  2Z5U A;  1EZJ A;  2ITD C;  4JAV A;  2JIZ G;  5L3B A;  2WLN A;  2IJH A;  1GKF A;  4UVB A;  5IDJ A;  2EIK C;  1Q7Y W;  3JCZ A;  4P2Z A;  5DN6 G;  2CK3 G;  2ATK C;  2DWE C;  3IC7 A;  3ZMU A;  5LGN A;  4LP8 A;  4EKW A;  1W0J G;  4QPJ A;  3ZN0 A;  2XAJ A;  2HJF C;  2NLJ C;  2LFR A;  1YTF B;  2LP7 A;  3M99 B;  2V1D A;  2JK5 C;  3D3I A;  5GW7 A;  3UM7 A;  3G4S V;  1S0V A;  5H9C A;  4MW3 A;  3E2E A;  2B1I A;  2KB1 A;  3ZRW B;  1VQ6 V;  1MSW D;  2B5U A;  5EC2 C;  3AG4 C;  1TUE B;  3DTU B;  1ORQ C;  3FYI B;  4MVR A;  4J9Z B;  1JQ0 A;  3ASO B;  1AI6 A;  4KP4 A;  3RBZ A;  1FXK B;  2ZD9 A;  3SPH A;  3JD1 A;  4MW8 A;  4FK5 C;  2X6B A;  4HZ3 A;  4DO2 A;  1Q81 W;  2DQ3 A;  1VQ7 V;  1JVM A;  2OCC C;  2QE7 G;  2QM8 A;  3OMA B;  2GHY A;  1R3K C;  4RO2 A;  4BIU A;  4P9O A;  3ASN B;  5CA3 A;  3AG1 C;  5EBM C;  4U7N A;  3SJQ C;  1OCR C;  2WAM A;  3AG3 B;  3GWO A;  4MVS A;  1UJW B;  4MVZ A;  4PA9 A;  3RVY A;  3LNM B;  1GM9 A;  3MHH C;  1JOY A;  4UVC A;  3I56 V;  3CC4 V;  3ABM C;  1MAB G;  4MTX A;  4R8C A;  1NVP D;  4R7C A;  5EBW C;  3B8N A;  1K73 W;  2Q68 A;  1QR9 A;  1GM7 A;  4BIZ A;  4ASU G;  4PEL A;  4LC1 A;  3IGA C;  2W6I G;  4JAS A;  1NJI W;  5B1O A;  3SPJ A;  2JEU A;  4MSW C;  4R6Z A;  5CBH A;  1V55 C;  1BHB A;  3OUF A;  3OMN B;  4X88 A;  5EBL C;  3OM3 B;  3OR7 C;  1QLN A;  3K79 A;  3FB7 C;  3FB6 C;  4MVU A;  2DQ0 A;  3EFF K;  5IYB O;  4PDR A;  2HG5 C;  3AG2 C;  2YEV B;  5H6R A;  4TT3 G;  3QO8 A;  4RAI A;  1VQP V;  3E8F A;  3HB3 B;  3KG2 A;  1H8E G;  3ZRW A;  4QE7 A;  1KD1 W;  3AG1 B;  3ETE A;  1M90 W;  3QO5 A;  2Y69 C;  2XAQ A;  2P90 A;  1NBM G;  1W0K G;  5LHG A;  4JTA B;  5HFM A;  2XAS A;  2IU3 A;  2IH3 C;  1QR8 A;  3T4D A;  3FYE B;  2DYR C;  2X6A A;  4L87 A;  1K5Q A;  4GX2 A;  2EIJ C;  3CYO A;  3ZMZ A;  2A0L A;  3F7V C;  5C93 A;  1KQS U;  1YJW V;  2ITC C;  3OMI B;  3ZRS A;  2YEV A;  2EIL B;  5J9P C;  2D3O W;  1H8H G;  1K3E A;  3ABM B;  1MG1 A;  1PKX A;  5L3C A;  3K03 A;  3G71 V;  1K33 A;  1ZWI C;  1FS0 G;  2WPD G;  1G8M A;  1FFT B;  4JF3 A;  4GT1 A;  4P9P A;  4R50 A;  3SPC A;  1OCR B;  3R65 A;  4RUE A;  2EIM C;  3NXS A;  2H8P C;  3E8G A;  3F5W C;  3OGC C;  4QE9 A;  5B1A B;  5B3S B;  1M57 B;  1LNQ A;  1KP3 A;  3CCS V;  3LDE A;  5B1N A;  1F4M A;  4UVA A;  1YJN V;  4JGS A;  2DYS C;  3JD4 A;  3CCU V;  4WF9 V;  3ABT A;  5HFL A;  2QM7 A;  3ABK C;  4LCU C;  1BL8 A;  3CXC U;  4PA7 A;  1Y4M A;  4FJC C;  5L3D A;  1JX9 A;  2K1E A;  5B1A C;  2Y69 B;  5B3S C;  5L3E A;  4RQE A;  3CCJ V;  1W2B U;  2AHY A;  1VQ4 V;  2AHZ A;  1BMF G;  4Z1M G;  3FKS G;  4PA3 A;  4MTG A;  4JTC B;  1NKD A;  2PI4 A;  4FIP C;  1OCC B;  1VQ8 V;  4QPK A;  1IXM A;  1PD3 A;  4X8A A;  2PI5 A;  4PDV A;  5EK0 A;  3ZJZ A;  3ZRV A;  1PNM A;  2HR3 A;  3SYC A;  2EIK B;  4DXW A;  1ROP A;  4I9W A;  4XBF A;  4WFB V;  3ABL C;  3ABU A;  1KC8 W;  2EIJ B;  2IH1 C;  3FB5 C;  3E35 A;  3ETD A;  3STZ C;  2WLL A;  3K06 A;  1NH2 B;  3IFX A;  5H6Q A;  3SYQ A;  5IY5 C;  1KEC A;  1OZ0 A;  4TWK A;  3ZIA G;  1SES A;  4LBE C;  4RQF A;  1CEZ A;  1RM1 B;  2V7Q G;  1AI7 A;  2DW4 A;  4MTF A;  1I5Y A;  2GSM B;  2XAG A;  2ZXW B;  3AG2 B;  4WCE V;  2HVK C;  1GK9 A;  4WFG A;  1B6Q A;  1THZ A;  3W7U A;  1K9M W;  4F4L A;  4WFA V;  1M57 C;  1R3L C;  1DF4 A;  2Y48 A;  3CCQ V;  1S77 D;  3GB7 C;  3LDD A;  5E1A C;  1K34 A;  4BW5 A;  1FXH A;  1S5H C;  3W7T A;  3AEI A;  3G6E V;  1EFR G;  2JJ1 G;  3ASO C;  1J95 A;  3SYA A;  1BHA A;  1Q82 W;  2EIN C;  1GM8 A;  1GO3 F;  2HLD G;  3E83 A;  1DF5 A;  4MVQ A;  2R9I A;  1GMG A;  1L1F A;  4GX5 A;  3ZN1 A;  3K04 A;  3RVZ A;  2EZP A;  1Y66 A;  5B1B B;  4J9Y B;  1R3I C;  2OT5 A;  2P67 A;  4MS2 A;  3OE7 G;  5DM6 V;  3W7S A;  2C2A A;  1YIT V;  1K97 A;  2ZDI C;  3X2Q B;  1P4R A;  3LDC A;  3ABL B;  5EC1 C;  2Q6A A;  4RUF A;  5LGT A;  3VBB A;  3OEH G;  3LSS A;  1OCO B;  1VQO V;  2WLJ A;  4UV8 A;  2XAH A;  4OXS A;  1FXV A;  2X0L A;  1KKD A;  2XND G;  4MVO A;  1K4D C;  1M56 B;  4JTD B;  1JJ2 U;  3A0R A;  1RM1 C;  3TET A;  5LHI A;  1GTO A;  5KUK A;  1AJN A;  1YTF D;  1NR1 A;  1K8A W;  2WLI A;  3B8M A;  1XL4 A;  4G28 B;  1PNL A;  3P30 A;  2IU0 A;  2QA4 V;  2Z3Y A;  4JAU A;  1N8R W;  3QO7 A;  1FXK A;  3PJS K;  3CCL V;  1QBZ A;  1K7D A;  4N23 A;  2P6J A;  3CMA V;  1SZT A;  1KP2 A;  2JDI G;  4ZKI A;  2EJR A;  2UXX A;  3ZCC A;  1V54 B;  3OR6 C;  3ZMV A;  4QNH B;  2BOB C;  3TCU A;  3OW2 U;  1XL6 A;  1AJQ A;  3CCM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...