3E8GA

Crystal structure of the the open nak channel-na+/ca2+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Membrane protein
source organism Bacillus cereus
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8gA00
4R50A 5EBWC 3OUSA 4PDVA 4R8CA 3E83A 5EBMC 4P30A 2AHYA 3AG1C 3K0GA 4R6ZA 4LBEC 4JTCB 4MVSA 3SPIA 3STZC 3E8GA 3K08A 2ITDC 2BOBC 2A0LA 1M57C 1V54C 2DWEC 4PDMA 2ITCC 1R3KC 4X89A 3RVYA 2QTOA 4PDLA 2DYSC 1QLEC 3HPLC 4MTFA 1XL4A 3FB5C 2Q6AA 4MW8A 4P2ZA 3OR7C 4QE7A 2DWDC 4I9WA 3SJQC 2NLJC 4CBCA 4PA6A 4F4LA 3SYQA 1R3LC 2IH3C 3FB7C 4HZ3A 1V55C 4JTAB 3STLC 4KFMA 5EK0A 1BL8A 2X6CA 1OCRC 4BW5A 3E8HA 3JYCA 2P7TC 2Q67A 3OR6C 4G27B 3SYPA 3E86A 3PJSK 3WG7C 1ZWIC 4QNHB 3F7YC 4RUEA 5B1BC 4DXWA 2Q69A 1G4YB 3FB8C 4GX5A 3E89A 4J9YB 2EIMC 3AG2C 4R7CA 2ATKC 3K06A 3T4ZA 3OGCC 4XDKA 2EINC 1XL6A 2AHZA 2H8PC 3LUTB 2HJFC 4MVMA 4MVQA 2WLMA 4H33A 2Y69C 4P9PA 3FB6C 5KUKA 2WLJA 4MSWC 1ORQC 4MVOA 2EIJC 2HFEC 3ABKC 3K03A 3RW0A 2ZXWC 3AG3C 4WFGA 4LP8A 4RUFA 5CBHA 3T1CA 3X2QC 2QKSA 4TWKA 2BOCC 4P9OA 3ASOC 4UUJC 1KKDA 4WFHA 4MTOA 3UM7A 3R65A 3ZJZA 3VOUA 2WLHA 1R3IC 3BEHA 1OCOC 2JK5C 3LDEA 5EC1C 3SPJA 3ZRSA 1M56C 2A9HA 3SYCA 4RAIA 3K0DA 4PA4A 4X88A 5KUMA 3UKMA 3OUFA 3SYAA 2DYRC 4QE9A 3T4DA 3LNMB 5E1AC 3SPGA 4LCUC 5J9PC 1JVMA 4HYOA 4ZBMA 4X8AA 3E8BA 5B1AC 4MVRA 2A79B 3ABMC 2K1EA 2ZD9A 3ABLC 1J95A 4OXSA 1P7BA 4WFFA 5BZBA 5B3SC 2HVKC 2WLLB 2Q68A 2YEVA 4GX2A 3SPCA 2X6BA 3RBZA 4MS2A 4XDLA 4PA3A 4MVZA 3K04A 3AG4C 3IGAC 2EILC 2WLNA 4RO2A 3SPHA 5EC2C 1K4CC 4G28B 5CBFA 3LDDA 4PDRA 3LDCA 3IFXA 2EIKC 1K4DC 2KB1A 2WLLA 4PA7A 3EFFK 1S5HC 1LNQA 2W0FC 1OCCC 4PA9A 3KG2A 4XDJA 4H37A 4JTDB 3T2MA 3TCUA 2X6AA 3RVZA 3F7VC 5EBLC 2OCCC 4WFEA 3TETA 2IH1C 2WLIA 4GX1A 5CBGA 4EKWA 1OCZC 2HVJC 4GX0A 4MW3A 3E8FA 2WLKA 3ASNC 4J9ZB 5IY5C 2R9RB 1R3JC 3F5WC 2HG5C 3SYOA 4MVUA 3GB7C 2WLIB 4MTGA
chains in the Genus database with same CATH superfamily
4IIJA 1LR1A 1JA8A 3TXQA 1QHTA 1WPXA 2ITDC 1IBLO 4KHPO 2Y0PA 2PY5A 5GTIZ 5JCOC 2ITCC 5F2VO 3WB2A 4DR6O 1SS3A 3H01A 5LXTA 4LF6B 2E3CA 1R3LC 1TUBA 3STLC 2P7TC 4FLXA 2OCCB 3MDSA 3OMNB 1YZBA 2JRIA 3C3SA 4O4LA 1FJGB 5KMGA 3K06A 2Z3YA 4X20B 4J42A 4GYCB 2EIJC 3RW0A 1RPRA 3AG3C 3CCRV 4LP8A 1R6KA 4RUFA 2P67A 1WP8A 1H8EG 5DECA 2WAMA 1Q86W 2CAZC 4I0XB 5KHJA 5IDJA 1AR4A 3SYCA 4FIPC 4O2BB 3M7MX 2CTWA 5KAFZ 2ZDIA 2XT9A 5LP6B 3CCVV 1NR7A 1E1QG 2B1IA 5GW7A 4OXSA 3W7TA 5B1NA 4FK5C 1VF7A 3N2GB 4MTXA 3IGAC 4DV7O 4TUYB 3RFRA 1Z5VA 2Q5ZA 1VP7A 2A7WA 2PGGA 3B2EE 4J7JA 2W0FC 4DR3B 4CS3A 3TETA 1TVKA 3QVNA 2HEPA 3ZEDA 1AJNA 3F5WC 4K3AA 4NR1A 1OJHA 1RSOB 1Q81W 5EBMC 3N2KA 4P30A 5CA1A 4DV1B 1NH2D 3SPIA 5LYJA 4JI1B 3U0ZA 4LC1A 1UJWB 4DV6O 3OMIB 1CEZA 3A2FA 5C8YB 1NKDA 1HNXO 4JI7O 2BTQB 4B3TO 3FB7C 4JTAB 1BL8A 3LSSA 1ZWIC 5IJ9A 4RUEA 2E74B 3GWKC 2QDOA 3E89A 1SQBH 4JYBA 2CGNA 3UCSC 2CK3G 1PKXA 2DN9A 4ZOLB 1QNMA 4DR7B 4O4JB 1IBMB 1F23A 3QTCA 1BSMA 2JIZG 4X1KB 2F1MA 1Q6IA 4NB5A 1YTFB 1IXMA 1JFFA 2JK5C 3HKDA 1CXZB 1B04A 3O65A 4DR3O 3K0DA 5KHKA 1H2KA 1FAFA 2EZPA 1PNMA 3ZHVA 4NYKA 1KP2A 2P6JA 2Z0AA 4ZBMA 2FB5A 1F7YA 3E8BA 4MVRA 2PZSA 2YXHA 5LHGA 1Y4MA 3I5DA 3RYFB 1I5XA 4J41A 5L3BA 4PJ0Z 2LQTA 1GM9A 3EHBB 1K4CC 5CBFA 3IFXA 1S3JA 3BY6A 2GUZB 2YEVB 2NN4A 4DV6B 3S3XA 1FPOA 1IX9A 4DV3B 4CH3A 4LF9O 3CJHA 2EX3A 2ZCEA 3CRRA 5LOVB 1UPGA 4B7EA 1HNXB 4JPRA 1XMQB 5H6QA 3K5NA 4GT1A 1KECA 3P3NA 3K5LA 2PUSA 2YC0A 1VQOV 3OUSA 1GO3F 3RYHB 2ZXWB 2EJRA 1KB9F 4DO2A 4JAUA 1B06A 1QLEC 2FL4A 1FS0G 2D3OW 4DV2O 2DWDC 5IYDO 2OYQA 4PA6A 4X1IA 5GONB 4EB6B 1H38A 1X59A 5LA6B 1ENVA 5ITZB 2ZE7A 1HNWO 5IYZA 3D36C 3OGCC 1FFXB 4XDKA 3HKDB 4NTWA 4J7ZA 2Y69C 4FLTA 1VF5B 4I4TB 4GKKB 2VRZA 1NVPD 4IL6Z 4X1YB 5DEDA 1I5YA 4WFAV 4TOIA 4MTOA 4NXNO 3I55V 2QKAA 4UVCA 2JGDA 1WNSA 1R3IC 3QNEA 1N33B 2MK3A 2Q7GA 3UO2A 1NT2B 3BRCA 1JOYA 1BGYH 1JVMA 1SA0B 2EILB 1Y74A 2QWQB 4QPJA 1F51A 5CN0A 5JQGB 2LGQA 2XNDG 4Q20A 4EFBA 4JI2B 1NS1A 1XQ8A 3SPCA 2HVKC 2WLLB 3JD1A 2GBOA 4MS2A 2N74A 2F4VB 2A06H 2IJJA 5CA3A 3A0RA 2EBOA 3ZMZA 1ZTEA 2BSKB 2WLLA 3TK1A 3QO5A 3AK1A 3O9OA 3JAKB 1AVMA 3ETGA 3DXRA 3CRCA 2X6AA 5A2QN 2G38A 3WG7B 3OD4A 3CB2A 2WLIA 2AW9A 4LNUA 2N04A 2ZE6A 4GX0A 3E8FA 1R1BA 1Q8IA 3HKCA 3JD0A 4TV8B 4IIJB 1N36O 2F66C 3AK3A 3UO3A 4CS4A 1OV9A 1H8HG 1V54B 3KKYA 4R8CA 2UUCB 4AI8A 3AG1C 5KHIA 3M8AA 3UT5A 3STZC 2Q0AA 3J7AU 3CXHF 4O4HA 2QTSA 5DM6V 2QE7G 3JAWB 3OFNG 1MMMA 2PTMA 1Q6HA 4AQYO 4TV9A 1KC8W 4W4LA 1VMGA 1V55C 3S3WA 4BW5A 3JAWA 4G27B 3E86A 3PJSK 3F7YC 2Q69A 3FB8C 5B3SB 1XBLA 3UT5B 3OTOO 2AHZA 4CH4A 3E35A 2JEUA 4H33A 5IJ0B 5JWPA 5JJNB 1S77D 4DR7O 4QGPA 3L71H 4NVPA 4YXWG 3UM7A 3JD2A 5GTHZ 2V4DA 2P06A 1XREA 5B1AB 2QWPB 5LMUO 5LOVA 4LCUC 3CRMA 1VQNV 2UXNA 2LFSA 3ABLC 1VIBA 2W6JG 4UCUA 1Q43A 4K8ZA 1ZLZA 2CE4A 1Q3EA 4PDRA 5H6RA 3RYFA 1ZL8B 1K9MW 3VQXA 2Y4UA 2X0LA 5FPOA 2DE0X 2JJ2G 3BA9A 3SGIA 2IH1C 2LW7A 4FZ1A 2LP7A 1WPBA 2QJ1A 2XTAA 4X1YA 2GSMB 4TQFA 1AJPA 5IY5C 2X7RB 1HWYA 1H2SB 3G71V 3OMAB 1N32B 4BAYA 2DYSB 2HKOA 5CA0B 3QF7A 4DW1A 2CGOA 1YXBA 1AI4A 1R6NA 1M57C 1SZTA 4D7TA 2QTOA 1S5JA 3H1LH 1NTMH 2NNUA 4GCZA 2UXCB 1FKAO 3OR7C 4UV9A 4I55B 1G1XB 3FAVA 5LMUB 3SYPA 3WG7C 1KP3A 2QKCA 2UXXA 4J11A 4JAVA 4CH5A 4J9YB 1N4CA 1L0LH 1N0JA 1XNRO 3CWBH 2WLMA 5L3GA 5CB4A 1S76D 4DUZB 4IHJB 3AG1B 1EN5A 5EYPB 1NQTA 2QKSA 4ZIBA 5BMVA 1N8RW 5IYCO 4X65B 3H1HH 3CP1A 1M57B 1NR1A 5FLXN 3SDLA 4RAIA 4PI0A 2F4VO 2YICA 4E4EA 4I4TA 2HR3A 3SYAA 3ZN1A 3ZBHA 1I94O 4JI8B 4KXRA 3ABMC 3ZMUA 5LL6Y 1S0VA 2DOSA 1JJ2U 4BIUA 5KX5A 3OEEG 5LA6A 1AILA 3K9AA 3N2GA 2IU3A 1HR0O 3AEIA 5K1PA 4ABMA 2V7QG 5FL7G 2OCHA 4B3RB 3RT3C 1B6QA 1XI1A 5EBLC 2MW2B 4DR1O 4JI0B 3CX5F 3FFQA 1MABG 4O2BA 4O4IA 1OCZC 3BHPA 3ICXA 1QLNA 1A32A 2Y48A 4FFBB 5KHGA 1H2MA 2E75B 4MVUA 3U10A 3GB7C 5E1AC 1PM9A 1IXBA 5FNVB 3E83A 1TGOA 2AHYA 4R6ZA 5L3FA 2OT5A 2UXCO 3E8GA 1D2DA 5CB4B 2BSKA 1ZX3A 2IBZH 4D6TH 1RM1B 1R6TA 3H1KH 3SYQA 2IM9A 2WA4A 2XAJA 3ZHRA 5L3DA 4DR6B 4WBNB 2Q9LA 4I55A 2GTSA 2R9IA 4QNHB 4LF6O 4X65O 2W6IG 4DXWA 3W7SA 1YHQV 2HLDG 4UCVA 4XBFA 1B3QA 2XUMA 2P90A 3T4ZA 3OW2U 3OEHG 5JJJB 5CA1B 2EIKB 1L8DA 3CHXA 1K3EA 3WB1A 2OTJV 1RSOA 4KP4A 4DR2B 1ORQC 3JARB 5KA6A 5CBHA 4JYYA 3X2QC 3CCLV 4P9OA 4X1KA 3HKBA 3WB0A 4LF8O 3SPJA 4K0KO 2WPDG 4U3FH 4X88A 4JI1O 1U97A 4X9QA 3DC6A 2DYRC 4QE9A 5IYZB 3LNMB 2ZR3A 4DRXA 1Q7YW 4X64B 1VQ6V 2ZQMA 4JI6O 1T5EA 1FXKB 1VF6A 2O57A 2Q68A 1YJWV 4XDLA 5IJ9B 1JCHA 1WJZA 1KD1W 4MVZA 1PD3A 3AG4C 4WBNA 2EIKC 2CDYA 2KB1A 1OCCC 1XHXA 5KHHA 2PYJA 2CTPA 3RYHA 4I0XA 1Y76B 4Z1MG 2RDCA 1XMOB 1IZ3A 1CP9A 1I08A 2JS5A 2BE3A 4K8XA 5LYJB 5BMVB 3Q4HB 4JZ2A 5EIBC 1WLEA 3CS5A 3ZRVA 4JASA 3DGEA 3LSUA 4R50A 2DYRB 1AROP 4UB8Z 4I50A 3B4SA 2BOBC 3D8CA 1XNQO 1BQZA 4PDMA 2ZE5A 5IJ0A 4X89A 4DR4B 4MTFA 1AI6A 2L35A 2Q6AA 4P2ZA 2UXDB 3CCEV 4I9WA 3K5MA 2R72A 2ZDIC 5KX5B 4UCSA 4FM2A 4LR3A 3TXSA 3B09A 5HFLA 3CCUV 1DTOA 1S72V 4N21A 4MVQA 4OX9B 1AI5A 3K03A 3APQA 2DMXA 3T1CA 4TWKA 1O9HA 3EVKA 1YDXA 1WP7A 3R65A 3VOUA 4JI5B 1BMFG 1OCOC 1M4UA 2AGAA 1N34O 1IBMO 3MHSC 1N33O 3ABLB 3W7XA 2DW4A 4PI2A 4JI6B 4IHJA 3JSLA 3N27A 4RQFA 1AI7A 3ML0A 4LH6A 3A8TA 1J95A 2GTAA 1NJIW 1QVFU 1SQGA 2X6BA 1TA8A 4B3TB 1K97A 3K04A 4B3SO 1GN4A 1GN3A 3HKEB 4JV5B 1MZEA 5DN6G 2QWRB 1UFIA 3K58A 1LNQA 2AXTZ 2WWWA 3F7VC 4FM1A 2OCCC 3RN4A 4DV2B 3G67A 3CE2A 3OTFA 1PPJH 5B66Z 2XOKG 1OCOB 2JGDB 5KAIZ 3W7UA 3E22B 1N34B 4B3MO 5EBWC 1EN4A 3T1HB 1R73A 4HAMA 3B8MA 1R3KC 3H9VA 1XL4A 4L87A 4MW8A 4OX9O 2RMKB 3M99B 5TISZ 2HHHO 1LUVA 3NR7A 4KFMA 4YHHB 1OCRC 4LFBO 3JYCA 1EFRG 1HDJA 1BT8A 2LO1A 4LF5B 2EIMC 2L6LA 1SQVH 3QO7A 4PELA 2EINC 3D3IA 2UUBO 4O2AB 2QR4A 4P9PA 1VQKV 2PI4A 4MSWC 2YXYA 4UVBA 3RYCA 2B5UA 4LF4B 2BOCC 1MNGA 1BQ0A 4YIOA 1YVWA 2ARHA 3ZJZA 4J80A 2WLHA 5B1OA 5LP6C 1M56C 4NXMO 1JMKC 3BA8A 2E76B 3CSXA 2ZE8A 2QWNB 4IGGA 3G4SV 4EEQA 3OUFA 1FFTB 2JEXA 3CEIA 1K7DA 2GDSA 2H3OA 3CJHB 4X8AA 2XAQA 4FLUA 3CCSV 1VQLV 4BIZA 1I7FA 2K1EA 2PI5A 1GK9A 1YI2V 1TUBB 1PNKA 5D5QA 2YEVA 3DTUB 4I9QA 4DW0A 4ZKIA 1VQMV 2WLNA 5J2UA 4PA7A 4BR6A 4TV9B 4DUZO 3T2MA 1WA8A 2VQEB 4FVMA 1IDSA 2QM7A 4BWAA 5H9CA 3CYOA 3ASNC 4F6RA 1R3JC 2IW5A 4FZ0A 5EZYA 3A0BZ 4PDVA 4UV8A 2ETNA 4JTCB 1US6A 2AZ2A 2GV9A 4MT8A 5JH7B 3HPLC 4G2KA 4WFBV 1K5QA 2IU0A 1QVGU 5GONA 4YY3B 3CXCU 1H2LA 1VQPV 3FX7A 4L8JA 5EK0A 1P84F 2HJDA 3E8HA 2Q67A 1PNLA 5J2TB 3IC9A 4B3MB 2BTQA 1BE3H 4YJ3B 4I50B 2XAHA 1H2GA 2B1GA 4B08A 1DF5A 4FMTA 4GKJO 4JI4O 3DSQA 3RYCB 3OGIB 4NXNB 4NXMB 1KKDA 5LMNB 2DJVA 5D5PA 2YSUB 2DQ0A 2Q4PA 3JCZA 4O2AA 1E1RG 3BFRA 2XHBA 4UCOA 1NZ6A 4PV1B 4ZHQB 5J9PC 1OCRB 1URFA 1NVPB 1MSWD 3TJTA 1NBMG 1X4TA 4WFFA 2EIMB 1MSDA 1OCCB 5ITZA 4PA3A 1HNZO 2YXLA 3K5OA 4DRXB 1SF9A 4G28B 2YIBA 4DV0O 1S5HC 4PA9A 1OZ0A 4DUYO 2YI9A 5IT9N 2EIJB 3GVMA 5H5NA 1SQXH 3E22A 2CTQA 1W0KG 1CPYA 3ZHSA 4X62B 4MW3A 3HKCB 2WLIB 2Y69B 3E2EA 3Q4HA 4MVSA 5EYPA 4X64O 1MOFA 3K08A 3ETQA 4BW9A 2DWEC 1YJNV 3DC5A 2ZIOA 4DR5O 3K3WA 4PDLA 2DYSC 5BR8O 2YIDA 4QE7A 3JATA 2LFRA 4ZI7A 4PD4F 5JQGA 4QJFB 1M5IA 2Q8VA 3APOA 3U11A 4IYIA 3ETEA 5EIBD 2R9AA 3SJCC 2QEXV 2ATKC 2A3QA 3ASNB 5L3EA 1W2BU 4JI4B 1XL6A 3LUTB 2LJ2A 3ZX6A 4FM0A 1RP3B 2OTLV 1JFFB 2ZNJA 3QG5A 1VEWA 2RQ6A 1KYOF 4X62O 1XHZA 3AG7A 3ZRSA 2A9HA 2UUAO 2BCCH 4PHZA 4PA4A 5LBQA 4KHPB 4HYOA 4EB6A 2ZNIA 1YEWA 4X1IB 3ZHUA 1EZVH 1J5EO 1O9GA 5B5EZ 1E79G 3ZCCA 2H94A 1PL0A 4GUNA 4LWSB 2VQFB 1VF6C 1K33A 5LGUA 1WN7A 3D36A 5BR8B 5C8YA 3ZMSA 3I56V 1NTKH 3SJBC 4YIPA 3C3TA 3W7WA 2IJKA 4GZRB 2C2AA 2LW1A 1WB8A 4B3RO 3UQ8A 2E5LO 4EFEA 2WLKA 4J9ZB 5FNVA 2HHHB 4RWUA 1NH2B 1QQCA 4JI8O 1AP5A 3L73H 3P30A 4I5SA 4IT5A 1QR9A 3J81N 1HW7A 4NTYA 2UXBB 1THZA 4DUYB 3BPZA 3RVYA 3CRQA 1DK1A 1SERA 3CCQV 2CUGA 3ZRXA 4LF7B 3ZRWA 4IYHA 1GM8A 5JH7A 3JSNA 1YF2A 1L1FA 2Q7EA 4GX5A 1W59A 1SETA 2ZR2A 2Q0OC 4KL1A 2H8PC 3B40A 3WU2Z 1BCCH 1DLBA 3HKBB 2WLJA 3RGBA 3OE7G 4JI3B 2VWKA 4F6RB 4O4JA 1J5EB 3ZMVA 3CCMV 1G8MA 1EN6A 4CS2A 4TV8A 2M6YA 1M1KW 2IJHA 2VWJA 4DV1O 2FTKA 5A9GA 3K9SA 5JVDA 2JVDA 4FLYA 1D5NA 1QBZA 1FXVA 4X20A 2RJZA 3JAKA 1Q82W 4Q6GA 4DV5O 1EM1A 3JD3A 4QPKA 4AILC 1Y67A 2YI8A 3LDCA 1V55B 1K4DC 5K1XA 4XDJA 3D3QA 5IWAO 3TCUA 4NTXA 5JJEB 4X66O 4UB6Z 4YJ2B 4FFBA 1IBKB 4O4IB 3RYIB 1IBLB 5LGNA 2PYLA 1SQQH 1KU9A 1V9PA 1FXHA 1JQ0A 3AK2A 4OPAA 4H13B 2B9ZA 4NKGB 1ZUQA 4DR5B 5LGTA 1WA8B 1SESA 3FB5C 4TSFG 1SQPH 4I7ZB 2CTRA 2JS3A 1KBHA 1KUQA 2IH3C 2KQXA 4JF3A 3KCXA 1Z2GA 4ZHQA 1XUQA 1OHHG 3WFVA 2CH7B 3LNNA 5KLVH 4MVMA 3IJ4A 3OTOB 2M7WA 3ASOB 2HFEC 4H44B 1GN6A 3K57A 4UFZA 1GAXA 4J10A 3PN1A 2ZXWC 3LSQA 1K8AW 4E2LA 3IC7A 2ADPA 1XMQO 2P4KA 4DV7B 4WFHA 3ZHQA 4B7KA 1G6UA 5HFMA 5EC1C 1DGSA 3BEHA 1N0NA 4FLWA 2FYUH 5KUMA 1P7GA 5KMGB 3ABMB 3T4DA 2P22C 3ZMTA 3MAQA 3HKEA 1Y76A 1Q5OA 4JYAO 2YIAA 4CZZA 3L70H 2CH7A 2NR5A 4JI7B 3T1YO 4UVAA 5IE9A 1MZFA 1P7BA 4LFAB 2OWOA 5KA5A 4LWSA 4YHHO 1IBKO 2VQFO 5IWAB 1SA0A 1YJ9V 4FFKA 4A5UB 4CH6A 3IAYA 1AJQA 3MD0A 1HNWB 1K5SA 4C7UA 2JJ1G 4H37A 1N32O 1BHBA 2OIGA 2KKWA 2ODMA 1OCZB 2Y0IA 2QM4A 4AHCA 3G80A 4EKWA 3JALB 4JI5O 2HVJC 2AZ0A 4HBNA 3JAMN 4KUMA 3TGUH 1FFXA 4LNUB 4YJ2A 2QWOB 2A0LA 4ZOLA 1KQSU 1V54C 1F4MA 2ILMA 4LH7A 3DXRB 3P3PA 3SJQC 4CC6A 1XNRB 2QGNA 4RQEA 4HZ3A 1S5LZ 4JYAB 3THOA 4U3JA 2Q7HA 4JI3O 2QM8A 3ZIAG 1G4YB 3ZHTA 3BCCH 3K79A 4DR2O 3CC4V 1N36B 1PL4A 3T1YB 1Y74B 1RFYA 1P4RA 4MVOA 3ABKC 2ZM6O 2Q73A 3ABTA 1BS3A 3BVOA 3ASOC 4CC5A 2P4VA 1L0NH 2YS8A 3F5TA 1NTZH 3VQVA 1M93A 3RWRD 2RCVA 1F4NA 1WB7A 2F93B 4QIWF 1PP9H 1TVKB 2GUZA 3JASA 5B1AC 2ZD9A 2F23A 4H0LB 1LUWA 5BZBA 5B3SC 5FPRA 1FXKA 4TUYA 3SPHA 1GKFA 4LF9B 1SRYA 2BTOA 3CMAV 3EFFK 4DR4O 1JPXA 4O4HB 3VQYA 1XEQA 3ABKB 2QSAA 3RVZA 4DK0A 4LFCB 4GKKO 1MA1A 3HB3B 4DV3O 1HR0B 3R66A 2IJIA 4WCEV 2VQEO 2WA3A 1YIJV 1XNQB 1K92A 5IY5B 2XAFA 4J7KA 2K9PA 1M9NA 4X66B 4N23A 2JDIG 1Y6XA 3L75H 2JGUA 3CC7V 3G6EV 4JI2O 4FPPA 4YJ3A 1SC5B 5J2TA 3ZS8C 2D2CB 1VQ5V 2X6CA 3FAVB 4JGSA 3OR6C 3K59A 4YY3O 2EZOA 4DV0B 4FJCC 1RPOA 2F43G 5IYBO 5LXTB 1Z5WA 3AG2C 1SKVA 1VARA 5CMUA 3CRAA 1EBOA 5BXZA 3FB6C 2RNBA 4JAAA 4B3SB 3OAAG 1DF4A 4K35A 3OT7A 2UU9O 1VQ9V 5EZYB 4LF8B 1COWG 2ZKOA 4LFAO 1NI8A 3LDEA 3JARA 1AR5A 4K0KB 3JD4A 3JCUZ 1XILA 1PV0A 1SQFA 1GRJA 4BIOA 2A79B 3ZRWB 4GX2A 3SJAC 4Z1VA 2PF4E 1M90W 2W0XA 1BHAA 1K73W 5EC2C 1VQ7V 3BABA 1EZJA 2R70A 1YITV 3CPWU 3QO8A 3SR2C 3VBBA 1GMGA 4AQYB 4GX1A 5CBGA 2UXBO 4LF4O 5H2FZ 2R9RB 2HP8A 4UCRA 3CD6V 5KUKA 4MTGA 2UXDO 2F95B 3C90A 1HNZB 2EULA 1KKCA 4LF5O 2FKXA 5BY1A 1FXKC 1FYJA 4OGQB 1Q6UA 4JI0O 4DR1B 2UUCO 4LFBB 4U3JB 4CBCA 4OPHA 1ZAUA 2UU9B 1VQ8V 2Z5UA 1U96A 2EINB 3KZIZ 2V1DA 2LGWA 1YTFD 4R7CA 1MG1A 2VS0A 3JASB 3H1IH 2HJFC 3L9DA 2GHYA 2EJ7A 2YUAA 1TAEA 2UUAB 1JR9A 3CMEV 4UUJC 1FJGO 1M56B 3ABUA 3J80N 3RYIA 1RM1C 1GM7A 1XDCA 2P5OA 3L72H 5LHIA 4Z2WA 3UKMA 1YSCA 1ZL8A 3SPGA 4JV5O 4DYLA 1I0HA 1K34A 4HNAB 5AG2A 4WF9V 2XASA 1GH6A 4ZI7B 3AG2B 3JATB 2YIBD 3RBZA 2KSDA 1GN2A 4LFCO 4TT3G 1BZKA 4D7SA 1AP6A 2DQ3A 1VQ4V 3P32A 4ICGA 1SZXA 3X2QB 3FYIB 4U7NA 5B1BB 3N2KB 1GTOA 4HNAA 4WFEA 4GKJB 2WSSG 1D5AA 1JJOA 1AB3A 5CA0A 1XMOO 1FD9A 4U7OA 3KCYA 3SYOA 4DV4B 3FKSG 2FMLA 3K0GA 3T1HO 3AG3B 4LBEC 3VQWA 1I94B 1W0JG 3EXAA 3AG4B 3B77A 3FD9A 2KG7B 5C93A 3B8NA 2YDEA 2NLJC 4F4LA 1NU1H 5J2UB 4GLXA 4DK1A 1WAZA 1QLEB 1QU7A 1P49A 1KMIZ 5B1BC 2E5LB 4JYCA 5LP6A 3CCJV 4TQDA 2UUBB 1TUEB 5JCOA 1QR8A 1ZSPA 5LMNO 1JX9A 3A0HZ 1IVSA 4ASUG 3HR0A 4FLVA 1YCIA 4WFGA 2ZIMA 2ZINA 2QA4V 3NXSA 4UCTA 3MHHC 3ZN0A 4LF7O 1Q90D 1XOUA 4O4LB 3BAAA 1QCEA 2ZT9B 3L74H 4UXNA 2RN9A 1H2NA 1ROPA 3FYEB 2N05A 4JZGA 4RO2A 2EILC 2ZM6B 4FLZA 3OM3B 4DV5B 2Y4TA 4DV4O 3LDDA 5JVDB 4F6EA 5LHHA 3KG2A 4JTDB 2KG7A 2OIEA 2XAGA 1IURA 3GWOA 5E79Z 3G6BA 3H1JH 3CC2V 2ADQB 3ETDA 1AR1B 4W4KA 1HP8A 3JALA 1Y66A 2HG5C 5L3CA
chains in the Genus database with same CATH topology
2DYSB 4PDVA 2HKOA 4KUMA 4UV8A 4JTCB 1WPXA 2ITDC 1AI4A 2A0LA 1R6NA 1M57C 1KQSU 1V54C 1SZTA 2ITCC 4MT8A 2QTOA 1F4MA 3HPLC 4G2KA 4WFBV 1K5QA 2NNUA 4GCZA 2IU0A 3OR7C 1QVGU 3H01A 3SJQC 3CXCU 1VQPV 4RQEA 1R3LC 4HZ3A 3STLC 5EK0A 4UV9A 3E8HA 2P7TC 2Q67A 3SYPA 2OCCB 1PNLA 3WG7C 1KP3A 2UXXA 3OMNB 4JAVA 2QM8A 3ZIAG 1G4YB 4J9YB 3K79A 3CC4V 3K06A 2Z3YA 2XAHA 1H2GA 2B1GA 2WLMA 5L3GA 1DF5A 1S76D 4FMTA 1P4RA 4MVOA 2EIJC 3ABKC 3RW0A 3AG1B 1RPRA 3AG3C 3ABTA 3CCRV 4LP8A 1NQTA 1R6KA 4RUFA 2P67A 2QKSA 1KKDA 3ASOC 1N8RW 1H8EG 5IYCO 2YSUB 2DQ0A 2WAMA 1Q86W 3CP1A 1M57B 3JCZA 1NR1A 1E1RG 5IDJA 3SYCA 4RAIA 4FIPC 1F4NA 3SYAA 2HR3A 4QIWF 3ZN1A 2ZDIA 5J9PC 3CCVV 1OCRB 1NVPB 1NR7A 5B1AC 1E1QG 1MSWD 2B1IA 3ABMC 5GW7A 3ZMUA 2ZD9A 1S0VA 1NBMG 4OXSA 3W7TA 4WFFA 2EIMB 5B3SC 5BZBA 1JJ2U 4BIUA 1OCCB 5B1NA 3OEEG 1FXKA 4PA3A 4FK5C 3K9AA 4MTXA 3SPHA 3IGAC 2IU3A 1GKFA 4G28B 1SRYA 3AEIA 3CMAV 3EFFK 1S5HC 1JPXA 2V7QG 2W0FC 5FL7G 4PA9A 1OZ0A 2EIJB 3ABKB 1B6QA 3RVZA 5EBLC 3TETA 1W0KG 1MABG 1CPYA 1OCZC 3HB3B 1QLNA 2Y48A 4MW3A 2IJIA 4WCEV 1AJNA 3F5WC 1YIJV 4MVUA 3GB7C 2WLIB 2Y69B 5E1AC 1Q81W 1K92A 5IY5B 2XAFA 3E83A 4P30A 5EBMC 2AHYA 4R6ZA 5L3FA 3E2EA 2OT5A 1NH2D 4MVSA 3SPIA 1MOFA 3E8GA 3K08A 1M9NA 4N23A 2JDIG 2DWEC 1YJNV 3CC7V 4LC1A 3K3WA 4PDLA 1UJWB 1RM1B 2DYSC 3G6EV 3OMIB 1CEZA 4FPPA 4QE7A 1NKDA 3SYQA 2LFRA 3FB7C 2XAJA 4JTAB 1VQ5V 4QJFB 5L3DA 1BL8A 2X6CA 3LSSA 4JGSA 3ETEA 3OR6C 2R9IA 4QNHB 1ZWIC 2EZOA 4RUEA 2W6IG 4DXWA 3W7SA 4FJCC 1YHQV 2HLDG 1RPOA 2F43G 3E89A 5IYBO 4XBFA 3AG2C 2QEXV 2ATKC 4JYBA 3T4ZA 2P90A 3ASNB 3OEHG 5L3EA 3OW2U 5CMUA 1XL6A 1W2BU 2CK3G 1PKXA 2EIKB 3LUTB 1EBOA 1K3EA 2OTJV 3FB6C 4KP4A 1ORQC 3OAAG 1DF4A 5KA6A 5CBHA 2OTLV 3X2QC 1VQ9V 1F23A 3CCLV 4P9OA 2JIZG 1COWG 1YTFB 3SPJA 1IXMA 2JK5C 3LDEA 3ZRSA 2A9HA 2WPDG 3JD4A 3K0DA 4PA4A 4X88A 2EZPA 1PNMA 2DYRC 4QE9A 3LNMB 5LBQA 1KP2A 2P6JA 4HYOA 2ZR3A 4ZBMA 1Q7YW 3E8BA 4MVRA 1VQ6V 2ZQMA 2A79B 1FXKB 3ZRWB 5LHGA 1Y4MA 2Q68A 4GX2A 1YJWV 1I5XA 4XDLA 1JCHA 5L3BA 1KD1W 4MVZA 1PD3A 1GM9A 3AG4C 3EHBB 1M90W 1BHAA 1E79G 1K73W 5EC2C 1VQ7V 1K4CC 2H94A 3ZCCA 5CBFA 1PL0A 1S3JA 3BY6A 2EIKC 3IFXA 2YEVB 1K33A 2KB1A 3D36A 5LGUA 1EZJA 1YITV 3CPWU 1OCCC 3QO8A 3ZMSA 3I56V 4Z1MG 3VBBA 1GMGA 1CP9A 4GX1A 5CBGA 3W7WA 2IJKA 2C2AA 4JPRA 5H6QA 2WLKA 4GT1A 4J9ZB 1KECA 1WLEA 2R9RB 3ZRVA 4JASA 3CD6V 3DGEA 5KUKA 4MTGA 1NH2B 4R50A 2DYRB 1AROP 3P30A 4I5SA 3OUSA 1VQOV 1QR9A 1GO3F 2ZXWB 2BOBC 2EJRA 1THZA 1FXKC 4PDMA 4X89A 3RVYA 4DO2A 4JAUA 1QLEC 1SERA 4MTFA 3CCQV 1FS0G 1AI6A 2Q6AA 4P2ZA 3CCEV 3ZRXA 2D3OW 2DWDC 4I9WA 4CBCA 5IYDO 4PA6A 3ZRWA 2ZDIC 1VQ8V 2Z5UA 1H38A 1ENVA 1GM8A 2EINB 2V1DA 1L1FA 4GX5A 1YTFD 4R7CA 1MG1A 1SETA 2ZR2A 3OGCC 4XDKA 2H8PC 2HJFC 5HFLA 3CCUV 1DTOA 1S72V 4N21A 4MVQA 2Y69C 1AI5A 1DLBA 2WLJA 3OE7G 2GHYA 3K03A 1NVPD 3T1CA 4WFAV 1I5YA 4TWKA 4UUJC 3ZMVA 1M56B 3CMEV 3CCMV 1G8MA 4MTOA 3ABUA 3I55V 4UVCA 3R65A 1RM1C 3VOUA 1BMFG 1R3IC 1OCOC 3QNEA 2MK3A 1GM7A 3MHSC 3ABLB 1M1KW 3W7XA 2DW4A 2IJHA 5LHIA 2FTKA 3UKMA 1JOYA 1YSCA 3SPGA 4RQFA 1JVMA 1K34A 4WF9V 2EILB 1QBZA 2XASA 1FXVA 1AI7A 3ML0A 4QPJA 1F51A 5CN0A 1Q82W 1J95A 2XNDG 4Q20A 3AG2B 2HVKC 2WLLB 3JD1A 3SPCA 1NJIW 1QVFU 2X6BA 3RBZA 3JD3A 4MS2A 4QPKA 1K97A 2IJJA 3K04A 4TT3G 5CA3A 3A0RA 2EBOA 3ZMZA 3LDCA 5DN6G 1V55B 1K4DC 2WLLA 2DQ3A 3TK1A 3QO5A 1LNQA 1VQ4V 3P32A 3ETGA 4XDJA 3X2QB 2WWWA 3FYIB 4U7NA 5B1BB 3TCUA 2X6AA 1GTOA 3F7VC 2OCCC 4WFEA 3WG7B 2WLIA 2WSSG 4GX0A 2XOKG 3E8FA 1OCOB 3JD0A 4U7OA 3SYOA 3W7UA 5LGNA 5EBWC 3FKSG 1H8HG 1V54B 1R73A 4R8CA 1FXHA 1JQ0A 3AG1C 3K0GA 4HAMA 3AG3B 4LBEC 3STZC 1W0JG 3B8MA 1R3KC 5LGTA 3AG4B 3B77A 5DM6V 2QE7G 1SESA 1XL4A 3FB5C 5C93A 3OFNG 4L87A 4MW8A 3B8NA 1KC8W 2NLJC 3M99B 4TSFG 4F4LA 2IH3C 1V55C 4JF3A 4KFMA 4BW5A 1OCRC 3JYCA 1EFRG 1QLEB 4G27B 3E86A 3PJSK 3F7YC 5B1BC 2Q69A 3FB8C 4JYCA 2EIMC 3QO7A 5B3SB 4PELA 3CCJV 1OHHG 3WFVA 2EINC 2AHZA 1TUEB 4MVMA 3D3IA 3E35A 1QR8A 2JEUA 4H33A 1JX9A 4P9PA 1VQKV 2PI4A 2M7WA 3ASOB 4MSWC 4ASUG 1S77D 2HFEC 4UVBA 2ZXWC 4WFGA 3LSQA 1K8AW 4E2LA 2B5UA 3IC7A 2BOCC 4WFHA 2QA4V 4YXWG 3UM7A 3NXSA 3ZJZA 3JD2A 5HFMA 2WLHA 3BEHA 5EC1C 5B1OA 1M56C 3MHHC 3ZN0A 3G4SV 5KUMA 5B1AB 3OUFA 1FFTB 3ABMB 3T4DA 2JEXA 3ZMTA 1K7DA 4LCUC 1QCEA 4X8AA 2XAQA 4CZZA 3CCSV 1VQLV 1VQNV 2UXNA 4UXNA 4BIZA 2K1EA 2LFSA 3ABLC 2PI5A 4UVAA 1GK9A 1P7BA 1YI2V 1ROPA 1PNKA 2W6JG 2YEVA 5KA5A 3FYEB 3DTUB 4ZKIA 1VQMV 4RO2A 2EILC 2WLNA 3OM3B 1YJ9V 3LDDA 4PDRA 5H6RA 1AJQA 3MD0A 4PA7A 1K9MW 5LHHA 1K5SA 2JJ1G 2X0LA 3KG2A 2JJ2G 4H37A 1BHBA 4JTDB 1OCZB 3T2MA 2XAGA 2IH1C 3GWOA 2LP7A 4EKWA 3CC2V 2QM7A 5H9CA 3ETDA 2HVJC 1AR1B 3CYOA 2GSMB 3ASNC 1AJPA 5IY5C 2X7RB 1R3JC 1HWYA 1Y66A 2HG5C 5L3CA 3G71V 2IW5A 3OMAB 4BAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R50 A;  5EBW C;  3OUS A;  4PDV A;  4R8C A;  3E83 A;  5EBM C;  4P30 A;  2AHY A;  3AG1 C;  3K0G A;  4R6Z A;  4LBE C;  4JTC B;  4MVS A;  3SPI A;  3STZ C;  3E8G A;  3K08 A;  2ITD C;  2BOB C;  2A0L A;  1M57 C;  1V54 C;  2DWE C;  4PDM A;  2ITC C;  1R3K C;  4X89 A;  3RVY A;  2QTO A;  4PDL A;  2DYS C;  1QLE C;  3HPL C;  4MTF A;  1XL4 A;  3FB5 C;  2Q6A A;  4MW8 A;  4P2Z A;  3OR7 C;  4QE7 A;  2DWD C;  4I9W A;  3SJQ C;  2NLJ C;  4CBC A;  4PA6 A;  4F4L A;  3SYQ A;  1R3L C;  2IH3 C;  3FB7 C;  4HZ3 A;  1V55 C;  4JTA B;  3STL C;  4KFM A;  5EK0 A;  1BL8 A;  2X6C A;  1OCR C;  4BW5 A;  3E8H A;  3JYC A;  2P7T C;  2Q67 A;  3OR6 C;  4G27 B;  3SYP A;  3E86 A;  3PJS K;  3WG7 C;  1ZWI C;  4QNH B;  3F7Y C;  4RUE A;  5B1B C;  4DXW A;  2Q69 A;  1G4Y B;  3FB8 C;  4GX5 A;  3E89 A;  4J9Y B;  2EIM C;  3AG2 C;  4R7C A;  2ATK C;  3K06 A;  3T4Z A;  3OGC C;  4XDK A;  2EIN C;  1XL6 A;  2AHZ A;  2H8P C;  3LUT B;  2HJF C;  4MVM A;  4MVQ A;  2WLM A;  4H33 A;  2Y69 C;  4P9P A;  3FB6 C;  5KUK A;  2WLJ A;  4MSW C;  1ORQ C;  4MVO A;  2EIJ C;  2HFE C;  3ABK C;  3K03 A;  3RW0 A;  2ZXW C;  3AG3 C;  4WFG A;  4LP8 A;  4RUF A;  5CBH A;  3T1C A;  3X2Q C;  2QKS A;  4TWK A;  2BOC C;  4P9O A;  3ASO C;  4UUJ C;  1KKD A;  4WFH A;  4MTO A;  3UM7 A;  3R65 A;  3ZJZ A;  3VOU A;  2WLH A;  1R3I C;  3BEH A;  1OCO C;  2JK5 C;  3LDE A;  5EC1 C;  3SPJ A;  3ZRS A;  1M56 C;  2A9H A;  3SYC A;  4RAI A;  3K0D A;  4PA4 A;  4X88 A;  5KUM A;  3UKM A;  3OUF A;  3SYA A;  2DYR C;  4QE9 A;  3T4D A;  3LNM B;  5E1A C;  3SPG A;  4LCU C;  5J9P C;  1JVM A;  4HYO A;  4ZBM A;  4X8A A;  3E8B A;  5B1A C;  4MVR A;  2A79 B;  3ABM C;  2K1E A;  2ZD9 A;  3ABL C;  1J95 A;  4OXS A;  1P7B A;  4WFF A;  5BZB A;  5B3S C;  2HVK C;  2WLL B;  2Q68 A;  2YEV A;  4GX2 A;  3SPC A;  2X6B A;  3RBZ A;  4MS2 A;  4XDL A;  4PA3 A;  4MVZ A;  3K04 A;  3AG4 C;  3IGA C;  2EIL C;  2WLN A;  4RO2 A;  3SPH A;  5EC2 C;  1K4C C;  4G28 B;  5CBF A;  3LDD A;  4PDR A;  3LDC A;  3IFX A;  2EIK C;  1K4D C;  2KB1 A;  2WLL A;  4PA7 A;  3EFF K;  1S5H C;  1LNQ A;  2W0F C;  1OCC C;  4PA9 A;  3KG2 A;  4XDJ A;  4H37 A;  4JTD B;  3T2M A;  3TCU A;  2X6A A;  3RVZ A;  3F7V C;  5EBL C;  2OCC C;  4WFE A;  3TET A;  2IH1 C;  2WLI A;  4GX1 A;  5CBG A;  4EKW A;  1OCZ C;  2HVJ C;  4GX0 A;  4MW3 A;  3E8F A;  2WLK A;  3ASN C;  4J9Z B;  5IY5 C;  2R9R B;  1R3J C;  3F5W C;  2HG5 C;  3SYO A;  4MVU A;  3GB7 C;  2WLI B;  4MTG A; 
#chains in the Genus database with same CATH topology
 4IIJ A;  1LR1 A;  1JA8 A;  3TXQ A;  1QHT A;  1WPX A;  2ITD C;  1IBL O;  4KHP O;  2Y0P A;  2PY5 A;  5GTI Z;  5JCO C;  2ITC C;  5F2V O;  3WB2 A;  4DR6 O;  1SS3 A;  3H01 A;  5LXT A;  4LF6 B;  2E3C A;  1R3L C;  1TUB A;  3STL C;  2P7T C;  4FLX A;  2OCC B;  3MDS A;  3OMN B;  1YZB A;  2JRI A;  3C3S A;  4O4L A;  1FJG B;  5KMG A;  3K06 A;  2Z3Y A;  4X20 B;  4J42 A;  4GYC B;  2EIJ C;  3RW0 A;  1RPR A;  3AG3 C;  3CCR V;  4LP8 A;  1R6K A;  4RUF A;  2P67 A;  1WP8 A;  1H8E G;  5DEC A;  2WAM A;  1Q86 W;  2CAZ C;  4I0X B;  5KHJ A;  5IDJ A;  1AR4 A;  3SYC A;  4FIP C;  4O2B B;  3M7M X;  2CTW A;  5KAF Z;  2ZDI A;  2XT9 A;  5LP6 B;  3CCV V;  1NR7 A;  1E1Q G;  2B1I A;  5GW7 A;  4OXS A;  3W7T A;  5B1N A;  4FK5 C;  1VF7 A;  3N2G B;  4MTX A;  3IGA C;  4DV7 O;  4TUY B;  3RFR A;  1Z5V A;  2Q5Z A;  1VP7 A;  2A7W A;  2PGG A;  3B2E E;  4J7J A;  2W0F C;  4DR3 B;  4CS3 A;  3TET A;  1TVK A;  3QVN A;  2HEP A;  3ZED A;  1AJN A;  3F5W C;  4K3A A;  4NR1 A;  1OJH A;  1RSO B;  1Q81 W;  5EBM C;  3N2K A;  4P30 A;  5CA1 A;  4DV1 B;  1NH2 D;  3SPI A;  5LYJ A;  4JI1 B;  3U0Z A;  4LC1 A;  1UJW B;  4DV6 O;  3OMI B;  1CEZ A;  3A2F A;  5C8Y B;  1NKD A;  1HNX O;  4JI7 O;  2BTQ B;  4B3T O;  3FB7 C;  4JTA B;  1BL8 A;  3LSS A;  1ZWI C;  5IJ9 A;  4RUE A;  2E74 B;  3GWK C;  2QDO A;  3E89 A;  1SQB H;  4JYB A;  2CGN A;  3UCS C;  2CK3 G;  1PKX A;  2DN9 A;  4ZOL B;  1QNM A;  4DR7 B;  4O4J B;  1IBM B;  1F23 A;  3QTC A;  1BSM A;  2JIZ G;  4X1K B;  2F1M A;  1Q6I A;  4NB5 A;  1YTF B;  1IXM A;  1JFF A;  2JK5 C;  3HKD A;  1CXZ B;  1B04 A;  3O65 A;  4DR3 O;  3K0D A;  5KHK A;  1H2K A;  1FAF A;  2EZP A;  1PNM A;  3ZHV A;  4NYK A;  1KP2 A;  2P6J A;  2Z0A A;  4ZBM A;  2FB5 A;  1F7Y A;  3E8B A;  4MVR A;  2PZS A;  2YXH A;  5LHG A;  1Y4M A;  3I5D A;  3RYF B;  1I5X A;  4J41 A;  5L3B A;  4PJ0 Z;  2LQT A;  1GM9 A;  3EHB B;  1K4C C;  5CBF A;  3IFX A;  1S3J A;  3BY6 A;  2GUZ B;  2YEV B;  2NN4 A;  4DV6 B;  3S3X A;  1FPO A;  1IX9 A;  4DV3 B;  4CH3 A;  4LF9 O;  3CJH A;  2EX3 A;  2ZCE A;  3CRR A;  5LOV B;  1UPG A;  4B7E A;  1HNX B;  4JPR A;  1XMQ B;  5H6Q A;  3K5N A;  4GT1 A;  1KEC A;  3P3N A;  3K5L A;  2PUS A;  2YC0 A;  1VQO V;  3OUS A;  1GO3 F;  3RYH B;  2ZXW B;  2EJR A;  1KB9 F;  4DO2 A;  4JAU A;  1B06 A;  1QLE C;  2FL4 A;  1FS0 G;  2D3O W;  4DV2 O;  2DWD C;  5IYD O;  2OYQ A;  4PA6 A;  4X1I A;  5GON B;  4EB6 B;  1H38 A;  1X59 A;  5LA6 B;  1ENV A;  5ITZ B;  2ZE7 A;  1HNW O;  5IYZ A;  3D36 C;  3OGC C;  1FFX B;  4XDK A;  3HKD B;  4NTW A;  4J7Z A;  2Y69 C;  4FLT A;  1VF5 B;  4I4T B;  4GKK B;  2VRZ A;  1NVP D;  4IL6 Z;  4X1Y B;  5DED A;  1I5Y A;  4WFA V;  4TOI A;  4MTO A;  4NXN O;  3I55 V;  2QKA A;  4UVC A;  2JGD A;  1WNS A;  1R3I C;  3QNE A;  1N33 B;  2MK3 A;  2Q7G A;  3UO2 A;  1NT2 B;  3BRC A;  1JOY A;  1BGY H;  1JVM A;  1SA0 B;  2EIL B;  1Y74 A;  2QWQ B;  4QPJ A;  1F51 A;  5CN0 A;  5JQG B;  2LGQ A;  2XND G;  4Q20 A;  4EFB A;  4JI2 B;  1NS1 A;  1XQ8 A;  3SPC A;  2HVK C;  2WLL B;  3JD1 A;  2GBO A;  4MS2 A;  2N74 A;  2F4V B;  2A06 H;  2IJJ A;  5CA3 A;  3A0R A;  2EBO A;  3ZMZ A;  1ZTE A;  2BSK B;  2WLL A;  3TK1 A;  3QO5 A;  3AK1 A;  3O9O A;  3JAK B;  1AVM A;  3ETG A;  3DXR A;  3CRC A;  2X6A A;  5A2Q N;  2G38 A;  3WG7 B;  3OD4 A;  3CB2 A;  2WLI A;  2AW9 A;  4LNU A;  2N04 A;  2ZE6 A;  4GX0 A;  3E8F A;  1R1B A;  1Q8I A;  3HKC A;  3JD0 A;  4TV8 B;  4IIJ B;  1N36 O;  2F66 C;  3AK3 A;  3UO3 A;  4CS4 A;  1OV9 A;  1H8H G;  1V54 B;  3KKY A;  4R8C A;  2UUC B;  4AI8 A;  3AG1 C;  5KHI A;  3M8A A;  3UT5 A;  3STZ C;  2Q0A A;  3J7A U;  3CXH F;  4O4H A;  2QTS A;  5DM6 V;  2QE7 G;  3JAW B;  3OFN G;  1MMM A;  2PTM A;  1Q6H A;  4AQY O;  4TV9 A;  1KC8 W;  4W4L A;  1VMG A;  1V55 C;  3S3W A;  4BW5 A;  3JAW A;  4G27 B;  3E86 A;  3PJS K;  3F7Y C;  2Q69 A;  3FB8 C;  5B3S B;  1XBL A;  3UT5 B;  3OTO O;  2AHZ A;  4CH4 A;  3E35 A;  2JEU A;  4H33 A;  5IJ0 B;  5JWP A;  5JJN B;  1S77 D;  4DR7 O;  4QGP A;  3L71 H;  4NVP A;  4YXW G;  3UM7 A;  3JD2 A;  5GTH Z;  2V4D A;  2P06 A;  1XRE A;  5B1A B;  2QWP B;  5LMU O;  5LOV A;  4LCU C;  3CRM A;  1VQN V;  2UXN A;  2LFS A;  3ABL C;  1VIB A;  2W6J G;  4UCU A;  1Q43 A;  4K8Z A;  1ZLZ A;  2CE4 A;  1Q3E A;  4PDR A;  5H6R A;  3RYF A;  1ZL8 B;  1K9M W;  3VQX A;  2Y4U A;  2X0L A;  5FPO A;  2DE0 X;  2JJ2 G;  3BA9 A;  3SGI A;  2IH1 C;  2LW7 A;  4FZ1 A;  2LP7 A;  1WPB A;  2QJ1 A;  2XTA A;  4X1Y A;  2GSM B;  4TQF A;  1AJP A;  5IY5 C;  2X7R B;  1HWY A;  1H2S B;  3G71 V;  3OMA B;  1N32 B;  4BAY A;  2DYS B;  2HKO A;  5CA0 B;  3QF7 A;  4DW1 A;  2CGO A;  1YXB A;  1AI4 A;  1R6N A;  1M57 C;  1SZT A;  4D7T A;  2QTO A;  1S5J A;  3H1L H;  1NTM H;  2NNU A;  4GCZ A;  2UXC B;  1FKA O;  3OR7 C;  4UV9 A;  4I55 B;  1G1X B;  3FAV A;  5LMU B;  3SYP A;  3WG7 C;  1KP3 A;  2QKC A;  2UXX A;  4J11 A;  4JAV A;  4CH5 A;  4J9Y B;  1N4C A;  1L0L H;  1N0J A;  1XNR O;  3CWB H;  2WLM A;  5L3G A;  5CB4 A;  1S76 D;  4DUZ B;  4IHJ B;  3AG1 B;  1EN5 A;  5EYP B;  1NQT A;  2QKS A;  4ZIB A;  5BMV A;  1N8R W;  5IYC O;  4X65 B;  3H1H H;  3CP1 A;  1M57 B;  1NR1 A;  5FLX N;  3SDL A;  4RAI A;  4PI0 A;  2F4V O;  2YIC A;  4E4E A;  4I4T A;  2HR3 A;  3SYA A;  3ZN1 A;  3ZBH A;  1I94 O;  4JI8 B;  4KXR A;  3ABM C;  3ZMU A;  5LL6 Y;  1S0V A;  2DOS A;  1JJ2 U;  4BIU A;  5KX5 A;  3OEE G;  5LA6 A;  1AIL A;  3K9A A;  3N2G A;  2IU3 A;  1HR0 O;  3AEI A;  5K1P A;  4ABM A;  2V7Q G;  5FL7 G;  2OCH A;  4B3R B;  3RT3 C;  1B6Q A;  1XI1 A;  5EBL C;  2MW2 B;  4DR1 O;  4JI0 B;  3CX5 F;  3FFQ A;  1MAB G;  4O2B A;  4O4I A;  1OCZ C;  3BHP A;  3ICX A;  1QLN A;  1A32 A;  2Y48 A;  4FFB B;  5KHG A;  1H2M A;  2E75 B;  4MVU A;  3U10 A;  3GB7 C;  5E1A C;  1PM9 A;  1IXB A;  5FNV B;  3E83 A;  1TGO A;  2AHY A;  4R6Z A;  5L3F A;  2OT5 A;  2UXC O;  3E8G A;  1D2D A;  5CB4 B;  2BSK A;  1ZX3 A;  2IBZ H;  4D6T H;  1RM1 B;  1R6T A;  3H1K H;  3SYQ A;  2IM9 A;  2WA4 A;  2XAJ A;  3ZHR A;  5L3D A;  4DR6 B;  4WBN B;  2Q9L A;  4I55 A;  2GTS A;  2R9I A;  4QNH B;  4LF6 O;  4X65 O;  2W6I G;  4DXW A;  3W7S A;  1YHQ V;  2HLD G;  4UCV A;  4XBF A;  1B3Q A;  2XUM A;  2P90 A;  3T4Z A;  3OW2 U;  3OEH G;  5JJJ B;  5CA1 B;  2EIK B;  1L8D A;  3CHX A;  1K3E A;  3WB1 A;  2OTJ V;  1RSO A;  4KP4 A;  4DR2 B;  1ORQ C;  3JAR B;  5KA6 A;  5CBH A;  4JYY A;  3X2Q C;  3CCL V;  4P9O A;  4X1K A;  3HKB A;  3WB0 A;  4LF8 O;  3SPJ A;  4K0K O;  2WPD G;  4U3F H;  4X88 A;  4JI1 O;  1U97 A;  4X9Q A;  3DC6 A;  2DYR C;  4QE9 A;  5IYZ B;  3LNM B;  2ZR3 A;  4DRX A;  1Q7Y W;  4X64 B;  1VQ6 V;  2ZQM A;  4JI6 O;  1T5E A;  1FXK B;  1VF6 A;  2O57 A;  2Q68 A;  1YJW V;  4XDL A;  5IJ9 B;  1JCH A;  1WJZ A;  1KD1 W;  4MVZ A;  1PD3 A;  3AG4 C;  4WBN A;  2EIK C;  2CDY A;  2KB1 A;  1OCC C;  1XHX A;  5KHH A;  2PYJ A;  2CTP A;  3RYH A;  4I0X A;  1Y76 B;  4Z1M G;  2RDC A;  1XMO B;  1IZ3 A;  1CP9 A;  1I08 A;  2JS5 A;  2BE3 A;  4K8X A;  5LYJ B;  5BMV B;  3Q4H B;  4JZ2 A;  5EIB C;  1WLE A;  3CS5 A;  3ZRV A;  4JAS A;  3DGE A;  3LSU A;  4R50 A;  2DYR B;  1ARO P;  4UB8 Z;  4I50 A;  3B4S A;  2BOB C;  3D8C A;  1XNQ O;  1BQZ A;  4PDM A;  2ZE5 A;  5IJ0 A;  4X89 A;  4DR4 B;  4MTF A;  1AI6 A;  2L35 A;  2Q6A A;  4P2Z A;  2UXD B;  3CCE V;  4I9W A;  3K5M A;  2R72 A;  2ZDI C;  5KX5 B;  4UCS A;  4FM2 A;  4LR3 A;  3TXS A;  3B09 A;  5HFL A;  3CCU V;  1DTO A;  1S72 V;  4N21 A;  4MVQ A;  4OX9 B;  1AI5 A;  3K03 A;  3APQ A;  2DMX A;  3T1C A;  4TWK A;  1O9H A;  3EVK A;  1YDX A;  1WP7 A;  3R65 A;  3VOU A;  4JI5 B;  1BMF G;  1OCO C;  1M4U A;  2AGA A;  1N34 O;  1IBM O;  3MHS C;  1N33 O;  3ABL B;  3W7X A;  2DW4 A;  4PI2 A;  4JI6 B;  4IHJ A;  3JSL A;  3N27 A;  4RQF A;  1AI7 A;  3ML0 A;  4LH6 A;  3A8T A;  1J95 A;  2GTA A;  1NJI W;  1QVF U;  1SQG A;  2X6B A;  1TA8 A;  4B3T B;  1K97 A;  3K04 A;  4B3S O;  1GN4 A;  1GN3 A;  3HKE B;  4JV5 B;  1MZE A;  5DN6 G;  2QWR B;  1UFI A;  3K58 A;  1LNQ A;  2AXT Z;  2WWW A;  3F7V C;  4FM1 A;  2OCC C;  3RN4 A;  4DV2 B;  3G67 A;  3CE2 A;  3OTF A;  1PPJ H;  5B66 Z;  2XOK G;  1OCO B;  2JGD B;  5KAI Z;  3W7U A;  3E22 B;  1N34 B;  4B3M O;  5EBW C;  1EN4 A;  3T1H B;  1R73 A;  4HAM A;  3B8M A;  1R3K C;  3H9V A;  1XL4 A;  4L87 A;  4MW8 A;  4OX9 O;  2RMK B;  3M99 B;  5TIS Z;  2HHH O;  1LUV A;  3NR7 A;  4KFM A;  4YHH B;  1OCR C;  4LFB O;  3JYC A;  1EFR G;  1HDJ A;  1BT8 A;  2LO1 A;  4LF5 B;  2EIM C;  2L6L A;  1SQV H;  3QO7 A;  4PEL A;  2EIN C;  3D3I A;  2UUB O;  4O2A B;  2QR4 A;  4P9P A;  1VQK V;  2PI4 A;  4MSW C;  2YXY A;  4UVB A;  3RYC A;  2B5U A;  4LF4 B;  2BOC C;  1MNG A;  1BQ0 A;  4YIO A;  1YVW A;  2ARH A;  3ZJZ A;  4J80 A;  2WLH A;  5B1O A;  5LP6 C;  1M56 C;  4NXM O;  1JMK C;  3BA8 A;  2E76 B;  3CSX A;  2ZE8 A;  2QWN B;  4IGG A;  3G4S V;  4EEQ A;  3OUF A;  1FFT B;  2JEX A;  3CEI A;  1K7D A;  2GDS A;  2H3O A;  3CJH B;  4X8A A;  2XAQ A;  4FLU A;  3CCS V;  1VQL V;  4BIZ A;  1I7F A;  2K1E A;  2PI5 A;  1GK9 A;  1YI2 V;  1TUB B;  1PNK A;  5D5Q A;  2YEV A;  3DTU B;  4I9Q A;  4DW0 A;  4ZKI A;  1VQM V;  2WLN A;  5J2U A;  4PA7 A;  4BR6 A;  4TV9 B;  4DUZ O;  3T2M A;  1WA8 A;  2VQE B;  4FVM A;  1IDS A;  2QM7 A;  4BWA A;  5H9C A;  3CYO A;  3ASN C;  4F6R A;  1R3J C;  2IW5 A;  4FZ0 A;  5EZY A;  3A0B Z;  4PDV A;  4UV8 A;  2ETN A;  4JTC B;  1US6 A;  2AZ2 A;  2GV9 A;  4MT8 A;  5JH7 B;  3HPL C;  4G2K A;  4WFB V;  1K5Q A;  2IU0 A;  1QVG U;  5GON A;  4YY3 B;  3CXC U;  1H2L A;  1VQP V;  3FX7 A;  4L8J A;  5EK0 A;  1P84 F;  2HJD A;  3E8H A;  2Q67 A;  1PNL A;  5J2T B;  3IC9 A;  4B3M B;  2BTQ A;  1BE3 H;  4YJ3 B;  4I50 B;  2XAH A;  1H2G A;  2B1G A;  4B08 A;  1DF5 A;  4FMT A;  4GKJ O;  4JI4 O;  3DSQ A;  3RYC B;  3OGI B;  4NXN B;  4NXM B;  1KKD A;  5LMN B;  2DJV A;  5D5P A;  2YSU B;  2DQ0 A;  2Q4P A;  3JCZ A;  4O2A A;  1E1R G;  3BFR A;  2XHB A;  4UCO A;  1NZ6 A;  4PV1 B;  4ZHQ B;  5J9P C;  1OCR B;  1URF A;  1NVP B;  1MSW D;  3TJT A;  1NBM G;  1X4T A;  4WFF A;  2EIM B;  1MSD A;  1OCC B;  5ITZ A;  4PA3 A;  1HNZ O;  2YXL A;  3K5O A;  4DRX B;  1SF9 A;  4G28 B;  2YIB A;  4DV0 O;  1S5H C;  4PA9 A;  1OZ0 A;  4DUY O;  2YI9 A;  5IT9 N;  2EIJ B;  3GVM A;  5H5N A;  1SQX H;  3E22 A;  2CTQ A;  1W0K G;  1CPY A;  3ZHS A;  4X62 B;  4MW3 A;  3HKC B;  2WLI B;  2Y69 B;  3E2E A;  3Q4H A;  4MVS A;  5EYP A;  4X64 O;  1MOF A;  3K08 A;  3ETQ A;  4BW9 A;  2DWE C;  1YJN V;  3DC5 A;  2ZIO A;  4DR5 O;  3K3W A;  4PDL A;  2DYS C;  5BR8 O;  2YID A;  4QE7 A;  3JAT A;  2LFR A;  4ZI7 A;  4PD4 F;  5JQG A;  4QJF B;  1M5I A;  2Q8V A;  3APO A;  3U11 A;  4IYI A;  3ETE A;  5EIB D;  2R9A A;  3SJC C;  2QEX V;  2ATK C;  2A3Q A;  3ASN B;  5L3E A;  1W2B U;  4JI4 B;  1XL6 A;  3LUT B;  2LJ2 A;  3ZX6 A;  4FM0 A;  1RP3 B;  2OTL V;  1JFF B;  2ZNJ A;  3QG5 A;  1VEW A;  2RQ6 A;  1KYO F;  4X62 O;  1XHZ A;  3AG7 A;  3ZRS A;  2A9H A;  2UUA O;  2BCC H;  4PHZ A;  4PA4 A;  5LBQ A;  4KHP B;  4HYO A;  4EB6 A;  2ZNI A;  1YEW A;  4X1I B;  3ZHU A;  1EZV H;  1J5E O;  1O9G A;  5B5E Z;  1E79 G;  3ZCC A;  2H94 A;  1PL0 A;  4GUN A;  4LWS B;  2VQF B;  1VF6 C;  1K33 A;  5LGU A;  1WN7 A;  3D36 A;  5BR8 B;  5C8Y A;  3ZMS A;  3I56 V;  1NTK H;  3SJB C;  4YIP A;  3C3T A;  3W7W A;  2IJK A;  4GZR B;  2C2A A;  2LW1 A;  1WB8 A;  4B3R O;  3UQ8 A;  2E5L O;  4EFE A;  2WLK A;  4J9Z B;  5FNV A;  2HHH B;  4RWU A;  1NH2 B;  1QQC A;  4JI8 O;  1AP5 A;  3L73 H;  3P30 A;  4I5S A;  4IT5 A;  1QR9 A;  3J81 N;  1HW7 A;  4NTY A;  2UXB B;  1THZ A;  4DUY B;  3BPZ A;  3RVY A;  3CRQ A;  1DK1 A;  1SER A;  3CCQ V;  2CUG A;  3ZRX A;  4LF7 B;  3ZRW A;  4IYH A;  1GM8 A;  5JH7 A;  3JSN A;  1YF2 A;  1L1F A;  2Q7E A;  4GX5 A;  1W59 A;  1SET A;  2ZR2 A;  2Q0O C;  4KL1 A;  2H8P C;  3B40 A;  3WU2 Z;  1BCC H;  1DLB A;  3HKB B;  2WLJ A;  3RGB A;  3OE7 G;  4JI3 B;  2VWK A;  4F6R B;  4O4J A;  1J5E B;  3ZMV A;  3CCM V;  1G8M A;  1EN6 A;  4CS2 A;  4TV8 A;  2M6Y A;  1M1K W;  2IJH A;  2VWJ A;  4DV1 O;  2FTK A;  5A9G A;  3K9S A;  5JVD A;  2JVD A;  4FLY A;  1D5N A;  1QBZ A;  1FXV A;  4X20 A;  2RJZ A;  3JAK A;  1Q82 W;  4Q6G A;  4DV5 O;  1EM1 A;  3JD3 A;  4QPK A;  4AIL C;  1Y67 A;  2YI8 A;  3LDC A;  1V55 B;  1K4D C;  5K1X A;  4XDJ A;  3D3Q A;  5IWA O;  3TCU A;  4NTX A;  5JJE B;  4X66 O;  4UB6 Z;  4YJ2 B;  4FFB A;  1IBK B;  4O4I B;  3RYI B;  1IBL B;  5LGN A;  2PYL A;  1SQQ H;  1KU9 A;  1V9P A;  1FXH A;  1JQ0 A;  3AK2 A;  4OPA A;  4H13 B;  2B9Z A;  4NKG B;  1ZUQ A;  4DR5 B;  5LGT A;  1WA8 B;  1SES A;  3FB5 C;  4TSF G;  1SQP H;  4I7Z B;  2CTR A;  2JS3 A;  1KBH A;  1KUQ A;  2IH3 C;  2KQX A;  4JF3 A;  3KCX A;  1Z2G A;  4ZHQ A;  1XUQ A;  1OHH G;  3WFV A;  2CH7 B;  3LNN A;  5KLV H;  4MVM A;  3IJ4 A;  3OTO B;  2M7W A;  3ASO B;  2HFE C;  4H44 B;  1GN6 A;  3K57 A;  4UFZ A;  1GAX A;  4J10 A;  3PN1 A;  2ZXW C;  3LSQ A;  1K8A W;  4E2L A;  3IC7 A;  2ADP A;  1XMQ O;  2P4K A;  4DV7 B;  4WFH A;  3ZHQ A;  4B7K A;  1G6U A;  5HFM A;  5EC1 C;  1DGS A;  3BEH A;  1N0N A;  4FLW A;  2FYU H;  5KUM A;  1P7G A;  5KMG B;  3ABM B;  3T4D A;  2P22 C;  3ZMT A;  3MAQ A;  3HKE A;  1Y76 A;  1Q5O A;  4JYA O;  2YIA A;  4CZZ A;  3L70 H;  2CH7 A;  2NR5 A;  4JI7 B;  3T1Y O;  4UVA A;  5IE9 A;  1MZF A;  1P7B A;  4LFA B;  2OWO A;  5KA5 A;  4LWS A;  4YHH O;  1IBK O;  2VQF O;  5IWA B;  1SA0 A;  1YJ9 V;  4FFK A;  4A5U B;  4CH6 A;  3IAY A;  1AJQ A;  3MD0 A;  1HNW B;  1K5S A;  4C7U A;  2JJ1 G;  4H37 A;  1N32 O;  1BHB A;  2OIG A;  2KKW A;  2ODM A;  1OCZ B;  2Y0I A;  2QM4 A;  4AHC A;  3G80 A;  4EKW A;  3JAL B;  4JI5 O;  2HVJ C;  2AZ0 A;  4HBN A;  3JAM N;  4KUM A;  3TGU H;  1FFX A;  4LNU B;  4YJ2 A;  2QWO B;  2A0L A;  4ZOL A;  1KQS U;  1V54 C;  1F4M A;  2ILM A;  4LH7 A;  3DXR B;  3P3P A;  3SJQ C;  4CC6 A;  1XNR B;  2QGN A;  4RQE A;  4HZ3 A;  1S5L Z;  4JYA B;  3THO A;  4U3J A;  2Q7H A;  4JI3 O;  2QM8 A;  3ZIA G;  1G4Y B;  3ZHT A;  3BCC H;  3K79 A;  4DR2 O;  3CC4 V;  1N36 B;  1PL4 A;  3T1Y B;  1Y74 B;  1RFY A;  1P4R A;  4MVO A;  3ABK C;  2ZM6 O;  2Q73 A;  3ABT A;  1BS3 A;  3BVO A;  3ASO C;  4CC5 A;  2P4V A;  1L0N H;  2YS8 A;  3F5T A;  1NTZ H;  3VQV A;  1M93 A;  3RWR D;  2RCV A;  1F4N A;  1WB7 A;  2F93 B;  4QIW F;  1PP9 H;  1TVK B;  2GUZ A;  3JAS A;  5B1A C;  2ZD9 A;  2F23 A;  4H0L B;  1LUW A;  5BZB A;  5B3S C;  5FPR A;  1FXK A;  4TUY A;  3SPH A;  1GKF A;  4LF9 B;  1SRY A;  2BTO A;  3CMA V;  3EFF K;  4DR4 O;  1JPX A;  4O4H B;  3VQY A;  1XEQ A;  3ABK B;  2QSA A;  3RVZ A;  4DK0 A;  4LFC B;  4GKK O;  1MA1 A;  3HB3 B;  4DV3 O;  1HR0 B;  3R66 A;  2IJI A;  4WCE V;  2VQE O;  2WA3 A;  1YIJ V;  1XNQ B;  1K92 A;  5IY5 B;  2XAF A;  4J7K A;  2K9P A;  1M9N A;  4X66 B;  4N23 A;  2JDI G;  1Y6X A;  3L75 H;  2JGU A;  3CC7 V;  3G6E V;  4JI2 O;  4FPP A;  4YJ3 A;  1SC5 B;  5J2T A;  3ZS8 C;  2D2C B;  1VQ5 V;  2X6C A;  3FAV B;  4JGS A;  3OR6 C;  3K59 A;  4YY3 O;  2EZO A;  4DV0 B;  4FJC C;  1RPO A;  2F43 G;  5IYB O;  5LXT B;  1Z5W A;  3AG2 C;  1SKV A;  1VAR A;  5CMU A;  3CRA A;  1EBO A;  5BXZ A;  3FB6 C;  2RNB A;  4JAA A;  4B3S B;  3OAA G;  1DF4 A;  4K35 A;  3OT7 A;  2UU9 O;  1VQ9 V;  5EZY B;  4LF8 B;  1COW G;  2ZKO A;  4LFA O;  1NI8 A;  3LDE A;  3JAR A;  1AR5 A;  4K0K B;  3JD4 A;  3JCU Z;  1XIL A;  1PV0 A;  1SQF A;  1GRJ A;  4BIO A;  2A79 B;  3ZRW B;  4GX2 A;  3SJA C;  4Z1V A;  2PF4 E;  1M90 W;  2W0X A;  1BHA A;  1K73 W;  5EC2 C;  1VQ7 V;  3BAB A;  1EZJ A;  2R70 A;  1YIT V;  3CPW U;  3QO8 A;  3SR2 C;  3VBB A;  1GMG A;  4AQY B;  4GX1 A;  5CBG A;  2UXB O;  4LF4 O;  5H2F Z;  2R9R B;  2HP8 A;  4UCR A;  3CD6 V;  5KUK A;  4MTG A;  2UXD O;  2F95 B;  3C90 A;  1HNZ B;  2EUL A;  1KKC A;  4LF5 O;  2FKX A;  5BY1 A;  1FXK C;  1FYJ A;  4OGQ B;  1Q6U A;  4JI0 O;  4DR1 B;  2UUC O;  4LFB B;  4U3J B;  4CBC A;  4OPH A;  1ZAU A;  2UU9 B;  1VQ8 V;  2Z5U A;  1U96 A;  2EIN B;  3KZI Z;  2V1D A;  2LGW A;  1YTF D;  4R7C A;  1MG1 A;  2VS0 A;  3JAS B;  3H1I H;  2HJF C;  3L9D A;  2GHY A;  2EJ7 A;  2YUA A;  1TAE A;  2UUA B;  1JR9 A;  3CME V;  4UUJ C;  1FJG O;  1M56 B;  3ABU A;  3J80 N;  3RYI A;  1RM1 C;  1GM7 A;  1XDC A;  2P5O A;  3L72 H;  5LHI A;  4Z2W A;  3UKM A;  1YSC A;  1ZL8 A;  3SPG A;  4JV5 O;  4DYL A;  1I0H A;  1K34 A;  4HNA B;  5AG2 A;  4WF9 V;  2XAS A;  1GH6 A;  4ZI7 B;  3AG2 B;  3JAT B;  2YIB D;  3RBZ A;  2KSD A;  1GN2 A;  4LFC O;  4TT3 G;  1BZK A;  4D7S A;  1AP6 A;  2DQ3 A;  1VQ4 V;  3P32 A;  4ICG A;  1SZX A;  3X2Q B;  3FYI B;  4U7N A;  5B1B B;  3N2K B;  1GTO A;  4HNA A;  4WFE A;  4GKJ B;  2WSS G;  1D5A A;  1JJO A;  1AB3 A;  5CA0 A;  1XMO O;  1FD9 A;  4U7O A;  3KCY A;  3SYO A;  4DV4 B;  3FKS G;  2FML A;  3K0G A;  3T1H O;  3AG3 B;  4LBE C;  3VQW A;  1I94 B;  1W0J G;  3EXA A;  3AG4 B;  3B77 A;  3FD9 A;  2KG7 B;  5C93 A;  3B8N A;  2YDE A;  2NLJ C;  4F4L A;  1NU1 H;  5J2U B;  4GLX A;  4DK1 A;  1WAZ A;  1QLE B;  1QU7 A;  1P49 A;  1KMI Z;  5B1B C;  2E5L B;  4JYC A;  5LP6 A;  3CCJ V;  4TQD A;  2UUB B;  1TUE B;  5JCO A;  1QR8 A;  1ZSP A;  5LMN O;  1JX9 A;  3A0H Z;  1IVS A;  4ASU G;  3HR0 A;  4FLV A;  1YCI A;  4WFG A;  2ZIM A;  2ZIN A;  2QA4 V;  3NXS A;  4UCT A;  3MHH C;  3ZN0 A;  4LF7 O;  1Q90 D;  1XOU A;  4O4L B;  3BAA A;  1QCE A;  2ZT9 B;  3L74 H;  4UXN A;  2RN9 A;  1H2N A;  1ROP A;  3FYE B;  2N05 A;  4JZG A;  4RO2 A;  2EIL C;  2ZM6 B;  4FLZ A;  3OM3 B;  4DV5 B;  2Y4T A;  4DV4 O;  3LDD A;  5JVD B;  4F6E A;  5LHH A;  3KG2 A;  4JTD B;  2KG7 A;  2OIE A;  2XAG A;  1IUR A;  3GWO A;  5E79 Z;  3G6B A;  3H1J H;  3CC2 V;  2ADQ B;  3ETD A;  1AR1 B;  4W4K A;  1HP8 A;  3JAL A;  1Y66 A;  2HG5 C;  5L3C A; 
#chains in the Genus database with same CATH homology
 2DYS B;  4PDV A;  2HKO A;  4KUM A;  4UV8 A;  4JTC B;  1WPX A;  2ITD C;  1AI4 A;  2A0L A;  1R6N A;  1M57 C;  1KQS U;  1V54 C;  1SZT A;  2ITC C;  4MT8 A;  2QTO A;  1F4M A;  3HPL C;  4G2K A;  4WFB V;  1K5Q A;  2NNU A;  4GCZ A;  2IU0 A;  3OR7 C;  1QVG U;  3H01 A;  3SJQ C;  3CXC U;  1VQP V;  4RQE A;  1R3L C;  4HZ3 A;  3STL C;  5EK0 A;  4UV9 A;  3E8H A;  2P7T C;  2Q67 A;  3SYP A;  2OCC B;  1PNL A;  3WG7 C;  1KP3 A;  2UXX A;  3OMN B;  4JAV A;  2QM8 A;  3ZIA G;  1G4Y B;  4J9Y B;  3K79 A;  3CC4 V;  3K06 A;  2Z3Y A;  2XAH A;  1H2G A;  2B1G A;  2WLM A;  5L3G A;  1DF5 A;  1S76 D;  4FMT A;  1P4R A;  4MVO A;  2EIJ C;  3ABK C;  3RW0 A;  3AG1 B;  1RPR A;  3AG3 C;  3ABT A;  3CCR V;  4LP8 A;  1NQT A;  1R6K A;  4RUF A;  2P67 A;  2QKS A;  1KKD A;  3ASO C;  1N8R W;  1H8E G;  5IYC O;  2YSU B;  2DQ0 A;  2WAM A;  1Q86 W;  3CP1 A;  1M57 B;  3JCZ A;  1NR1 A;  1E1R G;  5IDJ A;  3SYC A;  4RAI A;  4FIP C;  1F4N A;  3SYA A;  2HR3 A;  4QIW F;  3ZN1 A;  2ZDI A;  5J9P C;  3CCV V;  1OCR B;  1NVP B;  1NR7 A;  5B1A C;  1E1Q G;  1MSW D;  2B1I A;  3ABM C;  5GW7 A;  3ZMU A;  2ZD9 A;  1S0V A;  1NBM G;  4OXS A;  3W7T A;  4WFF A;  2EIM B;  5B3S C;  5BZB A;  1JJ2 U;  4BIU A;  1OCC B;  5B1N A;  3OEE G;  1FXK A;  4PA3 A;  4FK5 C;  3K9A A;  4MTX A;  3SPH A;  3IGA C;  2IU3 A;  1GKF A;  4G28 B;  1SRY A;  3AEI A;  3CMA V;  3EFF K;  1S5H C;  1JPX A;  2V7Q G;  2W0F C;  5FL7 G;  4PA9 A;  1OZ0 A;  2EIJ B;  3ABK B;  1B6Q A;  3RVZ A;  5EBL C;  3TET A;  1W0K G;  1MAB G;  1CPY A;  1OCZ C;  3HB3 B;  1QLN A;  2Y48 A;  4MW3 A;  2IJI A;  4WCE V;  1AJN A;  3F5W C;  1YIJ V;  4MVU A;  3GB7 C;  2WLI B;  2Y69 B;  5E1A C;  1Q81 W;  1K92 A;  5IY5 B;  2XAF A;  3E83 A;  4P30 A;  5EBM C;  2AHY A;  4R6Z A;  5L3F A;  3E2E A;  2OT5 A;  1NH2 D;  4MVS A;  3SPI A;  1MOF A;  3E8G A;  3K08 A;  1M9N A;  4N23 A;  2JDI G;  2DWE C;  1YJN V;  3CC7 V;  4LC1 A;  3K3W A;  4PDL A;  1UJW B;  1RM1 B;  2DYS C;  3G6E V;  3OMI B;  1CEZ A;  4FPP A;  4QE7 A;  1NKD A;  3SYQ A;  2LFR A;  3FB7 C;  2XAJ A;  4JTA B;  1VQ5 V;  4QJF B;  5L3D A;  1BL8 A;  2X6C A;  3LSS A;  4JGS A;  3ETE A;  3OR6 C;  2R9I A;  4QNH B;  1ZWI C;  2EZO A;  4RUE A;  2W6I G;  4DXW A;  3W7S A;  4FJC C;  1YHQ V;  2HLD G;  1RPO A;  2F43 G;  3E89 A;  5IYB O;  4XBF A;  3AG2 C;  2QEX V;  2ATK C;  4JYB A;  3T4Z A;  2P90 A;  3ASN B;  3OEH G;  5L3E A;  3OW2 U;  5CMU A;  1XL6 A;  1W2B U;  2CK3 G;  1PKX A;  2EIK B;  3LUT B;  1EBO A;  1K3E A;  2OTJ V;  3FB6 C;  4KP4 A;  1ORQ C;  3OAA G;  1DF4 A;  5KA6 A;  5CBH A;  2OTL V;  3X2Q C;  1VQ9 V;  1F23 A;  3CCL V;  4P9O A;  2JIZ G;  1COW G;  1YTF B;  3SPJ A;  1IXM A;  2JK5 C;  3LDE A;  3ZRS A;  2A9H A;  2WPD G;  3JD4 A;  3K0D A;  4PA4 A;  4X88 A;  2EZP A;  1PNM A;  2DYR C;  4QE9 A;  3LNM B;  5LBQ A;  1KP2 A;  2P6J A;  4HYO A;  2ZR3 A;  4ZBM A;  1Q7Y W;  3E8B A;  4MVR A;  1VQ6 V;  2ZQM A;  2A79 B;  1FXK B;  3ZRW B;  5LHG A;  1Y4M A;  2Q68 A;  4GX2 A;  1YJW V;  1I5X A;  4XDL A;  1JCH A;  5L3B A;  1KD1 W;  4MVZ A;  1PD3 A;  1GM9 A;  3AG4 C;  3EHB B;  1M90 W;  1BHA A;  1E79 G;  1K73 W;  5EC2 C;  1VQ7 V;  1K4C C;  2H94 A;  3ZCC A;  5CBF A;  1PL0 A;  1S3J A;  3BY6 A;  2EIK C;  3IFX A;  2YEV B;  1K33 A;  2KB1 A;  3D36 A;  5LGU A;  1EZJ A;  1YIT V;  3CPW U;  1OCC C;  3QO8 A;  3ZMS A;  3I56 V;  4Z1M G;  3VBB A;  1GMG A;  1CP9 A;  4GX1 A;  5CBG A;  3W7W A;  2IJK A;  2C2A A;  4JPR A;  5H6Q A;  2WLK A;  4GT1 A;  4J9Z B;  1KEC A;  1WLE A;  2R9R B;  3ZRV A;  4JAS A;  3CD6 V;  3DGE A;  5KUK A;  4MTG A;  1NH2 B;  4R50 A;  2DYR B;  1ARO P;  3P30 A;  4I5S A;  3OUS A;  1VQO V;  1QR9 A;  1GO3 F;  2ZXW B;  2BOB C;  2EJR A;  1THZ A;  1FXK C;  4PDM A;  4X89 A;  3RVY A;  4DO2 A;  4JAU A;  1QLE C;  1SER A;  4MTF A;  3CCQ V;  1FS0 G;  1AI6 A;  2Q6A A;  4P2Z A;  3CCE V;  3ZRX A;  2D3O W;  2DWD C;  4I9W A;  4CBC A;  5IYD O;  4PA6 A;  3ZRW A;  2ZDI C;  1VQ8 V;  2Z5U A;  1H38 A;  1ENV A;  1GM8 A;  2EIN B;  2V1D A;  1L1F A;  4GX5 A;  1YTF D;  4R7C A;  1MG1 A;  1SET A;  2ZR2 A;  3OGC C;  4XDK A;  2H8P C;  2HJF C;  5HFL A;  3CCU V;  1DTO A;  1S72 V;  4N21 A;  4MVQ A;  2Y69 C;  1AI5 A;  1DLB A;  2WLJ A;  3OE7 G;  2GHY A;  3K03 A;  1NVP D;  3T1C A;  4WFA V;  1I5Y A;  4TWK A;  4UUJ C;  3ZMV A;  1M56 B;  3CME V;  3CCM V;  1G8M A;  4MTO A;  3ABU A;  3I55 V;  4UVC A;  3R65 A;  1RM1 C;  3VOU A;  1BMF G;  1R3I C;  1OCO C;  3QNE A;  2MK3 A;  1GM7 A;  3MHS C;  3ABL B;  1M1K W;  3W7X A;  2DW4 A;  2IJH A;  5LHI A;  2FTK A;  3UKM A;  1JOY A;  1YSC A;  3SPG A;  4RQF A;  1JVM A;  1K34 A;  4WF9 V;  2EIL B;  1QBZ A;  2XAS A;  1FXV A;  1AI7 A;  3ML0 A;  4QPJ A;  1F51 A;  5CN0 A;  1Q82 W;  1J95 A;  2XND G;  4Q20 A;  3AG2 B;  2HVK C;  2WLL B;  3JD1 A;  3SPC A;  1NJI W;  1QVF U;  2X6B A;  3RBZ A;  3JD3 A;  4MS2 A;  4QPK A;  1K97 A;  2IJJ A;  3K04 A;  4TT3 G;  5CA3 A;  3A0R A;  2EBO A;  3ZMZ A;  3LDC A;  5DN6 G;  1V55 B;  1K4D C;  2WLL A;  2DQ3 A;  3TK1 A;  3QO5 A;  1LNQ A;  1VQ4 V;  3P32 A;  3ETG A;  4XDJ A;  3X2Q B;  2WWW A;  3FYI B;  4U7N A;  5B1B B;  3TCU A;  2X6A A;  1GTO A;  3F7V C;  2OCC C;  4WFE A;  3WG7 B;  2WLI A;  2WSS G;  4GX0 A;  2XOK G;  3E8F A;  1OCO B;  3JD0 A;  4U7O A;  3SYO A;  3W7U A;  5LGN A;  5EBW C;  3FKS G;  1H8H G;  1V54 B;  1R73 A;  4R8C A;  1FXH A;  1JQ0 A;  3AG1 C;  3K0G A;  4HAM A;  3AG3 B;  4LBE C;  3STZ C;  1W0J G;  3B8M A;  1R3K C;  5LGT A;  3AG4 B;  3B77 A;  5DM6 V;  2QE7 G;  1SES A;  1XL4 A;  3FB5 C;  5C93 A;  3OFN G;  4L87 A;  4MW8 A;  3B8N A;  1KC8 W;  2NLJ C;  3M99 B;  4TSF G;  4F4L A;  2IH3 C;  1V55 C;  4JF3 A;  4KFM A;  4BW5 A;  1OCR C;  3JYC A;  1EFR G;  1QLE B;  4G27 B;  3E86 A;  3PJS K;  3F7Y C;  5B1B C;  2Q69 A;  3FB8 C;  4JYC A;  2EIM C;  3QO7 A;  5B3S B;  4PEL A;  3CCJ V;  1OHH G;  3WFV A;  2EIN C;  2AHZ A;  1TUE B;  4MVM A;  3D3I A;  3E35 A;  1QR8 A;  2JEU A;  4H33 A;  1JX9 A;  4P9P A;  1VQK V;  2PI4 A;  2M7W A;  3ASO B;  4MSW C;  4ASU G;  1S77 D;  2HFE C;  4UVB A;  2ZXW C;  4WFG A;  3LSQ A;  1K8A W;  4E2L A;  2B5U A;  3IC7 A;  2BOC C;  4WFH A;  2QA4 V;  4YXW G;  3UM7 A;  3NXS A;  3ZJZ A;  3JD2 A;  5HFM A;  2WLH A;  3BEH A;  5EC1 C;  5B1O A;  1M56 C;  3MHH C;  3ZN0 A;  3G4S V;  5KUM A;  5B1A B;  3OUF A;  1FFT B;  3ABM B;  3T4D A;  2JEX A;  3ZMT A;  1K7D A;  4LCU C;  1QCE A;  4X8A A;  2XAQ A;  4CZZ A;  3CCS V;  1VQL V;  1VQN V;  2UXN A;  4UXN A;  4BIZ A;  2K1E A;  2LFS A;  3ABL C;  2PI5 A;  4UVA A;  1GK9 A;  1P7B A;  1YI2 V;  1ROP A;  1PNK A;  2W6J G;  2YEV A;  5KA5 A;  3FYE B;  3DTU B;  4ZKI A;  1VQM V;  4RO2 A;  2EIL C;  2WLN A;  3OM3 B;  1YJ9 V;  3LDD A;  4PDR A;  5H6R A;  1AJQ A;  3MD0 A;  4PA7 A;  1K9M W;  5LHH A;  1K5S A;  2JJ1 G;  2X0L A;  3KG2 A;  2JJ2 G;  4H37 A;  1BHB A;  4JTD B;  1OCZ B;  3T2M A;  2XAG A;  2IH1 C;  3GWO A;  2LP7 A;  4EKW A;  3CC2 V;  2QM7 A;  5H9C A;  3ETD A;  2HVJ C;  1AR1 B;  3CYO A;  2GSM B;  3ASN C;  1AJP A;  5IY5 C;  2X7R B;  1R3J C;  1HWY A;  1Y66 A;  2HG5 C;  5L3C A;  3G71 V;  2IW5 A;  3OMA B;  4BAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...