3E8BA

Crystal structure of the the open nak channel- rb+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8bA00
4MTOA 4QNHB 2DYSC 4MW3A 4UUJC 4X89A 3JYCA 4HZ3A 3RBZA 1OCZC 4PDLA 5J9PC 4XDJA 3T4ZA 3T4DA 3IFXA 2Q6AA 3STLC 4PA3A 3AG1C 2HVKC 4PA9A 4X88A 3SPHA 5CBGA 4WFFA 3ABMC 2A79B 4MVQA 4QE7A 2KB1A 3K04A 2EILC 4R7CA 4JTDB 4MVMA 4RUFA 1P7BA 3FB6C 3R65A 3AG3C 4MVUA 3K03A 3UM7A 3FB7C 2Q68A 4R8CA 4F4LA 2YEVA 2X6CA 1J95A 3K0DA 2K1EA 3FB8C 2HG5C 3ABLC 3SYCA 2WLLB 3ZJZA 5CBHA 3LDCA 2DWDC 4MTFA 3RW0A 4ZBMA 4XDLA 1R3JC 2DYRC 2Q69A 3PJSK 4WFGA 3E86A 4GX2A 1R3IC 4RAIA 2EIMC 4H37A 5KUMA 1V54C 3E8BA 4RUEA 1LNQA 3F7YC 3LUTB 1XL6A 2Q67A 5EBWC 3VOUA 3ASOC 2BOBC 4JTAB 3TCUA 5B3SC 4MVZA 4G28B 4P9PA 5EC1C 4XDKA 2WLMA 3RVYA 2AHYA 2EINC 3E83A 4I9WA 5KUKA 2HVJC 4MSWC 2WLNA 3ZRSA 4J9YB 3STZC 1OCRC 3E8FA 3IGAC 5EBMC 2ITDC 5E1AC 4G27B 4TWKA 4DXWA 2AHZA 4R50A 2A9HA 3LDDA 5EK0A 3AG4C 5EC2C 2IH1C 3K06A 4MVSA 3OUFA 4PA7A 3T1CA 1OCCC 2X6BA 3OR7C 3SPJA 2ATKC 5B1AC 1KKDA 3SYPA 2R9RB 1K4CC 3RVZA 1M56C 2WLLA 2EIJC 1ZWIC 4J9ZB 2W0FC 3KG2A 4PDMA 3ASNC 4MTGA 3SPCA 5IY5C 2ZD9A 2QKSA 3ABKC 4KFMA 2P7TC 3GB7C 2EIKC 2WLIB 4P9OA 3E8HA 4HYOA 4PA6A 1R3KC 3E89A 4WFEA 3TETA 3SJQC 2WLKA 4H33A 4EKWA 5B1BC 1OCOC 1JVMA 3UKMA 3OR6C 3OGCC 3T2MA 4P30A 3HPLC 4LP8A 4GX0A 3LDEA 1M57C 1ORQC 3BEHA 3LNMB 4QE9A 2OCCC 4X8AA 3SYOA 2JK5C 2A0LA 4PA4A 1K4DC 2H8PC 2HFEC 2ZXWC 4GX1A 3X2QC 1G4YB 4MS2A 4MW8A 4LCUC 1XL4A 3SYAA 2HJFC 4R6ZA 3E8GA 4JTCB 2QTOA 2WLHA 2ITCC 1BL8A 3AG2C 3SPIA 3OUSA 4RO2A 2WLJA 3F7VC 2IH3C 4WFHA 5BZBA 2BOCC 4MVRA 3WG7C 4OXSA 4BW5A 1QLEC 1V55C 2NLJC 3F5WC 4MVOA 4P2ZA 4LBEC 2WLIA 1R3LC 3FB5C 5EBLC 4PDRA 5CBFA 2DWEC 2Y69C 4PDVA 3K0GA 1S5HC 4CBCA 3EFFK 4GX5A 3SYQA 3K08A 3SPGA 2X6AA
chains in the Genus database with same CATH superfamily
4JV5B 3RBZA 3K57A 2LO1A 4U7NA 1CEZA 3AG1C 3EVKA 1MSWD 4Q6GA 2M6YA 2GV9A 1GN6A 2JEXA 2AZ0A 4FFBA 3FAVA 4DV5O 4RUFA 5LP6A 1D5AA 4IHJA 1ZSPA 1VQ8V 2N05A 1D2DA 5E79Z 4NVPA 4WFAV 4FPPA 3K9AA 3EXAA 3KCXA 2DJVA 2PUSA 2WA3A 1KC8W 2QWOB 5DECA 2Q69A 3PJSK 2IBZH 4I9QA 2K9PA 1ZL8A 2DOSA 2QGNA 2EINB 3L73H 2ZQMA 3LUTB 3AG7A 3B8MA 5JJNB 3VOUA 4P9PA 1AILA 2GTAA 3CS5A 3E22A 1BE3H 5IYCO 1M56B 2RN9A 3ASNB 1WNSA 1BSMA 2V1DA 3BFRA 3KG2A 4H44B 1SQXH 4RQEA 2OT5A 2ZD9A 4FVMA 3L74H 4DV2B 4DV1O 4ZIBA 4H33A 1M57B 2YIBA 2M7WA 1JVMA 4LR3A 5IJ9B 1SS3A 4DR6B 2E75B 4JV5O 3JAWA 2P6JA 4BR6A 4GCZA 1NKDA 3CRRA 3E8GA 2WLHA 4O4JA 4CS2A 1H2NA 3CMAV 2RMKB 3D3IA 4LNUB 4I55B 1H2LA 1T5EA 4O4HA 2HEPA 3LSSA 1QLEC 1SC5B 1HNWB 4CH6A 1MABG 2PF4E 2DWEC 3ZN1A 2DYSB 1Q6UA 3K5OA 4MW3A 4HZ3A 4BIUA 5KX5A 4ASUG 4AI8A 2ZKOA 2V7QG 3LNNA 1G1XB 3B2EE 3K3WA 1XQ8A 4FMTA 3N2KA 2AGAA 4I7ZB 4NTWA 1AR1B 3CYOA 5LXTB 1J5EB 3AEIA 3JASA 2Q7HA 2E74B 4ZHQB 5IYZA 1F23A 3MDSA 4UFZA 1EZVH 3C3TA 4LF5B 1JFFB 5IE9A 4EB6B 1RM1C 1MOFA 2CGOA 3JALB 4DV2O 4ICGA 3TCUA 4FM1A 3ZEDA 4DK0A 3BA8A 2E76B 2A7WA 4DR6O 1XHXA 3U10A 1NR1A 3CXHF 2JS3A 1URFA 2Q9LA 4UVBA 2EX3A 4UB6Z 4FFBB 2EIMB 2UXBB 2D2CB 5LP6B 4MTGA 1RPOA 1QR9A 4HBNA 2EIKC 3LSQA 3JD1A 1N4CA 3OMAB 3JARA 4LFCB 3W7XA 1HNWO 1OCOC 3OR6C 2HP8A 3QVNA 3CJHA 4DW0A 3X2QB 2JK5C 4JAVA 4PA4A 2CTRA 1ZL8B 1JJ2U 4LCUC 3SYAA 1VQ5V 2QWRB 4UCTA 2UXCB 2LGWA 1V9PA 1SZTA 1J5EO 3H1LH 3E22B 4PDVA 2Y0IA 4JGSA 3ZHUA 3W7TA 4GX5A 1KD1W 3P30A 2KQXA 4D7TA 1FXVA 1VMGA 2XUMA 1OHHG 1MZFA 3JYCA 4LF5O 4NR1A 5CBGA 3WG7B 3ABMC 3ZMSA 2QDOA 5LMUB 4O2AA 1RP3B 1VQ4V 1UPGA 3WU2Z 4JI4B 4EFBA 1Q90D 1U96A 3DTUB 1F7YA 4O4JB 5DEDA 3FYIB 3AG1B 2UXBO 3VQWA 4XDLA 1YSCA 4WFGA 4MTXA 2UU9B 1PNMA 3QO7A 4RUEA 3OMIB 4DR2B 4LFCO 1GN3A 3D8CA 1L1FA 2YDEA 4G28B 2HVJC 4J9YB 3STZC 5C8YA 4JAAA 5KX5B 3CCQV 1NJIW 2OCHA 1FS0G 3SYPA 3J81N 4FIPC 1O9GA 1YCIA 2P06A 2YIAA 5B1OA 2YSUB 2UXCO 4DUYB 2Z5UA 3P3NA 5LHIA 4DUZB 3E89A 3OFNG 4CH5A 5H6RA 1WB7A 2XAGA 1Q5OA 1K97A 3UT5A 3JSNA 2XAHA 1K7DA 4YY3B 3C3SA 1SQBH 5JQGA 1DTOA 1G8MA 1NT2B 5LMUO 3O9OA 4JI4O 2Y69C 4DV7B 1NTMH 3EFFK 4X1IB 1SQPH 5IDJA 3ZRVA 2VRZA 4UUJC 1N0NA 4X89A 2KKWA 1M93A 4PA3A 3JARB 2UU9O 5B5EZ 1WA8A 4DR2O 1NH2D 3JD4A 1TA8A 1QLEB 4QE7A 1S77D 3CJHB 2P4VA 2FKXA 1KP3A 1GM7A 5KHIA 1KMIZ 1WP7A 3H1KH 1JMKC 4KHPB 1GKFA 4OX9B 4BIOA 4DUYO 4I50B 4DUZO 1SQFA 5KUMA 2Q0OC 1B04A 3IC9A 4YXWG 2EINC 3RYIA 5LGUA 1WAZA 2RJZA 5KHHA 5EK0A 3K06A 3JCUZ 4O2BA 3OR7C 3SPJA 4BWAA 3ZMVA 4YY3O 2MK3A 2R9RB 1M56C 1Y67A 4F6RA 3ASNC 3SPCA 1TVKA 1KYOF 2X7RB 4O2AB 5IJ0A 4GLXA 2Q5ZA 4UCUA 1JR9A 3SJQC 4WF9V 3ZHVA 3T1HB 3ML0A 4GX0A 1M57C 1ORQC 2OIGA 1TUBA 3KZIZ 4LF7B 2JS5A 3RGBA 1XHZA 2E5LB 2BTQB 2EZPA 2VWKA 1CPYA 4NXNB 2QTOA 3OEHG 1BL8A 3HKBB 4WFHA 1YHQV 2F4VB 1OCOB 1SRYA 2YIDA 1QBZA 2PTMA 5C8YB 4OXSA 2QKAA 3CE2A 4JI0B 4KXRA 1AJNA 4J11A 2Q8VA 1AP5A 5FNVA 4KHPO 4KL1A 2FL4A 4MTOA 4UVCA 4ABMA 1D5NA 2DYSC 4OX9O 3CX5F 3T4ZA 2GUZA 3ZS8C 5L3DA 1EN4A 3M99B 1HNZB 3WB1A 5J2TA 4JYBA 4JTDB 3AG3C 1DLBA 4PJ0Z 4UCVA 4X1KA 2X6CA 2K1EA 1N32B 4YJ3A 2ZNJA 2DYRB 2GHYA 4ZI7A 4XBFA 1KUQA 1GRJA 4ZBMA 4JYCA 3ABMB 2DW4A 4X62B 2D3OW 1V54C 1FYJA 3F7YC 1W0JG 4FK5C 2IJJA 4MVZA 4K8XA 3RVYA 2AZ2A 3T1HO 3ZRSA 2GDSA 4DXWA 4LF7O 1Z2GA 2E5LO 2ATKC 4NXNO 1P7GA 1NQTA 3WB2A 5FL7G 5B1NA 2F4VO 5B1BB 5IYBO 4F6EA 2Z0AA 4X20B 5LP6C 4UV9A 3TETA 3OMNB 4JI0O 4DV6B 2Y0PA 3H9VA 2OCCB 3L70H 3ICXA 1BCCH 4TV9A 2ZXWB 1KQSU 3MAQA 2MW2B 1SETA 4N23A 5LHGA 1Q81W 1Y74A 3C90A 1IXMA 4KUMA 3X2QC 1W2BU 3G6BA 5BMVB 1HNZO 5ITZA 3N2GA 3H01A 3HR0A 1LUWA 4X66B 1K8AW 4RO2A 4GZRB 1WP8A 1F4MA 1QCEA 5DM6V 1GK9A 2Q7EA 4MVOA 2Z3YA 3RYHB 1YXBA 2WAMA 3JD3A 1N32O 1OCZB 1H2MA 3FB6C 4O4LB 1Z5WA 1PM9A 1GH6A 2IU3A 5IJ0B 2B5UA 3IFXA 4X62O 5KHKA 3APQA 4PA9A 4KP4A 1M9NA 5JJEB 3TXSA 5L3FA 3RT3C 5D5QA 2PZSA 1TUBB 1NS1A 2XNDG 1VQPV 2YEVA 4UCOA 1J95A 1X59A 1YVWA 4X9QA 3ZN0A 3CCMV 2LW7A 5CBHA 4TV8A 1PNKA 4GUNA 4FLXA 2YI9A 1QU7A 1NH2B 3Q4HA 1R3IC 2FYUH 2LW1A 1VARA 3RYFB 1EM1A 4DV6O 1OCRB 1PP9H 1VIBA 3CB2A 1VP7A 1IXBA 5TISZ 5FNVB 2AHYA 3ZX6A 5CA1A 1L0NH 2WLNA 1AB3A 1U97A 2W0XA 4IL6Z 2GUZB 1GM9A 3T1CA 2R70A 3CMEV 1THZA 2PY5A 1K4CC 1LR1A 4LC1A 5AG2A 5J2TB 4X66O 5IY5C 1IURA 3GB7C 3ABUA 4YJ2B 1XILA 4FZ1A 4FLWA 4YJ3B 2QR4A 1AR5A 2JGUA 4LP8A 4ZI7B 3LDEA 4X8AA 1L8DA 3HKEB 3OW2U 4B3RB 4ZKIA 5D5PA 2HJFC 2ZINA 1H8EG 1BQZA 2ITCC 5CB4B 1NVPB 1V55B 1DF5A 1ZX3A 4X65B 1E79G 1KBHA 2YXLA 4Q20A 3I5DA 4QGPA 5JH7B 2FMLA 4I4TA 1Y76B 2ZE7A 1W59A 1BQ0A 4G2KA 4YIOA 3SPHA 4AQYB 4DV3B 1F4NA 2Q4PA 3CP1A 3H1HH 2Q7GA 2CDYA 4DRXA 1FD9A 1Y74B 5LA6A 2VWJA 1FFTB 5JWPA 3K0DA 3BVOA 3O65A 3G67A 4L87A 3JAKB 2NR5A 3VBBA 4EEQA 3ZRWA 3CCJV 3W7UA 3R66A 3AG3B 3BPZA 3NR7A 5LYJA 2UUAB 5IWAB 3CCVV 3BA9A 3AG4B 4MSWC 1BZKA 1Q7YW 4G27B 3CPWU 4B3RO 3SDLA 3K5NA 1M1KW 3OD4A 4UB8Z 5K1PA 1V54B 3A2FA 1YTFD 5L3BA 2QWNB 4K8ZA 1CXZB 1M5IA 5GTIZ 2JGDA 2YEVB 4X65O 1JOYA 4PHZA 1KB9F 5CN0A 1Q86W 3UKMA 2XOKG 3A0HZ 3VQXA 1EFRG 3RYCB 2CE4A 2KSDA 2W6JG 4TV8B 3D36A 5JVDA 3CWBH 3BY6A 1FFXA 5LBQA 2ODMA 1PKXA 3ZMUA 1S5LZ 2ZR2A 1Q8IA 4MW8A 3AG2B 1AI6A 1K34A 3FAVB 4AQYO 4JTCB 4DV3O 3L9DA 4IHJB 3OUSA 3SJBC 2ILMA 1K73W 3JCZA 3GWKC 4MVRA 1SKVA 1IX9A 3F5WC 2WLIA 5KAFZ 1MG1A 1QR8A 4TUYA 3F5TA 3OGIB 3JATA 3LSUA 4TOIA 2LQTA 3QG5A 1UFIA 4W4LA 3OAAG 4DO2A 2HVKC 1PV0A 4ZOLA 2NN4A 3W7SA 2OTJV 2UUAO 4MVQA 5IWAO 3K04A 4U3JA 4MVMA 2CGNA 2LFRA 2PI4A 3CC4V 1SERA 2CUGA 2F1MA 2FTKA 4J7KA 2ETNA 1XBLA 4JI5B 3RW0A 1S76D 2DYRC 4JZGA 2F95B 5B66Z 3JAWB 2HJDA 4L8JA 2VQFB 1P49A 2LP7A 1WLEA 2XAQA 1YITV 5EBMC 4R50A 3CRAA 4QJFB 1WB8A 2X6BA 1H2SB 1HW7A 5HFLA 2WLLA 4O4HB 4PDMA 2KG7A 4JI6B 4DRXB 4WFBV 1QLNA 5LA6B 2DE0X 5B1BC 3OGCC 2RCVA 3B77A 4O4IA 4JI3B 2OCCC 3SYOA 1HR0B 4CC6A 2A0LA 4LFAB 2ZXWC 5IY5B 3S3XA 2RNBA 5LYJB 3N2KB 4R6ZA 3K5MA 1Z5VA 4PD4F 4RWUA 2WLJA 2IH3C 2N04A 1RFYA 3JASB 3FB5C 3K9SA 2P22C 4AHCA 4Z1MG 5IYZB 2QE7G 2JJ1G 2ZE8A 1WN7A 3K08A 4PI0A 1XI1A 4JI5O 1OCZC 5J9PC 1YJ9V 1KECA 2JGDB 4JI2B 4X88A 4U7OA 1I94B 5BXZA 3FFQA 1X4TA 5JVDB 5EZYA 3K03A 3UM7A 5IT9N 1PL0A 2VQFO 1NR7A 4F4LA 3UQ8A 1EZJA 1IDSA 1AI5A 1H2KA 4LWSA 4E2LA 2EJ7A 3AK2A 3BABA 4U3FH 2XAJA 2WWWA 4B7EA 2QM4A 4JI1B 4JI6O 5J2UA 2BSKA 3FX7A 4TUYB 1MZEA 2ZIOA 3JSLA 3KCYA 4JI8B 3QTCA 1OCCB 3IJ4A 1OCRC 4JI3O 2ZDIA 1HR0O 4OPAA 2A9HA 4LFAO 5EC2C 2IH1C 1Y6XA 1FAFA 4X1YA 4RQFA 1I5YA 4NB5A 2EIJC 2W0FC 4I5SA 3HKCA 1PD3A 2IJKA 3QO8A 1ROPA 2CAZC 2WLKA 2XTAA 4BAYA 2LGQA 3HPLC 3L71H 3N27A 1SZXA 3BEHA 1A32A 4FFKA 2H8PC 2HFEC 4CS3A 1G4YB 4LH6A 4JI2O 1JJOA 1DGSA 2DQ0A 1I94O 3NXSA 1AR4A 1OV9A 4QPKA 2BTOA 1V55C 4B08A 4LBEC 2R9AA 1S5HC 3ETEA 3TXQA 2CTWA 3CSXA 3HKDA 1YJNV 4QNHB 4H13B 1GAXA 5KA5A 4JI1O 3THOA 4NXMB 1R6KA 1HNXB 3J7AU 1CP9A 1JA8A 2UUBB 4JI8O 3H1IH 3SJCC 1RSOA 2JRIA 2Q68A 4DR4B 4PI2A 4R8CA 3K79A 4TT3G 1XDCA 1KU9A 1TUEB 5EIBC 1AI4A 5FPRA 5GONA 5H2FZ 4DV4B 1NU1H 1K3EA 2JEUA 1JQ0A 1YF2A 3G71V 1K92A 4H37A 5B3SB 1COWG 2AW9A 4JZ2A 2YXHA 2EBOA 1IBLB 5EC1C 3G80A 2R9IA 4I9WA 5KUKA 1N0JA 5GTHZ 3UT5B 4OPHA 3AG4C 4PA7A 2YICA 4JF3A 3ZHRA 2HKOA 3FYEB 5JQGB 4IGGA 1PPJH 3ZBHA 1BS3A 4WBNA 1ZWIC 5EZYB 5KLVH 4HAMA 1R73A 2IU0A 4UCRA 4J42A 1K9MW 3MD0A 1SQGA 3OE7G 3GWOA 3T2MA 2Q0AA 4DW1A 2IW5A 1GTOA 2QEXV 3BHPA 1WA8B 4NXMO 2P5OA 2BSKB 1HNXO 2UUBO 3SPIA 1OZ0A 3AG2C 2L6LA 1PNLA 4DR4O 3G6EV 2ADQB 2Y4TA 1TGOA 1O9HA 5EBLC 3M8AA 1N34B 5K1XA 4EFEA 2W6IG 3SYQA 4PELA 4JASA 5IJ9A 3HKCB 2FB5A 4DV4O 2Q73A 1P4RA 4CH4A 1VF6A 2Q6AA 4BW9A 2A79B 3ETGA 5BY1A 2KB1A 3JD2A 1IBLO 3R65A 3RYIB 3I55V 3ZRXA 1AVMA 5LMNB 4O2BB 2HG5C 1S0VA 1N36B 2YXYA 3LDCA 2EULA 4F6RB 1TVKB 4MTFA 1K5QA 3APOA 5FPOA 1IBKB 5KMGA 2ZR3A 3BCCH 4D7SA 2CH7A 4GKJB 5JCOA 1HDJA 2ZIMA 2F23A 4AILC 5LXTA 5H9CA 4MVSA 3TGUH 4K0KB 3DXRA 2YI8A 3RVZA 4ZHQA 4J9ZB 1YZBA 1XMQB 1FXKA 3ABTA 1RSOB 2QKSA 4KFMA 5LL6Y 1MA1A 2LFSA 4P9OA 4EB6A 3SJAC 1IZ3A 3JALA 3CCLV 1WJZA 3K58A 1N34O 1N8RW 4FM2A 1BT8A 4IYIA 3MHHC 4JAUA 1XOUA 4X64B 2EIJB 1XMOB 4J41A 3I56V 3UO2A 3H1JH 1VQMV 4DR5B 3E2EA 4X1KB 3AK3A 3S3WA 4BW5A 2NLJC 5HFMA 1R3LC 4LF4B 5LMNO 5CBFA 1GMGA 3DSQA 3CC7V 1KP2A 2B9ZA 4WBNB 1N36O 2RQ6A 2QWPB 5LGTA 3SPGA 2X6AA 2WSSG 2JJ2G 3BAAA 2AXTZ 1S5JA 3SGIA 1EN6A 1IBKO 5EYPA 1AROP 5F2VO 4GKJO 3EHBB 4Z2WA 2R72A 3D36C 5LHHA 1NZ6A 2IJHA 1VQKV 4B3MB 2O57A 4K0KO 1DF4A 4GKKB 3CEIA 1HP8A 1XMQO 1S72V 1LUVA 1JPXA 1RPRA 1XUQA 1XREA 4JTAB 4MT8A 4TV9B 3D3QA 4XDKA 2VS0A 3E83A 3PN1A 4CC5A 1BHAA 1JCHA 5B1AB 1VQNV 3LDDA 4X64O 2UXNA 1XMOO 5ITZB 1OCCC 1QNMA 1YEWA 3N2GB 3G4SV 4A5UB 1Q6HA 1SQQH 2ADPA 4DR5O 2H94A 2DN9A 2BCCH 1VF7A 3ABKC 3QNEA 4PA6A 1S3JA 2QSAA 4YIPA 4JPRA 4EKWA 4LF4O 3T1YB 4CH3A 4FLVA 1QVFU 1L0LH 3DC6A 5KAIZ 3IAYA 1ZTEA 2ARHA 2OWOA 1XL4A 5KMGB 1I08A 1AJPA 1R6NA 1UJWB 2CH7B 5CA0A 5KHGA 4FLTA 2P67A 4UV8A 1BGYH 1WPBA 3J80N 1PL4A 3CXCU 4HNAA 1SESA 4PDRA 4DYLA 1AI7A 4PV1B 3K0GA 3DXRB 4B3MO 3CC2V 1FXKB 3Q4HB 4GKKO 3T4DA 3OT7A 2EJRA 1VQ6V 2NNUA 5CA1B 3ZHTA 4YHHB 2EILC 4MVUA 2XHBA 2P90A 1BHBA 3ABLB 5LOVA 1Q43A 3CHXA 3RN4A 1B3QA 2V4DA 2P4KA 1H8HG 3QO5A 4UXNA 1E1QG 1R1BA 4X1IA 1R3JC 2OYQA 1VQ7V 2BE3A 1K5SA 3ASOB 2RDCA 3E86A 4GX2A 4RAIA 2JIZG 2UUCB 1SQVH 4NTXA 4JI7B 1LNQA 1XL6A 2Q67A 4BIZA 5EBWC 4FLZA 3T1YO 2VQEB 1Q6IA 5B3SC 4IIJA 1OJHA 2UXDB 3IGAC 4W4KA 5EYPB 2Y48A 5KA6A 4I50A 1ZUQA 3B8NA 3OTOB 3ETDA 4I4TB 3CCSV 2QA4V 1MSDA 1VQLV 2UXXA 5GW7A 1E1RG 3HB3B 3WB0A 4NYKA 1GM8A 2ZE6A 2ZE5A 2GTSA 2GBOA 4YHHO 3VQYA 1FXHA 1KKCA 4P2ZA 3CCEV 3K59A 4CBCA 2ZDIC 1H2GA 1QVGU 1US6A 2XT9A 5A2QN 3TJTA 2HR3A 2HHHB 2C2AA 3ZRWB 4PDLA 4DK1A 2OIEA 2ZT9B 4XDJA 2N74A 4C7UA 2BTQA 2UUCO 4JI7O 2VQEO 2L35A 3A0BZ 4IT5A 1FPOA 1WPXA 1P7BA 3OEEG 3HKBA 2UXDO 1GN2A 1SA0A 2JDIG 2QM7A 1VQOV 1MMMA 5CA0B 4B3TB 4DV0B 3OM3B 4K3AA 2YC0A 2JVDA 2XAFA 4HNAB 1I0HA 4UCSA 4WCEV 3B4SA 4K35A 1BMFG 4Z1VA 3OTOO 1FFXB 4LF6B 4H0LB 5E1AC 3UO3A 2PYJA 5CA3A 1M90W 3OTFA 3L75H 1JX9A 2H3OA 2WLIB 5LOVB 5JJJB 5DN6G 5L3EA 5L3CA 3ZMZA 4I0XA 1VEWA 3JATB 4P30A 4DR3B 1FJGB 3E35A 3LNMB 4QE9A 2HHHO 2QKCA 3W7WA 3CRMA 2PGGA 1K4DC 4ZOLB 3K5LA 1B06A 2YUAA 3ABKB 1YJWV 4FLYA 4U3JB 3RFRA 4IIJB 1NBMG 1VF5B 2BOCC 1Y66A 3ZIAG 1W0KG 3ZMTA 4X20A 1IVSA 4FZ0A 4LF9B 1G6UA 3JD0A 2QTSA 3SR2C 1TAEA 3RWRD 2ZM6B 5LGNA 4B3TO 4DV0O 4UVAA 1QHTA 3A0RA 1YTFB 3M7MX 2EZOA 5L3GA 4IYHA 2WPDG 3A8TA 3P3PA 4WFFA 5BMVA 4R7CA 3FB7C 4LF6O 2DQ3A 3ETQA 1AJQA 3FB8C 3RYHA 1HWYA 2WLLB 3U11A 3ZJZA 4OGQB 1RM1B 3DC5A 4J7ZA 2KG7B 2IM9A 2F93B 1Q3EA 4CZZA 3AK1A 4O4LA 2EILB 3L72H 1NVPD 3KKYA 1Q82W 4DR7B 1XNRB 4O4IB 2WLMA 2XASA 5BR8B 4DR3O 4LFBB 4DV7O 1FJGO 4J10A 4CS4A 5A9GA 2OTLV 3OUFA 1Y4MA 2CK3G 4GT1A 5B1AC 1B6QA 1SF9A 4NKGB 1VF6C 2EIKB 5FLXN 1N33B 2P7TC 2QJ1A 3QF7A 4J80A 1SA0B 1YDXA 4J7JA 3E8HA 3UCSC 4HYOA 1R3KC 1MNGA 4FM0A 1I7FA 2GSMB 4D6TH 3RYFA 1VQ9V 4TQFA 4LF9O 4B7KA 3DGEA 5EIBD 1NI8A 3FKSG 1ENVA 2ZM6O 3TK1A 2HLDG 4GX1A 4MS2A 3ZHSA 2B1IA 4JYYA 5H5NA 3GVMA 4FJCC 3BRCA 3F7VC 2DMXA 5BZBA 2E3CA 4LH7A 5JCOC 4YJ2A 4QPJA 1NTZH 4LWSB 4GYCB 3CRCA 1M4UA 4DR1B 1XNQB 4LF8B 2YS8A 4TSFG 3P32A 1XEQA 1YIJV 1NTKH 5J2UB 3HKEA 4B3SB 3STLC 1IBMB 1FXKC 3MHSC 4DR7O 4I0XB 1XNRO 2ZCEA 4JYAB 3JAMN 5CB4A 5BR8O 4LFBO 5IYDO 2Y4UA 2QWQB 1P84F 5CMUA 3ZHQA 1AP6A 4X1YB 5H6QA 3ABLC 3SYCA 3B09A 2DWDC 3U0ZA 1H38A 1GN4A 5JH7A 2G38A 1I5XA 1Y76A 4TQDA 1DK1A 1N33O 2X0LA 1F51A 2EIMC 2B1GA 3E8BA 3WFVA 3ASOC 2BOBC 4DV5B 3FD9A 4LNUA 4I55A 3CCRV 2A3QA 3E8FA 2CTQA 2ITDC 2WA4A 4TWKA 2AHZA 1R6TA 2IJIA 2A06H 4QIWF 3ZCCA 4E4EA 4NTYA 1KKDA 5C93A 3CRQA 2CTPA 4FLUA 3CCUV 1ZLZA 3JAKA 3VQVA 1GO3F 2PI5A 4WFEA 1YI2V 1EBOA 1K33A 1FKAO 3HKDB 4DR1O 5KHJA 1XNQO 4LF8O 4N21A 2LJ2A 4B3SO 2F66C 1IBMO 2PYLA 1QQCA 2ZNIA 2F43G 3IC7A 4JYAO 1JFFA 2YIBD 2Y69B 3WG7C 3B40A 4DV1B 2QM8A 1EN5A 5GONB 3RYCA 1ZAUA 3CD6V
chains in the Genus database with same CATH topology
4MTOA 1FXKB 4UVCA 2DYSC 3RBZA 1OCZC 5J9PC 1YJ9V 3T4DA 3T4ZA 1KECA 4U7NA 1CEZA 4X88A 3AG1C 2EJRA 1MSWD 5L3DA 3M99B 4U7OA 2JEXA 1VQ6V 2NNUA 4RUFA 2EILC 4JYBA 4JTDB 3AG3C 1DLBA 4MVUA 3K03A 1VQ8V 3UM7A 1PL0A 2P90A 1BHBA 3ABLB 1NR7A 4F4LA 2X6CA 2K1EA 1EZJA 4WFAV 4FPPA 3K9AA 1AI5A 4E2LA 1H8HG 3QO5A 2DYRB 2GHYA 4UXNA 2XAJA 1E1QG 4XBFA 2WWWA 1KC8W 4ZBMA 4JYCA 3ABMB 1R3JC 2DW4A 2Q69A 3PJSK 1VQ7V 1K5SA 3ASOB 3E86A 4GX2A 4RAIA 2JIZG 2D3OW 1V54C 2EINB 1LNQA 3F7YC 2ZQMA 1XL6A 2Q67A 3B8MA 3LUTB 1W0JG 5EBWC 3VOUA 4BIZA 4FK5C 5B3SC 2IJJA 4MVZA 4P9PA 3RVYA 3ZRSA 1OCCB 1OCRC 3IGAC 2ZDIA 4DXWA 2A9HA 5IYCO 5EC2C 1M56B 2IH1C 3ASNB 2ATKC 4RQFA 1I5YA 2EIJC 1NQTA 2V1DA 2W0FC 3KG2A 4I5SA 4RQEA 1PD3A 2OT5A 2ZD9A 2IJKA 3QO8A 5FL7G 2Y48A 5B1BB 5B1NA 5KA6A 5IYBO 1ROPA 4UV9A 3TETA 3OMNB 2WLKA 4H33A 1M57B 3B8NA 2M7WA 1JVMA 2OCCB 4BAYA 3ETDA 3CCSV 2QA4V 3HPLC 2ZXWB 1KQSU 3BEHA 1SETA 4N23A 5LHGA 1Q81W 1VQLV 2P6JA 2UXXA 2H8PC 2HFEC 1IXMA 4KUMA 3X2QC 1G4YB 5GW7A 1E1RG 4GCZA 3HB3B 1W2BU 1NKDA 3E8GA 2DQ0A 2WLHA 1K8AW 3H01A 3CMAV 1GM8A 3NXSA 3D3IA 4RO2A 1F4MA 1QCEA 4QPKA 5DM6V 1GK9A 3LSSA 1FXHA 1QLEC 1V55C 4P2ZA 4MVOA 4LBEC 2Z3YA 3CCEV 1MABG 2DWEC 2WAMA 1S5HC 3ETEA 3JD3A 2ZDIC 1H2GA 2DYSB 3ZN1A 4CBCA 1QVGU 1OCZB 2HR3A 2C2AA 3CD6V 3ZRWB 3FB6C 1YJNV 4QNHB 4MW3A 4HZ3A 5KA5A 2IU3A 4PDLA 4BIUA 4XDJA 4ASUG 2B5UA 3IFXA 2V7QG 4PA9A 1R6KA 4KP4A 1M9NA 1CP9A 3K3WA 4FMTA 5L3FA 1WPXA 1AR1B 1P7BA 3CYOA 3OEEG 2Q68A 4R8CA 3K79A 2XNDG 3AEIA 4TT3G 1VQPV 2YEVA 1J95A 2JDIG 2QM7A 3ZN0A 1TUEB 3CCMV 1AI4A 1VQOV 5CBHA 1F23A 1PNKA 1K3EA 3OM3B 2JEUA 1NH2B 1RM1C 1JQ0A 2XAFA 1R3IC 3G71V 1MOFA 1K92A 4H37A 5B3SB 1COWG 4WCEV 1BMFG 2EBOA 3TCUA 1OCRB 5EC1C 2R9IA 2AHYA 4I9WA 5KUKA 2WLNA 1NR1A 5E1AC 1GM9A 3AG4C 3T1CA 5CA3A 4UVBA 4PA7A 4JF3A 1THZA 3CMEV 2HKOA 1M90W 3FYEB 2EIMB 1K4CC 4LC1A 1JX9A 1ZWIC 4MTGA 1RPOA 5IY5C 1QR9A 3GB7C 2EIKC 1R73A 3ABUA 4HAMA 2WLIB 2IU0A 3LSQA 3JD1A 5DN6G 3OMAB 1K9MW 3MD0A 5L3EA 3W7XA 3OE7G 1OCOC 5L3CA 3ZMZA 3GWOA 3OR6C 3T2MA 4P30A 4LP8A 3X2QB 3LDEA 2IW5A 3E35A 3LNMB 4QE9A 1GTOA 4X8AA 3OW2U 3W7WA 2JK5C 4JAVA 4PA4A 1K4DC 2QEXV 4ZKIA 1JJ2U 4LCUC 3SYAA 2HJFC 3ABKB 1YJWV 1VQ5V 1H8EG 2ITCC 1NVPB 3SPIA 1OZ0A 1V55B 3AG2C 1NBMG 1DF5A 2BOCC 1PNLA 1Y66A 3ZIAG 1E79G 1SZTA 3G6EV 1W0KG 3ZMTA 5EBLC 4Q20A 4PDVA 4JGSA 3JD0A 3W7TA 4GX5A 1KD1W 2W6IG 3SYQA 3P30A 4PELA 4JASA 5LGNA 1FXVA 4UVAA 3A0RA 1OHHG 3JYCA 1P4RA 4G2KA 1YTFB 2Q6AA 2EZOA 3SPHA 5CBGA 5L3GA 3WG7B 2WPDG 4WFFA 3ABMC 2A79B 3ETGA 1F4NA 3ZMSA 2KB1A 3JD2A 3CP1A 4R7CA 3R65A 3I55V 3FB7C 3ZRXA 2DQ3A 1VQ4V 1FFTB 3K0DA 1AJQA 3FB8C 3DTUB 2HG5C 1S0VA 1HWYA 2WLLB 3ZJZA 4L87A 3LDCA 1RM1B 3FYIB 3AG1B 4MTFA 1K5QA 3VBBA 4XDLA 3ZRWA 3CCJV 1YSCA 4WFGA 4CZZA 3W7UA 4MTXA 2EILB 1NVPD 3AG3B 1Q82W 1PNMA 3QO7A 2ZR3A 3OMIB 4RUEA 3CCVV 1L1FA 4G28B 2WLMA 2XASA 2HVJC 3AG4B 4MSWC 1Q7YW 4J9YB 3STZC 4G27B 3CPWU 3CCQV 1NJIW 5H9CA 2OTLV 4MVSA 3OUFA 1FS0G 1Y4MA 1M1KW 2CK3G 4GT1A 5B1AC 1B6QA 3SYPA 2EIKB 3RVZA 1V54B 4FIPC 4J9ZB 5B1OA 1YTFD 5L3BA 2YSUB 1FXKA 3ABTA 2QKSA 4KFMA 2Z5UA 2P7TC 5LHIA 2LFSA 4P9OA 3E8HA 4HYOA 1R3KC 2YEVB 3E89A 3OFNG 1JOYA 3CCLV 2GSMB 5CN0A 1Q86W 1VQ9V 3UKMA 2XOKG 1EFRG 1N8RW 5H6RA 2W6JG 3DGEA 3D36A 3MHHC 3FKSG 1ENVA 3BY6A 2XAGA 4JAUA 3TK1A 5LBQA 2HLDG 1PKXA 3ZMUA 4GX1A 2ZR2A 2EIJB 1K97A 4MS2A 4MW8A 3AG2B 3I56V 1AI6A 2XAHA 1K7DA 1K34A 2B1IA 4JTCB 1VQMV 3E2EA 3OUSA 4FJCC 1DTOA 1G8MA 3F7VC 5BZBA 1K73W 3JCZA 4MVRA 4BW5A 3F5WC 2NLJC 5HFMA 2WLIA 1R3LC 4QPJA 5CBFA 1GMGA 2Y69C 1MG1A 1KP2A 1QR8A 3CC7V 3EFFK 5LGTA 3SPGA 4TSFG 5IDJA 3ZRVA 2X6AA 3P32A 1YIJV 2WSSG 4UUJC 2JJ2G 4X89A 3STLC 3OAAG 4PA3A 1FXKC 2HVKC 4DO2A 3MHSC 3W7SA 3JD4A 1NH2D 2OTJV 1QLEB 4MVQA 4QE7A 1S77D 1AROP 3K04A 4MVMA 3EHBB 1KP3A 5IYDO 1GM7A 5LHHA 2LFRA 2PI4A 5CMUA 3CC4V 1SERA 5H6QA 3ABLC 3SYCA 2FTKA 2IJHA 1VQKV 2DWDC 1H38A 1DF4A 1GKFA 3RW0A 1S76D 1I5XA 1S72V 2DYRC 2X0LA 1F51A 1JPXA 2EIMC 5KUMA 2B1GA 1RPRA 4YXWG 3E8BA 3WFVA 3ASOC 2BOBC 4JTAB 4MT8A 4XDKA 3E83A 2EINC 3CCRV 1BHAA 1JCHA 2LP7A 1WLEA 2XAQA 3E8FA 5EBMC 2ITDC 5LGUA 5B1AB 4TWKA 1YITV 2AHZA 1VQNV 2IJIA 3LDDA 4R50A 5EK0A 2UXNA 4QJFB 3K06A 4QIWF 3ZCCA 1OCCC 2X6BA 3OR7C 3SPJA 5HFLA 3ZMVA 3G4SV 1KKDA 2MK3A 2R9RB 1M56C 2WLLA 5C93A 4PDMA 3ASNC 2H94A 2X7RB 3SPCA 3CCUV 3ABKC 3QNEA 4WFBV 1GO3F 1QLNA 2PI5A 4PA6A 1S3JA 4WFEA 4JPRA 3SJQC 4EKWA 4WF9V 5B1BC 1YI2V 1EBOA 1K33A 3OGCC 3ML0A 4GX0A 3B77A 1QVFU 1M57C 1ORQC 2OCCC 3SYOA 4N21A 2A0LA 2ZXWC 5IY5B 1XL4A 2EZPA 1AJPA 1CPYA 4R6ZA 2QTOA 1R6NA 1UJWB 3OEHG 1BL8A 2F43G 3IC7A 2WLJA 4WFHA 2IH3C 1YHQV 1OCOB 2P67A 1SRYA 4UV8A 2Y69B 1QBZA 3WG7C 4OXSA 3CXCU 1SESA 3FB5C 4PDRA 2QM8A 1AJNA 1AI7A 3K0GA 4Z1MG 2QE7G 2JJ1G 3K08A 3CC2V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTO A;  4QNH B;  2DYS C;  4MW3 A;  4UUJ C;  4X89 A;  3JYC A;  4HZ3 A;  3RBZ A;  1OCZ C;  4PDL A;  5J9P C;  4XDJ A;  3T4Z A;  3T4D A;  3IFX A;  2Q6A A;  3STL C;  4PA3 A;  3AG1 C;  2HVK C;  4PA9 A;  4X88 A;  3SPH A;  5CBG A;  4WFF A;  3ABM C;  2A79 B;  4MVQ A;  4QE7 A;  2KB1 A;  3K04 A;  2EIL C;  4R7C A;  4JTD B;  4MVM A;  4RUF A;  1P7B A;  3FB6 C;  3R65 A;  3AG3 C;  4MVU A;  3K03 A;  3UM7 A;  3FB7 C;  2Q68 A;  4R8C A;  4F4L A;  2YEV A;  2X6C A;  1J95 A;  3K0D A;  2K1E A;  3FB8 C;  2HG5 C;  3ABL C;  3SYC A;  2WLL B;  3ZJZ A;  5CBH A;  3LDC A;  2DWD C;  4MTF A;  3RW0 A;  4ZBM A;  4XDL A;  1R3J C;  2DYR C;  2Q69 A;  3PJS K;  4WFG A;  3E86 A;  4GX2 A;  1R3I C;  4RAI A;  2EIM C;  4H37 A;  5KUM A;  1V54 C;  3E8B A;  4RUE A;  1LNQ A;  3F7Y C;  3LUT B;  1XL6 A;  2Q67 A;  5EBW C;  3VOU A;  3ASO C;  2BOB C;  4JTA B;  3TCU A;  5B3S C;  4MVZ A;  4G28 B;  4P9P A;  5EC1 C;  4XDK A;  2WLM A;  3RVY A;  2AHY A;  2EIN C;  3E83 A;  4I9W A;  5KUK A;  2HVJ C;  4MSW C;  2WLN A;  3ZRS A;  4J9Y B;  3STZ C;  1OCR C;  3E8F A;  3IGA C;  5EBM C;  2ITD C;  5E1A C;  4G27 B;  4TWK A;  4DXW A;  2AHZ A;  4R50 A;  2A9H A;  3LDD A;  5EK0 A;  3AG4 C;  5EC2 C;  2IH1 C;  3K06 A;  4MVS A;  3OUF A;  4PA7 A;  3T1C A;  1OCC C;  2X6B A;  3OR7 C;  3SPJ A;  2ATK C;  5B1A C;  1KKD A;  3SYP A;  2R9R B;  1K4C C;  3RVZ A;  1M56 C;  2WLL A;  2EIJ C;  1ZWI C;  4J9Z B;  2W0F C;  3KG2 A;  4PDM A;  3ASN C;  4MTG A;  3SPC A;  5IY5 C;  2ZD9 A;  2QKS A;  3ABK C;  4KFM A;  2P7T C;  3GB7 C;  2EIK C;  2WLI B;  4P9O A;  3E8H A;  4HYO A;  4PA6 A;  1R3K C;  3E89 A;  4WFE A;  3TET A;  3SJQ C;  2WLK A;  4H33 A;  4EKW A;  5B1B C;  1OCO C;  1JVM A;  3UKM A;  3OR6 C;  3OGC C;  3T2M A;  4P30 A;  3HPL C;  4LP8 A;  4GX0 A;  3LDE A;  1M57 C;  1ORQ C;  3BEH A;  3LNM B;  4QE9 A;  2OCC C;  4X8A A;  3SYO A;  2JK5 C;  2A0L A;  4PA4 A;  1K4D C;  2H8P C;  2HFE C;  2ZXW C;  4GX1 A;  3X2Q C;  1G4Y B;  4MS2 A;  4MW8 A;  4LCU C;  1XL4 A;  3SYA A;  2HJF C;  4R6Z A;  3E8G A;  4JTC B;  2QTO A;  2WLH A;  2ITC C;  1BL8 A;  3AG2 C;  3SPI A;  3OUS A;  4RO2 A;  2WLJ A;  3F7V C;  2IH3 C;  4WFH A;  5BZB A;  2BOC C;  4MVR A;  3WG7 C;  4OXS A;  4BW5 A;  1QLE C;  1V55 C;  2NLJ C;  3F5W C;  4MVO A;  4P2Z A;  4LBE C;  2WLI A;  1R3L C;  3FB5 C;  5EBL C;  4PDR A;  5CBF A;  2DWE C;  2Y69 C;  4PDV A;  3K0G A;  1S5H C;  4CBC A;  3EFF K;  4GX5 A;  3SYQ A;  3K08 A;  3SPG A;  2X6A A; 
#chains in the Genus database with same CATH topology
 4JV5 B;  3RBZ A;  3K57 A;  2LO1 A;  4U7N A;  1CEZ A;  3AG1 C;  3EVK A;  1MSW D;  4Q6G A;  2M6Y A;  2GV9 A;  1GN6 A;  2JEX A;  2AZ0 A;  4FFB A;  3FAV A;  4DV5 O;  4RUF A;  5LP6 A;  1D5A A;  4IHJ A;  1ZSP A;  1VQ8 V;  2N05 A;  1D2D A;  5E79 Z;  4NVP A;  4WFA V;  4FPP A;  3K9A A;  3EXA A;  3KCX A;  2DJV A;  2PUS A;  2WA3 A;  1KC8 W;  2QWO B;  5DEC A;  2Q69 A;  3PJS K;  2IBZ H;  4I9Q A;  2K9P A;  1ZL8 A;  2DOS A;  2QGN A;  2EIN B;  3L73 H;  2ZQM A;  3LUT B;  3AG7 A;  3B8M A;  5JJN B;  3VOU A;  4P9P A;  1AIL A;  2GTA A;  3CS5 A;  3E22 A;  1BE3 H;  5IYC O;  1M56 B;  2RN9 A;  3ASN B;  1WNS A;  1BSM A;  2V1D A;  3BFR A;  3KG2 A;  4H44 B;  1SQX H;  4RQE A;  2OT5 A;  2ZD9 A;  4FVM A;  3L74 H;  4DV2 B;  4DV1 O;  4ZIB A;  4H33 A;  1M57 B;  2YIB A;  2M7W A;  1JVM A;  4LR3 A;  5IJ9 B;  1SS3 A;  4DR6 B;  2E75 B;  4JV5 O;  3JAW A;  2P6J A;  4BR6 A;  4GCZ A;  1NKD A;  3CRR A;  3E8G A;  2WLH A;  4O4J A;  4CS2 A;  1H2N A;  3CMA V;  2RMK B;  3D3I A;  4LNU B;  4I55 B;  1H2L A;  1T5E A;  4O4H A;  2HEP A;  3LSS A;  1QLE C;  1SC5 B;  1HNW B;  4CH6 A;  1MAB G;  2PF4 E;  2DWE C;  3ZN1 A;  2DYS B;  1Q6U A;  3K5O A;  4MW3 A;  4HZ3 A;  4BIU A;  5KX5 A;  4ASU G;  4AI8 A;  2ZKO A;  2V7Q G;  3LNN A;  1G1X B;  3B2E E;  3K3W A;  1XQ8 A;  4FMT A;  3N2K A;  2AGA A;  4I7Z B;  4NTW A;  1AR1 B;  3CYO A;  5LXT B;  1J5E B;  3AEI A;  3JAS A;  2Q7H A;  2E74 B;  4ZHQ B;  5IYZ A;  1F23 A;  3MDS A;  4UFZ A;  1EZV H;  3C3T A;  4LF5 B;  1JFF B;  5IE9 A;  4EB6 B;  1RM1 C;  1MOF A;  2CGO A;  3JAL B;  4DV2 O;  4ICG A;  3TCU A;  4FM1 A;  3ZED A;  4DK0 A;  3BA8 A;  2E76 B;  2A7W A;  4DR6 O;  1XHX A;  3U10 A;  1NR1 A;  3CXH F;  2JS3 A;  1URF A;  2Q9L A;  4UVB A;  2EX3 A;  4UB6 Z;  4FFB B;  2EIM B;  2UXB B;  2D2C B;  5LP6 B;  4MTG A;  1RPO A;  1QR9 A;  4HBN A;  2EIK C;  3LSQ A;  3JD1 A;  1N4C A;  3OMA B;  3JAR A;  4LFC B;  3W7X A;  1HNW O;  1OCO C;  3OR6 C;  2HP8 A;  3QVN A;  3CJH A;  4DW0 A;  3X2Q B;  2JK5 C;  4JAV A;  4PA4 A;  2CTR A;  1ZL8 B;  1JJ2 U;  4LCU C;  3SYA A;  1VQ5 V;  2QWR B;  4UCT A;  2UXC B;  2LGW A;  1V9P A;  1SZT A;  1J5E O;  3H1L H;  3E22 B;  4PDV A;  2Y0I A;  4JGS A;  3ZHU A;  3W7T A;  4GX5 A;  1KD1 W;  3P30 A;  2KQX A;  4D7T A;  1FXV A;  1VMG A;  2XUM A;  1OHH G;  1MZF A;  3JYC A;  4LF5 O;  4NR1 A;  5CBG A;  3WG7 B;  3ABM C;  3ZMS A;  2QDO A;  5LMU B;  4O2A A;  1RP3 B;  1VQ4 V;  1UPG A;  3WU2 Z;  4JI4 B;  4EFB A;  1Q90 D;  1U96 A;  3DTU B;  1F7Y A;  4O4J B;  5DED A;  3FYI B;  3AG1 B;  2UXB O;  3VQW A;  4XDL A;  1YSC A;  4WFG A;  4MTX A;  2UU9 B;  1PNM A;  3QO7 A;  4RUE A;  3OMI B;  4DR2 B;  4LFC O;  1GN3 A;  3D8C A;  1L1F A;  2YDE A;  4G28 B;  2HVJ C;  4J9Y B;  3STZ C;  5C8Y A;  4JAA A;  5KX5 B;  3CCQ V;  1NJI W;  2OCH A;  1FS0 G;  3SYP A;  3J81 N;  4FIP C;  1O9G A;  1YCI A;  2P06 A;  2YIA A;  5B1O A;  2YSU B;  2UXC O;  4DUY B;  2Z5U A;  3P3N A;  5LHI A;  4DUZ B;  3E89 A;  3OFN G;  4CH5 A;  5H6R A;  1WB7 A;  2XAG A;  1Q5O A;  1K97 A;  3UT5 A;  3JSN A;  2XAH A;  1K7D A;  4YY3 B;  3C3S A;  1SQB H;  5JQG A;  1DTO A;  1G8M A;  1NT2 B;  5LMU O;  3O9O A;  4JI4 O;  2Y69 C;  4DV7 B;  1NTM H;  3EFF K;  4X1I B;  1SQP H;  5IDJ A;  3ZRV A;  2VRZ A;  4UUJ C;  1N0N A;  4X89 A;  2KKW A;  1M93 A;  4PA3 A;  3JAR B;  2UU9 O;  5B5E Z;  1WA8 A;  4DR2 O;  1NH2 D;  3JD4 A;  1TA8 A;  1QLE B;  4QE7 A;  1S77 D;  3CJH B;  2P4V A;  2FKX A;  1KP3 A;  1GM7 A;  5KHI A;  1KMI Z;  1WP7 A;  3H1K H;  1JMK C;  4KHP B;  1GKF A;  4OX9 B;  4BIO A;  4DUY O;  4I50 B;  4DUZ O;  1SQF A;  5KUM A;  2Q0O C;  1B04 A;  3IC9 A;  4YXW G;  2EIN C;  3RYI A;  5LGU A;  1WAZ A;  2RJZ A;  5KHH A;  5EK0 A;  3K06 A;  3JCU Z;  4O2B A;  3OR7 C;  3SPJ A;  4BWA A;  3ZMV A;  4YY3 O;  2MK3 A;  2R9R B;  1M56 C;  1Y67 A;  4F6R A;  3ASN C;  3SPC A;  1TVK A;  1KYO F;  2X7R B;  4O2A B;  5IJ0 A;  4GLX A;  2Q5Z A;  4UCU A;  1JR9 A;  3SJQ C;  4WF9 V;  3ZHV A;  3T1H B;  3ML0 A;  4GX0 A;  1M57 C;  1ORQ C;  2OIG A;  1TUB A;  3KZI Z;  4LF7 B;  2JS5 A;  3RGB A;  1XHZ A;  2E5L B;  2BTQ B;  2EZP A;  2VWK A;  1CPY A;  4NXN B;  2QTO A;  3OEH G;  1BL8 A;  3HKB B;  4WFH A;  1YHQ V;  2F4V B;  1OCO B;  1SRY A;  2YID A;  1QBZ A;  2PTM A;  5C8Y B;  4OXS A;  2QKA A;  3CE2 A;  4JI0 B;  4KXR A;  1AJN A;  4J11 A;  2Q8V A;  1AP5 A;  5FNV A;  4KHP O;  4KL1 A;  2FL4 A;  4MTO A;  4UVC A;  4ABM A;  1D5N A;  2DYS C;  4OX9 O;  3CX5 F;  3T4Z A;  2GUZ A;  3ZS8 C;  5L3D A;  1EN4 A;  3M99 B;  1HNZ B;  3WB1 A;  5J2T A;  4JYB A;  4JTD B;  3AG3 C;  1DLB A;  4PJ0 Z;  4UCV A;  4X1K A;  2X6C A;  2K1E A;  1N32 B;  4YJ3 A;  2ZNJ A;  2DYR B;  2GHY A;  4ZI7 A;  4XBF A;  1KUQ A;  1GRJ A;  4ZBM A;  4JYC A;  3ABM B;  2DW4 A;  4X62 B;  2D3O W;  1V54 C;  1FYJ A;  3F7Y C;  1W0J G;  4FK5 C;  2IJJ A;  4MVZ A;  4K8X A;  3RVY A;  2AZ2 A;  3T1H O;  3ZRS A;  2GDS A;  4DXW A;  4LF7 O;  1Z2G A;  2E5L O;  2ATK C;  4NXN O;  1P7G A;  1NQT A;  3WB2 A;  5FL7 G;  5B1N A;  2F4V O;  5B1B B;  5IYB O;  4F6E A;  2Z0A A;  4X20 B;  5LP6 C;  4UV9 A;  3TET A;  3OMN B;  4JI0 O;  4DV6 B;  2Y0P A;  3H9V A;  2OCC B;  3L70 H;  3ICX A;  1BCC H;  4TV9 A;  2ZXW B;  1KQS U;  3MAQ A;  2MW2 B;  1SET A;  4N23 A;  5LHG A;  1Q81 W;  1Y74 A;  3C90 A;  1IXM A;  4KUM A;  3X2Q C;  1W2B U;  3G6B A;  5BMV B;  1HNZ O;  5ITZ A;  3N2G A;  3H01 A;  3HR0 A;  1LUW A;  4X66 B;  1K8A W;  4RO2 A;  4GZR B;  1WP8 A;  1F4M A;  1QCE A;  5DM6 V;  1GK9 A;  2Q7E A;  4MVO A;  2Z3Y A;  3RYH B;  1YXB A;  2WAM A;  3JD3 A;  1N32 O;  1OCZ B;  1H2M A;  3FB6 C;  4O4L B;  1Z5W A;  1PM9 A;  1GH6 A;  2IU3 A;  5IJ0 B;  2B5U A;  3IFX A;  4X62 O;  5KHK A;  3APQ A;  4PA9 A;  4KP4 A;  1M9N A;  5JJE B;  3TXS A;  5L3F A;  3RT3 C;  5D5Q A;  2PZS A;  1TUB B;  1NS1 A;  2XND G;  1VQP V;  2YEV A;  4UCO A;  1J95 A;  1X59 A;  1YVW A;  4X9Q A;  3ZN0 A;  3CCM V;  2LW7 A;  5CBH A;  4TV8 A;  1PNK A;  4GUN A;  4FLX A;  2YI9 A;  1QU7 A;  1NH2 B;  3Q4H A;  1R3I C;  2FYU H;  2LW1 A;  1VAR A;  3RYF B;  1EM1 A;  4DV6 O;  1OCR B;  1PP9 H;  1VIB A;  3CB2 A;  1VP7 A;  1IXB A;  5TIS Z;  5FNV B;  2AHY A;  3ZX6 A;  5CA1 A;  1L0N H;  2WLN A;  1AB3 A;  1U97 A;  2W0X A;  4IL6 Z;  2GUZ B;  1GM9 A;  3T1C A;  2R70 A;  3CME V;  1THZ A;  2PY5 A;  1K4C C;  1LR1 A;  4LC1 A;  5AG2 A;  5J2T B;  4X66 O;  5IY5 C;  1IUR A;  3GB7 C;  3ABU A;  4YJ2 B;  1XIL A;  4FZ1 A;  4FLW A;  4YJ3 B;  2QR4 A;  1AR5 A;  2JGU A;  4LP8 A;  4ZI7 B;  3LDE A;  4X8A A;  1L8D A;  3HKE B;  3OW2 U;  4B3R B;  4ZKI A;  5D5P A;  2HJF C;  2ZIN A;  1H8E G;  1BQZ A;  2ITC C;  5CB4 B;  1NVP B;  1V55 B;  1DF5 A;  1ZX3 A;  4X65 B;  1E79 G;  1KBH A;  2YXL A;  4Q20 A;  3I5D A;  4QGP A;  5JH7 B;  2FML A;  4I4T A;  1Y76 B;  2ZE7 A;  1W59 A;  1BQ0 A;  4G2K A;  4YIO A;  3SPH A;  4AQY B;  4DV3 B;  1F4N A;  2Q4P A;  3CP1 A;  3H1H H;  2Q7G A;  2CDY A;  4DRX A;  1FD9 A;  1Y74 B;  5LA6 A;  2VWJ A;  1FFT B;  5JWP A;  3K0D A;  3BVO A;  3O65 A;  3G67 A;  4L87 A;  3JAK B;  2NR5 A;  3VBB A;  4EEQ A;  3ZRW A;  3CCJ V;  3W7U A;  3R66 A;  3AG3 B;  3BPZ A;  3NR7 A;  5LYJ A;  2UUA B;  5IWA B;  3CCV V;  3BA9 A;  3AG4 B;  4MSW C;  1BZK A;  1Q7Y W;  4G27 B;  3CPW U;  4B3R O;  3SDL A;  3K5N A;  1M1K W;  3OD4 A;  4UB8 Z;  5K1P A;  1V54 B;  3A2F A;  1YTF D;  5L3B A;  2QWN B;  4K8Z A;  1CXZ B;  1M5I A;  5GTI Z;  2JGD A;  2YEV B;  4X65 O;  1JOY A;  4PHZ A;  1KB9 F;  5CN0 A;  1Q86 W;  3UKM A;  2XOK G;  3A0H Z;  3VQX A;  1EFR G;  3RYC B;  2CE4 A;  2KSD A;  2W6J G;  4TV8 B;  3D36 A;  5JVD A;  3CWB H;  3BY6 A;  1FFX A;  5LBQ A;  2ODM A;  1PKX A;  3ZMU A;  1S5L Z;  2ZR2 A;  1Q8I A;  4MW8 A;  3AG2 B;  1AI6 A;  1K34 A;  3FAV B;  4AQY O;  4JTC B;  4DV3 O;  3L9D A;  4IHJ B;  3OUS A;  3SJB C;  2ILM A;  1K73 W;  3JCZ A;  3GWK C;  4MVR A;  1SKV A;  1IX9 A;  3F5W C;  2WLI A;  5KAF Z;  1MG1 A;  1QR8 A;  4TUY A;  3F5T A;  3OGI B;  3JAT A;  3LSU A;  4TOI A;  2LQT A;  3QG5 A;  1UFI A;  4W4L A;  3OAA G;  4DO2 A;  2HVK C;  1PV0 A;  4ZOL A;  2NN4 A;  3W7S A;  2OTJ V;  2UUA O;  4MVQ A;  5IWA O;  3K04 A;  4U3J A;  4MVM A;  2CGN A;  2LFR A;  2PI4 A;  3CC4 V;  1SER A;  2CUG A;  2F1M A;  2FTK A;  4J7K A;  2ETN A;  1XBL A;  4JI5 B;  3RW0 A;  1S76 D;  2DYR C;  4JZG A;  2F95 B;  5B66 Z;  3JAW B;  2HJD A;  4L8J A;  2VQF B;  1P49 A;  2LP7 A;  1WLE A;  2XAQ A;  1YIT V;  5EBM C;  4R50 A;  3CRA A;  4QJF B;  1WB8 A;  2X6B A;  1H2S B;  1HW7 A;  5HFL A;  2WLL A;  4O4H B;  4PDM A;  2KG7 A;  4JI6 B;  4DRX B;  4WFB V;  1QLN A;  5LA6 B;  2DE0 X;  5B1B C;  3OGC C;  2RCV A;  3B77 A;  4O4I A;  4JI3 B;  2OCC C;  3SYO A;  1HR0 B;  4CC6 A;  2A0L A;  4LFA B;  2ZXW C;  5IY5 B;  3S3X A;  2RNB A;  5LYJ B;  3N2K B;  4R6Z A;  3K5M A;  1Z5V A;  4PD4 F;  4RWU A;  2WLJ A;  2IH3 C;  2N04 A;  1RFY A;  3JAS B;  3FB5 C;  3K9S A;  2P22 C;  4AHC A;  4Z1M G;  5IYZ B;  2QE7 G;  2JJ1 G;  2ZE8 A;  1WN7 A;  3K08 A;  4PI0 A;  1XI1 A;  4JI5 O;  1OCZ C;  5J9P C;  1YJ9 V;  1KEC A;  2JGD B;  4JI2 B;  4X88 A;  4U7O A;  1I94 B;  5BXZ A;  3FFQ A;  1X4T A;  5JVD B;  5EZY A;  3K03 A;  3UM7 A;  5IT9 N;  1PL0 A;  2VQF O;  1NR7 A;  4F4L A;  3UQ8 A;  1EZJ A;  1IDS A;  1AI5 A;  1H2K A;  4LWS A;  4E2L A;  2EJ7 A;  3AK2 A;  3BAB A;  4U3F H;  2XAJ A;  2WWW A;  4B7E A;  2QM4 A;  4JI1 B;  4JI6 O;  5J2U A;  2BSK A;  3FX7 A;  4TUY B;  1MZE A;  2ZIO A;  3JSL A;  3KCY A;  4JI8 B;  3QTC A;  1OCC B;  3IJ4 A;  1OCR C;  4JI3 O;  2ZDI A;  1HR0 O;  4OPA A;  2A9H A;  4LFA O;  5EC2 C;  2IH1 C;  1Y6X A;  1FAF A;  4X1Y A;  4RQF A;  1I5Y A;  4NB5 A;  2EIJ C;  2W0F C;  4I5S A;  3HKC A;  1PD3 A;  2IJK A;  3QO8 A;  1ROP A;  2CAZ C;  2WLK A;  2XTA A;  4BAY A;  2LGQ A;  3HPL C;  3L71 H;  3N27 A;  1SZX A;  3BEH A;  1A32 A;  4FFK A;  2H8P C;  2HFE C;  4CS3 A;  1G4Y B;  4LH6 A;  4JI2 O;  1JJO A;  1DGS A;  2DQ0 A;  1I94 O;  3NXS A;  1AR4 A;  1OV9 A;  4QPK A;  2BTO A;  1V55 C;  4B08 A;  4LBE C;  2R9A A;  1S5H C;  3ETE A;  3TXQ A;  2CTW A;  3CSX A;  3HKD A;  1YJN V;  4QNH B;  4H13 B;  1GAX A;  5KA5 A;  4JI1 O;  3THO A;  4NXM B;  1R6K A;  1HNX B;  3J7A U;  1CP9 A;  1JA8 A;  2UUB B;  4JI8 O;  3H1I H;  3SJC C;  1RSO A;  2JRI A;  2Q68 A;  4DR4 B;  4PI2 A;  4R8C A;  3K79 A;  4TT3 G;  1XDC A;  1KU9 A;  1TUE B;  5EIB C;  1AI4 A;  5FPR A;  5GON A;  5H2F Z;  4DV4 B;  1NU1 H;  1K3E A;  2JEU A;  1JQ0 A;  1YF2 A;  3G71 V;  1K92 A;  4H37 A;  5B3S B;  1COW G;  2AW9 A;  4JZ2 A;  2YXH A;  2EBO A;  1IBL B;  5EC1 C;  3G80 A;  2R9I A;  4I9W A;  5KUK A;  1N0J A;  5GTH Z;  3UT5 B;  4OPH A;  3AG4 C;  4PA7 A;  2YIC A;  4JF3 A;  3ZHR A;  2HKO A;  3FYE B;  5JQG B;  4IGG A;  1PPJ H;  3ZBH A;  1BS3 A;  4WBN A;  1ZWI C;  5EZY B;  5KLV H;  4HAM A;  1R73 A;  2IU0 A;  4UCR A;  4J42 A;  1K9M W;  3MD0 A;  1SQG A;  3OE7 G;  3GWO A;  3T2M A;  2Q0A A;  4DW1 A;  2IW5 A;  1GTO A;  2QEX V;  3BHP A;  1WA8 B;  4NXM O;  2P5O A;  2BSK B;  1HNX O;  2UUB O;  3SPI A;  1OZ0 A;  3AG2 C;  2L6L A;  1PNL A;  4DR4 O;  3G6E V;  2ADQ B;  2Y4T A;  1TGO A;  1O9H A;  5EBL C;  3M8A A;  1N34 B;  5K1X A;  4EFE A;  2W6I G;  3SYQ A;  4PEL A;  4JAS A;  5IJ9 A;  3HKC B;  2FB5 A;  4DV4 O;  2Q73 A;  1P4R A;  4CH4 A;  1VF6 A;  2Q6A A;  4BW9 A;  2A79 B;  3ETG A;  5BY1 A;  2KB1 A;  3JD2 A;  1IBL O;  3R65 A;  3RYI B;  3I55 V;  3ZRX A;  1AVM A;  5LMN B;  4O2B B;  2HG5 C;  1S0V A;  1N36 B;  2YXY A;  3LDC A;  2EUL A;  4F6R B;  1TVK B;  4MTF A;  1K5Q A;  3APO A;  5FPO A;  1IBK B;  5KMG A;  2ZR3 A;  3BCC H;  4D7S A;  2CH7 A;  4GKJ B;  5JCO A;  1HDJ A;  2ZIM A;  2F23 A;  4AIL C;  5LXT A;  5H9C A;  4MVS A;  3TGU H;  4K0K B;  3DXR A;  2YI8 A;  3RVZ A;  4ZHQ A;  4J9Z B;  1YZB A;  1XMQ B;  1FXK A;  3ABT A;  1RSO B;  2QKS A;  4KFM A;  5LL6 Y;  1MA1 A;  2LFS A;  4P9O A;  4EB6 A;  3SJA C;  1IZ3 A;  3JAL A;  3CCL V;  1WJZ A;  3K58 A;  1N34 O;  1N8R W;  4FM2 A;  1BT8 A;  4IYI A;  3MHH C;  4JAU A;  1XOU A;  4X64 B;  2EIJ B;  1XMO B;  4J41 A;  3I56 V;  3UO2 A;  3H1J H;  1VQM V;  4DR5 B;  3E2E A;  4X1K B;  3AK3 A;  3S3W A;  4BW5 A;  2NLJ C;  5HFM A;  1R3L C;  4LF4 B;  5LMN O;  5CBF A;  1GMG A;  3DSQ A;  3CC7 V;  1KP2 A;  2B9Z A;  4WBN B;  1N36 O;  2RQ6 A;  2QWP B;  5LGT A;  3SPG A;  2X6A A;  2WSS G;  2JJ2 G;  3BAA A;  2AXT Z;  1S5J A;  3SGI A;  1EN6 A;  1IBK O;  5EYP A;  1ARO P;  5F2V O;  4GKJ O;  3EHB B;  4Z2W A;  2R72 A;  3D36 C;  5LHH A;  1NZ6 A;  2IJH A;  1VQK V;  4B3M B;  2O57 A;  4K0K O;  1DF4 A;  4GKK B;  3CEI A;  1HP8 A;  1XMQ O;  1S72 V;  1LUV A;  1JPX A;  1RPR A;  1XUQ A;  1XRE A;  4JTA B;  4MT8 A;  4TV9 B;  3D3Q A;  4XDK A;  2VS0 A;  3E83 A;  3PN1 A;  4CC5 A;  1BHA A;  1JCH A;  5B1A B;  1VQN V;  3LDD A;  4X64 O;  2UXN A;  1XMO O;  5ITZ B;  1OCC C;  1QNM A;  1YEW A;  3N2G B;  3G4S V;  4A5U B;  1Q6H A;  1SQQ H;  2ADP A;  4DR5 O;  2H94 A;  2DN9 A;  2BCC H;  1VF7 A;  3ABK C;  3QNE A;  4PA6 A;  1S3J A;  2QSA A;  4YIP A;  4JPR A;  4EKW A;  4LF4 O;  3T1Y B;  4CH3 A;  4FLV A;  1QVF U;  1L0L H;  3DC6 A;  5KAI Z;  3IAY A;  1ZTE A;  2ARH A;  2OWO A;  1XL4 A;  5KMG B;  1I08 A;  1AJP A;  1R6N A;  1UJW B;  2CH7 B;  5CA0 A;  5KHG A;  4FLT A;  2P67 A;  4UV8 A;  1BGY H;  1WPB A;  3J80 N;  1PL4 A;  3CXC U;  4HNA A;  1SES A;  4PDR A;  4DYL A;  1AI7 A;  4PV1 B;  3K0G A;  3DXR B;  4B3M O;  3CC2 V;  1FXK B;  3Q4H B;  4GKK O;  3T4D A;  3OT7 A;  2EJR A;  1VQ6 V;  2NNU A;  5CA1 B;  3ZHT A;  4YHH B;  2EIL C;  4MVU A;  2XHB A;  2P90 A;  1BHB A;  3ABL B;  5LOV A;  1Q43 A;  3CHX A;  3RN4 A;  1B3Q A;  2V4D A;  2P4K A;  1H8H G;  3QO5 A;  4UXN A;  1E1Q G;  1R1B A;  4X1I A;  1R3J C;  2OYQ A;  1VQ7 V;  2BE3 A;  1K5S A;  3ASO B;  2RDC A;  3E86 A;  4GX2 A;  4RAI A;  2JIZ G;  2UUC B;  1SQV H;  4NTX A;  4JI7 B;  1LNQ A;  1XL6 A;  2Q67 A;  4BIZ A;  5EBW C;  4FLZ A;  3T1Y O;  2VQE B;  1Q6I A;  5B3S C;  4IIJ A;  1OJH A;  2UXD B;  3IGA C;  4W4K A;  5EYP B;  2Y48 A;  5KA6 A;  4I50 A;  1ZUQ A;  3B8N A;  3OTO B;  3ETD A;  4I4T B;  3CCS V;  2QA4 V;  1MSD A;  1VQL V;  2UXX A;  5GW7 A;  1E1R G;  3HB3 B;  3WB0 A;  4NYK A;  1GM8 A;  2ZE6 A;  2ZE5 A;  2GTS A;  2GBO A;  4YHH O;  3VQY A;  1FXH A;  1KKC A;  4P2Z A;  3CCE V;  3K59 A;  4CBC A;  2ZDI C;  1H2G A;  1QVG U;  1US6 A;  2XT9 A;  5A2Q N;  3TJT A;  2HR3 A;  2HHH B;  2C2A A;  3ZRW B;  4PDL A;  4DK1 A;  2OIE A;  2ZT9 B;  4XDJ A;  2N74 A;  4C7U A;  2BTQ A;  2UUC O;  4JI7 O;  2VQE O;  2L35 A;  3A0B Z;  4IT5 A;  1FPO A;  1WPX A;  1P7B A;  3OEE G;  3HKB A;  2UXD O;  1GN2 A;  1SA0 A;  2JDI G;  2QM7 A;  1VQO V;  1MMM A;  5CA0 B;  4B3T B;  4DV0 B;  3OM3 B;  4K3A A;  2YC0 A;  2JVD A;  2XAF A;  4HNA B;  1I0H A;  4UCS A;  4WCE V;  3B4S A;  4K35 A;  1BMF G;  4Z1V A;  3OTO O;  1FFX B;  4LF6 B;  4H0L B;  5E1A C;  3UO3 A;  2PYJ A;  5CA3 A;  1M90 W;  3OTF A;  3L75 H;  1JX9 A;  2H3O A;  2WLI B;  5LOV B;  5JJJ B;  5DN6 G;  5L3E A;  5L3C A;  3ZMZ A;  4I0X A;  1VEW A;  3JAT B;  4P30 A;  4DR3 B;  1FJG B;  3E35 A;  3LNM B;  4QE9 A;  2HHH O;  2QKC A;  3W7W A;  3CRM A;  2PGG A;  1K4D C;  4ZOL B;  3K5L A;  1B06 A;  2YUA A;  3ABK B;  1YJW V;  4FLY A;  4U3J B;  3RFR A;  4IIJ B;  1NBM G;  1VF5 B;  2BOC C;  1Y66 A;  3ZIA G;  1W0K G;  3ZMT A;  4X20 A;  1IVS A;  4FZ0 A;  4LF9 B;  1G6U A;  3JD0 A;  2QTS A;  3SR2 C;  1TAE A;  3RWR D;  2ZM6 B;  5LGN A;  4B3T O;  4DV0 O;  4UVA A;  1QHT A;  3A0R A;  1YTF B;  3M7M X;  2EZO A;  5L3G A;  4IYH A;  2WPD G;  3A8T A;  3P3P A;  4WFF A;  5BMV A;  4R7C A;  3FB7 C;  4LF6 O;  2DQ3 A;  3ETQ A;  1AJQ A;  3FB8 C;  3RYH A;  1HWY A;  2WLL B;  3U11 A;  3ZJZ A;  4OGQ B;  1RM1 B;  3DC5 A;  4J7Z A;  2KG7 B;  2IM9 A;  2F93 B;  1Q3E A;  4CZZ A;  3AK1 A;  4O4L A;  2EIL B;  3L72 H;  1NVP D;  3KKY A;  1Q82 W;  4DR7 B;  1XNR B;  4O4I B;  2WLM A;  2XAS A;  5BR8 B;  4DR3 O;  4LFB B;  4DV7 O;  1FJG O;  4J10 A;  4CS4 A;  5A9G A;  2OTL V;  3OUF A;  1Y4M A;  2CK3 G;  4GT1 A;  5B1A C;  1B6Q A;  1SF9 A;  4NKG B;  1VF6 C;  2EIK B;  5FLX N;  1N33 B;  2P7T C;  2QJ1 A;  3QF7 A;  4J80 A;  1SA0 B;  1YDX A;  4J7J A;  3E8H A;  3UCS C;  4HYO A;  1R3K C;  1MNG A;  4FM0 A;  1I7F A;  2GSM B;  4D6T H;  3RYF A;  1VQ9 V;  4TQF A;  4LF9 O;  4B7K A;  3DGE A;  5EIB D;  1NI8 A;  3FKS G;  1ENV A;  2ZM6 O;  3TK1 A;  2HLD G;  4GX1 A;  4MS2 A;  3ZHS A;  2B1I A;  4JYY A;  5H5N A;  3GVM A;  4FJC C;  3BRC A;  3F7V C;  2DMX A;  5BZB A;  2E3C A;  4LH7 A;  5JCO C;  4YJ2 A;  4QPJ A;  1NTZ H;  4LWS B;  4GYC B;  3CRC A;  1M4U A;  4DR1 B;  1XNQ B;  4LF8 B;  2YS8 A;  4TSF G;  3P32 A;  1XEQ A;  1YIJ V;  1NTK H;  5J2U B;  3HKE A;  4B3S B;  3STL C;  1IBM B;  1FXK C;  3MHS C;  4DR7 O;  4I0X B;  1XNR O;  2ZCE A;  4JYA B;  3JAM N;  5CB4 A;  5BR8 O;  4LFB O;  5IYD O;  2Y4U A;  2QWQ B;  1P84 F;  5CMU A;  3ZHQ A;  1AP6 A;  4X1Y B;  5H6Q A;  3ABL C;  3SYC A;  3B09 A;  2DWD C;  3U0Z A;  1H38 A;  1GN4 A;  5JH7 A;  2G38 A;  1I5X A;  1Y76 A;  4TQD A;  1DK1 A;  1N33 O;  2X0L A;  1F51 A;  2EIM C;  2B1G A;  3E8B A;  3WFV A;  3ASO C;  2BOB C;  4DV5 B;  3FD9 A;  4LNU A;  4I55 A;  3CCR V;  2A3Q A;  3E8F A;  2CTQ A;  2ITD C;  2WA4 A;  4TWK A;  2AHZ A;  1R6T A;  2IJI A;  2A06 H;  4QIW F;  3ZCC A;  4E4E A;  4NTY A;  1KKD A;  5C93 A;  3CRQ A;  2CTP A;  4FLU A;  3CCU V;  1ZLZ A;  3JAK A;  3VQV A;  1GO3 F;  2PI5 A;  4WFE A;  1YI2 V;  1EBO A;  1K33 A;  1FKA O;  3HKD B;  4DR1 O;  5KHJ A;  1XNQ O;  4LF8 O;  4N21 A;  2LJ2 A;  4B3S O;  2F66 C;  1IBM O;  2PYL A;  1QQC A;  2ZNI A;  2F43 G;  3IC7 A;  4JYA O;  1JFF A;  2YIB D;  2Y69 B;  3WG7 C;  3B40 A;  4DV1 B;  2QM8 A;  1EN5 A;  5GON B;  3RYC A;  1ZAU A;  3CD6 V; 
#chains in the Genus database with same CATH homology
 4MTO A;  1FXK B;  4UVC A;  2DYS C;  3RBZ A;  1OCZ C;  5J9P C;  1YJ9 V;  3T4D A;  3T4Z A;  1KEC A;  4U7N A;  1CEZ A;  4X88 A;  3AG1 C;  2EJR A;  1MSW D;  5L3D A;  3M99 B;  4U7O A;  2JEX A;  1VQ6 V;  2NNU A;  4RUF A;  2EIL C;  4JYB A;  4JTD B;  3AG3 C;  1DLB A;  4MVU A;  3K03 A;  1VQ8 V;  3UM7 A;  1PL0 A;  2P90 A;  1BHB A;  3ABL B;  1NR7 A;  4F4L A;  2X6C A;  2K1E A;  1EZJ A;  4WFA V;  4FPP A;  3K9A A;  1AI5 A;  4E2L A;  1H8H G;  3QO5 A;  2DYR B;  2GHY A;  4UXN A;  2XAJ A;  1E1Q G;  4XBF A;  2WWW A;  1KC8 W;  4ZBM A;  4JYC A;  3ABM B;  1R3J C;  2DW4 A;  2Q69 A;  3PJS K;  1VQ7 V;  1K5S A;  3ASO B;  3E86 A;  4GX2 A;  4RAI A;  2JIZ G;  2D3O W;  1V54 C;  2EIN B;  1LNQ A;  3F7Y C;  2ZQM A;  1XL6 A;  2Q67 A;  3B8M A;  3LUT B;  1W0J G;  5EBW C;  3VOU A;  4BIZ A;  4FK5 C;  5B3S C;  2IJJ A;  4MVZ A;  4P9P A;  3RVY A;  3ZRS A;  1OCC B;  1OCR C;  3IGA C;  2ZDI A;  4DXW A;  2A9H A;  5IYC O;  5EC2 C;  1M56 B;  2IH1 C;  3ASN B;  2ATK C;  4RQF A;  1I5Y A;  2EIJ C;  1NQT A;  2V1D A;  2W0F C;  3KG2 A;  4I5S A;  4RQE A;  1PD3 A;  2OT5 A;  2ZD9 A;  2IJK A;  3QO8 A;  5FL7 G;  2Y48 A;  5B1B B;  5B1N A;  5KA6 A;  5IYB O;  1ROP A;  4UV9 A;  3TET A;  3OMN B;  2WLK A;  4H33 A;  1M57 B;  3B8N A;  2M7W A;  1JVM A;  2OCC B;  4BAY A;  3ETD A;  3CCS V;  2QA4 V;  3HPL C;  2ZXW B;  1KQS U;  3BEH A;  1SET A;  4N23 A;  5LHG A;  1Q81 W;  1VQL V;  2P6J A;  2UXX A;  2H8P C;  2HFE C;  1IXM A;  4KUM A;  3X2Q C;  1G4Y B;  5GW7 A;  1E1R G;  4GCZ A;  3HB3 B;  1W2B U;  1NKD A;  3E8G A;  2DQ0 A;  2WLH A;  1K8A W;  3H01 A;  3CMA V;  1GM8 A;  3NXS A;  3D3I A;  4RO2 A;  1F4M A;  1QCE A;  4QPK A;  5DM6 V;  1GK9 A;  3LSS A;  1FXH A;  1QLE C;  1V55 C;  4P2Z A;  4MVO A;  4LBE C;  2Z3Y A;  3CCE V;  1MAB G;  2DWE C;  2WAM A;  1S5H C;  3ETE A;  3JD3 A;  2ZDI C;  1H2G A;  2DYS B;  3ZN1 A;  4CBC A;  1QVG U;  1OCZ B;  2HR3 A;  2C2A A;  3CD6 V;  3ZRW B;  3FB6 C;  1YJN V;  4QNH B;  4MW3 A;  4HZ3 A;  5KA5 A;  2IU3 A;  4PDL A;  4BIU A;  4XDJ A;  4ASU G;  2B5U A;  3IFX A;  2V7Q G;  4PA9 A;  1R6K A;  4KP4 A;  1M9N A;  1CP9 A;  3K3W A;  4FMT A;  5L3F A;  1WPX A;  1AR1 B;  1P7B A;  3CYO A;  3OEE G;  2Q68 A;  4R8C A;  3K79 A;  2XND G;  3AEI A;  4TT3 G;  1VQP V;  2YEV A;  1J95 A;  2JDI G;  2QM7 A;  3ZN0 A;  1TUE B;  3CCM V;  1AI4 A;  1VQO V;  5CBH A;  1F23 A;  1PNK A;  1K3E A;  3OM3 B;  2JEU A;  1NH2 B;  1RM1 C;  1JQ0 A;  2XAF A;  1R3I C;  3G71 V;  1MOF A;  1K92 A;  4H37 A;  5B3S B;  1COW G;  4WCE V;  1BMF G;  2EBO A;  3TCU A;  1OCR B;  5EC1 C;  2R9I A;  2AHY A;  4I9W A;  5KUK A;  2WLN A;  1NR1 A;  5E1A C;  1GM9 A;  3AG4 C;  3T1C A;  5CA3 A;  4UVB A;  4PA7 A;  4JF3 A;  1THZ A;  3CME V;  2HKO A;  1M90 W;  3FYE B;  2EIM B;  1K4C C;  4LC1 A;  1JX9 A;  1ZWI C;  4MTG A;  1RPO A;  5IY5 C;  1QR9 A;  3GB7 C;  2EIK C;  1R73 A;  3ABU A;  4HAM A;  2WLI B;  2IU0 A;  3LSQ A;  3JD1 A;  5DN6 G;  3OMA B;  1K9M W;  3MD0 A;  5L3E A;  3W7X A;  3OE7 G;  1OCO C;  5L3C A;  3ZMZ A;  3GWO A;  3OR6 C;  3T2M A;  4P30 A;  4LP8 A;  3X2Q B;  3LDE A;  2IW5 A;  3E35 A;  3LNM B;  4QE9 A;  1GTO A;  4X8A A;  3OW2 U;  3W7W A;  2JK5 C;  4JAV A;  4PA4 A;  1K4D C;  2QEX V;  4ZKI A;  1JJ2 U;  4LCU C;  3SYA A;  2HJF C;  3ABK B;  1YJW V;  1VQ5 V;  1H8E G;  2ITC C;  1NVP B;  3SPI A;  1OZ0 A;  1V55 B;  3AG2 C;  1NBM G;  1DF5 A;  2BOC C;  1PNL A;  1Y66 A;  3ZIA G;  1E79 G;  1SZT A;  3G6E V;  1W0K G;  3ZMT A;  5EBL C;  4Q20 A;  4PDV A;  4JGS A;  3JD0 A;  3W7T A;  4GX5 A;  1KD1 W;  2W6I G;  3SYQ A;  3P30 A;  4PEL A;  4JAS A;  5LGN A;  1FXV A;  4UVA A;  3A0R A;  1OHH G;  3JYC A;  1P4R A;  4G2K A;  1YTF B;  2Q6A A;  2EZO A;  3SPH A;  5CBG A;  5L3G A;  3WG7 B;  2WPD G;  4WFF A;  3ABM C;  2A79 B;  3ETG A;  1F4N A;  3ZMS A;  2KB1 A;  3JD2 A;  3CP1 A;  4R7C A;  3R65 A;  3I55 V;  3FB7 C;  3ZRX A;  2DQ3 A;  1VQ4 V;  1FFT B;  3K0D A;  1AJQ A;  3FB8 C;  3DTU B;  2HG5 C;  1S0V A;  1HWY A;  2WLL B;  3ZJZ A;  4L87 A;  3LDC A;  1RM1 B;  3FYI B;  3AG1 B;  4MTF A;  1K5Q A;  3VBB A;  4XDL A;  3ZRW A;  3CCJ V;  1YSC A;  4WFG A;  4CZZ A;  3W7U A;  4MTX A;  2EIL B;  1NVP D;  3AG3 B;  1Q82 W;  1PNM A;  3QO7 A;  2ZR3 A;  3OMI B;  4RUE A;  3CCV V;  1L1F A;  4G28 B;  2WLM A;  2XAS A;  2HVJ C;  3AG4 B;  4MSW C;  1Q7Y W;  4J9Y B;  3STZ C;  4G27 B;  3CPW U;  3CCQ V;  1NJI W;  5H9C A;  2OTL V;  4MVS A;  3OUF A;  1FS0 G;  1Y4M A;  1M1K W;  2CK3 G;  4GT1 A;  5B1A C;  1B6Q A;  3SYP A;  2EIK B;  3RVZ A;  1V54 B;  4FIP C;  4J9Z B;  5B1O A;  1YTF D;  5L3B A;  2YSU B;  1FXK A;  3ABT A;  2QKS A;  4KFM A;  2Z5U A;  2P7T C;  5LHI A;  2LFS A;  4P9O A;  3E8H A;  4HYO A;  1R3K C;  2YEV B;  3E89 A;  3OFN G;  1JOY A;  3CCL V;  2GSM B;  5CN0 A;  1Q86 W;  1VQ9 V;  3UKM A;  2XOK G;  1EFR G;  1N8R W;  5H6R A;  2W6J G;  3DGE A;  3D36 A;  3MHH C;  3FKS G;  1ENV A;  3BY6 A;  2XAG A;  4JAU A;  3TK1 A;  5LBQ A;  2HLD G;  1PKX A;  3ZMU A;  4GX1 A;  2ZR2 A;  2EIJ B;  1K97 A;  4MS2 A;  4MW8 A;  3AG2 B;  3I56 V;  1AI6 A;  2XAH A;  1K7D A;  1K34 A;  2B1I A;  4JTC B;  1VQM V;  3E2E A;  3OUS A;  4FJC C;  1DTO A;  1G8M A;  3F7V C;  5BZB A;  1K73 W;  3JCZ A;  4MVR A;  4BW5 A;  3F5W C;  2NLJ C;  5HFM A;  2WLI A;  1R3L C;  4QPJ A;  5CBF A;  1GMG A;  2Y69 C;  1MG1 A;  1KP2 A;  1QR8 A;  3CC7 V;  3EFF K;  5LGT A;  3SPG A;  4TSF G;  5IDJ A;  3ZRV A;  2X6A A;  3P32 A;  1YIJ V;  2WSS G;  4UUJ C;  2JJ2 G;  4X89 A;  3STL C;  3OAA G;  4PA3 A;  1FXK C;  2HVK C;  4DO2 A;  3MHS C;  3W7S A;  3JD4 A;  1NH2 D;  2OTJ V;  1QLE B;  4MVQ A;  4QE7 A;  1S77 D;  1ARO P;  3K04 A;  4MVM A;  3EHB B;  1KP3 A;  5IYD O;  1GM7 A;  5LHH A;  2LFR A;  2PI4 A;  5CMU A;  3CC4 V;  1SER A;  5H6Q A;  3ABL C;  3SYC A;  2FTK A;  2IJH A;  1VQK V;  2DWD C;  1H38 A;  1DF4 A;  1GKF A;  3RW0 A;  1S76 D;  1I5X A;  1S72 V;  2DYR C;  2X0L A;  1F51 A;  1JPX A;  2EIM C;  5KUM A;  2B1G A;  1RPR A;  4YXW G;  3E8B A;  3WFV A;  3ASO C;  2BOB C;  4JTA B;  4MT8 A;  4XDK A;  3E83 A;  2EIN C;  3CCR V;  1BHA A;  1JCH A;  2LP7 A;  1WLE A;  2XAQ A;  3E8F A;  5EBM C;  2ITD C;  5LGU A;  5B1A B;  4TWK A;  1YIT V;  2AHZ A;  1VQN V;  2IJI A;  3LDD A;  4R50 A;  5EK0 A;  2UXN A;  4QJF B;  3K06 A;  4QIW F;  3ZCC A;  1OCC C;  2X6B A;  3OR7 C;  3SPJ A;  5HFL A;  3ZMV A;  3G4S V;  1KKD A;  2MK3 A;  2R9R B;  1M56 C;  2WLL A;  5C93 A;  4PDM A;  3ASN C;  2H94 A;  2X7R B;  3SPC A;  3CCU V;  3ABK C;  3QNE A;  4WFB V;  1GO3 F;  1QLN A;  2PI5 A;  4PA6 A;  1S3J A;  4WFE A;  4JPR A;  3SJQ C;  4EKW A;  4WF9 V;  5B1B C;  1YI2 V;  1EBO A;  1K33 A;  3OGC C;  3ML0 A;  4GX0 A;  3B77 A;  1QVF U;  1M57 C;  1ORQ C;  2OCC C;  3SYO A;  4N21 A;  2A0L A;  2ZXW C;  5IY5 B;  1XL4 A;  2EZP A;  1AJP A;  1CPY A;  4R6Z A;  2QTO A;  1R6N A;  1UJW B;  3OEH G;  1BL8 A;  2F43 G;  3IC7 A;  2WLJ A;  4WFH A;  2IH3 C;  1YHQ V;  1OCO B;  2P67 A;  1SRY A;  4UV8 A;  2Y69 B;  1QBZ A;  3WG7 C;  4OXS A;  3CXC U;  1SES A;  3FB5 C;  4PDR A;  2QM8 A;  1AJN A;  1AI7 A;  3K0G A;  4Z1M G;  2QE7 G;  2JJ1 G;  3K08 A;  3CC2 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...