3E89A

Crystal structure of the the open nak channel-low na+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 32
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e89A00
1G4YB 4HYOA 4XDKA 4QE9A 4H33A 5KUMA 3F7VC 2DYSC 2A9HA 3ABLC 2DYRC 1XL6A 3FB7C 2KB1A 2X6CA 4G27B 4R8CA 4RO2A 3RVYA 1R3IC 4MVZA 2WLJA 3SPJA 3OR7C 3FB5C 3AG4C 3K03A 4I9WA 3STZC 1V55C 3PJSK 4QNHB 4EKWA 1K4CC 3F7YC 2BOCC 3HPLC 4JTAB 3RW0A 4BW5A 1R3LC 2ITDC 4H37A 4MVSA 4P30A 3WG7C 3TETA 3E8GA 2Q6AA 2WLHA 3LDCA 2EINC 4P9PA 4X89A 3UKMA 4MVQA 1OCRC 5E1AC 5EBMC 3AG3C 1S5HC 2R9RB 4MVOA 3R65A 4PA7A 4OXSA 2JK5C 4P9OA 3T2MA 1OCOC 2X6BA 4JTCB 3T1CA 2QTOA 3LUTB 1OCCC 2HFEC 2WLIA 3LDEA 3FB8C 4GX0A 4MTGA 4PA4A 2ZXWC 4R50A 2OCCC 4MW8A 1M57C 2WLLB 4R7CA 3SPCA 4DXWA 1BL8A 1ORQC 5KUKA 3BEHA 3SYCA 3RBZA 5J9PC 2W0FC 4WFHA 1QLEC 2AHZA 2HJFC 2WLIB 4GX5A 3SYQA 1ZWIC 1XL4A 4QE7A 4J9YB 5B1AC 1P7BA 1R3KC 4LBEC 3ZJZA 4PA6A 2WLKA 2P7TC 4LCUC 4UUJC 3UM7A 3E8BA 4MTFA 4XDJA 3K0GA 3ABKC 2Q68A 3AG1C 5EC1C 2AHYA 3ASNC 1KKDA 2K1EA 4LP8A 2HG5C 5IY5C 2WLLA 2DWEC 2Q67A 4CBCA 2A0LA 2HVJC 2ATKC 4R6ZA 3SYOA 4PDVA 4RUFA 3T4ZA 5B1BC 1M56C 2ITCC 4J9ZB 5CBHA 1K4DC 3AG2C 4X8AA 4HZ3A 4JTDB 2WLMA 5B3SC 3LNMB 1R3JC 2X6AA 4MS2A 4MW3A 5CBGA 4G28B 3E8HA 3IGAC 2BOBC 4WFGA 3SPIA 3VOUA 3X2QC 4WFFA 3RVZA 2A79B 3OUFA 3ASOC 2EIMC 5EBWC 2IH1C 3STLC 4PA9A 2EIKC 3E83A 4TWKA 4WFEA 2H8PC 3SYPA 1OCZC 4PDLA 4P2ZA 3SJQC 2QKSA 3K08A 4MVRA 4GX2A 5EC2C 4MSWC 3E89A 5EBLC 3OR6C 3OGCC 3EFFK 2DWDC 3IFXA 3LDDA 3K06A 3E86A 3F5WC 2HVKC 5BZBA 4MTOA 4X88A 4F4LA 3T4DA 3KG2A 3SPGA 3E8FA 3FB6C 2Y69C 3JYCA 4PA3A 4PDRA 5CBFA 3ABMC 2NLJC 2YEVA 3OUSA 4KFMA 3SPHA 4PDMA 4RUEA 2IH3C 4MVUA 2ZD9A 3ZRSA 2WLNA 3TCUA 1J95A 1LNQA 3SYAA 1JVMA 4GX1A 2Q69A 3K04A 2EILC 3GB7C 3K0DA 4MVMA 4ZBMA 4XDLA 2EIJC 4RAIA 5EK0A 1V54C
chains in the Genus database with same CATH superfamily
3CJHA 1DF4A 2RNBA 2R72A 1G8MA 3ABLC 4KHPB 2OTLV 1XNQO 2V7QG 5LA6B 5LHIA 4J41A 4KXRA 5B1BB 3TETA 3JD1A 1HNWB 1KP2A 4UV8A 3CCJV 1FXVA 2R9RB 1VQLV 2CH7A 2GTAA 3CRRA 3AK3A 3RYFA 1BS3A 4LC1A 4N23A 2CTRA 4JI8B 1EBOA 2JRIA 4TUYB 1TVKA 5LHHA 3AG7A 5KA6A 1BL8A 1Y67A 2JGDB 5JJJB 2LGQA 2XAFA 3ML0A 4PHZA 4GYCB 1E1RG 2AHZA 3BY6A 2YIBD 2DOSA 1KU9A 2LO1A 3RT3C 2IW5A 3CCEV 1E79G 1GN4A 2DE0X 4FM2A 3O65A 1KYOF 3T1HB 2WLLA 4IYHA 2V1DA 1QHTA 2PZSA 5LXTA 1VF6C 4PDVA 4DW0A 3JALB 3CX5F 4IHJB 4X8AA 5LYJB 1CXZB 2WA3A 3OD4A 2QA4V 3JASA 1WPXA 5KA5A 1SQFA 5FL7G 3CC4V 3JARA 4J10A 2YC0A 3OW2U 2NR5A 4K35A 4UCRA 1VF7A 1XREA 4JI8O 2PUSA 4FVMA 1FXKC 3P3NA 1AP6A 3GB7C 3S3XA 4B3SB 1QLEB 2OT5A 1IDSA 4GUNA 4H33A 2DYRC 4NR1A 2KB1A 2DJVA 5ITZA 1R3IC 2A3QA 2WLJA 3JSNA 3K9SA 2OIGA 5HFMA 4MT8A 3PJSK 2R9IA 4JYAB 2OTJV 1CP9A 1DLBA 4JYBA 1R3LC 2LW7A 2M7WA 4H37A 4MVSA 5JCOC 3F5TA 1MZFA 4TSFG 4JI0O 1Y76B 4JGSA 1JX9A 1H8HG 4P9OA 2XOKG 2X6BA 3L9DA 2EJRA 4IGGA 2WLIA 4PA4A 4R50A 1M57C 1NTKH 1NH2B 3B4SA 2LFRA 1H2NA 4DR1B 1JA8A 3RBZA 5J9PC 4UCTA 1YI2V 1QLNA 3FX7A 1NJIW 5IYZA 3H9VA 2B1IA 4FFKA 1R73A 1VQPV 1NVPD 1EN6A 1KKDA 3KCYA 2K1EA 4LFCO 4LFBB 3FFQA 2JS5A 2A7WA 2JS3A 1R3JC 2Z0AA 3AG4B 1ZL8A 1BSMA 5HFLA 2RMKB 5EIBD 4WFFA 1SESA 4DR3O 1Y66A 3K5OA 1GM8A 3E83A 4ASUG 5BMVB 3QF7A 5KHHA 4B3MB 1M9NA 4UCSA 2W0XA 5EBLC 3OGCC 3EFFK 3PN1A 5LOVB 1Q8IA 1TUBA 3CHXA 4DR1O 1SQQH 3K04A 4EFEA 5H9CA 5EK0A 3CWBH 4J11A 4UV9A 1AI5A 2FYUH 4NXNB 2KG7B 4R8CA 4HNAB 4MVZA 1EN4A 3ABKB 3AG1B 4CS3A 4DR5B 1AR5A 3NXSA 4BW5A 3WB1A 3L72H 5IDJA 1VQ5V 1RPRA 4TV9B 1YF2A 2GV9A 1QR9A 2UXDB 3CC7V 2YIDA 1S5HC 2EIMB 3QO5A 1Q6IA 2RN9A 2JK5C 4DV2O 1OCZB 3LNNA 3UT5A 3C3TA 3K3WA 2ILMA 3JATA 1D5AA 3LSQA 1Y6XA 2D2CB 2CH7B 3B8MA 2OCCC 1F4NA 3EVKA 2ZE7A 3RYFB 4FLXA 1FJGO 4CS4A 1YXBA 3CMAV 4GX5A 4WFBV 1TVKB 2CK3G 2ADPA 5H6RA 4FMTA 1X4TA 4ZIBA 3E8BA 3CCSV 2OCHA 2V4DA 1YSCA 4EFBA 4DW1A 3ABUA 1GK9A 3B2EE 2QTSA 2YXLA 1MABG 1JPXA 4DV1O 2Y4UA 4LF5B 1M56C 4J9ZB 1LR1A 4DR5O 1AJQA 3JD3A 3SPIA 5DM6V 4D7TA 5JQGA 2ODMA 2F4VB 3OUFA 3JAWB 1OJHA 4YJ2A 5LGUA 3VQXA 4JPRA 5CA1A 3K79A 5F2VO 2QKSA 1YHQV 2UXDO 4EB6A 4X64O 1RP3B 4DV3B 3L74H 3VQWA 3IFXA 3G71V 1NZ6A 1N34B 3JARB 3DSQA 4ZOLB 1XHXA 2AW9A 3ABMC 1SF9A 3ZRWA 1RSOA 3G67A 3MHHC 2WLNA 3TCUA 4J7KA 3SDLA 2GDSA 5GONA 5C93A 5IE9A 4YHHO 3CS5A 4NB5A 5EIBC 3JAMN 2A06H 4DR2O 2JIZG 4FLZA 1GAXA 5A9GA 3K03A 1S77D 5IY5B 3CB2A 2CE4A 5ITZB 3JD4A 2FKXA 1NR1A 1KKCA 1VQ9V 1PM9A 2D3OW 4UCVA 5B3SB 1JOYA 4GLXA 2XAJA 3UKMA 5E1AC 1OCRC 1H2LA 4C7UA 4MVOA 3MD0A 1MMMA 4CC5A 1N4CA 5LA6A 3OM3B 1Y74A 4OPAA 3U0ZA 4BAYA 2L6LA 2P4KA 1ORQC 2LFSA 1NT2B 1VARA 3D8CA 4PI0A 2WLIB 2QR4A 3DGEA 1GN6A 1HP8A 1R3KC 4GCZA 2IJKA 4X1IA 5EC1C 5KAFZ 4DV5B 1V54B 4DRXA 1DK1A 4I0XB 1SRYA 1YJ9V 3OT7A 4WFAV 5KLVH 3GVMA 1SKVA 3RVZA 2A79B 1J5EO 1SQGA 1LUVA 4DV6O 3N2GB 4WFEA 2GSMB 3AK2A 4CH3A 3JALA 1R6TA 4OX9B 5LYJA 2HVKC 1CEZA 4MTOA 1Z5VA 2Y69C 5J2UA 4LF8B 5L3EA 5LBQA 2VQFB 2UUBB 1FAFA 4X1KB 1PNMA 1K5SA 3OMNB 1LNQA 1TAEA 2JDIG 1PL0A 3H1HH 4XDLA 1S76D 1O9GA 2QJ1A 5KUMA 1TUBB 1S3JA 1PNLA 3SGIA 2W6IG 1IBMB 3SPJA 1FXHA 3ASNB 1VQ7V 4DV4O 1M90W 1X59A 2Y4TA 1P7GA 1Q81W 3K58A 3D3IA 2JEXA 3APOA 2Q9LA 3DC6A 4MVQA 2WAMA 3APQA 2R70A 3QO7A 1K8AW 4Z1MG 2YIAA 2GHYA 4G2KA 3LDEA 4GX0A 3ZN1A 1N36O 5K1XA 1BT8A 2N74A 1NQTA 3JATB 2UUAB 4LF8O 2VQFO 5CB4A 2UUBO 1G1XB 3N2KA 5L3DA 4WBNA 1HDJA 1OV9A 1P7BA 4FLUA 4LBEC 3LSSA 2QWQB 1OCRB 1Q90D 5KX5B 4BW9A 1FFXB 4R6ZA 4UVAA 1KC8W 3UO2A 2B1GA 2P90A 4I5SA 3E8HA 3QVNA 3VOUA 1YJNV 2XHBA 3BAAA 1QVFU 3LSUA 3L73H 3A8TA 4LF7O 5LMNO 3SJQC 1RM1B 3OAAG 3E89A 2F95B 4KP4A 4IT5A 3RN4A 5CA1B 1IXBA 2F1MA 3SPGA 3JD2A 2RDCA 3ZN0A 4UB6Z 4DYLA 2OIEA 4HAMA 3SPHA 2N04A 2ZE8A 2AXTZ 4GZRB 1KD1W 4B7EA 1CPYA 2UUAO 1EFRG 2EILC 4MVMA 3ZRWB 2BSKB 2EIJC 4JZ2A 4GKKB 4I50B 1KMIZ 4ZI7B 4QE9A 3F7VC 5B1AB 2A9HA 5GONB 1VF6A 5H2FZ 2P6JA 2HR3A 2Z3YA 3TXSA 4UVBA 2ADQB 3ZBHA 1IX9A 4F6RB 4DR4O 3AEIA 3W7UA 4P9PA 1VQOV 1IBKB 2KG7A 4HNAA 3AK1A 1GKFA 4L87A 1BMFG 1XMQB 4OXSA 1KECA 4JI6B 2JJ2G 1QQCA 1K33A 1VMGA 5IWAB 4TV9A 2ZXWC 1AROP 3M99B 4R7CA 3J7AU 2VRZA 4LF4O 1Y74B 2E76B 4WFHA 3MAQA 1K92A 5DECA 4K0KB 4O4JB 2BE3A 1MSWD 1XOUA 4U3FH 2F66C 2HJDA 4X1IB 4JI5O 3AG2C 2IM9A 4PELA 4TOIA 5JCOA 2CDYA 4MS2A 4RWUA 4DRXB 3D36C 1MNGA 4U7NA 4L8JA 5AG2A 3ZS8C 4WCEV 4QPKA 3SR2C 1IBKO 4O2BB 3M7MX 5IJ9A 3DXRA 4JF3A 1AILA 4MSWC 3ZMZA 1H2GA 4DR7O 4O4HB 1XMQO 3AG3B 2XNDG 3FB6C 3ETGA 1GO3F 5CBFA 3JAWA 4ZHQA 4KHPO 3ZMTA 4DK0A 1PD3A 5IWAO 4JAUA 4JI3B 4MTXA 4TQFA 4KL1A 4YIOA 4B08A 5J2UB 5L3GA 4FK5C 2X7RB 1NKDA 1HNWO 4K0KO 4XDKA 4ZOLA 2QDOA 3FB7C 1SA0A 3VBBA 1VQ4V 1VQ8V 3THOA 2ZKOA 1SQVH 2K9PA 3OR7C 4I9WA 4QNHB 1N8RW 5CA3A 1PPJH 4P30A 1F7YA 3E22A 2IJIA 1FD9A 1WP8A 3R65A 4PA7A 4FLTA 2YIBA 5DEDA 2PI4A 3T2MA 2UXNA 2RQ6A 3T1HO 2HFEC 3ZRXA 3FB8C 2Y0IA 2JEUA 4NKGB 5D5PA 1HR0B 1Q82W 3E2EA 3SYQA 1SS3A 3ZHRA 4NTWA 4QE7A 2AZ0A 1SQPH 3ZJZA 4LCUC 5KMGA 2P67A 5CB4B 3FAVA 3A0BZ 4FLYA 3N2KB 4YJ3A 4CH5A 1NS1A 4WBNB 4CBCA 1IZ3A 3QNEA 2R9AA 4I9QA 3ABLB 2ITCC 5B1OA 2WA4A 1LUWA 2QKCA 3BVOA 3IC7A 2XTAA 3X2QC 3ASOC 3CSXA 1D5NA 3OMIB 2EIKC 4I0XA 2HP8A 3K5MA 4B3SO 1H2KA 1JJ2U 1I94B 1XMOB 4X88A 2B9ZA 2ZQMA 1AI4A 3HKEA 3OUSA 4AQYB 3N2GA 2UXCB 1W0KG 4PDMA 4FLWA 4JYAO 4BR6A 1B06A 1HR0O 4ZBMA 3HR0A 2E5LB 2AZ2A 1XL6A 3WB0A 2JGUA 2UUCB 4X66B 2JVDA 2QKAA 4X1KA 1ENVA 1NU1H 1V55C 3A0HZ 2Z5UA 3K5LA 3BA9A 3F7YC 2YXYA 4QGPA 1B3QA 5KHIA 4D6TH 2Q0AA 5DN6G 1R1BA 2XAQA 4WF9V 2WWWA 4PD4F 4AILC 5JWPA 3SJBC 2ZCEA 4JTCB 3ZCCA 2CGNA 3QTCA 2DMXA 1VQMV 1HWYA 1I94O 2IU0A 4LFBO 1OCCC 1QR8A 4J42A 1XMOO 4JAAA 4MTGA 3OTFA 5EZYA 1QU7A 5LGNA 4AQYO 3IAYA 5FPRA 2EZPA 1FXKB 3MHSC 3H1IH 2X0LA 3CEIA 5LMUB 4DV7B 1OHHG 1YDXA 3NR7A 1HW7A 4B3MO 3FD9A 3FYEB 4QPJA 4BIUA 2DYRB 2UUCO 3CRCA 5CBHA 1YTFD 3UCSC 4JTDB 3E35A 2UU9B 1NTMH 4G28B 4FZ1A 3FKSG 3HKBB 1U97A 5KX5A 3VQYA 2OYQA 3K9AA 3TJTA 1FFXA 5LHGA 4K3AA 5EC2C 3CRQA 1JJOA 5LP6C 4FIPC 1N33B 1NR7A 1WN7A 4NXNO 5IJ9B 4FFBA 1ROPA 3DXRB 4PA3A 4FLVA 4LNUB 2CUGA 2ZD9A 4JI4B 3ZRSA 1M57B 1URFA 1XI1A 4ZHQB 4LF9B 4J7JA 5CA0A 5FPOA 1WB7A 3ZHSA 1XNRB 2CAZC 1H2SB 2CTQA 5LMUO 4DV7O 2QGNA 2RCVA 2ZINA 1I08A 1I0HA 2F43G 3Q4HB 1SA0B 3KKYA 2VWKA 2BSKA 5LL6Y 3CPWU 2Q6AA 2WLHA 4I50A 4ZI7A 4LFAB 3OTOB 4JI7B 1GN3A 2ZDIC 1D2DA 1L1FA 2F23A 2BTQA 3E22B 1WLEA 1FPOA 1I5YA 3L70H 1OCOC 4F6RA 1Y4MA 5B5EZ 1N33O 3ZMUA 1MA1A 4IL6Z 4LF5O 1BQ0A 2P22C 3W7XA 1MZEA 3SJCC 4JI4O 3IC9A 2XT9A 2F4VO 1T5EA 1OZ0A 2WLKA 4UUJC 4CZZA 5L3CA 4MTFA 1ZUQA 2ZM6B 4LP8A 4DV3O 2CTPA 1XNRO 4RUFA 3OGIB 3A2FA 5KMGB 5D5QA 1N34O 4CH6A 3FAVB 4YJ3B 1FYJA 3BRCA 3ZMSA 2DQ0A 2HLDG 4O4JA 4YIPA 2ZR2A 1VP7A 1SZXA 3DC5A 3SYPA 4PDLA 3OTOO 4BWAA 1JR9A 1AP5A 1TA8A 3KG2A 4ABMA 1AB3A 1ZSPA 1R6KA 1GM9A 4KFMA 2IH3C 1EM1A 2OCCB 3H1JH 4O2BA 4O4IB 1O9HA 3TK1A 1TUEB 1ZAUA 4DK1A 4O4HA 3HKEB 4CH4A 4FPPA 1MG1A 1B04A 4UFZA 4YY3B 1R6NA 2DYSC 4PJ0Z 3G80A 3IJ4A 1K34A 1JMKC 1K4CC 1M56B 3WG7C 4LWSB 3RFRA 1IXMA 2EINC 5L3BA 2Q7EA 4OGQB 3OEHG 5EBMC 2ZT9B 4NVPA 5JH7B 4PV1B 1QVGU 4I55A 1L0NH 3J80N 4DV5O 1BZKA 1P4RA 2Q0OC 1H8EG 1ZX3A 2KQXA 2QM8A 4W4LA 2PF4E 1PKXA 5KUKA 1NVPB 3ABMB 2HJFC 3CXHF 2ZNIA 2CGOA 2OWOA 4UCOA 5EZYB 4UCUA 2Q5ZA 4PA6A 5GTIZ 3UM7A 2HKOA 5B1NA 3ZX6A 3BCCH 4B3TB 1WP7A 2HVJC 3SYOA 2YS8A 3GWKC 5B1BC 5J2TB 4OX9O 4F6EA 3G4SV 5KHKA 2XAGA 2X6AA 2H94A 1GN2A 4U7OA 4AI8A 4X1YB 1K73W 2IJHA 2Y0PA 4JYCA 3UO3A 2Q73A 1IBLB 3RYIB 1BE3H 2MK3A 2PYLA 1E1QG 2Q4PA 3G6BA 3LDDA 3O9OA 3UQ8A 3I56V 3E8FA 2Q8VA 1IBMO 2N05A 3OFNG 1ZLZA 4FFBB 3K0DA 3L75H 4E4EA 1BQZA 1GMGA 1L0LH 4JZGA 1RFYA 4RO2A 4DV0B 2E74B 3FB5C 5CA0B 4B3TO 1VIBA 2KKWA 4E2LA 4NXMB 3P30A 1KQSU 2IBZH 4DUYB 4UB8Z 2QWPB 1H2MA 1AVMA 1UPGA 2L35A 1TGOA 3ETEA 4O2AB 5JVDB 3T1CA 2PY5A 3EHBB 2WPDG 3LUTB 2BTQB 2XAHA 1WA8A 4FM1A 3SPCA 2Y69B 3BEHA 3RGBA 2W0FC 1QLEC 1VQKV 4N21A 4ICGA 2UXXA 1EZJA 3H01A 3BABA 2Q68A 3ABTA 1N32B 2DWEC 1VF5B 3T4ZA 3ZIAG 4DV0O 5EYPB 4HZ3A 4DUZB 1FXKA 1WAZA 4NXMO 3GWOA 1NI8A 1A32A 5GTHZ 2QEXV 4A5UB 2LP7A 3WU2Z 1KB9F 1NTZH 2GBOA 3ZHTA 1YVWA 4GKKO 3CCVV 4F4LA 3S3WA 1AJPA 4PDRA 1YJWV 3JD0A 1HNXB 3K57A 3HKBA 4JYYA 2FMLA 2RJZA 3HKDB 2PI5A 3U10A 3JCUZ 1XILA 2ARHA 3ICXA 1G4YB 3JSLA 2QE7G 1W59A 1WJZA 1UFIA 3I5DA 1H38A 1N32O 2NN4A 4LNUA 3AG4C 4JI6O 2GUZB 3HPLC 3RW0A 2EZOA 1EZVH 4U3JA 4DUZO 4O4LB 3CRMA 4X89A 2YI9A 1XHZA 1KP3A 4LH7A 1XQ8A 3J81N 1W0JG 2ETNA 1DF5A 3Q4HA 4PI2A 2YICA 2QTOA 4I4TA 1Q6UA 2B5UA 4DXWA 3RYHA 5CN0A 4Q20A 3CCUV 4I55B 1IVSA 1N0NA 1HNXO 1JQ0A 4GKJB 4DR6B 1M93A 5K1PA 5KAIZ 3ETQA 4JI0B 1YIJV 2IJJA 4J9YB 5H6QA 2ZE6A 2EILB 5JJEB 3ABKC 3AG1C 3CD6V 2EIJB 3QG5A 2QWOB 3K59A 2G38A 3H1KH 5IJ0B 3JAKA 3HKCB 5FNVB 2MW2B 2Q7GA 1GH6A 4MW3A 1SZTA 3ETDA 4WFGA 3K5NA 1F23A 1S0VA 2EIMC 4JI3O 1AI6A 2E3CA 4PA9A 2VQEB 3ZEDA 1OCZC 4LFCB 4P2ZA 1BGYH 3ZHUA 3E86A 4ZKIA 3C90A 4X62B 1P49A 2W6JG 3T4DA 1SETA 2LQTA 4AHCA 2F93B 4DR3B 1GTOA 1FS0G 4RUEA 3CE2A 5IYDO 2ZXWB 4Q6GA 1J95A 4GKJO 4DR6O 4EEQA 1JVMA 2FTKA 2M6YA 4J80A 4RAIA 5IT9N 4HYOA 1F51A 1QCEA 2X6CA 5KHGA 1I7FA 1FKAO 2YUAA 3STZC 4O4IA 1Q3EA 1SERA 3BHPA 3RYCB 1XEQA 3AG2B 2QM4A 3CC2V 2WSSG 4NYKA 2VQEO 2QSAA 5LP6A 1BHBA 2EBOA 2IU3A 3CCMV 3N27A 3RWRD 3B77A 4LWSA 4X20B 4X62O 2HEPA 1PV0A 2O57A 1XBLA 1M5IA 2XUMA 2P5OA 3EXAA 3I55V 5JH7A 1WA8B 1XL4A 4JI2B 3TXQA 4DV2B 2ZE5A 2ZR3A 4NTYA 1YCIA 4XDJA 4IIJB 4FJCC 3T1YB 2HHHB 5B66Z 1M1KW 4TT3G 2HG5C 5IY5C 2Q67A 4HBNA 2ATKC 1FJGB 2WLMA 5B3SC 3LNMB 2DQ3A 3IGAC 5TISZ 1EN5A 3H1LH 2UXCO 4I7ZB 3ZHQA 2IH1C 2ZDIA 2YEVB 4TV8A 5C8YA 2VWJA 4K8XA 5J2TA 1VQ6V 4B3RB 3W7TA 4DV1B 4IYIA 5BXZA 2E5LO 3CJHB 4X1YA 2NNUA 1MOFA 1SC5B 3CYOA 4X66O 2NLJC 4J7ZA 4FM0A 3D3QA 4MVUA 3RYIA 3U11A 1DGSA 5LGTA 4X64B 4QJFB 1V54C 2YI8A 4JI2O 4G27B 2HHHO 3T1YO 4UVCA 3P3PA 1JFFA 1K97A 2BOCC 4JTAB 2QWNB 2P06A 3LDCA 4YHHB 4JV5B 3X2QB 3ASOB 2FL4A 4DR2B 4U3JB 3L71H 2EIKB 1S5LZ 3CXCU 1QBZA 4H13B 4B3RO 1SQXH 4LR3A 4MW8A 2WLLB 1Z2GA 2VS0A 5LXTB 4CS2A 4I4TB 3SYCA 1JCHA 2UU9O 2FB5A 4D7SA 3W7WA 1ZWIC 2BTOA 3RYHB 4O2AA 5JVDA 1COWG 1G6UA 3JASB 3ASNC 4Z1VA 2A0LA 3C3SA 1WNSA 2CTWA 4JI1B 4XBFA 2BOBC 1V55B 4LF6B 3CRAA 3JAKB 5EBWC 2E75B 2ZIMA 3P32A 4TWKA 3B40A 4OPHA 2H8PC 5BR8B 4MVRA 4JV5O 4LF9O 2QM7A 1K5QA 3ZRVA 1WB8A 5EYPA 2YDEA 2DW4A 4CC6A 1YEWA 4YXWG 3WB2A 1L8DA 1J5EB 1OCCB 4DV6B 1NBMG 2Y48A 4GX1A 2AGAA 4LFAO 3B09A 4JI7O 1AJNA 1SQBH 3FYIB 3HKDA 1Q7YW 1PNKA 1KBHA 1KUQA 1N0JA 2H3OA 4X9QA 5A2QN 1S72V 4JI1O 1MSDA 1RM1C 1FFTB 4LF6O 3B8NA 3MDSA 1V9PA 4TUYA 3TGUH 5BR8O 1P84F 2UXBB 3BA8A 5IYZB 1UJWB 4DV4B 2QWRB 2GUZA 2LJ2A 1DTOA 2JGDA 3VQVA 2ZM6O 4GT1A 5LP6B 1K3EA 4O4LA 4X65B 1RPOA 2YSUB 1M4UA 3OMAB 3CP1A 1YITV 3OE7G 4RQFA 5B1AC 1ZL8B 4BIOA 4Z2WA 3QO8A 3CCLV 2KSDA 4IHJA 5H5NA 2XASA 2ZNJA 1Q86W 1I5XA 1N36B 1GRJA 1K4DC 5CBGA 1Q6HA 4B7KA 1NH2D 4JAVA 1PL4A 4GX2A 1ZTEA 5IJ0A 3ZMVA 3HKCA 5FNVA 2DWDC 4RQEA 3F5WC 1Q5OA 4TV8B 5C8YB 4YY3O 2UXBO 4KUMA 2LGWA 5IYBO 5FLXN 1OCOB 5BY1A 4X65O 4LF7B 5LMNB 1AR1B 3SYAA 1S5JA 2PYJA 1US6A 4NTXA 5KHJA 3CMEV 3CCRV 5L3FA 3RVYA 3M8AA 2Q7HA 2PTMA 1K9MW 1Z5WA 2GTSA 4LH6A 3UT5B 4EKWA 1HNZB 2ITDC 4H44B 1Y76A 4QIWF 1JFFB 2YXHA 3E8GA 1XUQA 1XDCA 2PGGA 1GM7A 3ZHVA 5E79Z 4K8ZA 3AG3C 1PP9H 2DN9A 2ZIOA 1F4MA 3OEEG 2C2AA 3W7SA 3CCQV 4FZ0A 3RYCA 4W4KA 5CMUA 3BPZA 4DR4B 2P4VA 1W2BU 3BFRA 3D36A 3DTUB 4DO2A 1U96A 4H0LB 3JCZA 1AI7A 5JQGB 2P7TC 2EULA 1VQNV 3K0GA 2BCCH 4X20A 2AHYA 1YTFB 1THZA 1YZBA 4YJ2B 1IBLO 3HB3B 4EB6B 5JJNB 1XNQB 2DYSB 1K7DA 3SJAC 1Q43A 4LF4B 1BHAA 3A0RA 5IYCO 2EJ7A 5BMVA 1HNZO 4IIJA 1VEWA 3STLC 1BCCH 1RSOB 3WG7B 3K08A 2EINB 1QNMA 4UXNA 2JJ1G 1B6QA 3OR6C 1WPBA 3K06A 5BZBA 4JI5B 5LOVA 2LW1A 1IURA 3JYCA 4BIZA 5GW7A 2EX3A 2YEVA 3R66A 3G6EV 4TQDA 3WFVA 2Q69A 3KCXA 1AR4A 4DR7B 4DUYO 4JASA 3KZIZ
chains in the Genus database with same CATH topology
4HYOA 5KUMA 1F51A 1DF4A 1QCEA 1S3JA 1PNLA 1G8MA 3ABLC 2W6IG 2X6CA 3SPJA 1FXHA 2OTLV 3ASNB 1VQ7V 3STZC 1M90W 2F43G 2V7QG 5LHIA 5B1BB 1SERA 3TETA 3AG2B 1Q81W 3CPWU 2Q6AA 2WLHA 3JD1A 3D3IA 2JEXA 3CC2V 2WSSG 1KP2A 4UV8A 2ZDIC 4MVQA 3CCJV 2WAMA 1L1FA 1FXVA 2R9RB 1VQLV 1WLEA 1BHBA 3QO7A 1I5YA 1OCOC 2EBOA 1K8AW 2IU3A 1Y4MA 4Z1MG 3CCMV 4LC1A 3B77A 4N23A 2GHYA 1EBOA 4G2KA 3LDEA 4GX0A 3ZMUA 5LHHA 3ZN1A 5KA6A 1BL8A 2XAFA 1NQTA 3ML0A 1E1RG 2AHZA 3BY6A 3I55V 3W7XA 5L3DA 1XL4A 1P7BA 2IW5A 4LBEC 3CCEV 1E79G 1OZ0A 2WLKA 4UUJC 2ZR3A 4CZZA 3LSSA 5L3CA 4MTFA 4XDJA 4FJCC 1OCRB 4LP8A 4TT3G 2HG5C 5IY5C 1M1KW 2WLLA 2Q67A 2ATKC 2V1DA 4R6ZA 4PDVA 4RUFA 4UVAA 1KC8W 4X8AA 2B1GA 2P90A 2WLMA 3LNMB 5B3SC 2DQ3A 4I5SA 3E8HA 3IGAC 3ZMSA 2DQ0A 2HLDG 3VOUA 2QA4V 1YJNV 2ZR2A 1QVFU 1WPXA 2IH1C 5KA5A 2ZDIA 5FL7G 2YEVB 3CC4V 3SYPA 1RM1B 4PDLA 3SJQC 3OAAG 3E89A 4KP4A 1VQ6V 3W7TA 3OW2U 3KG2A 3SPGA 2NNUA 1MOFA 3JD2A 3ZN0A 3CYOA 1R6KA 1GM9A 2NLJC 4HAMA 4KFMA 3SPHA 2IH3C 1FXKC 4MVUA 2OCCB 1KD1W 3TK1A 1CPYA 5LGTA 1TUEB 1EFRG 2EILC 3GB7C 4MVMA 4QJFB 3ZRWB 4FPPA 2EIJC 1MG1A 2OT5A 1QLEB 1V54C 4QE9A 4H33A 3F7VC 1R6NA 2DYSC 2A9HA 5B1AB 2DYRC 4G27B 2KB1A 1R3IC 2WLJA 2P6JA 2HR3A 4UVCA 1K97A 2Z3YA 5HFMA 4MT8A 3PJSK 1K34A 2R9IA 4UVBA 2OTJV 1K4CC 1CP9A 1DLBA 2BOCC 4JYBA 4JTAB 1M56B 1R3LC 2M7WA 4H37A 4MVSA 3WG7C 3LDCA 1IXMA 3AEIA 2EINC 3W7UA 5L3BA 4P9PA 1VQOV 3OEHG 4TSFG 3X2QB 5EBMC 3ASOB 4JGSA 1GKFA 4L87A 1JX9A 1BMFG 2EIKB 1H8HG 4OXSA 3CXCU 1KECA 4P9OA 2XOKG 1QVGU 1QBZA 2X6BA 2EJRA 2JJ2G 1K33A 1P4RA 2WLIA 1H8EG 4PA4A 2ZXWC 1AROP 3M99B 2QM8A 1M57C 2WLLB 4MW8A 4R50A 4R7CA 1NH2B 2LFRA 1PKXA 5KUKA 3SYCA 3RBZA 5J9PC 1NVPB 4WFHA 1JCHA 3ABMB 1YI2V 2HJFC 1QLNA 3W7WA 1ZWIC 1NJIW 1K92A 2B1IA 4PA6A 1COWG 1R73A 3UM7A 1VQPV 1NVPD 2HKOA 5B1NA 1MSWD 1KKDA 3ASNC 2K1EA 2A0LA 2HVJC 3SYOA 5B1BC 3G4SV 2XAGA 3AG2C 4PELA 1R3JC 2X6AA 2H94A 4MS2A 4XBFA 3AG4B 4U7OA 2BOBC 1V55B 5HFLA 4WFFA 1K73W 1SESA 2IJHA 4JYCA 5EBWC 1Y66A 4U7NA 1GM8A 3E83A 3P32A 4TWKA 4ASUG 2H8PC 4WCEV 4QPKA 4MVRA 1M9NA 4JF3A 2MK3A 2QM7A 1H2GA 4MSWC 1E1QG 5EBLC 3ZMZA 1K5QA 3OGCC 3EFFK 3ZRVA 3LDDA 3AG3B 2XNDG 2DW4A 3I56V 3E8FA 3FB6C 3ETGA 1GO3F 4YXWG 5CBFA 3ZMTA 1PD3A 4JAUA 3OFNG 1OCCB 4MTXA 3E2EA 1NBMG 2Y48A 4GX1A 3K04A 5L3GA 3K0DA 4FK5C 2X7RB 1NKDA 5H9CA 5EK0A 1GMGA 4XDKA 4UV9A 1AI5A 3FB7C 1AJNA 3VBBA 4RO2A 4R8CA 1VQ4V 1VQ8V 4MVZA 3FYIB 3ABKB 3AG1B 1Q7YW 1PNKA 3OR7C 3FB5C 4I9WA 4QNHB 1N8RW 3NXSA 4E2LA 5CA3A 4BW5A 1S72V 3P30A 1KQSU 4P30A 5IDJA 1VQ5V 1RPRA 1RM1C 1FFTB 1QR9A 3B8NA 2IJIA 3CC7V 1S5HC 2EIMB 3QO5A 3R65A 4PA7A 2JK5C 2PI4A 3T2MA 1OCZB 1UJWB 2UXNA 3ETEA 3T1CA 3K3WA 1DTOA 3EHBB 2WPDG 3LSQA 3LUTB 4GT1A 2HFEC 3ZRXA 1K3EA 3FB8C 2XAHA 3B8MA 2OCCC 1F4NA 3SPCA 2JEUA 1RPOA 2YSUB 2Y69B 3BEHA 3OMAB 2W0FC 3CMAV 1QLEC 1VQKV 1Q82W 4N21A 4GX5A 3CP1A 4WFBV 3SYQA 1YITV 3OE7G 2UXXA 1EZJA 3H01A 4RQFA 4QE7A 2CK3G 5B1AC 3ZJZA 3QO8A 5H6RA 4LCUC 3CCLV 4FMTA 2P67A 3E8BA 3CCSV 2Q68A 3ABTA 1YSCA 3ABUA 1GK9A 2DWEC 4CBCA 2XASA 3QNEA 1MABG 1I5XA 1JPXA 1Q86W 3T4ZA 3ABLB 1M56C 2ITCC 4J9ZB 5B1OA 1K4DC 3ZIAG 4HZ3A 5CBGA 1AJQA 1FXKA 3JD3A 3SPIA 5DM6V 3IC7A 3GWOA 3X2QC 3OUFA 3ASOC 2QEXV 3OMIB 2EIKC 1NH2D 4JAVA 5LGUA 2LP7A 4JPRA 3K79A 1YHQV 2QKSA 4GX2A 3ZMVA 2DWDC 3IFXA 4RQEA 3F5WC 3G71V 1JJ2U 3CCVV 4X88A 4F4LA 4KUMA 1AJPA 5IYBO 1OCOB 4PDRA 1YJWV 2ZQMA 3JD0A 1AI4A 3ABMC 3ZRWA 3OUSA 1W0KG 4PDMA 2PI5A 3MHHC 2WLNA 3TCUA 1AR1B 3SYAA 4ZBMA 5C93A 1G4YB 3CMEV 2QE7G 3CCRV 1XL6A 3RVYA 5L3FA 2JIZG 1H38A 1K9MW 3K03A 3AG4C 1ENVA 1S77D 5IY5B 1V55C 2Z5UA 4EKWA 3F7YC 3HPLC 3RW0A 2EZOA 3JD4A 2ITDC 1NR1A 1VQ9V 4QIWF 3E8GA 2D3OW 5B3SB 5DN6G 1JOYA 2XAJA 4X89A 1GM7A 3UKMA 1KP3A 2XAQA 5E1AC 1OCRC 3AG3C 4WF9V 2WWWA 4MVOA 1F4MA 3MD0A 1W0JG 2C2AA 3OEEG 3W7SA 1DF5A 4JTCB 3ZCCA 2QTOA 3CCQV 3OM3B 1VQMV 1HWYA 4RAIA 5CMUA 1OCCC 1QR8A 2B5UA 2IU0A 4MTGA 4BAYA 4DXWA 5CN0A 1W2BU 4Q20A 3CCUV 5LGNA 3D36A 3DTUB 1JQ0A 1ORQC 2LFSA 4DO2A 3JCZA 2WLIB 3DGEA 1YIJV 2IJJA 4J9YB 2EZPA 1FXKB 1R3KC 1AI7A 3MHSC 4GCZA 2P7TC 2IJKA 2X0LA 5H6QA 1VQNV 2EILB 5EC1C 3K0GA 3ABKC 3AG1C 1OHHG 3CD6V 2AHYA 1YTFB 1THZA 2EIJB 1V54B 3HB3B 1SRYA 3FYEB 2DYSB 4QPJA 4BIUA 1K7DA 2DYRB 1YJ9V 5CBHA 1YTFD 1BHAA 4WFAV 3A0RA 4JTDB 3E35A 5IYCO 4MW3A 1SZTA 3ETDA 4G28B 4WFGA 3RVZA 1F23A 2A79B 3FKSG 1S0VA 2EIMC 3STLC 1AI6A 4PA9A 3WG7B 4WFEA 2GSMB 3K9AA 1OCZC 4P2ZA 3K08A 2EINB 5LHGA 5EC2C 4UXNA 2JJ1G 1B6QA 3OR6C 3K06A 3E86A 4FIPC 2HVKC 4ZKIA 5BZBA 1CEZA 4MTOA 1NR7A 2W6JG 3T4DA 2Y69C 3JYCA 1ROPA 4PA3A 1SETA 5GW7A 4BIZA 5L3EA 2YEVA 5LBQA 1GTOA 1FS0G 4RUEA 5IYDO 1PNMA 2ZXWB 2ZD9A 3ZRSA 1M57B 1K5SA 3G6EV 3OMNB 1J95A 1LNQA 3WFVA 1JVMA 2JDIG 2Q69A 1PL0A 2FTKA 4XDLA 1S76D 4JASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y B;  4HYO A;  4XDK A;  4QE9 A;  4H33 A;  5KUM A;  3F7V C;  2DYS C;  2A9H A;  3ABL C;  2DYR C;  1XL6 A;  3FB7 C;  2KB1 A;  2X6C A;  4G27 B;  4R8C A;  4RO2 A;  3RVY A;  1R3I C;  4MVZ A;  2WLJ A;  3SPJ A;  3OR7 C;  3FB5 C;  3AG4 C;  3K03 A;  4I9W A;  3STZ C;  1V55 C;  3PJS K;  4QNH B;  4EKW A;  1K4C C;  3F7Y C;  2BOC C;  3HPL C;  4JTA B;  3RW0 A;  4BW5 A;  1R3L C;  2ITD C;  4H37 A;  4MVS A;  4P30 A;  3WG7 C;  3TET A;  3E8G A;  2Q6A A;  2WLH A;  3LDC A;  2EIN C;  4P9P A;  4X89 A;  3UKM A;  4MVQ A;  1OCR C;  5E1A C;  5EBM C;  3AG3 C;  1S5H C;  2R9R B;  4MVO A;  3R65 A;  4PA7 A;  4OXS A;  2JK5 C;  4P9O A;  3T2M A;  1OCO C;  2X6B A;  4JTC B;  3T1C A;  2QTO A;  3LUT B;  1OCC C;  2HFE C;  2WLI A;  3LDE A;  3FB8 C;  4GX0 A;  4MTG A;  4PA4 A;  2ZXW C;  4R50 A;  2OCC C;  4MW8 A;  1M57 C;  2WLL B;  4R7C A;  3SPC A;  4DXW A;  1BL8 A;  1ORQ C;  5KUK A;  3BEH A;  3SYC A;  3RBZ A;  5J9P C;  2W0F C;  4WFH A;  1QLE C;  2AHZ A;  2HJF C;  2WLI B;  4GX5 A;  3SYQ A;  1ZWI C;  1XL4 A;  4QE7 A;  4J9Y B;  5B1A C;  1P7B A;  1R3K C;  4LBE C;  3ZJZ A;  4PA6 A;  2WLK A;  2P7T C;  4LCU C;  4UUJ C;  3UM7 A;  3E8B A;  4MTF A;  4XDJ A;  3K0G A;  3ABK C;  2Q68 A;  3AG1 C;  5EC1 C;  2AHY A;  3ASN C;  1KKD A;  2K1E A;  4LP8 A;  2HG5 C;  5IY5 C;  2WLL A;  2DWE C;  2Q67 A;  4CBC A;  2A0L A;  2HVJ C;  2ATK C;  4R6Z A;  3SYO A;  4PDV A;  4RUF A;  3T4Z A;  5B1B C;  1M56 C;  2ITC C;  4J9Z B;  5CBH A;  1K4D C;  3AG2 C;  4X8A A;  4HZ3 A;  4JTD B;  2WLM A;  5B3S C;  3LNM B;  1R3J C;  2X6A A;  4MS2 A;  4MW3 A;  5CBG A;  4G28 B;  3E8H A;  3IGA C;  2BOB C;  4WFG A;  3SPI A;  3VOU A;  3X2Q C;  4WFF A;  3RVZ A;  2A79 B;  3OUF A;  3ASO C;  2EIM C;  5EBW C;  2IH1 C;  3STL C;  4PA9 A;  2EIK C;  3E83 A;  4TWK A;  4WFE A;  2H8P C;  3SYP A;  1OCZ C;  4PDL A;  4P2Z A;  3SJQ C;  2QKS A;  3K08 A;  4MVR A;  4GX2 A;  5EC2 C;  4MSW C;  3E89 A;  5EBL C;  3OR6 C;  3OGC C;  3EFF K;  2DWD C;  3IFX A;  3LDD A;  3K06 A;  3E86 A;  3F5W C;  2HVK C;  5BZB A;  4MTO A;  4X88 A;  4F4L A;  3T4D A;  3KG2 A;  3SPG A;  3E8F A;  3FB6 C;  2Y69 C;  3JYC A;  4PA3 A;  4PDR A;  5CBF A;  3ABM C;  2NLJ C;  2YEV A;  3OUS A;  4KFM A;  3SPH A;  4PDM A;  4RUE A;  2IH3 C;  4MVU A;  2ZD9 A;  3ZRS A;  2WLN A;  3TCU A;  1J95 A;  1LNQ A;  3SYA A;  1JVM A;  4GX1 A;  2Q69 A;  3K04 A;  2EIL C;  3GB7 C;  3K0D A;  4MVM A;  4ZBM A;  4XDL A;  2EIJ C;  4RAI A;  5EK0 A;  1V54 C; 
#chains in the Genus database with same CATH topology
 3CJH A;  1DF4 A;  2RNB A;  2R72 A;  1G8M A;  3ABL C;  4KHP B;  2OTL V;  1XNQ O;  2V7Q G;  5LA6 B;  5LHI A;  4J41 A;  4KXR A;  5B1B B;  3TET A;  3JD1 A;  1HNW B;  1KP2 A;  4UV8 A;  3CCJ V;  1FXV A;  2R9R B;  1VQL V;  2CH7 A;  2GTA A;  3CRR A;  3AK3 A;  3RYF A;  1BS3 A;  4LC1 A;  4N23 A;  2CTR A;  4JI8 B;  1EBO A;  2JRI A;  4TUY B;  1TVK A;  5LHH A;  3AG7 A;  5KA6 A;  1BL8 A;  1Y67 A;  2JGD B;  5JJJ B;  2LGQ A;  2XAF A;  3ML0 A;  4PHZ A;  4GYC B;  1E1R G;  2AHZ A;  3BY6 A;  2YIB D;  2DOS A;  1KU9 A;  2LO1 A;  3RT3 C;  2IW5 A;  3CCE V;  1E79 G;  1GN4 A;  2DE0 X;  4FM2 A;  3O65 A;  1KYO F;  3T1H B;  2WLL A;  4IYH A;  2V1D A;  1QHT A;  2PZS A;  5LXT A;  1VF6 C;  4PDV A;  4DW0 A;  3JAL B;  3CX5 F;  4IHJ B;  4X8A A;  5LYJ B;  1CXZ B;  2WA3 A;  3OD4 A;  2QA4 V;  3JAS A;  1WPX A;  5KA5 A;  1SQF A;  5FL7 G;  3CC4 V;  3JAR A;  4J10 A;  2YC0 A;  3OW2 U;  2NR5 A;  4K35 A;  4UCR A;  1VF7 A;  1XRE A;  4JI8 O;  2PUS A;  4FVM A;  1FXK C;  3P3N A;  1AP6 A;  3GB7 C;  3S3X A;  4B3S B;  1QLE B;  2OT5 A;  1IDS A;  4GUN A;  4H33 A;  2DYR C;  4NR1 A;  2KB1 A;  2DJV A;  5ITZ A;  1R3I C;  2A3Q A;  2WLJ A;  3JSN A;  3K9S A;  2OIG A;  5HFM A;  4MT8 A;  3PJS K;  2R9I A;  4JYA B;  2OTJ V;  1CP9 A;  1DLB A;  4JYB A;  1R3L C;  2LW7 A;  2M7W A;  4H37 A;  4MVS A;  5JCO C;  3F5T A;  1MZF A;  4TSF G;  4JI0 O;  1Y76 B;  4JGS A;  1JX9 A;  1H8H G;  4P9O A;  2XOK G;  2X6B A;  3L9D A;  2EJR A;  4IGG A;  2WLI A;  4PA4 A;  4R50 A;  1M57 C;  1NTK H;  1NH2 B;  3B4S A;  2LFR A;  1H2N A;  4DR1 B;  1JA8 A;  3RBZ A;  5J9P C;  4UCT A;  1YI2 V;  1QLN A;  3FX7 A;  1NJI W;  5IYZ A;  3H9V A;  2B1I A;  4FFK A;  1R73 A;  1VQP V;  1NVP D;  1EN6 A;  1KKD A;  3KCY A;  2K1E A;  4LFC O;  4LFB B;  3FFQ A;  2JS5 A;  2A7W A;  2JS3 A;  1R3J C;  2Z0A A;  3AG4 B;  1ZL8 A;  1BSM A;  5HFL A;  2RMK B;  5EIB D;  4WFF A;  1SES A;  4DR3 O;  1Y66 A;  3K5O A;  1GM8 A;  3E83 A;  4ASU G;  5BMV B;  3QF7 A;  5KHH A;  4B3M B;  1M9N A;  4UCS A;  2W0X A;  5EBL C;  3OGC C;  3EFF K;  3PN1 A;  5LOV B;  1Q8I A;  1TUB A;  3CHX A;  4DR1 O;  1SQQ H;  3K04 A;  4EFE A;  5H9C A;  5EK0 A;  3CWB H;  4J11 A;  4UV9 A;  1AI5 A;  2FYU H;  4NXN B;  2KG7 B;  4R8C A;  4HNA B;  4MVZ A;  1EN4 A;  3ABK B;  3AG1 B;  4CS3 A;  4DR5 B;  1AR5 A;  3NXS A;  4BW5 A;  3WB1 A;  3L72 H;  5IDJ A;  1VQ5 V;  1RPR A;  4TV9 B;  1YF2 A;  2GV9 A;  1QR9 A;  2UXD B;  3CC7 V;  2YID A;  1S5H C;  2EIM B;  3QO5 A;  1Q6I A;  2RN9 A;  2JK5 C;  4DV2 O;  1OCZ B;  3LNN A;  3UT5 A;  3C3T A;  3K3W A;  2ILM A;  3JAT A;  1D5A A;  3LSQ A;  1Y6X A;  2D2C B;  2CH7 B;  3B8M A;  2OCC C;  1F4N A;  3EVK A;  2ZE7 A;  3RYF B;  4FLX A;  1FJG O;  4CS4 A;  1YXB A;  3CMA V;  4GX5 A;  4WFB V;  1TVK B;  2CK3 G;  2ADP A;  5H6R A;  4FMT A;  1X4T A;  4ZIB A;  3E8B A;  3CCS V;  2OCH A;  2V4D A;  1YSC A;  4EFB A;  4DW1 A;  3ABU A;  1GK9 A;  3B2E E;  2QTS A;  2YXL A;  1MAB G;  1JPX A;  4DV1 O;  2Y4U A;  4LF5 B;  1M56 C;  4J9Z B;  1LR1 A;  4DR5 O;  1AJQ A;  3JD3 A;  3SPI A;  5DM6 V;  4D7T A;  5JQG A;  2ODM A;  2F4V B;  3OUF A;  3JAW B;  1OJH A;  4YJ2 A;  5LGU A;  3VQX A;  4JPR A;  5CA1 A;  3K79 A;  5F2V O;  2QKS A;  1YHQ V;  2UXD O;  4EB6 A;  4X64 O;  1RP3 B;  4DV3 B;  3L74 H;  3VQW A;  3IFX A;  3G71 V;  1NZ6 A;  1N34 B;  3JAR B;  3DSQ A;  4ZOL B;  1XHX A;  2AW9 A;  3ABM C;  1SF9 A;  3ZRW A;  1RSO A;  3G67 A;  3MHH C;  2WLN A;  3TCU A;  4J7K A;  3SDL A;  2GDS A;  5GON A;  5C93 A;  5IE9 A;  4YHH O;  3CS5 A;  4NB5 A;  5EIB C;  3JAM N;  2A06 H;  4DR2 O;  2JIZ G;  4FLZ A;  1GAX A;  5A9G A;  3K03 A;  1S77 D;  5IY5 B;  3CB2 A;  2CE4 A;  5ITZ B;  3JD4 A;  2FKX A;  1NR1 A;  1KKC A;  1VQ9 V;  1PM9 A;  2D3O W;  4UCV A;  5B3S B;  1JOY A;  4GLX A;  2XAJ A;  3UKM A;  5E1A C;  1OCR C;  1H2L A;  4C7U A;  4MVO A;  3MD0 A;  1MMM A;  4CC5 A;  1N4C A;  5LA6 A;  3OM3 B;  1Y74 A;  4OPA A;  3U0Z A;  4BAY A;  2L6L A;  2P4K A;  1ORQ C;  2LFS A;  1NT2 B;  1VAR A;  3D8C A;  4PI0 A;  2WLI B;  2QR4 A;  3DGE A;  1GN6 A;  1HP8 A;  1R3K C;  4GCZ A;  2IJK A;  4X1I A;  5EC1 C;  5KAF Z;  4DV5 B;  1V54 B;  4DRX A;  1DK1 A;  4I0X B;  1SRY A;  1YJ9 V;  3OT7 A;  4WFA V;  5KLV H;  3GVM A;  1SKV A;  3RVZ A;  2A79 B;  1J5E O;  1SQG A;  1LUV A;  4DV6 O;  3N2G B;  4WFE A;  2GSM B;  3AK2 A;  4CH3 A;  3JAL A;  1R6T A;  4OX9 B;  5LYJ A;  2HVK C;  1CEZ A;  4MTO A;  1Z5V A;  2Y69 C;  5J2U A;  4LF8 B;  5L3E A;  5LBQ A;  2VQF B;  2UUB B;  1FAF A;  4X1K B;  1PNM A;  1K5S A;  3OMN B;  1LNQ A;  1TAE A;  2JDI G;  1PL0 A;  3H1H H;  4XDL A;  1S76 D;  1O9G A;  2QJ1 A;  5KUM A;  1TUB B;  1S3J A;  1PNL A;  3SGI A;  2W6I G;  1IBM B;  3SPJ A;  1FXH A;  3ASN B;  1VQ7 V;  4DV4 O;  1M90 W;  1X59 A;  2Y4T A;  1P7G A;  1Q81 W;  3K58 A;  3D3I A;  2JEX A;  3APO A;  2Q9L A;  3DC6 A;  4MVQ A;  2WAM A;  3APQ A;  2R70 A;  3QO7 A;  1K8A W;  4Z1M G;  2YIA A;  2GHY A;  4G2K A;  3LDE A;  4GX0 A;  3ZN1 A;  1N36 O;  5K1X A;  1BT8 A;  2N74 A;  1NQT A;  3JAT B;  2UUA B;  4LF8 O;  2VQF O;  5CB4 A;  2UUB O;  1G1X B;  3N2K A;  5L3D A;  4WBN A;  1HDJ A;  1OV9 A;  1P7B A;  4FLU A;  4LBE C;  3LSS A;  2QWQ B;  1OCR B;  1Q90 D;  5KX5 B;  4BW9 A;  1FFX B;  4R6Z A;  4UVA A;  1KC8 W;  3UO2 A;  2B1G A;  2P90 A;  4I5S A;  3E8H A;  3QVN A;  3VOU A;  1YJN V;  2XHB A;  3BAA A;  1QVF U;  3LSU A;  3L73 H;  3A8T A;  4LF7 O;  5LMN O;  3SJQ C;  1RM1 B;  3OAA G;  3E89 A;  2F95 B;  4KP4 A;  4IT5 A;  3RN4 A;  5CA1 B;  1IXB A;  2F1M A;  3SPG A;  3JD2 A;  2RDC A;  3ZN0 A;  4UB6 Z;  4DYL A;  2OIE A;  4HAM A;  3SPH A;  2N04 A;  2ZE8 A;  2AXT Z;  4GZR B;  1KD1 W;  4B7E A;  1CPY A;  2UUA O;  1EFR G;  2EIL C;  4MVM A;  3ZRW B;  2BSK B;  2EIJ C;  4JZ2 A;  4GKK B;  4I50 B;  1KMI Z;  4ZI7 B;  4QE9 A;  3F7V C;  5B1A B;  2A9H A;  5GON B;  1VF6 A;  5H2F Z;  2P6J A;  2HR3 A;  2Z3Y A;  3TXS A;  4UVB A;  2ADQ B;  3ZBH A;  1IX9 A;  4F6R B;  4DR4 O;  3AEI A;  3W7U A;  4P9P A;  1VQO V;  1IBK B;  2KG7 A;  4HNA A;  3AK1 A;  1GKF A;  4L87 A;  1BMF G;  1XMQ B;  4OXS A;  1KEC A;  4JI6 B;  2JJ2 G;  1QQC A;  1K33 A;  1VMG A;  5IWA B;  4TV9 A;  2ZXW C;  1ARO P;  3M99 B;  4R7C A;  3J7A U;  2VRZ A;  4LF4 O;  1Y74 B;  2E76 B;  4WFH A;  3MAQ A;  1K92 A;  5DEC A;  4K0K B;  4O4J B;  2BE3 A;  1MSW D;  1XOU A;  4U3F H;  2F66 C;  2HJD A;  4X1I B;  4JI5 O;  3AG2 C;  2IM9 A;  4PEL A;  4TOI A;  5JCO A;  2CDY A;  4MS2 A;  4RWU A;  4DRX B;  3D36 C;  1MNG A;  4U7N A;  4L8J A;  5AG2 A;  3ZS8 C;  4WCE V;  4QPK A;  3SR2 C;  1IBK O;  4O2B B;  3M7M X;  5IJ9 A;  3DXR A;  4JF3 A;  1AIL A;  4MSW C;  3ZMZ A;  1H2G A;  4DR7 O;  4O4H B;  1XMQ O;  3AG3 B;  2XND G;  3FB6 C;  3ETG A;  1GO3 F;  5CBF A;  3JAW A;  4ZHQ A;  4KHP O;  3ZMT A;  4DK0 A;  1PD3 A;  5IWA O;  4JAU A;  4JI3 B;  4MTX A;  4TQF A;  4KL1 A;  4YIO A;  4B08 A;  5J2U B;  5L3G A;  4FK5 C;  2X7R B;  1NKD A;  1HNW O;  4K0K O;  4XDK A;  4ZOL A;  2QDO A;  3FB7 C;  1SA0 A;  3VBB A;  1VQ4 V;  1VQ8 V;  3THO A;  2ZKO A;  1SQV H;  2K9P A;  3OR7 C;  4I9W A;  4QNH B;  1N8R W;  5CA3 A;  1PPJ H;  4P30 A;  1F7Y A;  3E22 A;  2IJI A;  1FD9 A;  1WP8 A;  3R65 A;  4PA7 A;  4FLT A;  2YIB A;  5DED A;  2PI4 A;  3T2M A;  2UXN A;  2RQ6 A;  3T1H O;  2HFE C;  3ZRX A;  3FB8 C;  2Y0I A;  2JEU A;  4NKG B;  5D5P A;  1HR0 B;  1Q82 W;  3E2E A;  3SYQ A;  1SS3 A;  3ZHR A;  4NTW A;  4QE7 A;  2AZ0 A;  1SQP H;  3ZJZ A;  4LCU C;  5KMG A;  2P67 A;  5CB4 B;  3FAV A;  3A0B Z;  4FLY A;  3N2K B;  4YJ3 A;  4CH5 A;  1NS1 A;  4WBN B;  4CBC A;  1IZ3 A;  3QNE A;  2R9A A;  4I9Q A;  3ABL B;  2ITC C;  5B1O A;  2WA4 A;  1LUW A;  2QKC A;  3BVO A;  3IC7 A;  2XTA A;  3X2Q C;  3ASO C;  3CSX A;  1D5N A;  3OMI B;  2EIK C;  4I0X A;  2HP8 A;  3K5M A;  4B3S O;  1H2K A;  1JJ2 U;  1I94 B;  1XMO B;  4X88 A;  2B9Z A;  2ZQM A;  1AI4 A;  3HKE A;  3OUS A;  4AQY B;  3N2G A;  2UXC B;  1W0K G;  4PDM A;  4FLW A;  4JYA O;  4BR6 A;  1B06 A;  1HR0 O;  4ZBM A;  3HR0 A;  2E5L B;  2AZ2 A;  1XL6 A;  3WB0 A;  2JGU A;  2UUC B;  4X66 B;  2JVD A;  2QKA A;  4X1K A;  1ENV A;  1NU1 H;  1V55 C;  3A0H Z;  2Z5U A;  3K5L A;  3BA9 A;  3F7Y C;  2YXY A;  4QGP A;  1B3Q A;  5KHI A;  4D6T H;  2Q0A A;  5DN6 G;  1R1B A;  2XAQ A;  4WF9 V;  2WWW A;  4PD4 F;  4AIL C;  5JWP A;  3SJB C;  2ZCE A;  4JTC B;  3ZCC A;  2CGN A;  3QTC A;  2DMX A;  1VQM V;  1HWY A;  1I94 O;  2IU0 A;  4LFB O;  1OCC C;  1QR8 A;  4J42 A;  1XMO O;  4JAA A;  4MTG A;  3OTF A;  5EZY A;  1QU7 A;  5LGN A;  4AQY O;  3IAY A;  5FPR A;  2EZP A;  1FXK B;  3MHS C;  3H1I H;  2X0L A;  3CEI A;  5LMU B;  4DV7 B;  1OHH G;  1YDX A;  3NR7 A;  1HW7 A;  4B3M O;  3FD9 A;  3FYE B;  4QPJ A;  4BIU A;  2DYR B;  2UUC O;  3CRC A;  5CBH A;  1YTF D;  3UCS C;  4JTD B;  3E35 A;  2UU9 B;  1NTM H;  4G28 B;  4FZ1 A;  3FKS G;  3HKB B;  1U97 A;  5KX5 A;  3VQY A;  2OYQ A;  3K9A A;  3TJT A;  1FFX A;  5LHG A;  4K3A A;  5EC2 C;  3CRQ A;  1JJO A;  5LP6 C;  4FIP C;  1N33 B;  1NR7 A;  1WN7 A;  4NXN O;  5IJ9 B;  4FFB A;  1ROP A;  3DXR B;  4PA3 A;  4FLV A;  4LNU B;  2CUG A;  2ZD9 A;  4JI4 B;  3ZRS A;  1M57 B;  1URF A;  1XI1 A;  4ZHQ B;  4LF9 B;  4J7J A;  5CA0 A;  5FPO A;  1WB7 A;  3ZHS A;  1XNR B;  2CAZ C;  1H2S B;  2CTQ A;  5LMU O;  4DV7 O;  2QGN A;  2RCV A;  2ZIN A;  1I08 A;  1I0H A;  2F43 G;  3Q4H B;  1SA0 B;  3KKY A;  2VWK A;  2BSK A;  5LL6 Y;  3CPW U;  2Q6A A;  2WLH A;  4I50 A;  4ZI7 A;  4LFA B;  3OTO B;  4JI7 B;  1GN3 A;  2ZDI C;  1D2D A;  1L1F A;  2F23 A;  2BTQ A;  3E22 B;  1WLE A;  1FPO A;  1I5Y A;  3L70 H;  1OCO C;  4F6R A;  1Y4M A;  5B5E Z;  1N33 O;  3ZMU A;  1MA1 A;  4IL6 Z;  4LF5 O;  1BQ0 A;  2P22 C;  3W7X A;  1MZE A;  3SJC C;  4JI4 O;  3IC9 A;  2XT9 A;  2F4V O;  1T5E A;  1OZ0 A;  2WLK A;  4UUJ C;  4CZZ A;  5L3C A;  4MTF A;  1ZUQ A;  2ZM6 B;  4LP8 A;  4DV3 O;  2CTP A;  1XNR O;  4RUF A;  3OGI B;  3A2F A;  5KMG B;  5D5Q A;  1N34 O;  4CH6 A;  3FAV B;  4YJ3 B;  1FYJ A;  3BRC A;  3ZMS A;  2DQ0 A;  2HLD G;  4O4J A;  4YIP A;  2ZR2 A;  1VP7 A;  1SZX A;  3DC5 A;  3SYP A;  4PDL A;  3OTO O;  4BWA A;  1JR9 A;  1AP5 A;  1TA8 A;  3KG2 A;  4ABM A;  1AB3 A;  1ZSP A;  1R6K A;  1GM9 A;  4KFM A;  2IH3 C;  1EM1 A;  2OCC B;  3H1J H;  4O2B A;  4O4I B;  1O9H A;  3TK1 A;  1TUE B;  1ZAU A;  4DK1 A;  4O4H A;  3HKE B;  4CH4 A;  4FPP A;  1MG1 A;  1B04 A;  4UFZ A;  4YY3 B;  1R6N A;  2DYS C;  4PJ0 Z;  3G80 A;  3IJ4 A;  1K34 A;  1JMK C;  1K4C C;  1M56 B;  3WG7 C;  4LWS B;  3RFR A;  1IXM A;  2EIN C;  5L3B A;  2Q7E A;  4OGQ B;  3OEH G;  5EBM C;  2ZT9 B;  4NVP A;  5JH7 B;  4PV1 B;  1QVG U;  4I55 A;  1L0N H;  3J80 N;  4DV5 O;  1BZK A;  1P4R A;  2Q0O C;  1H8E G;  1ZX3 A;  2KQX A;  2QM8 A;  4W4L A;  2PF4 E;  1PKX A;  5KUK A;  1NVP B;  3ABM B;  2HJF C;  3CXH F;  2ZNI A;  2CGO A;  2OWO A;  4UCO A;  5EZY B;  4UCU A;  2Q5Z A;  4PA6 A;  5GTI Z;  3UM7 A;  2HKO A;  5B1N A;  3ZX6 A;  3BCC H;  4B3T B;  1WP7 A;  2HVJ C;  3SYO A;  2YS8 A;  3GWK C;  5B1B C;  5J2T B;  4OX9 O;  4F6E A;  3G4S V;  5KHK A;  2XAG A;  2X6A A;  2H94 A;  1GN2 A;  4U7O A;  4AI8 A;  4X1Y B;  1K73 W;  2IJH A;  2Y0P A;  4JYC A;  3UO3 A;  2Q73 A;  1IBL B;  3RYI B;  1BE3 H;  2MK3 A;  2PYL A;  1E1Q G;  2Q4P A;  3G6B A;  3LDD A;  3O9O A;  3UQ8 A;  3I56 V;  3E8F A;  2Q8V A;  1IBM O;  2N05 A;  3OFN G;  1ZLZ A;  4FFB B;  3K0D A;  3L75 H;  4E4E A;  1BQZ A;  1GMG A;  1L0L H;  4JZG A;  1RFY A;  4RO2 A;  4DV0 B;  2E74 B;  3FB5 C;  5CA0 B;  4B3T O;  1VIB A;  2KKW A;  4E2L A;  4NXM B;  3P30 A;  1KQS U;  2IBZ H;  4DUY B;  4UB8 Z;  2QWP B;  1H2M A;  1AVM A;  1UPG A;  2L35 A;  1TGO A;  3ETE A;  4O2A B;  5JVD B;  3T1C A;  2PY5 A;  3EHB B;  2WPD G;  3LUT B;  2BTQ B;  2XAH A;  1WA8 A;  4FM1 A;  3SPC A;  2Y69 B;  3BEH A;  3RGB A;  2W0F C;  1QLE C;  1VQK V;  4N21 A;  4ICG A;  2UXX A;  1EZJ A;  3H01 A;  3BAB A;  2Q68 A;  3ABT A;  1N32 B;  2DWE C;  1VF5 B;  3T4Z A;  3ZIA G;  4DV0 O;  5EYP B;  4HZ3 A;  4DUZ B;  1FXK A;  1WAZ A;  4NXM O;  3GWO A;  1NI8 A;  1A32 A;  5GTH Z;  2QEX V;  4A5U B;  2LP7 A;  3WU2 Z;  1KB9 F;  1NTZ H;  2GBO A;  3ZHT A;  1YVW A;  4GKK O;  3CCV V;  4F4L A;  3S3W A;  1AJP A;  4PDR A;  1YJW V;  3JD0 A;  1HNX B;  3K57 A;  3HKB A;  4JYY A;  2FML A;  2RJZ A;  3HKD B;  2PI5 A;  3U10 A;  3JCU Z;  1XIL A;  2ARH A;  3ICX A;  1G4Y B;  3JSL A;  2QE7 G;  1W59 A;  1WJZ A;  1UFI A;  3I5D A;  1H38 A;  1N32 O;  2NN4 A;  4LNU A;  3AG4 C;  4JI6 O;  2GUZ B;  3HPL C;  3RW0 A;  2EZO A;  1EZV H;  4U3J A;  4DUZ O;  4O4L B;  3CRM A;  4X89 A;  2YI9 A;  1XHZ A;  1KP3 A;  4LH7 A;  1XQ8 A;  3J81 N;  1W0J G;  2ETN A;  1DF5 A;  3Q4H A;  4PI2 A;  2YIC A;  2QTO A;  4I4T A;  1Q6U A;  2B5U A;  4DXW A;  3RYH A;  5CN0 A;  4Q20 A;  3CCU V;  4I55 B;  1IVS A;  1N0N A;  1HNX O;  1JQ0 A;  4GKJ B;  4DR6 B;  1M93 A;  5K1P A;  5KAI Z;  3ETQ A;  4JI0 B;  1YIJ V;  2IJJ A;  4J9Y B;  5H6Q A;  2ZE6 A;  2EIL B;  5JJE B;  3ABK C;  3AG1 C;  3CD6 V;  2EIJ B;  3QG5 A;  2QWO B;  3K59 A;  2G38 A;  3H1K H;  5IJ0 B;  3JAK A;  3HKC B;  5FNV B;  2MW2 B;  2Q7G A;  1GH6 A;  4MW3 A;  1SZT A;  3ETD A;  4WFG A;  3K5N A;  1F23 A;  1S0V A;  2EIM C;  4JI3 O;  1AI6 A;  2E3C A;  4PA9 A;  2VQE B;  3ZED A;  1OCZ C;  4LFC B;  4P2Z A;  1BGY H;  3ZHU A;  3E86 A;  4ZKI A;  3C90 A;  4X62 B;  1P49 A;  2W6J G;  3T4D A;  1SET A;  2LQT A;  4AHC A;  2F93 B;  4DR3 B;  1GTO A;  1FS0 G;  4RUE A;  3CE2 A;  5IYD O;  2ZXW B;  4Q6G A;  1J95 A;  4GKJ O;  4DR6 O;  4EEQ A;  1JVM A;  2FTK A;  2M6Y A;  4J80 A;  4RAI A;  5IT9 N;  4HYO A;  1F51 A;  1QCE A;  2X6C A;  5KHG A;  1I7F A;  1FKA O;  2YUA A;  3STZ C;  4O4I A;  1Q3E A;  1SER A;  3BHP A;  3RYC B;  1XEQ A;  3AG2 B;  2QM4 A;  3CC2 V;  2WSS G;  4NYK A;  2VQE O;  2QSA A;  5LP6 A;  1BHB A;  2EBO A;  2IU3 A;  3CCM V;  3N27 A;  3RWR D;  3B77 A;  4LWS A;  4X20 B;  4X62 O;  2HEP A;  1PV0 A;  2O57 A;  1XBL A;  1M5I A;  2XUM A;  2P5O A;  3EXA A;  3I55 V;  5JH7 A;  1WA8 B;  1XL4 A;  4JI2 B;  3TXQ A;  4DV2 B;  2ZE5 A;  2ZR3 A;  4NTY A;  1YCI A;  4XDJ A;  4IIJ B;  4FJC C;  3T1Y B;  2HHH B;  5B66 Z;  1M1K W;  4TT3 G;  2HG5 C;  5IY5 C;  2Q67 A;  4HBN A;  2ATK C;  1FJG B;  2WLM A;  5B3S C;  3LNM B;  2DQ3 A;  3IGA C;  5TIS Z;  1EN5 A;  3H1L H;  2UXC O;  4I7Z B;  3ZHQ A;  2IH1 C;  2ZDI A;  2YEV B;  4TV8 A;  5C8Y A;  2VWJ A;  4K8X A;  5J2T A;  1VQ6 V;  4B3R B;  3W7T A;  4DV1 B;  4IYI A;  5BXZ A;  2E5L O;  3CJH B;  4X1Y A;  2NNU A;  1MOF A;  1SC5 B;  3CYO A;  4X66 O;  2NLJ C;  4J7Z A;  4FM0 A;  3D3Q A;  4MVU A;  3RYI A;  3U11 A;  1DGS A;  5LGT A;  4X64 B;  4QJF B;  1V54 C;  2YI8 A;  4JI2 O;  4G27 B;  2HHH O;  3T1Y O;  4UVC A;  3P3P A;  1JFF A;  1K97 A;  2BOC C;  4JTA B;  2QWN B;  2P06 A;  3LDC A;  4YHH B;  4JV5 B;  3X2Q B;  3ASO B;  2FL4 A;  4DR2 B;  4U3J B;  3L71 H;  2EIK B;  1S5L Z;  3CXC U;  1QBZ A;  4H13 B;  4B3R O;  1SQX H;  4LR3 A;  4MW8 A;  2WLL B;  1Z2G A;  2VS0 A;  5LXT B;  4CS2 A;  4I4T B;  3SYC A;  1JCH A;  2UU9 O;  2FB5 A;  4D7S A;  3W7W A;  1ZWI C;  2BTO A;  3RYH B;  4O2A A;  5JVD A;  1COW G;  1G6U A;  3JAS B;  3ASN C;  4Z1V A;  2A0L A;  3C3S A;  1WNS A;  2CTW A;  4JI1 B;  4XBF A;  2BOB C;  1V55 B;  4LF6 B;  3CRA A;  3JAK B;  5EBW C;  2E75 B;  2ZIM A;  3P32 A;  4TWK A;  3B40 A;  4OPH A;  2H8P C;  5BR8 B;  4MVR A;  4JV5 O;  4LF9 O;  2QM7 A;  1K5Q A;  3ZRV A;  1WB8 A;  5EYP A;  2YDE A;  2DW4 A;  4CC6 A;  1YEW A;  4YXW G;  3WB2 A;  1L8D A;  1J5E B;  1OCC B;  4DV6 B;  1NBM G;  2Y48 A;  4GX1 A;  2AGA A;  4LFA O;  3B09 A;  4JI7 O;  1AJN A;  1SQB H;  3FYI B;  3HKD A;  1Q7Y W;  1PNK A;  1KBH A;  1KUQ A;  1N0J A;  2H3O A;  4X9Q A;  5A2Q N;  1S72 V;  4JI1 O;  1MSD A;  1RM1 C;  1FFT B;  4LF6 O;  3B8N A;  3MDS A;  1V9P A;  4TUY A;  3TGU H;  5BR8 O;  1P84 F;  2UXB B;  3BA8 A;  5IYZ B;  1UJW B;  4DV4 B;  2QWR B;  2GUZ A;  2LJ2 A;  1DTO A;  2JGD A;  3VQV A;  2ZM6 O;  4GT1 A;  5LP6 B;  1K3E A;  4O4L A;  4X65 B;  1RPO A;  2YSU B;  1M4U A;  3OMA B;  3CP1 A;  1YIT V;  3OE7 G;  4RQF A;  5B1A C;  1ZL8 B;  4BIO A;  4Z2W A;  3QO8 A;  3CCL V;  2KSD A;  4IHJ A;  5H5N A;  2XAS A;  2ZNJ A;  1Q86 W;  1I5X A;  1N36 B;  1GRJ A;  1K4D C;  5CBG A;  1Q6H A;  4B7K A;  1NH2 D;  4JAV A;  1PL4 A;  4GX2 A;  1ZTE A;  5IJ0 A;  3ZMV A;  3HKC A;  5FNV A;  2DWD C;  4RQE A;  3F5W C;  1Q5O A;  4TV8 B;  5C8Y B;  4YY3 O;  2UXB O;  4KUM A;  2LGW A;  5IYB O;  5FLX N;  1OCO B;  5BY1 A;  4X65 O;  4LF7 B;  5LMN B;  1AR1 B;  3SYA A;  1S5J A;  2PYJ A;  1US6 A;  4NTX A;  5KHJ A;  3CME V;  3CCR V;  5L3F A;  3RVY A;  3M8A A;  2Q7H A;  2PTM A;  1K9M W;  1Z5W A;  2GTS A;  4LH6 A;  3UT5 B;  4EKW A;  1HNZ B;  2ITD C;  4H44 B;  1Y76 A;  4QIW F;  1JFF B;  2YXH A;  3E8G A;  1XUQ A;  1XDC A;  2PGG A;  1GM7 A;  3ZHV A;  5E79 Z;  4K8Z A;  3AG3 C;  1PP9 H;  2DN9 A;  2ZIO A;  1F4M A;  3OEE G;  2C2A A;  3W7S A;  3CCQ V;  4FZ0 A;  3RYC A;  4W4K A;  5CMU A;  3BPZ A;  4DR4 B;  2P4V A;  1W2B U;  3BFR A;  3D36 A;  3DTU B;  4DO2 A;  1U96 A;  4H0L B;  3JCZ A;  1AI7 A;  5JQG B;  2P7T C;  2EUL A;  1VQN V;  3K0G A;  2BCC H;  4X20 A;  2AHY A;  1YTF B;  1THZ A;  1YZB A;  4YJ2 B;  1IBL O;  3HB3 B;  4EB6 B;  5JJN B;  1XNQ B;  2DYS B;  1K7D A;  3SJA C;  1Q43 A;  4LF4 B;  1BHA A;  3A0R A;  5IYC O;  2EJ7 A;  5BMV A;  1HNZ O;  4IIJ A;  1VEW A;  3STL C;  1BCC H;  1RSO B;  3WG7 B;  3K08 A;  2EIN B;  1QNM A;  4UXN A;  2JJ1 G;  1B6Q A;  3OR6 C;  1WPB A;  3K06 A;  5BZB A;  4JI5 B;  5LOV A;  2LW1 A;  1IUR A;  3JYC A;  4BIZ A;  5GW7 A;  2EX3 A;  2YEV A;  3R66 A;  3G6E V;  4TQD A;  3WFV A;  2Q69 A;  3KCX A;  1AR4 A;  4DR7 B;  4DUY O;  4JAS A;  3KZI Z; 
#chains in the Genus database with same CATH homology
 4HYO A;  5KUM A;  1F51 A;  1DF4 A;  1QCE A;  1S3J A;  1PNL A;  1G8M A;  3ABL C;  2W6I G;  2X6C A;  3SPJ A;  1FXH A;  2OTL V;  3ASN B;  1VQ7 V;  3STZ C;  1M90 W;  2F43 G;  2V7Q G;  5LHI A;  5B1B B;  1SER A;  3TET A;  3AG2 B;  1Q81 W;  3CPW U;  2Q6A A;  2WLH A;  3JD1 A;  3D3I A;  2JEX A;  3CC2 V;  2WSS G;  1KP2 A;  4UV8 A;  2ZDI C;  4MVQ A;  3CCJ V;  2WAM A;  1L1F A;  1FXV A;  2R9R B;  1VQL V;  1WLE A;  1BHB A;  3QO7 A;  1I5Y A;  1OCO C;  2EBO A;  1K8A W;  2IU3 A;  1Y4M A;  4Z1M G;  3CCM V;  4LC1 A;  3B77 A;  4N23 A;  2GHY A;  1EBO A;  4G2K A;  3LDE A;  4GX0 A;  3ZMU A;  5LHH A;  3ZN1 A;  5KA6 A;  1BL8 A;  2XAF A;  1NQT A;  3ML0 A;  1E1R G;  2AHZ A;  3BY6 A;  3I55 V;  3W7X A;  5L3D A;  1XL4 A;  1P7B A;  2IW5 A;  4LBE C;  3CCE V;  1E79 G;  1OZ0 A;  2WLK A;  4UUJ C;  2ZR3 A;  4CZZ A;  3LSS A;  5L3C A;  4MTF A;  4XDJ A;  4FJC C;  1OCR B;  4LP8 A;  4TT3 G;  2HG5 C;  5IY5 C;  1M1K W;  2WLL A;  2Q67 A;  2ATK C;  2V1D A;  4R6Z A;  4PDV A;  4RUF A;  4UVA A;  1KC8 W;  4X8A A;  2B1G A;  2P90 A;  2WLM A;  3LNM B;  5B3S C;  2DQ3 A;  4I5S A;  3E8H A;  3IGA C;  3ZMS A;  2DQ0 A;  2HLD G;  3VOU A;  2QA4 V;  1YJN V;  2ZR2 A;  1QVF U;  1WPX A;  2IH1 C;  5KA5 A;  2ZDI A;  5FL7 G;  2YEV B;  3CC4 V;  3SYP A;  1RM1 B;  4PDL A;  3SJQ C;  3OAA G;  3E89 A;  4KP4 A;  1VQ6 V;  3W7T A;  3OW2 U;  3KG2 A;  3SPG A;  2NNU A;  1MOF A;  3JD2 A;  3ZN0 A;  3CYO A;  1R6K A;  1GM9 A;  2NLJ C;  4HAM A;  4KFM A;  3SPH A;  2IH3 C;  1FXK C;  4MVU A;  2OCC B;  1KD1 W;  3TK1 A;  1CPY A;  5LGT A;  1TUE B;  1EFR G;  2EIL C;  3GB7 C;  4MVM A;  4QJF B;  3ZRW B;  4FPP A;  2EIJ C;  1MG1 A;  2OT5 A;  1QLE B;  1V54 C;  4QE9 A;  4H33 A;  3F7V C;  1R6N A;  2DYS C;  2A9H A;  5B1A B;  2DYR C;  4G27 B;  2KB1 A;  1R3I C;  2WLJ A;  2P6J A;  2HR3 A;  4UVC A;  1K97 A;  2Z3Y A;  5HFM A;  4MT8 A;  3PJS K;  1K34 A;  2R9I A;  4UVB A;  2OTJ V;  1K4C C;  1CP9 A;  1DLB A;  2BOC C;  4JYB A;  4JTA B;  1M56 B;  1R3L C;  2M7W A;  4H37 A;  4MVS A;  3WG7 C;  3LDC A;  1IXM A;  3AEI A;  2EIN C;  3W7U A;  5L3B A;  4P9P A;  1VQO V;  3OEH G;  4TSF G;  3X2Q B;  5EBM C;  3ASO B;  4JGS A;  1GKF A;  4L87 A;  1JX9 A;  1BMF G;  2EIK B;  1H8H G;  4OXS A;  3CXC U;  1KEC A;  4P9O A;  2XOK G;  1QVG U;  1QBZ A;  2X6B A;  2EJR A;  2JJ2 G;  1K33 A;  1P4R A;  2WLI A;  1H8E G;  4PA4 A;  2ZXW C;  1ARO P;  3M99 B;  2QM8 A;  1M57 C;  2WLL B;  4MW8 A;  4R50 A;  4R7C A;  1NH2 B;  2LFR A;  1PKX A;  5KUK A;  3SYC A;  3RBZ A;  5J9P C;  1NVP B;  4WFH A;  1JCH A;  3ABM B;  1YI2 V;  2HJF C;  1QLN A;  3W7W A;  1ZWI C;  1NJI W;  1K92 A;  2B1I A;  4PA6 A;  1COW G;  1R73 A;  3UM7 A;  1VQP V;  1NVP D;  2HKO A;  5B1N A;  1MSW D;  1KKD A;  3ASN C;  2K1E A;  2A0L A;  2HVJ C;  3SYO A;  5B1B C;  3G4S V;  2XAG A;  3AG2 C;  4PEL A;  1R3J C;  2X6A A;  2H94 A;  4MS2 A;  4XBF A;  3AG4 B;  4U7O A;  2BOB C;  1V55 B;  5HFL A;  4WFF A;  1K73 W;  1SES A;  2IJH A;  4JYC A;  5EBW C;  1Y66 A;  4U7N A;  1GM8 A;  3E83 A;  3P32 A;  4TWK A;  4ASU G;  2H8P C;  4WCE V;  4QPK A;  4MVR A;  1M9N A;  4JF3 A;  2MK3 A;  2QM7 A;  1H2G A;  4MSW C;  1E1Q G;  5EBL C;  3ZMZ A;  1K5Q A;  3OGC C;  3EFF K;  3ZRV A;  3LDD A;  3AG3 B;  2XND G;  2DW4 A;  3I56 V;  3E8F A;  3FB6 C;  3ETG A;  1GO3 F;  4YXW G;  5CBF A;  3ZMT A;  1PD3 A;  4JAU A;  3OFN G;  1OCC B;  4MTX A;  3E2E A;  1NBM G;  2Y48 A;  4GX1 A;  3K04 A;  5L3G A;  3K0D A;  4FK5 C;  2X7R B;  1NKD A;  5H9C A;  5EK0 A;  1GMG A;  4XDK A;  4UV9 A;  1AI5 A;  3FB7 C;  1AJN A;  3VBB A;  4RO2 A;  4R8C A;  1VQ4 V;  1VQ8 V;  4MVZ A;  3FYI B;  3ABK B;  3AG1 B;  1Q7Y W;  1PNK A;  3OR7 C;  3FB5 C;  4I9W A;  4QNH B;  1N8R W;  3NXS A;  4E2L A;  5CA3 A;  4BW5 A;  1S72 V;  3P30 A;  1KQS U;  4P30 A;  5IDJ A;  1VQ5 V;  1RPR A;  1RM1 C;  1FFT B;  1QR9 A;  3B8N A;  2IJI A;  3CC7 V;  1S5H C;  2EIM B;  3QO5 A;  3R65 A;  4PA7 A;  2JK5 C;  2PI4 A;  3T2M A;  1OCZ B;  1UJW B;  2UXN A;  3ETE A;  3T1C A;  3K3W A;  1DTO A;  3EHB B;  2WPD G;  3LSQ A;  3LUT B;  4GT1 A;  2HFE C;  3ZRX A;  1K3E A;  3FB8 C;  2XAH A;  3B8M A;  2OCC C;  1F4N A;  3SPC A;  2JEU A;  1RPO A;  2YSU B;  2Y69 B;  3BEH A;  3OMA B;  2W0F C;  3CMA V;  1QLE C;  1VQK V;  1Q82 W;  4N21 A;  4GX5 A;  3CP1 A;  4WFB V;  3SYQ A;  1YIT V;  3OE7 G;  2UXX A;  1EZJ A;  3H01 A;  4RQF A;  4QE7 A;  2CK3 G;  5B1A C;  3ZJZ A;  3QO8 A;  5H6R A;  4LCU C;  3CCL V;  4FMT A;  2P67 A;  3E8B A;  3CCS V;  2Q68 A;  3ABT A;  1YSC A;  3ABU A;  1GK9 A;  2DWE C;  4CBC A;  2XAS A;  3QNE A;  1MAB G;  1I5X A;  1JPX A;  1Q86 W;  3T4Z A;  3ABL B;  1M56 C;  2ITC C;  4J9Z B;  5B1O A;  1K4D C;  3ZIA G;  4HZ3 A;  5CBG A;  1AJQ A;  1FXK A;  3JD3 A;  3SPI A;  5DM6 V;  3IC7 A;  3GWO A;  3X2Q C;  3OUF A;  3ASO C;  2QEX V;  3OMI B;  2EIK C;  1NH2 D;  4JAV A;  5LGU A;  2LP7 A;  4JPR A;  3K79 A;  1YHQ V;  2QKS A;  4GX2 A;  3ZMV A;  2DWD C;  3IFX A;  4RQE A;  3F5W C;  3G71 V;  1JJ2 U;  3CCV V;  4X88 A;  4F4L A;  4KUM A;  1AJP A;  5IYB O;  1OCO B;  4PDR A;  1YJW V;  2ZQM A;  3JD0 A;  1AI4 A;  3ABM C;  3ZRW A;  3OUS A;  1W0K G;  4PDM A;  2PI5 A;  3MHH C;  2WLN A;  3TCU A;  1AR1 B;  3SYA A;  4ZBM A;  5C93 A;  1G4Y B;  3CME V;  2QE7 G;  3CCR V;  1XL6 A;  3RVY A;  5L3F A;  2JIZ G;  1H38 A;  1K9M W;  3K03 A;  3AG4 C;  1ENV A;  1S77 D;  5IY5 B;  1V55 C;  2Z5U A;  4EKW A;  3F7Y C;  3HPL C;  3RW0 A;  2EZO A;  3JD4 A;  2ITD C;  1NR1 A;  1VQ9 V;  4QIW F;  3E8G A;  2D3O W;  5B3S B;  5DN6 G;  1JOY A;  2XAJ A;  4X89 A;  1GM7 A;  3UKM A;  1KP3 A;  2XAQ A;  5E1A C;  1OCR C;  3AG3 C;  4WF9 V;  2WWW A;  4MVO A;  1F4M A;  3MD0 A;  1W0J G;  2C2A A;  3OEE G;  3W7S A;  1DF5 A;  4JTC B;  3ZCC A;  2QTO A;  3CCQ V;  3OM3 B;  1VQM V;  1HWY A;  4RAI A;  5CMU A;  1OCC C;  1QR8 A;  2B5U A;  2IU0 A;  4MTG A;  4BAY A;  4DXW A;  5CN0 A;  1W2B U;  4Q20 A;  3CCU V;  5LGN A;  3D36 A;  3DTU B;  1JQ0 A;  1ORQ C;  2LFS A;  4DO2 A;  3JCZ A;  2WLI B;  3DGE A;  1YIJ V;  2IJJ A;  4J9Y B;  2EZP A;  1FXK B;  1R3K C;  1AI7 A;  3MHS C;  4GCZ A;  2P7T C;  2IJK A;  2X0L A;  5H6Q A;  1VQN V;  2EIL B;  5EC1 C;  3K0G A;  3ABK C;  3AG1 C;  1OHH G;  3CD6 V;  2AHY A;  1YTF B;  1THZ A;  2EIJ B;  1V54 B;  3HB3 B;  1SRY A;  3FYE B;  2DYS B;  4QPJ A;  4BIU A;  1K7D A;  2DYR B;  1YJ9 V;  5CBH A;  1YTF D;  1BHA A;  4WFA V;  3A0R A;  4JTD B;  3E35 A;  5IYC O;  4MW3 A;  1SZT A;  3ETD A;  4G28 B;  4WFG A;  3RVZ A;  1F23 A;  2A79 B;  3FKS G;  1S0V A;  2EIM C;  3STL C;  1AI6 A;  4PA9 A;  3WG7 B;  4WFE A;  2GSM B;  3K9A A;  1OCZ C;  4P2Z A;  3K08 A;  2EIN B;  5LHG A;  5EC2 C;  4UXN A;  2JJ1 G;  1B6Q A;  3OR6 C;  3K06 A;  3E86 A;  4FIP C;  2HVK C;  4ZKI A;  5BZB A;  1CEZ A;  4MTO A;  1NR7 A;  2W6J G;  3T4D A;  2Y69 C;  3JYC A;  1ROP A;  4PA3 A;  1SET A;  5GW7 A;  4BIZ A;  5L3E A;  2YEV A;  5LBQ A;  1GTO A;  1FS0 G;  4RUE A;  5IYD O;  1PNM A;  2ZXW B;  2ZD9 A;  3ZRS A;  1M57 B;  1K5S A;  3G6E V;  3OMN B;  1J95 A;  1LNQ A;  3WFV A;  1JVM A;  2JDI G;  2Q69 A;  1PL0 A;  2FTK A;  4XDL A;  1S76 D;  4JAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...