3E8GA

Crystal structure of the the open nak channel-na+/ca2+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8gA00
1P7BA 1R3KC 1OCRC 4MVRA 4PA9A 2AHYA 4MVQA 1ZWIC 5CBGA 3EFFK 3AG1C 4PA3A 3F7VC 2DYSC 2OCCC 5KUKA 3E8BA 3STZC 2A79B 5BZBA 4X8AA 3SYAA 4P9OA 2EIJC 4GX5A 3E8HA 1OCZC 3K08A 4G28B 1M56C 4R8CA 4P2ZA 3TETA 2Q67A 2WLLA 5CBFA 1V55C 4ZBMA 2QTOA 4I9WA 4PDVA 4HZ3A 2DYRC 4CBCA 4WFEA 4MTGA 4WFGA 4G27B 2EIMC 2WLKA 5EK0A 3T1CA 1R3IC 5B1BC 3SYCA 3T2MA 4JTDB 3SYPA 1XL4A 5B3SC 3ASOC 4MW8A 4MVZA 4EKWA 2ZXWC 4MVMA 4QNHB 2AHZA 2X6CA 2JK5C 2HVJC 3JYCA 3FB8C 3PJSK 4R6ZA 3IFXA 4GX1A 2IH3C 3OGCC 5CBHA 5EBWC 4MSWC 2A9HA 2HJFC 4RO2A 3SYQA 2R9RB 2K1EA 3TCUA 2ATKC 3ASNC 3LDDA 4PA7A 2WLJA 4P30A 4J9ZB 4MVUA 4QE7A 4XDJA 4MS2A 2DWEC 2KB1A 2YEVA 2HVKC 1R3LC 2WLHA 3OUFA 4H37A 5KUMA 3R65A 2WLIB 3OUSA 1R3JC 3FB5C 2ITDC 3K0GA 2QKSA 4GX0A 4R7CA 4XDLA 1S5HC 3SPIA 1XL6A 3UM7A 4GX2A 3T4ZA 4RUEA 2WLNA 3WG7C 3E86A 3ZJZA 4J9YB 3ABLC 2A0LA 3SPHA 1JVMA 3LNMB 3X2QC 2Q68A 3RVYA 3K04A 3LDCA 2EIKC 4RAIA 1G4YB 3E8FA 4PA4A 3UKMA 5IY5C 4JTCB 4WFFA 3SPGA 2EINC 3LDEA 4OXSA 5EC1C 4BW5A 1OCCC 4KFMA 3BEHA 3RW0A 3RVZA 4MVOA 2DWDC 4LP8A 4MVSA 2WLLB 4P9PA 2X6BA 3SYOA 3ABKC 2ITCC 2H8PC 4UUJC 3FB7C 4X89A 2BOBC 2Q69A 1V54C 2IH1C 4QE9A 4PDMA 5B1AC 3OR6C 2Q6AA 1K4DC 3F7YC 4DXWA 3E89A 2EILC 4TWKA 3SPJA 3T4DA 2ZD9A 4JTAB 5J9PC 5EC2C 4PA6A 5EBMC 3AG3C 2HG5C 4WFHA 2P7TC 4XDKA 3SPCA 1BL8A 3KG2A 4HYOA 3VOUA 3ABMC 2BOCC 4PDRA 4R50A 3F5WC 3K0DA 2HFEC 2NLJC 2W0FC 1ORQC 3GB7C 3IGAC 4LBEC 3E83A 2X6AA 4MTFA 4MTOA 5E1AC 4LCUC 3K06A 3SJQC 1K4CC 3OR7C 3K03A 1KKDA 4RUFA 3FB6C 5EBLC 4H33A 4MW3A 1OCOC 4PDLA 3STLC 3E8GA 4X88A 3ZRSA 3AG4C 3RBZA 3LUTB 3AG2C 4F4LA 2WLIA 2Y69C 1LNQA 2WLMA 1M57C 1QLEC 3HPLC 1J95A
chains in the Genus database with same CATH superfamily
1OCRC 2AHYA 4DV2B 3EFFK 3K57A 1E79G 2Y0IA 3QF7A 1SQXH 1FKAO 4B3SO 3B2EE 4B3MB 2ZE8A 1BGYH 1OCZC 3ZCCA 1HNZO 2WLLA 1H2LA 3I55V 4HZ3A 4X62O 4H0LB 2P5OA 5BR8O 1ZTEA 4LNUB 5JQGA 4U3JB 2NN4A 3JASB 4B3TO 5GW7A 1OJHA 1EFRG 5EZYA 3AG3B 4X1KA 5LGUA 3TCUA 1WP7A 1PKXA 5IWAB 3ZN1A 4MVUA 4ABMA 3ZMVA 2AZ0A 4IYHA 2Q9LA 4IL6Z 1QCEA 2VQFO 5D5PA 1W2BU 1F23A 2QWOB 3E86A 3ZJZA 1Y76B 3OEEG 1VQMV 2OYQA 4ZOLB 5DEDA 2F66C 4X1IB 4X62B 3RW0A 5IY5B 1Z2GA 2Y0PA 2D3OW 2CH7B 3ZHUA 4JAVA 4CH4A 3J81N 3JARB 5B1AC 4WCEV 4DR1B 3ASNB 3HKBB 1EM1A 2ZD9A 4UB8Z 2UUAO 5JCOA 5LMUO 5IJ0A 2N05A 1XNQB 1ZLZA 3ABMC 4O2BA 5JH7A 5IYZB 3IC9A 1U97A 3L71H 3D36A 1KECA 2CTQA 3O9OA 1PPJH 4PDLA 3W7TA 3CXCU 4X88A 2PF4E 3G6BA 2QWNB 4GKJB 4K0KB 2D2CB 2KG7B 1LNQA 1IXBA 1NTKH 2CTPA 4OPAA 1YTFB 3L9DA 2JS5A 5H6QA 4GYCB 1K7DA 3SJAC 4MVQA 1IBLO 1DF5A 4L8JA 2QSAA 2OCCC 1KBHA 4GLXA 5EIBC 5BZBA 4GZRB 4OX9B 2BCCH 3TGUH 1OCRB 2IU3A 2Q0OC 2YC0A 4W4LA 4K8ZA 3HKEA 4K8XA 1BHBA 1SQVH 2OTJV 3ZRWA 5LA6A 4J42A 4LF7B 1ENVA 2QGNA 4JTDB 4JI3O 1XL4A 4YHHO 2ZXWC 2JGDA 2QJ1A 3JALA 3CD6V 1PL0A 4O2AB 3ZHTA 4QIWF 4GCZA 5EBWC 1ZAUA 4X9QA 1D2DA 1XMOO 2EULA 2R9RB 3OEHG 2IW5A 2YI9A 2ZM6B 1U96A 2KB1A 1Y76A 1QVGU 3OUSA 3FB5C 1Q7YW 1SERA 4O2BB 1YVWA 3UM7A 2VQFB 2RJZA 3FYIB 4LF5O 3WG7C 3SR2C 3LNMB 3JCZA 3U11A 2P67A 1CP9A 1AB3A 5ITZB 1IDSA 4J11A 1AP6A 4O4LA 1GKFA 2H8PC 4DR7O 2M6YA 2F23A 3OR6C 4DXWA 1K4DC 1P4RA 4XDKA 3BHPA 2Z3YA 2EIKB 2BOCC 2GUZA 4R50A 4DR5B 2HFEC 2W0FC 3CC7V 1J5EB 4FLTA 3GB7C 3OD4A 2DOSA 1HNZB 1TVKA 1SZXA 2VWJA 3K06A 2DYSB 2C2AA 3P30A 4F4LA 1Q6HA 1GK9A 2N74A 4AHCA 4PA9A 4X65O 3C3SA 2PTMA 4AQYO 1FXKA 4JI6B 4DV6O 4GKKB 4TV8A 3APQA 3JALB 4DO2A 1NI8A 1NTZH 2KQXA 1EN4A 3CCUV 1S5JA 2Y48A 3S3XA 4WFGA 5J2UB 2E5LO 4DV4B 2IJIA 2Y69B 4RWUA 1NH2D 1Y6XA 2E5LB 4RO2A 1B3QA 4I55B 3ASNC 2ZCEA 2EINB 2ILMA 4UVCA 4MT8A 3DGEA 3H9VA 4I0XA 3CCJV 4GX0A 3LSSA 2KG7A 4DUZB 3EHBB 2WLNA 1XI1A 4X65B 4DK1A 2GSMB 2AXTZ 4PJ0Z 2HLDG 1AROP 4HNAB 1XNQO 1Q3EA 3UKMA 5KHKA 3GWOA 4LF4B 5IYBO 3BVOA 2UXCO 1CEZA 3BRCA 1Q86W 4DK0A 4J41A 4DR4O 1MABG 3QO7A 3UT5B 3N2GA 4G2KA 5EC2C 3H1JH 1YF2A 4DV7O 2ZNIA 1NVPD 4N21A 2L35A 5GONA 2P4VA 1ZL8B 2BTQA 1K4CC 2QTSA 3X2QB 5EYPA 3STLC 5L3GA 3ZRSA 2Q8VA 2YS8A 4U7NA 2ZR3A 1PL4A 3JAKB 1KP3A 4LH6A 3CB2A 2BTOA 3O65A 1NU1H 1K34A 4BIZA 4LFBO 3ZMSA 2DYSC 3E8BA 4DUYO 5JCOC 4F6RA 5CBFA 2EZPA 3CYOA 2Q4PA 2OCCB 5H6RA 2YXYA 4QPKA 3MHHC 5A9GA 2XAGA 4H13B 2E74B 1XMOB 4FM0A 4MVZA 2EZOA 4HNAA 1M57B 2A9HA 2QKAA 3W7WA 4JI3B 2HJFC 3CRAA 4KXRA 1FFXB 2ATKC 4FLUA 4DV5B 1IXMA 2V7QG 1W0KG 2ZIOA 4MS2A 1JOYA 1IBLB 2UUCB 1W59A 5KUMA 3HKDB 1H2NA 2ITDC 4R7CA 4I4TB 1XL6A 4GX2A 4DR3B 2WWWA 2M7WA 2EJ7A 1OV9A 4UXNA 5HFLA 1KB9F 1KKCA 3ML0A 5B66Z 1I5XA 2FYUH 2QM7A 5FLXN 4DR3O 2P6JA 3H1KH 4KFMA 1KQSU 2W6IG 4JV5B 4NR1A 4JI0O 3SYOA 3OE7G 1QLNA 2R9AA 4LWSB 3JSNA 4I5SA 3CRCA 5J2UA 1BHAA 2ZDIC 2NR5A 1IBMB 2N04A 2F93B 2F4VO 3BAAA 3T4DA 2DN9A 4AI8A 5LMUB 2CUGA 5H9CA 2R9IA 4IHJB 1X59A 1P84F 3T1HB 1ORQC 1K5QA 2V4DA 4PHZA 5IJ0B 5JVDA 3ZX6A 1YZBA 1ZUQA 1PNMA 2YDEA 4Q20A 2B5UA 3TJTA 4JI4O 1SQQH 1H8EG 2CH7A 3JD3A 2B9ZA 3F5TA 1H2GA 1RPOA 4X1KB 1KMIZ 1JJ2U 2LJ2A 3HR0A 4EEQA 3MHSC 2HEPA 4B3RB 1H2MA 1AI7A 1DK1A 3FYEB 2FB5A 4PV1B 1IZ3A 1GM8A 3OMAB 3U10A 3TXSA 4TV9A 3RYHB 1MG1A 3QO5A 2UXBO 1KYOF 1WJZA 1F51A 1Q6IA 3VQVA 5JJJB 1X4TA 4UVAA 5J2TB 3K3WA 3NR7A 3SGIA 3T1HO 2QEXV 4B3SB 1WPXA 4DV2O 3ZEDA 1IBMO 2WLIB 1TUEB 4B3MO 1S3JA 4LF4O 2GBOA 4JV5O 1K5SA 1SZTA 3LDCA 2JGDB 4O2AA 3E8FA 4WFFA 1SESA 3SPGA 2YSUB 3JCUZ 5D5QA 5LP6C 1GMGA 4LFAO 4LFCO 4OPHA 1V54C 5LYJA 5L3FA 3WB1A 3A8TA 4WFHA 3WB0A 3L72H 1BL8A 5L3EA 3IC7A 2CE4A 3FFQA 5C8YA 3VQYA 1WLEA 2LGWA 3SJQC 3S3WA 1SA0B 2LQTA 4RUFA 4ZHQA 3RYHA 5KHIA 1Z5VA 4Q6GA 2R72A 4NYKA 4FFBB 1OZ0A 1PP9H 2F95B 4JI7B 1LUWA 4OGQB 2JDIG 4JYYA 2QM4A 4KP4A 3F7VC 4AQYB 1YIJV 4JI2O 5CA1A 1N0NA 1HNWB 1O9HA 3WU2Z 4UVBA 4NTWA 4KHPO 4R8CA 3A2FA 1IBKB 1Z5WA 5H2FZ 1V54B 1V55B 1QLEB 3BFRA 3N2GB 5EZYB 4I50A 2X6CA 5DECA 1SRYA 5CBHA 1N32O 4YJ2A 3A0RA 1YSCA 1Y74B 3JSLA 3RYFB 4O4LB 4UCOA 2F43G 3B09A 3CMEV 1Q5OA 4JGSA 2AZ2A 1SS3A 1A32A 2BTQB 2DWEC 1NBMG 4DV3B 2RCVA 4UV8A 1DLBA 4NXNO 3RT3C 1GN4A 5LA6B 5KX5B 4DV0O 4LNUA 4EFEA 2PGGA 1GM9A 3BEHA 1IVSA 4MVOA 1F7YA 2WLLB 4DW1A 1HNWO 3OGIB 3JAWA 1XOUA 1NS1A 3P3NA 3FB7C 4X89A 1NTMH 2BOBC 2IH1C 5K1XA 1N33O 5H5NA 4X64B 5IYCO 1F4MA 3B77A 2NLJC 3PN1A 4FK5C 4H44B 1TUBA 1EZVH 4JYAB 4JI0B 4O4JA 1H2SB 3DXRA 4FLYA 1VF5B 1W0JG 1VARA 3OTOB 2WLIA 3K9AA 1I7FA 3HPLC 4CS4A 2LGQA 4UFZA 3K58A 2IJJA 1R6KA 5B1NA 4U3FH 5LMNO 1FFXA 1N8RW 4P9OA 4P2ZA 3TETA 4DYLA 3N27A 3IJ4A 1YITV 4I9WA 4QGPA 4EB6B 3T1CA 3CCEV 4PD4F 4NKGB 5EIBD 2UUAB 3ZHRA 4FPPA 2PYJA 2UUBO 4MSWC 1QHTA 5LP6B 1J5EO 3CRRA 2UXBB 4LF9B 4RQEA 3HB3B 5J2TA 5B1AB 1YTFD 1F4NA 4HBNA 4QPJA 3K0GA 3K5NA 4DUYB 4LF6O 2GUZB 1AVMA 3MDSA 3T4ZA 4LH7A 1FFTB 2DQ3A 3L70H 3KCYA 2ZR2A 2Z0AA 3E22B 5DN6G 1KD1W 4UCTA 3G4SV 1NKDA 4QJFB 3RVZA 2Q7HA 2DWDC 1IBKO 1EN5A 3L74H 2EJRA 2X6BA 2ZE7A 1YCIA 4ICGA 3CCQV 4YY3B 3WFVA 1PNKA 3AK2A 2MK3A 1K73W 5JQGB 1D5AA 2R70A 1VQ7V 3VQWA 5EBMC 5LBQA 3DC5A 2ZM6O 3JASA 1M90W 4X1YB 3VOUA 3K0DA 3IGAC 1VF7A 1QVFU 4LF8O 3HKCB 4FLXA 3ZMUA 2IBZH 4MW3A 1OCOC 4W4KA 1M9NA 1XUQA 1N4CA 3ABTA 1JFFB 1SETA 2PZSA 2ZKOA 2ZDIA 2JVDA 1SA0A 3OFNG 4ZHQB 3AEIA 4MVRA 3DC6A 4LWSA 3KCXA 2JEUA 2CAZC 1XREA 2YUAA 1L0LH 3C3TA 2BSKA 3SJCC 2ADQB 4BW9A 3AG4B 2DYRC 3N2KA 1RP3B 5BMVB 4JASA 5KHHA 5B3SC 4MW8A 2L6LA 3JARA 3JD0A 4FLVA 3R66A 2UUCO 1HR0B 4UCUA 5JJEB 3LDDA 1JQ0A 1KU9A 4O4HB 3ETQA 4TV8B 1HNXO 4D7TA 1VEWA 3DTUB 3E22A 3SPIA 4PELA 4JYCA 3OAAG 4J9YB 4PI0A 1VMGA 1GTOA 3MD0A 3QNEA 3UO2A 3LDEA 1OCCC 1NVPB 3ETDA 3M99B 2VQEO 1FXVA 1Q6UA 2ITCC 1XILA 5JWPA 4PDMA 2B1GA 3F7YC 4LF6B 2DMXA 2P7TC 3HKCA 4DV1B 3RYFA 1AR1B 3JD4A 3FAVA 2VRZA 1BZKA 3OR7C 4L87A 3CX5F 3ZMTA 1XHZA 3SJBC 5KHJA 4ZIBA 5L3CA 1YHQV 3J7AU 4LF9O 1WA8B 2WLMA 4U3JA 3T1YB 1EZJA 1R3KC 4JF3A 3CXHF 3B4SA 5JJNB 5F2VO 4K3AA 2W6JG 4IHJA 2XT9A 5L3BA 1MZEA 2UXCB 2LFRA 1I08A 2QA4V 1BE3H 3BY6A 3ZBHA 3AG2B 5CB4B 4G27B 2EIMC 2JRIA 4HAMA 2PYLA 1S77D 3RWRD 3ZHSA 2LW1A 3FX7A 4TOIA 2HVJC 4R6ZA 5KLVH 5LMNB 1I5YA 3ABMB 2LFSA 1QBZA 1VQOV 1IX9A 4X20A 1H2KA 3M8AA 3IAYA 4J9ZB 4C7UA 1K97A 2XUMA 4JZGA 1LR1A 3K5OA 3R65A 1UPGA 1RSOA 2VWKA 3K79A 4UCSA 1SF9A 1GN3A 2BE3A 1AJNA 3X2QC 5C8YB 4GUNA 2GHYA 4B7KA 4K0KO 4BW5A 2EINC 1PD3A 3BCCH 2RMKB 4X20B 1S76D 1TAEA 4JI8O 1COWG 2A7WA 4UUJC 1VQ5V 3TK1A 4DV0B 2Q6AA 5J9PC 4E2LA 3CCVV 3AG3C 1K3EA 1NT2B 1SKVA 4FM2A 4DR5O 2E3CA 2JJ2G 3E83A 4MTOA 4X1IA 4NXNB 4FIPC 3FB6C 2FTKA 3AG2C 1ZL8A 2RQ6A 1YEWA 1M57C 4J80A 1J95A 1P7BA 1Y74A 1BCCH 3KKYA 3AG1C 4CZZA 3CCLV 5KUKA 2XAHA 3TXQA 1QNMA 2JGUA 2EIJC 4G28B 2Q5ZA 1FJGB 4NVPA 2Q0AA 2VQEB 2QTOA 2PUSA 1R6TA 1WPBA 3UQ8A 4MTGA 5LOVB 1NQTA 4DR2O 1BSMA 1R3IC 2ETNA 4KHPB 2IM9A 3FB8C 3PJSK 3D3IA 4O4HA 4JI8B 3ZRVA 1JMKC 1GO3F 5IE9A 3ETGA 2F4VB 4XDLA 2QKSA 5LGNA 2G38A 4OX9O 1E1QG 4J7ZA 5B1OA 5E79Z 1Q82W 4LFAB 2X7RB 2RNBA 1XEQA 3MAQA 2GDSA 1VQ9V 2PI4A 1S72V 4WF9V 1H38A 4KL1A 3K5MA 4MVSA 3J80N 4LFCB 2OTLV 3K9SA 1HW7A 4DV6B 4GKKO 2Q69A 5BMVA 4UV9A 3G71V 2UU9B 3K59A 1GRJA 2DE0X 3F5WC 3D8CA 2X6AA 4MTFA 3B8NA 5GTHZ 1WN7A 1ZX3A 4WBNB 5C93A 1HWYA 3D36C 3T1YO 5CN0A 4IIJA 2P90A 4DW0A 2AW9A 1EN6A 3STZC 4BIOA 3JAKA 1YXBA 4YY3O 4DR7B 5CB4A 1BQZA 1NH2B 2QWQB 5JH7B 3JATB 4X1YA 4NXMO 1LUVA 4ZBMA 3UO3A 2HHHB 5LXTB 4CBCA 2PY5A 2E76B 3SYCA 1DF4A 1TA8A 5LHIA 5BY1A 5FNVA 4LC1A 4F6RB 5EYPB 4MTXA 3W7UA 4LF5B 1AI6A 5ITZA 4B3TB 3RN4A 2Q7GA 1SQPH 1FXHA 3FAVB 2YIAA 5BR8B 4JI4B 3APOA 1S5LZ 1M4UA 3ABUA 1R3LC 3OTFA 1WB7A 2CK3G 5CMUA 2LW7A 3ABLB 3CP1A 1S5HC 4DR4B 1OHHG 2ZE6A 3UCSC 5FPOA 1H8HG 2EX3A 3ABLC 2Y4UA 2A0LA 4JYBA 1JVMA 3SPHA 1HNXB 3RFRA 4LF7O 3ZIAG 3HKEB 1YJNV 1K9MW 4P9PA 1B6QA 1BMFG 4IIJB 2MW2B 1I0HA 1GM7A 4YJ3A 4I0XB 3RYIA 4JI5O 3WB2A 5A2QN 4JTAB 4PA6A 1VF6A 2LO1A 2V1DA 1AR5A 1PNLA 3KG2A 3K5LA 4DR6O 3DXRB 2FMLA 5AG2A 2BSKB 2QKCA 4FVMA 1KKDA 4CS3A 5B1BB 5EBLC 4BR6A 3GWKC 4DRXB 4DV4O 1O9GA 3CWBH 4CC6A 1DGSA 3CRMA 2WSSG 1ZWIC 4KUMA 3C90A 4X64O 1VIBA 4JPRA 2CDYA 3AG7A 3P32A 2A79B 2GTSA 2EIJB 4GX5A 3HKDA 1M56C 1UFIA 2DJVA 5KHGA 2XAJA 1TUBB 1V55C 1FXKC 2XHBA 1D5NA 4N23A 4I4TA 3QO8A 4WFEA 3ZHQA 3CCMV 3T2MA 3SYPA 4BWAA 2H94A 2NNUA 3GVMA 1N0JA 2XNDG 1RPRA 2JIZG 1PM9A 1QR9A 1AI5A 1OCOB 3RGBA 2JS3A 4LFBB 2RN9A 2XAQA 1OCZB 1JR9A 2A3QA 4TUYB 1GN2A 4P30A 3CSXA 2OT5A 3JATA 4IYIA 4DV3O 4YJ2B 5IYDO 2HVKC 4H37A 1VQKV 2UXDO 1R3JC 3HKBA 1M1KW 1OCCB 5K1PA 2OIEA 2WA4A 2PI5A 5GONB 1N32B 4U7OA 4JI1B 1YJ9V 4IT5A 3RVYA 5JVDB 2Q68A 1US6A 3ETEA 5IY5C 2XOKG 2Q73A 5LHGA 3RYCA 4K35A 4ZOLA 5LXTA 1FAFA 2K9PA 3SDLA 1AI4A 1FPOA 2UUBB 4EB6A 2X0LA 1VQNV 4QE9A 4WFAV 3SPJA 1GN6A 4JI2B 1QU7A 1VP7A 4FM1A 4PDRA 4A5UB 5LHHA 1N34B 2YXHA 2ZNJA 2QWRB 4FZ0A 1R1BA 4DRXA 3N2KB 5KA5A 2CGOA 3AK3A 4FZ1A 3K03A 1NJIW 3CC2V 4YIOA 5KAFZ 5CA0A 3AG4C 4JAAA 4CH6A 3JD1A 2Y69C 4HYOA 4Z1MG 1VQPV 1L8DA 4PA3A 3QTCA 1N36B 2UXNA 3ICXA 1XHXA 1ROPA 2Q7EA 2YEVB 3BABA 1RSOB 4JI6O 4PDVA 1MSWD 4DR6B 5EK0A 3ZN0A 5IJ9B 3NXSA 1SC5B 3ASOB 4EKWA 2AHZA 2JK5C 2B1IA 1JJOA 3BA9A 3OM3B 2OIGA 3D3QA 4CS2A 3SYQA 4UCVA 3THOA 1L1FA 2QM8A 5HFMA 3CMAV 4JI5B 2RDCA 4O4JB 1YDXA 1XBLA 1RM1B 3CPWU 2IJKA 3FD9A 1MSDA 4FJCC 3CJHA 3ZMZA 3CCSV 2DW4A 4JAUA 4FLZA 3OMIB 3RYCB 3K04A 4RAIA 5BXZA 1AILA 1NR1A 1VQ4V 1G1XB 4JTCB 1YI2V 2HJDA 2ZE5A 4ASUG 2WA3A 1WA8A 4B3RO 1MA1A 5B5EZ 1WNSA 2ADPA 3L75H 1Y66A 3ABKC 4J7JA 1XNRO 4DV1O 1FS0G 1Y67A 1URFA 1M93A 2EILC 1JPXA 2QWPB 4IGGA 1GAXA 1BT8A 1UJWB 2KSDA 4CH3A 1FYJA 3LSQA 1DTOA 3UT5A 5LGTA 4D6TH 4NXMB 4CC5A 5LL6Y 2ZT9B 5E1AC 4TQDA 1G8MA 1QR8A 2P4KA 4I50B 3G67A 1ZSPA 5IDJA 2FKXA 3CC4V 5LP6A 1B06A 4TQFA 4X8AA 3BA8A 1HR0O 4YHHB 4YIPA 1V9PA 2YIBD 4ZI7A 2HKOA 2UU9O 4YJ3B 4LR3A 2EIMB 1HP8A 3OW2U 3EVKA 3CE2A 2E75B 4TT3G 5KMGB 3DSQA 3L73H 4GT1A 2WLJA 1VQLV 3E35A 2YEVA 3ZHVA 3RYIB 1JFFA 2YIBA 1FD9A 1RFYA 4WFBV 1TGOA 3G6EV 4JYAO 1AJQA 1MZFA 2Y4TA 4RUEA 3CEIA 1L0NH 2FL4A 3Q4HB 1TVKB 4LF8B 4UB6Z 5GTIZ 4I7ZB 1MOFA 4J10A 4DR1O 1N33B 1KC8W 2OWOA 3A0BZ 4LP8A 4D7SA 2ODMA 3CRQA 2CGNA 2YICA 5IYZA 2UXXA 4O4IB 4TWKA 4XBFA 1WAZA 4ZKIA 2ARHA 4TSFG 1BQ0A 2HG5C 1E1RG 4J7KA 2DYRB 4DR2B 1Q90D 5CA0B 1GH6A 1FJGO 4LCUC 1XQ8A 2QE7G 1R6NA 1HDJA 4H33A 4NB5A 1Y4MA 2JJ1G 4PI2A 3RBZA 3LUTB 5FNVB 3CJHB 2LP7A 3QG5A 5IWAO 1JA8A 2W0XA 4DV7B 2HR3A 2DQ0A 4NTXA 4NTYA 4JI1O 2A06H 3B8MA 4O4IA 4TUYA 1VQ8V 4FLWA 3AG1B 3E8HA 3A0HZ 5FPRA 1T5EA 2WLKA 5B1BC 3CCRV 2EILB 3Q4HA 1CPYA 4QNHB 3AK1A 3JYCA 1WP8A 4GX1A 4EFBA 3ABKB 5CA3A 2K1EA 2KKWA 4QE7A 1EBOA 1NR7A 4XDJA 2OCHA 3OUFA 2WLHA 2YIDA 4FFBA 2P22C 1BS3A 2EBOA 1YJWV 3QVNA 1NZ6A 3OMNB 1KP2A 2EIKC 4FMTA 2GTAA 3OTOO 1MMMA 1VQ6V 4Z1VA 3CS5A 5EC1C 2YI8A 1K33A 3E2EA 1MNGA 3ZRWB 1N36O 4I55A 1I94O 3B40A 1Q81W 1CXZB 1AJPA 5IJ9A 1FXKB 3E89A 2AGAA 2CTWA 3W7XA 1SQGA 1Q8IA 1SQBH 1XMQO 4X66O 2XASA 1K8AW 1N34O 3E8GA 4TV9B 4I9QA 2HP8A 3P3PA 2H3OA 3JAWB 3ZRXA 1QLEC 2XTAA 2CTRA 4BIUA 1S0VA 5CBGA 1RM1C 3KZIZ 3W7SA 1JX9A 3H01A 1QQCA 1XNRB 5L3DA 1G6UA 5LOVA 3SYAA 5KAIZ 3K08A 2ZXWB 2Q67A 1P7GA 1XDCA 1JCHA 3H1IH 3G80A 4RQFA 1AR4A 3ASOC 4CH5A 4MVMA 1M56B 2QR4A 4BAYA 3IFXA 3VBBA 5IT9N 2IH3C 3OGCC 1R73A 2UXDB 2ZINA 3OT7A 1B04A 1KUQA 4E4EA 4FFKA 3H1LH 4PA7A 1SQFA 2HHHO 2IJHA 2VS0A 1XMQB 5KA6A 4JI7O 2XAFA 3CHXA 5TISZ 4DUZO 4X66B 3H1HH 3I56V 3JD2A 4AILC 4YXWG 1VF6C 3I5DA 1IURA 3M7MX 2Z5UA 1I94B 4JZ2A 5CA1B 1G4YB 1PV0A 4PA4A 3VQXA 4OXSA 3FKSG 3WG7B 4B7EA 1K92A 2ZIMA 2WAMA 2O57A 2YXLA 2QDOA 4UCRA 1AP5A 4F6EA 4Z2WA 2JEXA 3LSUA 2ZQMA 5KMGA 3SPCA 1WB8A 5DM6V 1P49A 5FL7G 5LYJB 4WBNA 2P06A 4LBEC 1M5IA 3EXAA 1Q43A 2GV9A 2IU0A 3LNNA 3JAMN 1THZA 2F1MA 4ZI7B 5B3SB 3BPZA 3U0ZA 4GKJO 3ZS8C 2WPDG 4B08A 4DV5O 5KX5A
chains in the Genus database with same CATH topology
1EZJA 3JD3A 1R3KC 4Z1MG 1OCRC 2AHYA 4JF3A 1VQPV 1H2GA 3EFFK 4PA3A 1E79G 1RPOA 2UXNA 2W6JG 5L3BA 1JJ2U 1OCZC 2LFRA 3ZCCA 1ROPA 3MHSC 2YEVB 2QA4V 2WLLA 3BY6A 1AI7A 3I55V 4PDVA 3FYEB 4HZ3A 1MSWD 3AG2B 1GM8A 3OMAB 4G27B 2EIMC 4HAMA 5EK0A 3ZN0A 1S77D 3NXSA 3ASOB 1MG1A 4EKWA 2AHZA 3QO5A 2JK5C 2B1IA 2HVJC 1F51A 4R6ZA 1I5YA 3OM3B 4UVAA 3ABMB 2LFSA 3K3WA 5GW7A 1QBZA 3SYQA 1VQOV 1EFRG 3AG3B 2QM8A 1L1FA 5HFMA 5LGUA 3CMAV 3TCUA 2QEXV 1WPXA 1PKXA 3ZN1A 4J9ZB 4MVUA 1K97A 1RM1B 3ZMVA 3CPWU 2IJKA 3R65A 2WLIB 1TUEB 4FJCC 3ZMZA 1S3JA 1QCEA 3K79A 3CCSV 1W2BU 1F23A 3E86A 3ZJZA 2DW4A 4JAUA 1AJNA 3OEEG 3OMIB 3X2QC 1VQMV 1K5SA 1SZTA 3K04A 2GHYA 3LDCA 4RAIA 3E8FA 1NR1A 1VQ4V 4JTCB 1YI2V 4WFFA 1SESA 3SPGA 2EINC 4BW5A 2YSUB 4ASUG 3RW0A 1PD3A 5IY5B 1S76D 2D3OW 1Y66A 3ABKC 1GMGA 1COWG 4UUJC 1VQ5V 4JAVA 1V54C 3TK1A 1FS0G 5B1AC 4WCEV 2Q6AA 2EILC 5L3FA 1JPXA 3ASNB 5J9PC 2ZD9A 4E2LA 1UJWB 3CCVV 3AG3C 4WFHA 1K3EA 1BL8A 5L3EA 3IC7A 3LSQA 1DTOA 3ABMC 2JJ2G 5LGTA 3E83A 1WLEA 4MTOA 5E1AC 3D36A 1KECA 3SJQC 4FIPC 4RUFA 3FB6C 1G8MA 2FTKA 4PDLA 3W7TA 3CXCU 4X88A 1QR8A 3AG2C 1OZ0A 1LNQA 1YTFB 1M57C 2JDIG 1J95A 5H6QA 5IDJA 1P7BA 1K7DA 4MVQA 1DF5A 3AG1C 4KP4A 3F7VC 4CZZA 2OCCC 5KUKA 3CCLV 1YIJV 2XAHA 3CC4V 5BZBA 4X8AA 2EIJC 4UVBA 4G28B 4R8CA 1OCRB 2IU3A 1BHBA 2QTOA 1V54B 2OTJV 3ZRWA 2HKOA 4MTGA 1NQTA 1ENVA 1R3IC 1V55B 4JTDB 1QLEB 1XL4A 2ZXWC 3CD6V 1PL0A 2X6CA 2EIMB 4QIWF 3FB8C 1SRYA 3PJSK 3D3IA 3OW2U 4GCZA 4TT3G 5CBHA 5EBWC 3A0RA 4GT1A 1YSCA 3ZRVA 2R9RB 3OEHG 2F43G 1GO3F 3CMEV 4JGSA 2IW5A 2WLJA 1VQLV 2DWEC 1NBMG 3E35A 2KB1A 2YEVA 3ETGA 1QVGU 3OUSA 4UV8A 1DLBA 3FB5C 4XDLA 1Q7YW 1SERA 2QKSA 4WFBV 3UM7A 3G6EV 5LGNA 1AJQA 3FYIB 4RUEA 1E1QG 3WG7C 5B1OA 3LNMB 3JCZA 1Q82W 2X7RB 2P67A 1CP9A 1VQ9V 2PI4A 1MOFA 1S72V 4WF9V 1H38A 1GM9A 3BEHA 1KC8W 4MVOA 4LP8A 4MVSA 2WLLB 2OTLV 1GKFA 2H8PC 3FB7C 4X89A 2BOBC 2Q69A 2IH1C 3OR6C 4DXWA 1K4DC 2UXXA 4UV9A 4TWKA 4XBFA 1P4RA 4ZKIA 4TSFG 4XDKA 2HG5C 3G71V 5IYCO 1F4MA 1E1RG 2Z3YA 3B77A 2DYRB 2EIKB 2BOCC 4R50A 3F5WC 2HFEC 2NLJC 2W0FC 3CC7V 3GB7C 4FK5C 2X6AA 4MTFA 4LCUC 3K06A 3B8NA 2QE7G 1R6NA 4H33A 1Y4MA 2JJ1G 2DYSB 1W0JG 2C2AA 3P30A 3RBZA 3LUTB 4F4LA 2LP7A 2WLIA 5C93A 1GK9A 1HWYA 3K9AA 3HPLC 5CN0A 4PA9A 2HR3A 2DQ0A 2P90A 2IJJA 1R6KA 5B1NA 1FXKA 3B8MA 3STZC 1VQ8V 1N8RW 3AG1B 4P9OA 1NH2B 3E8HA 4P2ZA 3TETA 4DO2A 4ZBMA 3CCUV 1YITV 4I9WA 4CBCA 2Y48A 4WFGA 2WLKA 3T1CA 5B1BC 3SYCA 1DF4A 3CCEV 5LHIA 3CCRV 2IJIA 2Y69B 2EILB 4LC1A 1CPYA 4QNHB 4MTXA 3JYCA 3W7UA 4FPPA 4GX1A 1AI6A 1NH2D 3ABKB 4MSWC 5CA3A 4RO2A 1FXHA 2K1EA 3ASNC 2EINB 4RQEA 4QE7A 1EBOA 1NR7A 4XDJA 3HB3B 4UVCA 3ABUA 4MT8A 3DGEA 3OUFA 1R3LC 2WLHA 5B1AB 1YTFD 2CK3G 1F4NA 5CMUA 4QPJA 3ABLB 3CCJV 2EBOA 3K0GA 3CP1A 4GX0A 1YJWV 1S5HC 3LSSA 1OHHG 3EHBB 3T4ZA 2WLNA 3OMNB 1H8HG 1FFTB 2DQ3A 2GSMB 3ABLC 4JYBA 2A0LA 3SPHA 1JVMA 2ZR2A 1KP2A 2EIKC 2HLDG 1AROP 4FMTA 5DN6G 1KD1W 3UKMA 3GWOA 3G4SV 3ZIAG 5EC1C 1VQ6V 1NKDA 5IYBO 1K33A 4QJFB 3E2EA 1CEZA 3RVZA 1YJNV 2DWDC 1K9MW 4P9PA 3ZRWB 1B6QA 1BMFG 2EJRA 2X6BA 1Q86W 1GM7A 1Q81W 1MABG 3QO7A 3CCQV 1AJPA 3WFVA 1PNKA 1FXKB 2MK3A 3E89A 4G2KA 1K73W 4JTAB 3W7XA 5EC2C 4PA6A 1VQ7V 2V1DA 5EBMC 5LBQA 1PNLA 1M90W 3KG2A 3VOUA 3K0DA 1NVPD 4N21A 3IGAC 1QVFU 1K4CC 2XASA 1KKDA 1K8AW 5B1BB 5EBLC 3ZMUA 4MW3A 3X2QB 1OCOC 3STLC 5L3GA 3E8GA 1M9NA 3ZRSA 3ABTA 4U7NA 2ZR3A 3ZRXA 1SETA 1KP3A 2ZDIA 1QLEC 3OFNG 3AEIA 4BIUA 4MVRA 2WSSG 1ZWIC 1S0VA 1K34A 4KUMA 4BIZA 5CBGA 1RM1C 3ZMSA 2DYSC 2JEUA 3W7SA 1JX9A 4JPRA 3E8BA 3H01A 3P32A 5L3DA 2A79B 3SYAA 2EIJB 4GX5A 3K08A 1M56C 2ZXWB 2Q67A 2XAJA 5CBFA 1V55C 2EZPA 1FXKC 3CYOA 2OCCB 5H6RA 4QPKA 3AG4B 1JCHA 2DYRC 3MHHC 4N23A 3QO8A 4WFEA 2XAGA 3CCMV 4JASA 3T2MA 3SYPA 5B3SC 4RQFA 3ASOC 4MW8A 2H94A 2EZOA 4MVZA 4MVMA 1M56B 1M57B 2NNUA 2XNDG 1RPRA 4BAYA 2JIZG 3IFXA 3VBBA 3JD0A 2IH3C 3OGCC 1R73A 1QR9A 1AI5A 1OCOB 2A9HA 3W7WA 2HJFC 2XAQA 1OCZB 2ATKC 3LDDA 1JQ0A 4PA7A 1IXMA 2V7QG 4P30A 2OT5A 1W0KG 1JOYA 4MS2A 2IJHA 5IYDO 2HVKC 4H37A 1VQKV 5KUMA 5KA6A 1R3JC 2XAFA 2ITDC 1M1KW 4R7CA 3DTUB 3SPIA 1XL6A 4PELA 4JYCA 1OCCB 4GX2A 2PI5A 3OAAG 2WWWA 2M7WA 3I56V 4U7OA 4UXNA 3JD2A 4J9YB 5HFLA 4YXWG 1YJ9V 2Q68A 3ML0A 3RVYA 1GTOA 2Z5UA 1I5XA 3MD0A 3QNEA 3ETEA 1G4YB 2QM7A 4PA4A 5IY5C 2XOKG 2P6JA 3LDEA 4OXSA 3FKSG 1OCCC 4KFMA 3WG7B 1NVPB 1KQSU 3ETDA 5LHGA 2W6IG 3M99B 1K92A 1FXVA 2WAMA 1AI4A 3OE7G 3SYOA 1QLNA 2ITCC 2X0LA 1VQNV 4I5SA 1BHAA 2ZDIC 4QE9A 4PDMA 2B1GA 3F7YC 2JEXA 4WFAV 3SPJA 3T4DA 2ZQMA 2P7TC 5H9CA 3SPCA 2R9IA 5DM6V 4PDRA 5LHHA 5FL7G 1ORQC 1K5QA 4LBEC 1AR1B 3JD4A 5KA5A 2IU0A 3OR7C 3K03A 1NJIW 1THZA 4L87A 3CC2V 5B3SB 3ZMTA 1PNMA 3AG4C 4Q20A 5L3CA 1YHQV 2WPDG 3JD1A 2B5UA 2Y69C 2WLMA 4HYOA 1H8EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7B A;  1R3K C;  1OCR C;  4MVR A;  4PA9 A;  2AHY A;  4MVQ A;  1ZWI C;  5CBG A;  3EFF K;  3AG1 C;  4PA3 A;  3F7V C;  2DYS C;  2OCC C;  5KUK A;  3E8B A;  3STZ C;  2A79 B;  5BZB A;  4X8A A;  3SYA A;  4P9O A;  2EIJ C;  4GX5 A;  3E8H A;  1OCZ C;  3K08 A;  4G28 B;  1M56 C;  4R8C A;  4P2Z A;  3TET A;  2Q67 A;  2WLL A;  5CBF A;  1V55 C;  4ZBM A;  2QTO A;  4I9W A;  4PDV A;  4HZ3 A;  2DYR C;  4CBC A;  4WFE A;  4MTG A;  4WFG A;  4G27 B;  2EIM C;  2WLK A;  5EK0 A;  3T1C A;  1R3I C;  5B1B C;  3SYC A;  3T2M A;  4JTD B;  3SYP A;  1XL4 A;  5B3S C;  3ASO C;  4MW8 A;  4MVZ A;  4EKW A;  2ZXW C;  4MVM A;  4QNH B;  2AHZ A;  2X6C A;  2JK5 C;  2HVJ C;  3JYC A;  3FB8 C;  3PJS K;  4R6Z A;  3IFX A;  4GX1 A;  2IH3 C;  3OGC C;  5CBH A;  5EBW C;  4MSW C;  2A9H A;  2HJF C;  4RO2 A;  3SYQ A;  2R9R B;  2K1E A;  3TCU A;  2ATK C;  3ASN C;  3LDD A;  4PA7 A;  2WLJ A;  4P30 A;  4J9Z B;  4MVU A;  4QE7 A;  4XDJ A;  4MS2 A;  2DWE C;  2KB1 A;  2YEV A;  2HVK C;  1R3L C;  2WLH A;  3OUF A;  4H37 A;  5KUM A;  3R65 A;  2WLI B;  3OUS A;  1R3J C;  3FB5 C;  2ITD C;  3K0G A;  2QKS A;  4GX0 A;  4R7C A;  4XDL A;  1S5H C;  3SPI A;  1XL6 A;  3UM7 A;  4GX2 A;  3T4Z A;  4RUE A;  2WLN A;  3WG7 C;  3E86 A;  3ZJZ A;  4J9Y B;  3ABL C;  2A0L A;  3SPH A;  1JVM A;  3LNM B;  3X2Q C;  2Q68 A;  3RVY A;  3K04 A;  3LDC A;  2EIK C;  4RAI A;  1G4Y B;  3E8F A;  4PA4 A;  3UKM A;  5IY5 C;  4JTC B;  4WFF A;  3SPG A;  2EIN C;  3LDE A;  4OXS A;  5EC1 C;  4BW5 A;  1OCC C;  4KFM A;  3BEH A;  3RW0 A;  3RVZ A;  4MVO A;  2DWD C;  4LP8 A;  4MVS A;  2WLL B;  4P9P A;  2X6B A;  3SYO A;  3ABK C;  2ITC C;  2H8P C;  4UUJ C;  3FB7 C;  4X89 A;  2BOB C;  2Q69 A;  1V54 C;  2IH1 C;  4QE9 A;  4PDM A;  5B1A C;  3OR6 C;  2Q6A A;  1K4D C;  3F7Y C;  4DXW A;  3E89 A;  2EIL C;  4TWK A;  3SPJ A;  3T4D A;  2ZD9 A;  4JTA B;  5J9P C;  5EC2 C;  4PA6 A;  5EBM C;  3AG3 C;  2HG5 C;  4WFH A;  2P7T C;  4XDK A;  3SPC A;  1BL8 A;  3KG2 A;  4HYO A;  3VOU A;  3ABM C;  2BOC C;  4PDR A;  4R50 A;  3F5W C;  3K0D A;  2HFE C;  2NLJ C;  2W0F C;  1ORQ C;  3GB7 C;  3IGA C;  4LBE C;  3E83 A;  2X6A A;  4MTF A;  4MTO A;  5E1A C;  4LCU C;  3K06 A;  3SJQ C;  1K4C C;  3OR7 C;  3K03 A;  1KKD A;  4RUF A;  3FB6 C;  5EBL C;  4H33 A;  4MW3 A;  1OCO C;  4PDL A;  3STL C;  3E8G A;  4X88 A;  3ZRS A;  3AG4 C;  3RBZ A;  3LUT B;  3AG2 C;  4F4L A;  2WLI A;  2Y69 C;  1LNQ A;  2WLM A;  1M57 C;  1QLE C;  3HPL C;  1J95 A; 
#chains in the Genus database with same CATH topology
 1OCR C;  2AHY A;  4DV2 B;  3EFF K;  3K57 A;  1E79 G;  2Y0I A;  3QF7 A;  1SQX H;  1FKA O;  4B3S O;  3B2E E;  4B3M B;  2ZE8 A;  1BGY H;  1OCZ C;  3ZCC A;  1HNZ O;  2WLL A;  1H2L A;  3I55 V;  4HZ3 A;  4X62 O;  4H0L B;  2P5O A;  5BR8 O;  1ZTE A;  4LNU B;  5JQG A;  4U3J B;  2NN4 A;  3JAS B;  4B3T O;  5GW7 A;  1OJH A;  1EFR G;  5EZY A;  3AG3 B;  4X1K A;  5LGU A;  3TCU A;  1WP7 A;  1PKX A;  5IWA B;  3ZN1 A;  4MVU A;  4ABM A;  3ZMV A;  2AZ0 A;  4IYH A;  2Q9L A;  4IL6 Z;  1QCE A;  2VQF O;  5D5P A;  1W2B U;  1F23 A;  2QWO B;  3E86 A;  3ZJZ A;  1Y76 B;  3OEE G;  1VQM V;  2OYQ A;  4ZOL B;  5DED A;  2F66 C;  4X1I B;  4X62 B;  3RW0 A;  5IY5 B;  1Z2G A;  2Y0P A;  2D3O W;  2CH7 B;  3ZHU A;  4JAV A;  4CH4 A;  3J81 N;  3JAR B;  5B1A C;  4WCE V;  4DR1 B;  3ASN B;  3HKB B;  1EM1 A;  2ZD9 A;  4UB8 Z;  2UUA O;  5JCO A;  5LMU O;  5IJ0 A;  2N05 A;  1XNQ B;  1ZLZ A;  3ABM C;  4O2B A;  5JH7 A;  5IYZ B;  3IC9 A;  1U97 A;  3L71 H;  3D36 A;  1KEC A;  2CTQ A;  3O9O A;  1PPJ H;  4PDL A;  3W7T A;  3CXC U;  4X88 A;  2PF4 E;  3G6B A;  2QWN B;  4GKJ B;  4K0K B;  2D2C B;  2KG7 B;  1LNQ A;  1IXB A;  1NTK H;  2CTP A;  4OPA A;  1YTF B;  3L9D A;  2JS5 A;  5H6Q A;  4GYC B;  1K7D A;  3SJA C;  4MVQ A;  1IBL O;  1DF5 A;  4L8J A;  2QSA A;  2OCC C;  1KBH A;  4GLX A;  5EIB C;  5BZB A;  4GZR B;  4OX9 B;  2BCC H;  3TGU H;  1OCR B;  2IU3 A;  2Q0O C;  2YC0 A;  4W4L A;  4K8Z A;  3HKE A;  4K8X A;  1BHB A;  1SQV H;  2OTJ V;  3ZRW A;  5LA6 A;  4J42 A;  4LF7 B;  1ENV A;  2QGN A;  4JTD B;  4JI3 O;  1XL4 A;  4YHH O;  2ZXW C;  2JGD A;  2QJ1 A;  3JAL A;  3CD6 V;  1PL0 A;  4O2A B;  3ZHT A;  4QIW F;  4GCZ A;  5EBW C;  1ZAU A;  4X9Q A;  1D2D A;  1XMO O;  2EUL A;  2R9R B;  3OEH G;  2IW5 A;  2YI9 A;  2ZM6 B;  1U96 A;  2KB1 A;  1Y76 A;  1QVG U;  3OUS A;  3FB5 C;  1Q7Y W;  1SER A;  4O2B B;  1YVW A;  3UM7 A;  2VQF B;  2RJZ A;  3FYI B;  4LF5 O;  3WG7 C;  3SR2 C;  3LNM B;  3JCZ A;  3U11 A;  2P67 A;  1CP9 A;  1AB3 A;  5ITZ B;  1IDS A;  4J11 A;  1AP6 A;  4O4L A;  1GKF A;  2H8P C;  4DR7 O;  2M6Y A;  2F23 A;  3OR6 C;  4DXW A;  1K4D C;  1P4R A;  4XDK A;  3BHP A;  2Z3Y A;  2EIK B;  2BOC C;  2GUZ A;  4R50 A;  4DR5 B;  2HFE C;  2W0F C;  3CC7 V;  1J5E B;  4FLT A;  3GB7 C;  3OD4 A;  2DOS A;  1HNZ B;  1TVK A;  1SZX A;  2VWJ A;  3K06 A;  2DYS B;  2C2A A;  3P30 A;  4F4L A;  1Q6H A;  1GK9 A;  2N74 A;  4AHC A;  4PA9 A;  4X65 O;  3C3S A;  2PTM A;  4AQY O;  1FXK A;  4JI6 B;  4DV6 O;  4GKK B;  4TV8 A;  3APQ A;  3JAL B;  4DO2 A;  1NI8 A;  1NTZ H;  2KQX A;  1EN4 A;  3CCU V;  1S5J A;  2Y48 A;  3S3X A;  4WFG A;  5J2U B;  2E5L O;  4DV4 B;  2IJI A;  2Y69 B;  4RWU A;  1NH2 D;  1Y6X A;  2E5L B;  4RO2 A;  1B3Q A;  4I55 B;  3ASN C;  2ZCE A;  2EIN B;  2ILM A;  4UVC A;  4MT8 A;  3DGE A;  3H9V A;  4I0X A;  3CCJ V;  4GX0 A;  3LSS A;  2KG7 A;  4DUZ B;  3EHB B;  2WLN A;  1XI1 A;  4X65 B;  4DK1 A;  2GSM B;  2AXT Z;  4PJ0 Z;  2HLD G;  1ARO P;  4HNA B;  1XNQ O;  1Q3E A;  3UKM A;  5KHK A;  3GWO A;  4LF4 B;  5IYB O;  3BVO A;  2UXC O;  1CEZ A;  3BRC A;  1Q86 W;  4DK0 A;  4J41 A;  4DR4 O;  1MAB G;  3QO7 A;  3UT5 B;  3N2G A;  4G2K A;  5EC2 C;  3H1J H;  1YF2 A;  4DV7 O;  2ZNI A;  1NVP D;  4N21 A;  2L35 A;  5GON A;  2P4V A;  1ZL8 B;  2BTQ A;  1K4C C;  2QTS A;  3X2Q B;  5EYP A;  3STL C;  5L3G A;  3ZRS A;  2Q8V A;  2YS8 A;  4U7N A;  2ZR3 A;  1PL4 A;  3JAK B;  1KP3 A;  4LH6 A;  3CB2 A;  2BTO A;  3O65 A;  1NU1 H;  1K34 A;  4BIZ A;  4LFB O;  3ZMS A;  2DYS C;  3E8B A;  4DUY O;  5JCO C;  4F6R A;  5CBF A;  2EZP A;  3CYO A;  2Q4P A;  2OCC B;  5H6R A;  2YXY A;  4QPK A;  3MHH C;  5A9G A;  2XAG A;  4H13 B;  2E74 B;  1XMO B;  4FM0 A;  4MVZ A;  2EZO A;  4HNA A;  1M57 B;  2A9H A;  2QKA A;  3W7W A;  4JI3 B;  2HJF C;  3CRA A;  4KXR A;  1FFX B;  2ATK C;  4FLU A;  4DV5 B;  1IXM A;  2V7Q G;  1W0K G;  2ZIO A;  4MS2 A;  1JOY A;  1IBL B;  2UUC B;  1W59 A;  5KUM A;  3HKD B;  1H2N A;  2ITD C;  4R7C A;  4I4T B;  1XL6 A;  4GX2 A;  4DR3 B;  2WWW A;  2M7W A;  2EJ7 A;  1OV9 A;  4UXN A;  5HFL A;  1KB9 F;  1KKC A;  3ML0 A;  5B66 Z;  1I5X A;  2FYU H;  2QM7 A;  5FLX N;  4DR3 O;  2P6J A;  3H1K H;  4KFM A;  1KQS U;  2W6I G;  4JV5 B;  4NR1 A;  4JI0 O;  3SYO A;  3OE7 G;  1QLN A;  2R9A A;  4LWS B;  3JSN A;  4I5S A;  3CRC A;  5J2U A;  1BHA A;  2ZDI C;  2NR5 A;  1IBM B;  2N04 A;  2F93 B;  2F4V O;  3BAA A;  3T4D A;  2DN9 A;  4AI8 A;  5LMU B;  2CUG A;  5H9C A;  2R9I A;  4IHJ B;  1X59 A;  1P84 F;  3T1H B;  1ORQ C;  1K5Q A;  2V4D A;  4PHZ A;  5IJ0 B;  5JVD A;  3ZX6 A;  1YZB A;  1ZUQ A;  1PNM A;  2YDE A;  4Q20 A;  2B5U A;  3TJT A;  4JI4 O;  1SQQ H;  1H8E G;  2CH7 A;  3JD3 A;  2B9Z A;  3F5T A;  1H2G A;  1RPO A;  4X1K B;  1KMI Z;  1JJ2 U;  2LJ2 A;  3HR0 A;  4EEQ A;  3MHS C;  2HEP A;  4B3R B;  1H2M A;  1AI7 A;  1DK1 A;  3FYE B;  2FB5 A;  4PV1 B;  1IZ3 A;  1GM8 A;  3OMA B;  3U10 A;  3TXS A;  4TV9 A;  3RYH B;  1MG1 A;  3QO5 A;  2UXB O;  1KYO F;  1WJZ A;  1F51 A;  1Q6I A;  3VQV A;  5JJJ B;  1X4T A;  4UVA A;  5J2T B;  3K3W A;  3NR7 A;  3SGI A;  3T1H O;  2QEX V;  4B3S B;  1WPX A;  4DV2 O;  3ZED A;  1IBM O;  2WLI B;  1TUE B;  4B3M O;  1S3J A;  4LF4 O;  2GBO A;  4JV5 O;  1K5S A;  1SZT A;  3LDC A;  2JGD B;  4O2A A;  3E8F A;  4WFF A;  1SES A;  3SPG A;  2YSU B;  3JCU Z;  5D5Q A;  5LP6 C;  1GMG A;  4LFA O;  4LFC O;  4OPH A;  1V54 C;  5LYJ A;  5L3F A;  3WB1 A;  3A8T A;  4WFH A;  3WB0 A;  3L72 H;  1BL8 A;  5L3E A;  3IC7 A;  2CE4 A;  3FFQ A;  5C8Y A;  3VQY A;  1WLE A;  2LGW A;  3SJQ C;  3S3W A;  1SA0 B;  2LQT A;  4RUF A;  4ZHQ A;  3RYH A;  5KHI A;  1Z5V A;  4Q6G A;  2R72 A;  4NYK A;  4FFB B;  1OZ0 A;  1PP9 H;  2F95 B;  4JI7 B;  1LUW A;  4OGQ B;  2JDI G;  4JYY A;  2QM4 A;  4KP4 A;  3F7V C;  4AQY B;  1YIJ V;  4JI2 O;  5CA1 A;  1N0N A;  1HNW B;  1O9H A;  3WU2 Z;  4UVB A;  4NTW A;  4KHP O;  4R8C A;  3A2F A;  1IBK B;  1Z5W A;  5H2F Z;  1V54 B;  1V55 B;  1QLE B;  3BFR A;  3N2G B;  5EZY B;  4I50 A;  2X6C A;  5DEC A;  1SRY A;  5CBH A;  1N32 O;  4YJ2 A;  3A0R A;  1YSC A;  1Y74 B;  3JSL A;  3RYF B;  4O4L B;  4UCO A;  2F43 G;  3B09 A;  3CME V;  1Q5O A;  4JGS A;  2AZ2 A;  1SS3 A;  1A32 A;  2BTQ B;  2DWE C;  1NBM G;  4DV3 B;  2RCV A;  4UV8 A;  1DLB A;  4NXN O;  3RT3 C;  1GN4 A;  5LA6 B;  5KX5 B;  4DV0 O;  4LNU A;  4EFE A;  2PGG A;  1GM9 A;  3BEH A;  1IVS A;  4MVO A;  1F7Y A;  2WLL B;  4DW1 A;  1HNW O;  3OGI B;  3JAW A;  1XOU A;  1NS1 A;  3P3N A;  3FB7 C;  4X89 A;  1NTM H;  2BOB C;  2IH1 C;  5K1X A;  1N33 O;  5H5N A;  4X64 B;  5IYC O;  1F4M A;  3B77 A;  2NLJ C;  3PN1 A;  4FK5 C;  4H44 B;  1TUB A;  1EZV H;  4JYA B;  4JI0 B;  4O4J A;  1H2S B;  3DXR A;  4FLY A;  1VF5 B;  1W0J G;  1VAR A;  3OTO B;  2WLI A;  3K9A A;  1I7F A;  3HPL C;  4CS4 A;  2LGQ A;  4UFZ A;  3K58 A;  2IJJ A;  1R6K A;  5B1N A;  4U3F H;  5LMN O;  1FFX A;  1N8R W;  4P9O A;  4P2Z A;  3TET A;  4DYL A;  3N27 A;  3IJ4 A;  1YIT V;  4I9W A;  4QGP A;  4EB6 B;  3T1C A;  3CCE V;  4PD4 F;  4NKG B;  5EIB D;  2UUA B;  3ZHR A;  4FPP A;  2PYJ A;  2UUB O;  4MSW C;  1QHT A;  5LP6 B;  1J5E O;  3CRR A;  2UXB B;  4LF9 B;  4RQE A;  3HB3 B;  5J2T A;  5B1A B;  1YTF D;  1F4N A;  4HBN A;  4QPJ A;  3K0G A;  3K5N A;  4DUY B;  4LF6 O;  2GUZ B;  1AVM A;  3MDS A;  3T4Z A;  4LH7 A;  1FFT B;  2DQ3 A;  3L70 H;  3KCY A;  2ZR2 A;  2Z0A A;  3E22 B;  5DN6 G;  1KD1 W;  4UCT A;  3G4S V;  1NKD A;  4QJF B;  3RVZ A;  2Q7H A;  2DWD C;  1IBK O;  1EN5 A;  3L74 H;  2EJR A;  2X6B A;  2ZE7 A;  1YCI A;  4ICG A;  3CCQ V;  4YY3 B;  3WFV A;  1PNK A;  3AK2 A;  2MK3 A;  1K73 W;  5JQG B;  1D5A A;  2R70 A;  1VQ7 V;  3VQW A;  5EBM C;  5LBQ A;  3DC5 A;  2ZM6 O;  3JAS A;  1M90 W;  4X1Y B;  3VOU A;  3K0D A;  3IGA C;  1VF7 A;  1QVF U;  4LF8 O;  3HKC B;  4FLX A;  3ZMU A;  2IBZ H;  4MW3 A;  1OCO C;  4W4K A;  1M9N A;  1XUQ A;  1N4C A;  3ABT A;  1JFF B;  1SET A;  2PZS A;  2ZKO A;  2ZDI A;  2JVD A;  1SA0 A;  3OFN G;  4ZHQ B;  3AEI A;  4MVR A;  3DC6 A;  4LWS A;  3KCX A;  2JEU A;  2CAZ C;  1XRE A;  2YUA A;  1L0L H;  3C3T A;  2BSK A;  3SJC C;  2ADQ B;  4BW9 A;  3AG4 B;  2DYR C;  3N2K A;  1RP3 B;  5BMV B;  4JAS A;  5KHH A;  5B3S C;  4MW8 A;  2L6L A;  3JAR A;  3JD0 A;  4FLV A;  3R66 A;  2UUC O;  1HR0 B;  4UCU A;  5JJE B;  3LDD A;  1JQ0 A;  1KU9 A;  4O4H B;  3ETQ A;  4TV8 B;  1HNX O;  4D7T A;  1VEW A;  3DTU B;  3E22 A;  3SPI A;  4PEL A;  4JYC A;  3OAA G;  4J9Y B;  4PI0 A;  1VMG A;  1GTO A;  3MD0 A;  3QNE A;  3UO2 A;  3LDE A;  1OCC C;  1NVP B;  3ETD A;  3M99 B;  2VQE O;  1FXV A;  1Q6U A;  2ITC C;  1XIL A;  5JWP A;  4PDM A;  2B1G A;  3F7Y C;  4LF6 B;  2DMX A;  2P7T C;  3HKC A;  4DV1 B;  3RYF A;  1AR1 B;  3JD4 A;  3FAV A;  2VRZ A;  1BZK A;  3OR7 C;  4L87 A;  3CX5 F;  3ZMT A;  1XHZ A;  3SJB C;  5KHJ A;  4ZIB A;  5L3C A;  1YHQ V;  3J7A U;  4LF9 O;  1WA8 B;  2WLM A;  4U3J A;  3T1Y B;  1EZJ A;  1R3K C;  4JF3 A;  3CXH F;  3B4S A;  5JJN B;  5F2V O;  4K3A A;  2W6J G;  4IHJ A;  2XT9 A;  5L3B A;  1MZE A;  2UXC B;  2LFR A;  1I08 A;  2QA4 V;  1BE3 H;  3BY6 A;  3ZBH A;  3AG2 B;  5CB4 B;  4G27 B;  2EIM C;  2JRI A;  4HAM A;  2PYL A;  1S77 D;  3RWR D;  3ZHS A;  2LW1 A;  3FX7 A;  4TOI A;  2HVJ C;  4R6Z A;  5KLV H;  5LMN B;  1I5Y A;  3ABM B;  2LFS A;  1QBZ A;  1VQO V;  1IX9 A;  4X20 A;  1H2K A;  3M8A A;  3IAY A;  4J9Z B;  4C7U A;  1K97 A;  2XUM A;  4JZG A;  1LR1 A;  3K5O A;  3R65 A;  1UPG A;  1RSO A;  2VWK A;  3K79 A;  4UCS A;  1SF9 A;  1GN3 A;  2BE3 A;  1AJN A;  3X2Q C;  5C8Y B;  4GUN A;  2GHY A;  4B7K A;  4K0K O;  4BW5 A;  2EIN C;  1PD3 A;  3BCC H;  2RMK B;  4X20 B;  1S76 D;  1TAE A;  4JI8 O;  1COW G;  2A7W A;  4UUJ C;  1VQ5 V;  3TK1 A;  4DV0 B;  2Q6A A;  5J9P C;  4E2L A;  3CCV V;  3AG3 C;  1K3E A;  1NT2 B;  1SKV A;  4FM2 A;  4DR5 O;  2E3C A;  2JJ2 G;  3E83 A;  4MTO A;  4X1I A;  4NXN B;  4FIP C;  3FB6 C;  2FTK A;  3AG2 C;  1ZL8 A;  2RQ6 A;  1YEW A;  1M57 C;  4J80 A;  1J95 A;  1P7B A;  1Y74 A;  1BCC H;  3KKY A;  3AG1 C;  4CZZ A;  3CCL V;  5KUK A;  2XAH A;  3TXQ A;  1QNM A;  2JGU A;  2EIJ C;  4G28 B;  2Q5Z A;  1FJG B;  4NVP A;  2Q0A A;  2VQE B;  2QTO A;  2PUS A;  1R6T A;  1WPB A;  3UQ8 A;  4MTG A;  5LOV B;  1NQT A;  4DR2 O;  1BSM A;  1R3I C;  2ETN A;  4KHP B;  2IM9 A;  3FB8 C;  3PJS K;  3D3I A;  4O4H A;  4JI8 B;  3ZRV A;  1JMK C;  1GO3 F;  5IE9 A;  3ETG A;  2F4V B;  4XDL A;  2QKS A;  5LGN A;  2G38 A;  4OX9 O;  1E1Q G;  4J7Z A;  5B1O A;  5E79 Z;  1Q82 W;  4LFA B;  2X7R B;  2RNB A;  1XEQ A;  3MAQ A;  2GDS A;  1VQ9 V;  2PI4 A;  1S72 V;  4WF9 V;  1H38 A;  4KL1 A;  3K5M A;  4MVS A;  3J80 N;  4LFC B;  2OTL V;  3K9S A;  1HW7 A;  4DV6 B;  4GKK O;  2Q69 A;  5BMV A;  4UV9 A;  3G71 V;  2UU9 B;  3K59 A;  1GRJ A;  2DE0 X;  3F5W C;  3D8C A;  2X6A A;  4MTF A;  3B8N A;  5GTH Z;  1WN7 A;  1ZX3 A;  4WBN B;  5C93 A;  1HWY A;  3D36 C;  3T1Y O;  5CN0 A;  4IIJ A;  2P90 A;  4DW0 A;  2AW9 A;  1EN6 A;  3STZ C;  4BIO A;  3JAK A;  1YXB A;  4YY3 O;  4DR7 B;  5CB4 A;  1BQZ A;  1NH2 B;  2QWQ B;  5JH7 B;  3JAT B;  4X1Y A;  4NXM O;  1LUV A;  4ZBM A;  3UO3 A;  2HHH B;  5LXT B;  4CBC A;  2PY5 A;  2E76 B;  3SYC A;  1DF4 A;  1TA8 A;  5LHI A;  5BY1 A;  5FNV A;  4LC1 A;  4F6R B;  5EYP B;  4MTX A;  3W7U A;  4LF5 B;  1AI6 A;  5ITZ A;  4B3T B;  3RN4 A;  2Q7G A;  1SQP H;  1FXH A;  3FAV B;  2YIA A;  5BR8 B;  4JI4 B;  3APO A;  1S5L Z;  1M4U A;  3ABU A;  1R3L C;  3OTF A;  1WB7 A;  2CK3 G;  5CMU A;  2LW7 A;  3ABL B;  3CP1 A;  1S5H C;  4DR4 B;  1OHH G;  2ZE6 A;  3UCS C;  5FPO A;  1H8H G;  2EX3 A;  3ABL C;  2Y4U A;  2A0L A;  4JYB A;  1JVM A;  3SPH A;  1HNX B;  3RFR A;  4LF7 O;  3ZIA G;  3HKE B;  1YJN V;  1K9M W;  4P9P A;  1B6Q A;  1BMF G;  4IIJ B;  2MW2 B;  1I0H A;  1GM7 A;  4YJ3 A;  4I0X B;  3RYI A;  4JI5 O;  3WB2 A;  5A2Q N;  4JTA B;  4PA6 A;  1VF6 A;  2LO1 A;  2V1D A;  1AR5 A;  1PNL A;  3KG2 A;  3K5L A;  4DR6 O;  3DXR B;  2FML A;  5AG2 A;  2BSK B;  2QKC A;  4FVM A;  1KKD A;  4CS3 A;  5B1B B;  5EBL C;  4BR6 A;  3GWK C;  4DRX B;  4DV4 O;  1O9G A;  3CWB H;  4CC6 A;  1DGS A;  3CRM A;  2WSS G;  1ZWI C;  4KUM A;  3C90 A;  4X64 O;  1VIB A;  4JPR A;  2CDY A;  3AG7 A;  3P32 A;  2A79 B;  2GTS A;  2EIJ B;  4GX5 A;  3HKD A;  1M56 C;  1UFI A;  2DJV A;  5KHG A;  2XAJ A;  1TUB B;  1V55 C;  1FXK C;  2XHB A;  1D5N A;  4N23 A;  4I4T A;  3QO8 A;  4WFE A;  3ZHQ A;  3CCM V;  3T2M A;  3SYP A;  4BWA A;  2H94 A;  2NNU A;  3GVM A;  1N0J A;  2XND G;  1RPR A;  2JIZ G;  1PM9 A;  1QR9 A;  1AI5 A;  1OCO B;  3RGB A;  2JS3 A;  4LFB B;  2RN9 A;  2XAQ A;  1OCZ B;  1JR9 A;  2A3Q A;  4TUY B;  1GN2 A;  4P30 A;  3CSX A;  2OT5 A;  3JAT A;  4IYI A;  4DV3 O;  4YJ2 B;  5IYD O;  2HVK C;  4H37 A;  1VQK V;  2UXD O;  1R3J C;  3HKB A;  1M1K W;  1OCC B;  5K1P A;  2OIE A;  2WA4 A;  2PI5 A;  5GON B;  1N32 B;  4U7O A;  4JI1 B;  1YJ9 V;  4IT5 A;  3RVY A;  5JVD B;  2Q68 A;  1US6 A;  3ETE A;  5IY5 C;  2XOK G;  2Q73 A;  5LHG A;  3RYC A;  4K35 A;  4ZOL A;  5LXT A;  1FAF A;  2K9P A;  3SDL A;  1AI4 A;  1FPO A;  2UUB B;  4EB6 A;  2X0L A;  1VQN V;  4QE9 A;  4WFA V;  3SPJ A;  1GN6 A;  4JI2 B;  1QU7 A;  1VP7 A;  4FM1 A;  4PDR A;  4A5U B;  5LHH A;  1N34 B;  2YXH A;  2ZNJ A;  2QWR B;  4FZ0 A;  1R1B A;  4DRX A;  3N2K B;  5KA5 A;  2CGO A;  3AK3 A;  4FZ1 A;  3K03 A;  1NJI W;  3CC2 V;  4YIO A;  5KAF Z;  5CA0 A;  3AG4 C;  4JAA A;  4CH6 A;  3JD1 A;  2Y69 C;  4HYO A;  4Z1M G;  1VQP V;  1L8D A;  4PA3 A;  3QTC A;  1N36 B;  2UXN A;  3ICX A;  1XHX A;  1ROP A;  2Q7E A;  2YEV B;  3BAB A;  1RSO B;  4JI6 O;  4PDV A;  1MSW D;  4DR6 B;  5EK0 A;  3ZN0 A;  5IJ9 B;  3NXS A;  1SC5 B;  3ASO B;  4EKW A;  2AHZ A;  2JK5 C;  2B1I A;  1JJO A;  3BA9 A;  3OM3 B;  2OIG A;  3D3Q A;  4CS2 A;  3SYQ A;  4UCV A;  3THO A;  1L1F A;  2QM8 A;  5HFM A;  3CMA V;  4JI5 B;  2RDC A;  4O4J B;  1YDX A;  1XBL A;  1RM1 B;  3CPW U;  2IJK A;  3FD9 A;  1MSD A;  4FJC C;  3CJH A;  3ZMZ A;  3CCS V;  2DW4 A;  4JAU A;  4FLZ A;  3OMI B;  3RYC B;  3K04 A;  4RAI A;  5BXZ A;  1AIL A;  1NR1 A;  1VQ4 V;  1G1X B;  4JTC B;  1YI2 V;  2HJD A;  2ZE5 A;  4ASU G;  2WA3 A;  1WA8 A;  4B3R O;  1MA1 A;  5B5E Z;  1WNS A;  2ADP A;  3L75 H;  1Y66 A;  3ABK C;  4J7J A;  1XNR O;  4DV1 O;  1FS0 G;  1Y67 A;  1URF A;  1M93 A;  2EIL C;  1JPX A;  2QWP B;  4IGG A;  1GAX A;  1BT8 A;  1UJW B;  2KSD A;  4CH3 A;  1FYJ A;  3LSQ A;  1DTO A;  3UT5 A;  5LGT A;  4D6T H;  4NXM B;  4CC5 A;  5LL6 Y;  2ZT9 B;  5E1A C;  4TQD A;  1G8M A;  1QR8 A;  2P4K A;  4I50 B;  3G67 A;  1ZSP A;  5IDJ A;  2FKX A;  3CC4 V;  5LP6 A;  1B06 A;  4TQF A;  4X8A A;  3BA8 A;  1HR0 O;  4YHH B;  4YIP A;  1V9P A;  2YIB D;  4ZI7 A;  2HKO A;  2UU9 O;  4YJ3 B;  4LR3 A;  2EIM B;  1HP8 A;  3OW2 U;  3EVK A;  3CE2 A;  2E75 B;  4TT3 G;  5KMG B;  3DSQ A;  3L73 H;  4GT1 A;  2WLJ A;  1VQL V;  3E35 A;  2YEV A;  3ZHV A;  3RYI B;  1JFF A;  2YIB A;  1FD9 A;  1RFY A;  4WFB V;  1TGO A;  3G6E V;  4JYA O;  1AJQ A;  1MZF A;  2Y4T A;  4RUE A;  3CEI A;  1L0N H;  2FL4 A;  3Q4H B;  1TVK B;  4LF8 B;  4UB6 Z;  5GTI Z;  4I7Z B;  1MOF A;  4J10 A;  4DR1 O;  1N33 B;  1KC8 W;  2OWO A;  3A0B Z;  4LP8 A;  4D7S A;  2ODM A;  3CRQ A;  2CGN A;  2YIC A;  5IYZ A;  2UXX A;  4O4I B;  4TWK A;  4XBF A;  1WAZ A;  4ZKI A;  2ARH A;  4TSF G;  1BQ0 A;  2HG5 C;  1E1R G;  4J7K A;  2DYR B;  4DR2 B;  1Q90 D;  5CA0 B;  1GH6 A;  1FJG O;  4LCU C;  1XQ8 A;  2QE7 G;  1R6N A;  1HDJ A;  4H33 A;  4NB5 A;  1Y4M A;  2JJ1 G;  4PI2 A;  3RBZ A;  3LUT B;  5FNV B;  3CJH B;  2LP7 A;  3QG5 A;  5IWA O;  1JA8 A;  2W0X A;  4DV7 B;  2HR3 A;  2DQ0 A;  4NTX A;  4NTY A;  4JI1 O;  2A06 H;  3B8M A;  4O4I A;  4TUY A;  1VQ8 V;  4FLW A;  3AG1 B;  3E8H A;  3A0H Z;  5FPR A;  1T5E A;  2WLK A;  5B1B C;  3CCR V;  2EIL B;  3Q4H A;  1CPY A;  4QNH B;  3AK1 A;  3JYC A;  1WP8 A;  4GX1 A;  4EFB A;  3ABK B;  5CA3 A;  2K1E A;  2KKW A;  4QE7 A;  1EBO A;  1NR7 A;  4XDJ A;  2OCH A;  3OUF A;  2WLH A;  2YID A;  4FFB A;  2P22 C;  1BS3 A;  2EBO A;  1YJW V;  3QVN A;  1NZ6 A;  3OMN B;  1KP2 A;  2EIK C;  4FMT A;  2GTA A;  3OTO O;  1MMM A;  1VQ6 V;  4Z1V A;  3CS5 A;  5EC1 C;  2YI8 A;  1K33 A;  3E2E A;  1MNG A;  3ZRW B;  1N36 O;  4I55 A;  1I94 O;  3B40 A;  1Q81 W;  1CXZ B;  1AJP A;  5IJ9 A;  1FXK B;  3E89 A;  2AGA A;  2CTW A;  3W7X A;  1SQG A;  1Q8I A;  1SQB H;  1XMQ O;  4X66 O;  2XAS A;  1K8A W;  1N34 O;  3E8G A;  4TV9 B;  4I9Q A;  2HP8 A;  3P3P A;  2H3O A;  3JAW B;  3ZRX A;  1QLE C;  2XTA A;  2CTR A;  4BIU A;  1S0V A;  5CBG A;  1RM1 C;  3KZI Z;  3W7S A;  1JX9 A;  3H01 A;  1QQC A;  1XNR B;  5L3D A;  1G6U A;  5LOV A;  3SYA A;  5KAI Z;  3K08 A;  2ZXW B;  2Q67 A;  1P7G A;  1XDC A;  1JCH A;  3H1I H;  3G80 A;  4RQF A;  1AR4 A;  3ASO C;  4CH5 A;  4MVM A;  1M56 B;  2QR4 A;  4BAY A;  3IFX A;  3VBB A;  5IT9 N;  2IH3 C;  3OGC C;  1R73 A;  2UXD B;  2ZIN A;  3OT7 A;  1B04 A;  1KUQ A;  4E4E A;  4FFK A;  3H1L H;  4PA7 A;  1SQF A;  2HHH O;  2IJH A;  2VS0 A;  1XMQ B;  5KA6 A;  4JI7 O;  2XAF A;  3CHX A;  5TIS Z;  4DUZ O;  4X66 B;  3H1H H;  3I56 V;  3JD2 A;  4AIL C;  4YXW G;  1VF6 C;  3I5D A;  1IUR A;  3M7M X;  2Z5U A;  1I94 B;  4JZ2 A;  5CA1 B;  1G4Y B;  1PV0 A;  4PA4 A;  3VQX A;  4OXS A;  3FKS G;  3WG7 B;  4B7E A;  1K92 A;  2ZIM A;  2WAM A;  2O57 A;  2YXL A;  2QDO A;  4UCR A;  1AP5 A;  4F6E A;  4Z2W A;  2JEX A;  3LSU A;  2ZQM A;  5KMG A;  3SPC A;  1WB8 A;  5DM6 V;  1P49 A;  5FL7 G;  5LYJ B;  4WBN A;  2P06 A;  4LBE C;  1M5I A;  3EXA A;  1Q43 A;  2GV9 A;  2IU0 A;  3LNN A;  3JAM N;  1THZ A;  2F1M A;  4ZI7 B;  5B3S B;  3BPZ A;  3U0Z A;  4GKJ O;  3ZS8 C;  2WPD G;  4B08 A;  4DV5 O;  5KX5 A; 
#chains in the Genus database with same CATH homology
 1EZJ A;  3JD3 A;  1R3K C;  4Z1M G;  1OCR C;  2AHY A;  4JF3 A;  1VQP V;  1H2G A;  3EFF K;  4PA3 A;  1E79 G;  1RPO A;  2UXN A;  2W6J G;  5L3B A;  1JJ2 U;  1OCZ C;  2LFR A;  3ZCC A;  1ROP A;  3MHS C;  2YEV B;  2QA4 V;  2WLL A;  3BY6 A;  1AI7 A;  3I55 V;  4PDV A;  3FYE B;  4HZ3 A;  1MSW D;  3AG2 B;  1GM8 A;  3OMA B;  4G27 B;  2EIM C;  4HAM A;  5EK0 A;  3ZN0 A;  1S77 D;  3NXS A;  3ASO B;  1MG1 A;  4EKW A;  2AHZ A;  3QO5 A;  2JK5 C;  2B1I A;  2HVJ C;  1F51 A;  4R6Z A;  1I5Y A;  3OM3 B;  4UVA A;  3ABM B;  2LFS A;  3K3W A;  5GW7 A;  1QBZ A;  3SYQ A;  1VQO V;  1EFR G;  3AG3 B;  2QM8 A;  1L1F A;  5HFM A;  5LGU A;  3CMA V;  3TCU A;  2QEX V;  1WPX A;  1PKX A;  3ZN1 A;  4J9Z B;  4MVU A;  1K97 A;  1RM1 B;  3ZMV A;  3CPW U;  2IJK A;  3R65 A;  2WLI B;  1TUE B;  4FJC C;  3ZMZ A;  1S3J A;  1QCE A;  3K79 A;  3CCS V;  1W2B U;  1F23 A;  3E86 A;  3ZJZ A;  2DW4 A;  4JAU A;  1AJN A;  3OEE G;  3OMI B;  3X2Q C;  1VQM V;  1K5S A;  1SZT A;  3K04 A;  2GHY A;  3LDC A;  4RAI A;  3E8F A;  1NR1 A;  1VQ4 V;  4JTC B;  1YI2 V;  4WFF A;  1SES A;  3SPG A;  2EIN C;  4BW5 A;  2YSU B;  4ASU G;  3RW0 A;  1PD3 A;  5IY5 B;  1S76 D;  2D3O W;  1Y66 A;  3ABK C;  1GMG A;  1COW G;  4UUJ C;  1VQ5 V;  4JAV A;  1V54 C;  3TK1 A;  1FS0 G;  5B1A C;  4WCE V;  2Q6A A;  2EIL C;  5L3F A;  1JPX A;  3ASN B;  5J9P C;  2ZD9 A;  4E2L A;  1UJW B;  3CCV V;  3AG3 C;  4WFH A;  1K3E A;  1BL8 A;  5L3E A;  3IC7 A;  3LSQ A;  1DTO A;  3ABM C;  2JJ2 G;  5LGT A;  3E83 A;  1WLE A;  4MTO A;  5E1A C;  3D36 A;  1KEC A;  3SJQ C;  4FIP C;  4RUF A;  3FB6 C;  1G8M A;  2FTK A;  4PDL A;  3W7T A;  3CXC U;  4X88 A;  1QR8 A;  3AG2 C;  1OZ0 A;  1LNQ A;  1YTF B;  1M57 C;  2JDI G;  1J95 A;  5H6Q A;  5IDJ A;  1P7B A;  1K7D A;  4MVQ A;  1DF5 A;  3AG1 C;  4KP4 A;  3F7V C;  4CZZ A;  2OCC C;  5KUK A;  3CCL V;  1YIJ V;  2XAH A;  3CC4 V;  5BZB A;  4X8A A;  2EIJ C;  4UVB A;  4G28 B;  4R8C A;  1OCR B;  2IU3 A;  1BHB A;  2QTO A;  1V54 B;  2OTJ V;  3ZRW A;  2HKO A;  4MTG A;  1NQT A;  1ENV A;  1R3I C;  1V55 B;  4JTD B;  1QLE B;  1XL4 A;  2ZXW C;  3CD6 V;  1PL0 A;  2X6C A;  2EIM B;  4QIW F;  3FB8 C;  1SRY A;  3PJS K;  3D3I A;  3OW2 U;  4GCZ A;  4TT3 G;  5CBH A;  5EBW C;  3A0R A;  4GT1 A;  1YSC A;  3ZRV A;  2R9R B;  3OEH G;  2F43 G;  1GO3 F;  3CME V;  4JGS A;  2IW5 A;  2WLJ A;  1VQL V;  2DWE C;  1NBM G;  3E35 A;  2KB1 A;  2YEV A;  3ETG A;  1QVG U;  3OUS A;  4UV8 A;  1DLB A;  3FB5 C;  4XDL A;  1Q7Y W;  1SER A;  2QKS A;  4WFB V;  3UM7 A;  3G6E V;  5LGN A;  1AJQ A;  3FYI B;  4RUE A;  1E1Q G;  3WG7 C;  5B1O A;  3LNM B;  3JCZ A;  1Q82 W;  2X7R B;  2P67 A;  1CP9 A;  1VQ9 V;  2PI4 A;  1MOF A;  1S72 V;  4WF9 V;  1H38 A;  1GM9 A;  3BEH A;  1KC8 W;  4MVO A;  4LP8 A;  4MVS A;  2WLL B;  2OTL V;  1GKF A;  2H8P C;  3FB7 C;  4X89 A;  2BOB C;  2Q69 A;  2IH1 C;  3OR6 C;  4DXW A;  1K4D C;  2UXX A;  4UV9 A;  4TWK A;  4XBF A;  1P4R A;  4ZKI A;  4TSF G;  4XDK A;  2HG5 C;  3G71 V;  5IYC O;  1F4M A;  1E1R G;  2Z3Y A;  3B77 A;  2DYR B;  2EIK B;  2BOC C;  4R50 A;  3F5W C;  2HFE C;  2NLJ C;  2W0F C;  3CC7 V;  3GB7 C;  4FK5 C;  2X6A A;  4MTF A;  4LCU C;  3K06 A;  3B8N A;  2QE7 G;  1R6N A;  4H33 A;  1Y4M A;  2JJ1 G;  2DYS B;  1W0J G;  2C2A A;  3P30 A;  3RBZ A;  3LUT B;  4F4L A;  2LP7 A;  2WLI A;  5C93 A;  1GK9 A;  1HWY A;  3K9A A;  3HPL C;  5CN0 A;  4PA9 A;  2HR3 A;  2DQ0 A;  2P90 A;  2IJJ A;  1R6K A;  5B1N A;  1FXK A;  3B8M A;  3STZ C;  1VQ8 V;  1N8R W;  3AG1 B;  4P9O A;  1NH2 B;  3E8H A;  4P2Z A;  3TET A;  4DO2 A;  4ZBM A;  3CCU V;  1YIT V;  4I9W A;  4CBC A;  2Y48 A;  4WFG A;  2WLK A;  3T1C A;  5B1B C;  3SYC A;  1DF4 A;  3CCE V;  5LHI A;  3CCR V;  2IJI A;  2Y69 B;  2EIL B;  4LC1 A;  1CPY A;  4QNH B;  4MTX A;  3JYC A;  3W7U A;  4FPP A;  4GX1 A;  1AI6 A;  1NH2 D;  3ABK B;  4MSW C;  5CA3 A;  4RO2 A;  1FXH A;  2K1E A;  3ASN C;  2EIN B;  4RQE A;  4QE7 A;  1EBO A;  1NR7 A;  4XDJ A;  3HB3 B;  4UVC A;  3ABU A;  4MT8 A;  3DGE A;  3OUF A;  1R3L C;  2WLH A;  5B1A B;  1YTF D;  2CK3 G;  1F4N A;  5CMU A;  4QPJ A;  3ABL B;  3CCJ V;  2EBO A;  3K0G A;  3CP1 A;  4GX0 A;  1YJW V;  1S5H C;  3LSS A;  1OHH G;  3EHB B;  3T4Z A;  2WLN A;  3OMN B;  1H8H G;  1FFT B;  2DQ3 A;  2GSM B;  3ABL C;  4JYB A;  2A0L A;  3SPH A;  1JVM A;  2ZR2 A;  1KP2 A;  2EIK C;  2HLD G;  1ARO P;  4FMT A;  5DN6 G;  1KD1 W;  3UKM A;  3GWO A;  3G4S V;  3ZIA G;  5EC1 C;  1VQ6 V;  1NKD A;  5IYB O;  1K33 A;  4QJF B;  3E2E A;  1CEZ A;  3RVZ A;  1YJN V;  2DWD C;  1K9M W;  4P9P A;  3ZRW B;  1B6Q A;  1BMF G;  2EJR A;  2X6B A;  1Q86 W;  1GM7 A;  1Q81 W;  1MAB G;  3QO7 A;  3CCQ V;  1AJP A;  3WFV A;  1PNK A;  1FXK B;  2MK3 A;  3E89 A;  4G2K A;  1K73 W;  4JTA B;  3W7X A;  5EC2 C;  4PA6 A;  1VQ7 V;  2V1D A;  5EBM C;  5LBQ A;  1PNL A;  1M90 W;  3KG2 A;  3VOU A;  3K0D A;  1NVP D;  4N21 A;  3IGA C;  1QVF U;  1K4C C;  2XAS A;  1KKD A;  1K8A W;  5B1B B;  5EBL C;  3ZMU A;  4MW3 A;  3X2Q B;  1OCO C;  3STL C;  5L3G A;  3E8G A;  1M9N A;  3ZRS A;  3ABT A;  4U7N A;  2ZR3 A;  3ZRX A;  1SET A;  1KP3 A;  2ZDI A;  1QLE C;  3OFN G;  3AEI A;  4BIU A;  4MVR A;  2WSS G;  1ZWI C;  1S0V A;  1K34 A;  4KUM A;  4BIZ A;  5CBG A;  1RM1 C;  3ZMS A;  2DYS C;  2JEU A;  3W7S A;  1JX9 A;  4JPR A;  3E8B A;  3H01 A;  3P32 A;  5L3D A;  2A79 B;  3SYA A;  2EIJ B;  4GX5 A;  3K08 A;  1M56 C;  2ZXW B;  2Q67 A;  2XAJ A;  5CBF A;  1V55 C;  2EZP A;  1FXK C;  3CYO A;  2OCC B;  5H6R A;  4QPK A;  3AG4 B;  1JCH A;  2DYR C;  3MHH C;  4N23 A;  3QO8 A;  4WFE A;  2XAG A;  3CCM V;  4JAS A;  3T2M A;  3SYP A;  5B3S C;  4RQF A;  3ASO C;  4MW8 A;  2H94 A;  2EZO A;  4MVZ A;  4MVM A;  1M56 B;  1M57 B;  2NNU A;  2XND G;  1RPR A;  4BAY A;  2JIZ G;  3IFX A;  3VBB A;  3JD0 A;  2IH3 C;  3OGC C;  1R73 A;  1QR9 A;  1AI5 A;  1OCO B;  2A9H A;  3W7W A;  2HJF C;  2XAQ A;  1OCZ B;  2ATK C;  3LDD A;  1JQ0 A;  4PA7 A;  1IXM A;  2V7Q G;  4P30 A;  2OT5 A;  1W0K G;  1JOY A;  4MS2 A;  2IJH A;  5IYD O;  2HVK C;  4H37 A;  1VQK V;  5KUM A;  5KA6 A;  1R3J C;  2XAF A;  2ITD C;  1M1K W;  4R7C A;  3DTU B;  3SPI A;  1XL6 A;  4PEL A;  4JYC A;  1OCC B;  4GX2 A;  2PI5 A;  3OAA G;  2WWW A;  2M7W A;  3I56 V;  4U7O A;  4UXN A;  3JD2 A;  4J9Y B;  5HFL A;  4YXW G;  1YJ9 V;  2Q68 A;  3ML0 A;  3RVY A;  1GTO A;  2Z5U A;  1I5X A;  3MD0 A;  3QNE A;  3ETE A;  1G4Y B;  2QM7 A;  4PA4 A;  5IY5 C;  2XOK G;  2P6J A;  3LDE A;  4OXS A;  3FKS G;  1OCC C;  4KFM A;  3WG7 B;  1NVP B;  1KQS U;  3ETD A;  5LHG A;  2W6I G;  3M99 B;  1K92 A;  1FXV A;  2WAM A;  1AI4 A;  3OE7 G;  3SYO A;  1QLN A;  2ITC C;  2X0L A;  1VQN V;  4I5S A;  1BHA A;  2ZDI C;  4QE9 A;  4PDM A;  2B1G A;  3F7Y C;  2JEX A;  4WFA V;  3SPJ A;  3T4D A;  2ZQM A;  2P7T C;  5H9C A;  3SPC A;  2R9I A;  5DM6 V;  4PDR A;  5LHH A;  5FL7 G;  1ORQ C;  1K5Q A;  4LBE C;  1AR1 B;  3JD4 A;  5KA5 A;  2IU0 A;  3OR7 C;  3K03 A;  1NJI W;  1THZ A;  4L87 A;  3CC2 V;  5B3S B;  3ZMT A;  1PNM A;  3AG4 C;  4Q20 A;  5L3C A;  1YHQ V;  2WPD G;  3JD1 A;  2B5U A;  2Y69 C;  2WLM A;  4HYO A;  1H8E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...