3E8GA

Crystal structure of the the open nak channel-na+/ca2+ complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8gA00
3SPJA 3ZRSA 2IH1C 4J9YB 3AG1C 4MVRA 4LCUC 3SPCA 3SYAA 3TETA 3UM7A 2WLLA 4HZ3A 2HVJC 4UUJC 2X6BA 5CBGA 2WLKA 3FB7C 4MSWC 2A0LA 3ASOC 1OCRC 3FB5C 4MVSA 1KKDA 1JVMA 1BL8A 1M56C 3F7YC 1XL4A 2ATKC 3RVZA 5CBHA 2HVKC 2R9RB 3ABKC 2AHZA 4P2ZA 3UKMA 4X88A 3SYQA 3HPLC 3K06A 5IY5C 3BEHA 4GX1A 3EFFK 4LP8A 3SJQC 3E83A 5KUKA 2EILC 1OCCC 4JTAB 3VOUA 5J9PC 4QNHB 2EIKC 3SPGA 3K03A 4JTDB 3E89A 4P30A 4R8CA 1S5HC 4PDMA 2OCCC 3OR6C 4MVOA 2EIJC 2WLMA 4WFFA 5EBLC 4PA6A 4MS2A 1ORQC 1V55C 2QKSA 4CBCA 4PDRA 2Q6AA 4XDLA 1R3JC 4MW8A 4TWKA 3ZJZA 2Y69C 4PDVA 3FB8C 3LDDA 2DWDC 3PJSK 3FB6C 2JK5C 3K04A 2DYRC 3T2MA 3AG3C 4P9PA 3E8HA 2EIMC 3R65A 3STZC 2WLIB 2X6CA 2DYSC 4LBEC 2H8PC 3TCUA 3ASNC 4G28B 4MW3A 3OUSA 1OCOC 3K0GA 2A79B 2HFEC 4MTGA 4XDJA 4I9WA 5KUMA 4MTOA 3RW0A 2Q67A 1QLEC 4RO2A 3X2QC 2HJFC 1V54C 2WLHA 5B3SC 3RVYA 3T4ZA 4MVUA 4MTFA 4PDLA 5EBMC 2X6AA 1LNQA 4H37A 4HYOA 3STLC 4PA3A 3T4DA 3OGCC 4WFGA 2YEVA 3AG2C 5EC1C 3GB7C 1M57C 4PA7A 1K4DC 5EK0A 5B1AC 1G4YB 4MVZA 4WFEA 2WLIA 5E1AC 3IGAC 4RUEA 3LUTB 4JTCB 2Q68A 2QTOA 2WLJA 4H33A 1OCZC 2ZD9A 3SPIA 2ITDC 3AG4C 2AHYA 4X8AA 4WFHA 1R3IC 3F7VC 1XL6A 3K0DA 4X89A 3E8GA 3SYPA 3T1CA 5CBFA 2ITCC 3KG2A 4R50A 4P9OA 2KB1A 4MVQA 2K1EA 4BW5A 4GX2A 4G27B 4R7CA 3OR7C 5B1BC 3ABMC 1J95A 1P7BA 4QE9A 3WG7C 3E8BA 3E86A 2Q69A 5EC2C 2WLNA 4RUFA 4KFMA 2DWEC 4J9ZB 2IH3C 3OUFA 4EKWA 4MVMA 3JYCA 1R3LC 2WLLB 2P7TC 2EINC 4RAIA 3LDEA 2BOCC 4GX0A 4F4LA 4DXWA 5EBWC 3F5WC 3K08A 3SPHA 3LNMB 3SYOA 3ABLC 2NLJC 2ZXWC 4OXSA 4PA9A 1K4CC 2W0FC 4XDKA 3IFXA 3RBZA 4PA4A 4QE7A 1ZWIC 4GX5A 3E8FA 5BZBA 3LDCA 2A9HA 4ZBMA 1R3KC 4R6ZA 2BOBC 2HG5C 3SYCA
chains in the Genus database with same CATH superfamily
4DV2O 4DR1O 4J9YB 4LCUC 1H2LA 1GAXA 4QPKA 2BE3A 4B3MO 5GW7A 3ASOC 5DM6V 1BL8A 4JI8O 1I94O 4YJ3B 2RDCA 1ZX3A 3A2FA 2F43G 3JARB 4GX1A 2EILC 3JAWB 3JAMN 2IJKA 4ZIBA 3CB2A 2F95B 5CN0A 2QKSA 1YJWV 3D8CA 4IT5A 5CMUA 1AVMA 1KYOF 1DLBA 3I55V 2UXCB 5BY1A 5L3CA 1N0JA 2WLIB 1HNXB 3CCJV 1HNWB 2VS0A 3J80N 1Q81W 2CUGA 2RCVA 2WSSG 5H5NA 1ZUQA 3JSLA 1DF4A 3CRCA 1ZL8A 2Q4PA 3STLC 4DW0A 5KLVH 4WFGA 3L72H 4LF5B 3WU2Z 2XAFA 1FXKA 5JQGB 2FL4A 4WFEA 4WF9V 4FM2A 1SC5B 1R6TA 4LF9B 4UXNA 4R7CA 1P7BA 2QM4A 5FNVA 3BY6A 4I7ZB 2DWEC 1SZXA 4JF3A 1Z5WA 4JI4O 2YXLA 2WLLB 1OCOB 5IYDO 4DXWA 2UXDB 2NLJC 4PA9A 4ZOLA 4I50A 4DO2A 4GKJO 3FD9A 5B1AB 4TV8A 4TQDA 1QLNA 4W4LA 1X59A 3SPCA 2XNDG 4LF7O 3ZRXA 4GYCB 4BR6A 2CTQA 3CX5F 3A0BZ 3FB5C 5CB4A 3ABMB 2RQ6A 3WG7B 3G6BA 1BHAA 2BSKB 3H1LH 1KMIZ 1VQ6V 1YTFB 2N05A 3GVMA 3SJQC 2B9ZA 4JI6B 4NXNO 3E22B 3E83A 3M8AA 2IU0A 5J9PC 2IM9A 3K58A 4PELA 1S5HC 1F4NA 4ABMA 2KSDA 1MZFA 4WBNA 4JYCA 4NTWA 2AZ0A 4JAVA 3UQ8A 1RM1C 1NVPD 1KKCA 3I5DA 1VEWA 1JCHA 5IT9N 1AJQA 1XI1A 3TCUA 1FJGO 4X20B 1M56B 1JFFA 5ITZA 5J2TA 4K8ZA 1XDCA 5LP6A 3C3SA 3OGCC 1O9HA 1SESA 1WN7A 1LUWA 4Q20A 4D6TH 2QJ1A 2HHHO 4DR3O 1GN6A 2QKAA 4JI3O 1GK9A 3G6EV 4DV2B 4DR1B 3UT5B 1U96A 2Y0IA 3CMEV 1ROPA 1YF2A 2ZR2A 4B3MB 1HP8A 4IYHA 4GCZA 4QE9A 4K3AA 1S77D 3D36C 4X1KA 1N33O 4JI8B 1UFIA 1I94B 3ASNB 4B7KA 3FX7A 3JD0A 1B3QA 1KP3A 4GX0A 4LR3A 1YJNV 3B8NA 1A32A 2UU9O 2CAZC 1H2KA 3AG2B 4LFBO 1M57B 2BOBC 1XBLA 4A5UB 1VQOV 2CK3G 3TETA 1DTOA 3LNNA 4TSFG 2PYLA 2XUMA 1Q43A 4GUNA 2CH7A 2ZDIC 2R9RB 4LF8O 2LW7A 3EXAA 5IY5C 5H9CA 1N36O 4K0KO 3JATA 4P30A 3S3XA 3TXSA 4ASUG 4IIJA 2A3QA 5H6RA 3SDLA 4MVOA 4FLZA 2ZXWB 3K79A 4HAMA 4CH4A 1ZL8B 4J10A 4PDRA 1H2SB 2Q9LA 3RYCB 1G1XB 2PZSA 1YVWA 2OWOA 1FXKB 1SQVH 4I0XB 3ZN0A 1FXHA 4P9PA 1W0KG 1MG1A 4QPJA 5KHHA 3L75H 2F4VO 5J2UA 4MTGA 2UXXA 1PNMA 3G67A 3RYHB 4JI4B 1V54C 2B5UA 1MSWD 4XBFA 5KHKA 1QVGU 2WPDG 5FNVB 1H8EG 5EC1C 4TQFA 4TV9A 3O9OA 2P4VA 4JI5O 4GKJB 5JCOA 5KHGA 2P22C 1SA0A 3RYIB 1N32B 2M6YA 2RJZA 4LF7B 4GX2A 2CE4A 1PNKA 5GTHZ 5B1BC 3E86A 1XNRO 5BMVA 4O4LB 2WLNA 3ABKB 2ETNA 4FZ0A 1XEQA 4MVMA 3M7MX 3DC5A 2GUZA 1PV0A 4NXNB 5B3SB 3B8MA 5CB4B 1IXBA 1S3JA 2E5LO 3OE7G 1OHHG 5HFMA 1PNLA 3G80A 3U10A 3RWRD 1NH2B 4R6ZA 4J41A 3ZHUA 3QG5A 2R72A 2XAHA 3IJ4A 2N04A 2Q0OC 1BZKA 4WBNB 1M9NA 2YI9A 4PV1B 3B09A 4WFAV 3B77A 1XUQA 1FJGB 1NT2B 1Z2GA 3OEEG 1KUQA 1LUVA 4NYKA 3SYQA 1FAFA 2F23A 2YXHA 3OR6C 1TUEB 1JFFB 1VQMV 4IHJB 5J2TB 4DR3B 3K9SA 3NXSA 5LP6B 4MW8A 4JI3B 3ZIAG 4YHHO 3K5NA 3T2MA 4H0LB 2FYUH 4X1IA 1Y66A 1E79G 2UUAB 4I9QA 2WA4A 4CS2A 3OUSA 2A7WA 2P67A 1K7DA 3E35A 1N33B 3CCSV 1M5IA 4MVUA 5JH7A 2QKCA 4UV8A 3JCUZ 1BQ0A 4X1KB 3N2GA 3CP1A 1G4YB 2UU9B 3VQVA 1VQKV 2ZKOA 5KA5A 4LFBB 3W7SA 2EIJB 2QA4V 1TA8A 2LW1A 4J11A 4Z1MG 4DW1A 1SQQH 1NTMH 1AB3A 2E76B 2JJ1G 4RUFA 3TXQA 4LF8B 2EULA 5DN6G 1N36B 4K0KB 1WB7A 4CC5A 1YEWA 4NVPA 3UCSC 1AR4A 4FPPA 5EZYA 3DTUB 1K5SA 2PTMA 4H44B 3RBZA 1SQXH 1WLEA 1PP9H 1QR9A 3F5TA 1VQLV 3JATB 4IIJB 1CP9A 4F6RA 4MVSA 2YXYA 4TT3G 3JASA 3VBBA 3SJCC 3ABKC 2OTJV 1IBLO 3QVNA 2ZQMA 1AR1B 2Q5ZA 4UVAA 1H38A 5KMGA 3U0ZA 3ZMZA 5J2UB 3JCZA 2EINB 3OGIB 4JTDB 5L3DA 4B7EA 4UB6Z 3ETEA 5BR8O 1VQNV 5D5QA 3CCEV 4JI5B 1T5EA 3FB8C 5DEDA 1I5YA 1SQFA 2DOSA 4JI2O 4TV9B 2OIGA 4DR2O 1W59A 3P30A 1PL0A 1SA0B 1QLEC 1SS3A 4JI0O 1B06A 1FD9A 2ZR3A 1Y74A 5GONA 5EBMC 1LNQA 1PM9A 5KHIA 5EIBC 1WPBA 2E5LB 4EEQA 1YCIA 4JZGA 4MT8A 3LUTB 4DUYO 2GUZB 4JTCB 2PI5A 1Y4MA 3SPIA 4O4JA 4UB8Z 5LGTA 3JALB 4UCOA 2KB1A 4UV9A 4U3FH 2GTAA 4H13B 3HKBA 5LYJB 1KB9F 4QJFB 3ZHVA 5C8YA 4DV1O 4RWUA 1M93A 2YIBA 4U7NA 3F5WC 4LH6A 3BRCA 1YHQV 1EN5A 4OXSA 2JJ2G 1WNSA 3E8FA 2IW5A 3KCYA 1E1RG 2GHYA 4YXWG 4JI7O 3VQWA 3IC7A 4YHHB 4IYIA 4LH7A 4LFAO 1HNZO 4MSWC 1Y67A 4UCRA 1GM9A 3F7YC 1WP7A 2AHZA 1G6UA 3HKCA 1NVPB 3APOA 4X1IB 2P6JA 2QWNB 1EN4A 2M7WA 3ABUA 1X4TA 4N23A 2OCCC 1GMGA 2YI8A 3CCVV 1Q8IA 2E3CA 1N34O 1V55C 4UCSA 1Q3EA 1YXBA 3W7XA 4DK0A 1L8DA 4BIUA 2JGDA 1URFA 3QNEA 3AG1B 4LBEC 2ADPA 3G4SV 3GWKC 1OCRB 1OV9A 1YIJV 2HJFC 2P5OA 2KQXA 3BAAA 3RVYA 5B1OA 1S76D 4CS4A 4CH5A 2YEVA 1UPGA 1K9MW 3IAYA 4K8XA 1VQPV 2UUCO 4ZI7A 3AG4C 2R9AA 5JWPA 1XL6A 3ETDA 1I0HA 1Y76A 4B08A 3ML0A 5KX5A 5JVDB 4G27B 1IXMA 3A0HZ 3OR7C 4O2BA 1V9PA 2IU3A 2Q69A 4KFMA 4LC1A 1BQZA 4DV6B 2Y4TA 2ZINA 4B3TO 1R3LC 4PJ0Z 1IBLB 3H1IH 2VQEO 4JZ2A 1Q6HA 3CCRV 1IX9A 3BPZA 4DYLA 5KMGB 5IYBO 2F93B 5BR8B 3ZHRA 4DK1A 4FVMA 2W6IG 4E2LA 1BSMA 4EFEA 1WA8A 4HZ3A 1ENVA 5LA6A 2C2AA 5HFLA 4WFBV 1P7GA 4JI2B 1Q90D 4DR2B 2GBOA 3RFRA 1EN6A 1FXVA 5A2QN 3I56V 4QNHB 3ABTA 2QR4A 2PF4E 4DUYB 4PA6A 2HLDG 4O4IA 1SQGA 5GONB 2VWKA 4XDLA 2UXBO 1BE3H 4NXMO 1IVSA 3AEIA 3AG3C 2YDEA 3ZRWA 2X6CA 2DYSC 1AP6A 2X0LA 2HEPA 2V4DA 2VRZA 3JAKA 4O4JB 1XHXA 2HFEC 1SKVA 3SJBC 3TK1A 1UJWB 1MA1A 4DV0O 4DUZO 5D5PA 4DV1B 5EYPA 4O2AA 3HKBB 3ZN1A 1FFXA 1K3EA 4HNAA 3OMNB 2L35A 2CDYA 2ITDC 4JI7B 3OTFA 2QE7G 1M4UA 1NTKH 3LSQA 2YIAA 4R50A 1GN2A 1HNZB 5K1XA 3CCMV 2ZT9B 1S5JA 1QNMA 2EJ7A 4WCEV 4TUYA 2JS5A 2P7TC 2Y0PA 4RAIA 2ZIMA 3KCXA 1JJOA 3ZMSA 3RN4A 1K4CC 2XHBA 4GX5A 1I08A 2GTSA 1GO3F 1VP7A 3BVOA 5CA1A 1N34B 5LGNA 2GV9A 3OT7A 3MHSC 4UUJC 1NZ6A 4LFCO 1JVMA 1XNQO 4QIWF 1JOYA 2R70A 1O9GA 3CC4V 2FMLA 1DF5A 1GKFA 4NB5A 3ZRVA 4YIOA 1D5AA 4N21A 2EX3A 1K73W 2OYQA 4OGQB 2WLMA 1NJIW 2UUCB 1R3JC 3LDDA 3MAQA 4QGPA 1KD1W 5LBQA 3E8HA 1FKAO 2VQFO 4ZI7B 1XILA 4JYAO 4DV5O 4MW3A 3CHXA 1OCOC 2QM7A 4UFZA 3OEHG 5F2VO 3NR7A 4FJCC 5KX5B 1Y76B 4B3TB 3CS5A 4OPAA 3BA8A 1QCEA 5TISZ 3ZS8C 4HYOA 2VQEB 2VWJA 4UCUA 1Q7YW 5B1AC 3CJHA 3ZMTA 1DK1A 2CGOA 4YJ2A 4OPHA 1W0JG 1EZVH 1EBOA 3C90A 1N4CA 3T1CA 5CBFA 3KG2A 1HR0O 2CTPA 1TVKA 4X1YA 3ABMC 3WB2A 3WG7C 1ZAUA 1D5NA 2DYRB 2EIMB 1J5EO 2DN9A 2RMKB 1K92A 2OIEA 2JVDA 5IWAO 3ZCCA 1AP5A 5LA6B 3GWOA 4X9QA 4DV4O 2Q7EA 4J42A 1VF6C 3H1HH 3CRAA 2CGNA 5BZBA 2XAJA 4FMTA 4ZOLB 1KC8W 1VQ7V 2ZM6O 3Q4HA 3SPJA 2K9PA 4I50B 2UXBB 1VF5B 2B1GA 3UO2A 4TV8B 1OCZB 2H94A 4NKGB 3ZHSA 2LP7A 3UO3A 4FFBA 4PI2A 1KKDA 3T1HO 4O4IB 2YIBD 4GKKO 1AJPA 1M56C 2Y48A 5CBHA 2JDIG 3QO7A 3EVKA 2XT9A 5H6QA 2PY5A 2Y4UA 1I7FA 3HR0A 3ZRWB 4DV0B 1DGSA 4DUZB 4JTAB 3MHHC 2OT5A 3OW2U 3JAKB 4E4EA 4R8CA 2NR5A 1XMOO 3BHPA 2A06H 4FIPC 1R6KA 5EYPB 4DR4O 1F23A 4PDVA 3W7WA 2DWDC 4O2AB 2LO1A 1P4RA 2YUAA 3K04A 1FFXB 1SRYA 1BGYH 4TOIA 3OMIB 4HNAB 3ASNC 1D2DA 2NN4A 1US6A 3M99B 5LMUO 5B1NA 5ITZB 2JIZG 2HHHB 2MW2B 3AG2C 1M57C 4PA7A 1OCCB 1K4DC 5EK0A 5E1AC 3L9DA 3CRRA 1IBKO 2CTRA 2D3OW 2DQ3A 1JQ0A 1R3IC 3K0DA 3SYPA 2OTLV 1CEZA 1M90W 3ZEDA 4ZKIA 1SQPH 3WFVA 1S5LZ 4LFCB 1GM7A 1QHTA 1TAEA 5CA1B 2B1IA 1XMQO 4LF6O 1XNQB 4O4HA 5IYZA 1QBZA 4ZHQA 2AZ2A 1OJHA 2BOCC 5EBWC 3SPHA 3SYOA 1PKXA 2NNUA 2OCHA 2ZXWC 2LFRA 4KXRA 4XDKA 2YICA 1BCCH 3SGIA 3CYOA 1KECA 4ZBMA 4DR6O 1FXKC 3ZRSA 3OAAG 3UM7A 2FTKA 4D7TA 2X6BA 5CBGA 4DV7O 1L0LH 2VQFB 4B3SO 1GRJA 4JYAB 3JARA 4DV5B 2HVKC 4LF4O 1CXZB 3JAWA 2CH7B 1XHZA 1JR9A 2QSAA 1NR1A 2LJ2A 1AILA 4U7OA 3ABLB 4I55A 1L0NH 4KUMA 2ZE8A 5KAFZ 1HWYA 1R6NA 3D36A 3HKEA 2F4VB 1R73A 1BS3A 3CJHB 3ZHQA 1HR0B 1KU9A 2JEUA 2JRIA 4PD4F 1J5EB 3ASOB 3PN1A 5KUMA 3RW0A 1F51A 2WLHA 5B3SC 5IWAB 1TVKB 4X1YB 4DV4B 3THOA 3AK1A 4NR1A 3K59A 1QU7A 2EILB 4MVZA 3IGAC 2LGWA 3N27A 4JI1O 4Z1VA 2KKWA 2WLJA 4H33A 1P84F 2LFSA 3MD0A 1H2GA 2ZM6B 1XNRB 1NTZH 1H2NA 2QWPB 2K1EA 2ZDIA 2QTSA 1WJZA 5CA0A 3CSXA 3T1HB 4GKKB 1QR8A 1GM8A 5BMVB 3CXCU 3BFRA 3JD1A 1Q82W 4FFBB 2DW4A 1FFTB 2HP8A 3P3PA 1XMOB 5AG2A 5LP6C 1U97A 1BHBA 3L71H 1NI8A 5LOVA 4JYYA 1NR7A 3SYCA 3T1YO 1M1KW 4DR4B 2IH1C 2AXTZ 4J7KA 2P06A 4DRXA 2WLKA 4CH3A 3CCQV 4J7ZA 2ZE7A 3CWBH 1JJ2U 2JS3A 3OFNG 5EIBD 4FLYA 2GSMB 4LP8A 5LMUB 2KG7A 4PI0A 1VF6A 3E89A 5JJEB 1JPXA 3CMAV 2Q7HA 2PUSA 2EIJC 3A0RA 2EBOA 1IBKB 2Q7GA 4TWKA 1CPYA 2HR3A 3PJSK 3FB6C 4KHPO 1Z5VA 4NTYA 4KL1A 4MTXA 4FLUA 2YSUB 5LXTA 1XMQB 1YI2V 4AQYO 2P90A 4LF6B 4CZZA 3J7AU 3CC2V 3N2KA 4MTFA 2FB5A 2DE0X 2ODMA 3CXHF 4O4HB 1AROP 5IYZB 5JH7B 4ZHQB 4AHCA 2DJVA 3N2GB 4DR6B 4OX9O 2F66C 3VQXA 1SETA 4P9OA 3ZX6A 1Q5OA 4ICGA 1RM1B 3E8BA 4DV7B 3HB3B 1SF9A 2ADQB 2FKXA 3JSNA 3K5LA 4B3SB 3OUFA 1RPOA 1ZTEA 4LF4B 2EINC 4LWSA 2EIKB 2HKOA 2Q0AA 2D2CB 1RSOA 5IE9A 3U11A 1K33A 1BT8A 1E1QG 5EZYB 1IBMO 2Y69B 3K5MA 2Z3YA 3RYFA 1L1FA 3BA9A 5JCOC 5JJNB 4I55B 1S72V 1QVFU 2ATKC 3X2QB 4F6RB 4JAUA 1VQ9V 4P2ZA 1H2MA 3HKEB 2XASA 3CCUV 3UKMA 4X88A 1K34A 3K06A 3JASB 3B2EE 1JX9A 1FYJA 4LNUA 3B4SA 5KUKA 1F4MA 3OMAB 1FPOA 3QTCA 3H9VA 4PDMA 1AR5A 3RYCA 3CPWU 4WFFA 1ORQC 4JI1B 4J80A 4I0XA 4FM1A 3C3TA 1QQCA 5FPRA 1GN3A 3STZC 2AGAA 4BW9A 1MABG 3RYHA 4JI0B 3LSUA 1YZBA 5LL6Y 4MTOA 1K8AW 2Q67A 1AI7A 3T4ZA 5CA0B 3K3WA 5IY5B 4F6EA 5FPOA 3T4DA 1TUBA 5KA6A 4DR5O 1Y74B 3DXRA 3TGUH 2G38A 3RYIA 4IL6Z 2V7QG 2E74B 1Q6UA 3F7VC 3T1YB 3E8GA 4O4LA 1N8RW 3ZHTA 5L3EA 1N32O 2ARHA 5LOVB 4UCVA 1Y6XA 4DRXB 2RNBA 3LDEA 4F4LA 1JA8A 1V54B 3K08A 3LNMB 5C8YB 5LMNO 1YSCA 4JYBA 1GH6A 4PA4A 3LSSA 4QE7A 3OM3B 1IURA 1KQSU 4FLXA 3JYCA 2HG5C 4LFAB 2KG7B 3AG1C 1NKDA 4BIOA 3ZMVA 2HVJC 4CH6A 1MMMA 4KHPB 1OCRC 3ETGA 4FZ1A 4IGGA 5B1BB 1XL4A 3KKYA 2HJDA 4AQYB 4BAYA 3RGBA 3HPLC 4YY3O 2UUBO 1PPJH 3BEHA 3W7TA 4GLXA 3OD4A 3HKCB 2EIKC 3SPGA 2IJJA 5LXTB 3K03A 4IHJA 4UVBA 2QWRB 2XTAA 5EBLC 3N2KB 4NTXA 4CBCA 2Y69C 1FS0G 4X64O 5IJ9A 4OX9B 2XAGA 3FYIB 2ILMA 1SQBH 2H8PC 2JGDB 3AK2A 3K9AA 2UUAO 1H8HG 4I9WA 3X2QC 4CS3A 2EZPA 1HW7A 4JASA 4PDLA 1Q6IA 3QO5A 5E79Z 4FLTA 1WB8A 4H37A 3CRQA 3CRMA 4PA3A 4BIZA 3D3IA 4UCTA 3GB7C 3AK3A 2YEVB 3L73H 4LWSB 1IBMB 4WFHA 2IJIA 4X89A 3CCLV 2JGUA 2ITCC 4D7SA 3OTOO 1RSOB 4BW5A 1WPXA 5CA3A 4O2BB 5LHHA 2QEXV 3JD4A 1W2BU 3FFQA 3RYFB 1VF7A 4JV5O 3HKDA 4Q6GA 2JEXA 2W0FC 1ZWIC 1XOUA 3LDCA 2A9HA 4LNUB 4X62O 5IDJA 4MVRA 4JGSA 3EHBB 1XQ8A 2QGNA 3CE2A 2ZCEA 4YIPA 1WA8B 1NU1H 4GT1A 3RVZA 5GTIZ 4B3RO 3H1JH 2YS8A 4I4TA 4JPRA 5FLXN 4DR5B 2WWWA 2F1MA 4NXMB 4CC6A 4DR7O 2DQ0A 2LGQA 3ZJZA 2V1DA 1B04A 1YTFD 1TUBB 2LQTA 5B5EZ 3DXRB 3R65A 4X65O 2Q8VA 3DC6A 3VQYA 2MK3A 3TJTA 2UXNA 1WP8A 1MZEA 2YC0A 2O57A 5LMNB 1S0VA 1AI4A 1NBMG 4J7JA 4EFBA 3WB0A 3JALA 4X8AA 2XAQA 2EZOA 1N0NA 1VMGA 3CC7V 5LYJA 1BMFG 4RQEA 1P49A 3ZMUA 2Q73A 1YDXA 5L3FA 2IH3C 1MSDA 5IJ0A 1MNGA 2XOKG 3L74H 4YY3B 2UUBB 4L8JA 1QLEB 4TUYB 4UVCA 4C7UA 1EZJA 3G71V 3BABA 3O65A 5LHGA 4X66O 5K1PA 1OZ0A 1RFYA 1AI5A 2W6JG 3J81N 4HBNA 4K35A 4X64B 4FK5C 4FLWA 2BTQA 2PGGA 2A0LA 3FB7C 3FAVA 4FLVA 4BWAA 4U3JA 3CD6V 5IYCO 5IJ9B 1EM1A 3EFFK 4EB6A 3VOUA 5LGUA 1LR1A 2Z0AA 5C93A 3WB1A 4DV3O 2IJHA 3MDSA 2QM8A 4FM0A 2Q6AA 2ZIOA 4YJ3A 3DSQA 4AILC 3R66A 1VARA 2DYRC 4JAAA 3OTOB 2EIMC 2RN9A 2ZNJA 1SZTA 5KHJA 2R9IA 4G28B 3KZIZ 2A79B 3E2EA 3ICXA 4I5SA 4RO2A 3JD2A 1Q86W 3K57A 2X6AA 4JV5B 2N74A 1PD3A 2WLIA 4RUEA 2OCCB 2GDSA 2Q68A 3BCCH 3P32A 1OCZC 5H2FZ 3QO8A 2AHYA 5JVDA 3HKDB 4YJ2B 4X62B 3ETQA 2QDOA 1V55B 2UXCO 2P4KA 1VIBA 3H1KH 3L70H 1HNXO 1NQTA 1HNWO 1SERA 5DECA 5BXZA 5A9GA 5JQGA 3SJAC 2W0XA 3AG7A 3RT3C 4EKWA 4B3RB 1GTOA 4DV6O 4W4KA 1YJ9V 3FYEB 4LF5O 3S3WA 1KP2A 1NS1A 4PHZA 1VQ5V 1R3KC 2DMXA 4DR7B 4AI8A 4I4TB 4LF9O 3JD3A 2WA3A 3SYAA 1G8MA 2WLLA 3AG4B 3Q4HB 1GN4A 3K5OA 4GZRB 5KAIZ 5FL7G 4X65B 4RQFA 2E75B 1K97A 5L3BA 3APQA 1I5XA 1NH2D 1AI6A 5L3GA 1IZ3A 3IC9A 2UXDO 1OCCC 1VQ4V 1HDJA 3D3QA 1R1BA 2QWQB 4FFKA 3ZBHA 4MS2A 2ZNIA 2IBZH 2L6LA 2BSKA 1RP3B 1F7YA 2JK5C 1WAZA 2EJRA 1MOFA 2BTOA 2PI4A 3E22A 2ZE6A 4L87A 3P3NA 1YITV 1PL4A 1TGOA 2H3OA 3H01A 3K0GA 4XDJA 3QF7A 1XREA 4JI6O 3B40A 1ZSPA 2WAMA 2Z5UA 3W7UA 1JMKC 5JJJB 3SR2C 2X7RB 5IJ0B 4X66B 2QTOA 2ZD9A 4X20A 5B66Z 2YIDA 4MVQA 2BCCH 5LHIA 4Z2WA 1IDSA 1J95A 2ZE5A 5EC2C 3AG3B 1RPRA 1COWG 1THZA 2DYSB 4J9ZB 1EFRG 2AW9A 2QWOB 1B6QA 1K5QA 4KP4A 2BTQB 3DGEA 3FAVB 2CTWA 3ABLC 3FKSG 1AJNA 3UT5A 1KBHA 4U3JB 3IFXA 4DV3B 3CEIA 3A8TA 4G2KA 1VQ8V 2PYJA 4EB6B 1ZLZA
chains in the Genus database with same CATH topology
3SPJA 1VQLV 4J9YB 2B1GA 1NKDA 3AG1C 4LCUC 4QPKA 3ZMVA 1OCZB 2HVJC 1CP9A 2H94A 2LP7A 5GW7A 3ASOC 1OCRC 5DM6V 4MVSA 1KKDA 3ETGA 1AJPA 4TT3G 1BL8A 1M56C 2Y48A 1XL4A 5B1BB 3VBBA 5CBHA 2JDIG 3QO7A 5H6QA 3ABKC 2OTJV 4BAYA 1AR1B 2ZQMA 3HPLC 4UVAA 2F43G 1H38A 3BEHA 4GX1A 3ZRWB 3W7TA 3ZMZA 2EILC 4JTAB 3MHHC 2OT5A 2EINB 3JCZA 2EIKC 3SPGA 2IJJA 3K03A 4JTDB 3OW2U 4R8CA 4UVBA 5L3DA 2IJKA 3ETEA 5CN0A 4FIPC 5EBLC 1R6KA 2QKSA 1VQNV 4CBCA 1YJWV 3CCEV 1F23A 2Y69C 4PDVA 3FB8C 3W7WA 1I5YA 2DWDC 5CMUA 1FS0G 1P4RA 1DLBA 3K04A 3I55V 2XAGA 1SRYA 5L3CA 2WLIB 3FYIB 3CCJV 3P30A 3OMIB 2H8PC 1PL0A 3ASNC 3K9AA 1Q81W 2WSSG 1H8HG 4I9WA 1QLEC 3X2QC 1DF4A 3M99B 2EZPA 2ZR3A 4JASA 4PDLA 3QO5A 5EBMC 1LNQA 4H37A 5B1NA 3STLC 2JIZG 4PA3A 4BIZA 3D3IA 4WFGA 3AG2C 2XAFA 1M57C 1FXKA 1OCCB 1K4DC 3GB7C 4PA7A 5EK0A 4MT8A 4WFEA 5E1AC 3LUTB 4WF9V 2YEVB 4JTCB 2PI5A 1Y4MA 2D3OW 2DQ3A 3SPIA 1JQ0A 1KC8W 4WFHA 1R3IC 2IJIA 4X89A 3K0DA 3SYPA 3CCLV 2OTLV 1CEZA 4UXNA 5LGTA 2ITCC 1M90W 2KB1A 4BW5A 4UV9A 4ZKIA 3WFVA 4R7CA 1P7BA 1WPXA 1GM7A 2B1IA 3BY6A 5CA3A 5LHHA 2QEXV 2DWEC 3JD4A 4JF3A 1W2BU 1QBZA 4QJFB 3JYCA 2WLLB 1OCOB 5IYDO 2BOCC 4U7NA 4DXWA 5EBWC 3F5WC 3SPHA 1YHQV 3SYOA 1PKXA 2NNUA 2NLJC 2ZXWC 2JEXA 4OXSA 4PA9A 2JJ2G 2LFRA 2W0FC 4XDKA 1ZWIC 3CYOA 3E8FA 4DO2A 2IW5A 1KECA 3LDCA 1E1RG 2A9HA 4ZBMA 2GHYA 5B1AB 4YXWG 1FXKC 5IDJA 1QLNA 3ZRSA 3IC7A 4MVRA 3OAAG 3SPCA 2XNDG 3UM7A 4JGSA 3EHBB 3ZRXA 2FTKA 2X6BA 5CBGA 4MSWC 3FB5C 1GM9A 3F7YC 3ABMB 4GT1A 3RVZA 3WG7B 1BHAA 2HVKC 2AHZA 1VQ6V 1YTFB 1NVPB 3SJQC 3E83A 2P6JA 1NR1A 4JPRA 2IU0A 5J9PC 2M7WA 3ABUA 4PELA 1S5HC 1F4NA 4N23A 4U7OA 2OCCC 1GMGA 2WWWA 3ABLB 3CCVV 4JYCA 1V55C 2DQ0A 4JAVA 3ZJZA 2V1DA 4KUMA 3W7XA 1HWYA 1R6NA 1YTFD 3D36A 1RM1C 1NVPD 4BIUA 1R73A 1JCHA 3QNEA 3R65A 3AG1B 1AJQA 2JEUA 4LBEC 3TCUA 3G4SV 3ASOB 1OCRB 5KUMA 3RW0A 1F51A 1YIJV 2HJFC 2WLHA 1M56B 2MK3A 5B3SC 3RVYA 5B1OA 1S76D 2UXNA 3OGCC 2YEVA 1SESA 2EILB 4Q20A 1S0VA 1K9MW 1AI4A 1NBMG 4MVZA 3IGAC 1VQPV 2WLJA 4H33A 1GK9A 2LFSA 3AG4C 3MD0A 4X8AA 1H2GA 3G6EV 1XL6A 2XAQA 3ETDA 3ML0A 2EZOA 2K1EA 2ZDIA 1IXMA 1ROPA 2ZR2A 3OR7C 4G27B 3CMEV 3CC7V 4GCZA 4QE9A 1S77D 1BMFG 2IU3A 4RQEA 2Q69A 3ZMUA 4KFMA 4LC1A 1QR8A 1GM8A 5L3FA 2IH3C 1R3LC 3ASNB 3CXCU 2XOKG 3JD0A 3JD1A 3G71V 1QLEB 1Q82W 1KP3A 4GX0A 1EZJA 4UVCA 2DW4A 1YJNV 1FFTB 3B8NA 5LHGA 3CCRV 3AG2B 1M57B 1OZ0A 1BHBA 1AI5A 2W6JG 5IYBO 2BOBC 1NR7A 3SYCA 1M1KW 2IH1C 2CK3G 1VQOV 3TETA 1DTOA 2W6IG 4E2LA 4HZ3A 1ENVA 4FK5C 2C2AA 2WLKA 5HFLA 4TSFG 4WFBV 3FB7C 2A0LA 3CCQV 1JJ2U 2ZDIC 2R9RB 1FXVA 3CD6V 3OFNG 5IYCO 2GSMB 5IY5C 5H9CA 3EFFK 4LP8A 3I56V 3VOUA 4QNHB 5LGUA 5C93A 3E89A 4P30A 4ASUG 1JPXA 2IJHA 5H6RA 3ABTA 4MVOA 3CMAV 2ZXWB 3K79A 2EIJC 4HAMA 2HLDG 2QM8A 4PA6A 3A0RA 2EBOA 2Q6AA 4PDRA 4XDLA 4TWKA 1CPYA 2HR3A 3PJSK 3FB6C 1FXKB 2DYRC 3AEIA 3AG3C 1FXHA 1W0KG 4P9PA 2EIMC 3ZRWA 3ZN0A 1MG1A 2X6CA 4QPJA 4MTXA 2DYSC 1SZTA 2YSUB 2R9IA 2X0LA 4G28B 1YI2V 4MTGA 2A79B 2HFEC 2P90A 2UXXA 1PNMA 4CZZA 3E2EA 3TK1A 4I5SA 4RO2A 1V54C 1UJWB 3JD2A 2B5UA 3CC2V 1Q86W 4MTFA 1MSWD 2X6AA 4XBFA 1QVGU 2WPDG 1H8EG 5EC1C 1AROP 3ZN1A 1PD3A 2WLIA 4RUEA 1K3EA 2OCCB 3OMNB 2Q68A 3P32A 1OCZC 2ITDC 3QO8A 2AHYA 2QE7G 1V55B 3LSQA 4R50A 1SETA 4P9OA 4GX2A 1PNKA 3CCMV 1NQTA 5B1BC 1RM1B 1SERA 3E8BA 3E86A 3HB3B 2WLNA 4WCEV 3ABKB 3OUFA 1RPOA 4EKWA 4MVMA 2P7TC 2EINC 4RAIA 1GTOA 2EIKB 2HKOA 3B8MA 5B3SB 1YJ9V 3FYEB 3ZMSA 1S3JA 4G2KA 1K4CC 1KP2A 1K33A 3OE7G 1OHHG 5HFMA 4GX5A 1E1QG 1PNLA 1GO3F 1VQ5V 1NH2B 1R3KC 4R6ZA 2Y69B 2Z3YA 3JD3A 3SYAA 5LGNA 1L1FA 2XAHA 1G8MA 3MHSC 2WLLA 3AG4B 4UUJC 1M9NA 5FL7G 1S72V 1JVMA 4QIWF 4RQFA 1JOYA 1QVFU 4WFAV 2ATKC 1K97A 3B77A 3X2QB 5L3BA 4JAUA 1VQ9V 4P2ZA 3CCUV 1I5XA 2XASA 3OEEG 3UKMA 4X88A 1AI6A 3SYQA 1K34A 3K06A 5L3GA 1NH2D 1JX9A 3CC4V 5KUKA 1OCCC 1DF5A 1F4MA 3OMAB 1GKFA 1VQ4V 3ZRVA 4PDMA 3OR6C 4N21A 1TUEB 1K73W 1VQMV 3CPWU 2WLMA 4WFFA 1NJIW 4MS2A 1ORQC 3NXSA 1R3JC 4MW8A 3ZIAG 3LDDA 2JK5C 1KD1W 3T2MA 5LBQA 2EJRA 1MOFA 3E8HA 3STZC 2PI4A 1Y66A 1E79G 1MABG 4L87A 4MW3A 1YITV 3OUSA 1OCOC 3K0GA 3H01A 2P67A 2QM7A 3OEHG 4XDJA 4MTOA 1K8AW 1K7DA 2Q67A 3E35A 4FJCC 1AI7A 3CCSV 3T4ZA 4MVUA 1QCEA 2WAMA 3K3WA 4UV8A 4HYOA 2Z5UA 5IY5B 3W7UA 3T4DA 5KA6A 1Q7YW 3CP1A 5B1AC 1G4YB 3ZMTA 1VQKV 2X7RB 5KA5A 1W0JG 3W7SA 1EBOA 2QTOA 2V7QG 2ZD9A 2EIJB 3F7VC 3E8GA 3T1CA 5CBFA 2QA4V 3KG2A 4Z1MG 4MVQA 1N8RW 5L3EA 5LHIA 3ABMC 1J95A 3WG7C 2DYRB 5EC2C 2JJ1G 3AG3B 2EIMB 4RUFA 1RPRA 1COWG 1THZA 2DYSB 4J9ZB 1EFRG 1K92A 3ZCCA 1B6QA 1K5QA 5DN6G 3GWOA 3LDEA 4KP4A 4F4LA 3DGEA 1V54B 3K08A 3LNMB 3ABLC 3FKSG 1AJNA 1YSCA 4FPPA 4JYBA 3DTUB 1K5SA 3IFXA 3RBZA 4PA4A 3LSSA 4QE7A 3OM3B 5BZBA 2XAJA 1KQSU 1WLEA 4FMTA 1QR9A 1VQ8V 1VQ7V 2HG5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPJ A;  3ZRS A;  2IH1 C;  4J9Y B;  3AG1 C;  4MVR A;  4LCU C;  3SPC A;  3SYA A;  3TET A;  3UM7 A;  2WLL A;  4HZ3 A;  2HVJ C;  4UUJ C;  2X6B A;  5CBG A;  2WLK A;  3FB7 C;  4MSW C;  2A0L A;  3ASO C;  1OCR C;  3FB5 C;  4MVS A;  1KKD A;  1JVM A;  1BL8 A;  1M56 C;  3F7Y C;  1XL4 A;  2ATK C;  3RVZ A;  5CBH A;  2HVK C;  2R9R B;  3ABK C;  2AHZ A;  4P2Z A;  3UKM A;  4X88 A;  3SYQ A;  3HPL C;  3K06 A;  5IY5 C;  3BEH A;  4GX1 A;  3EFF K;  4LP8 A;  3SJQ C;  3E83 A;  5KUK A;  2EIL C;  1OCC C;  4JTA B;  3VOU A;  5J9P C;  4QNH B;  2EIK C;  3SPG A;  3K03 A;  4JTD B;  3E89 A;  4P30 A;  4R8C A;  1S5H C;  4PDM A;  2OCC C;  3OR6 C;  4MVO A;  2EIJ C;  2WLM A;  4WFF A;  5EBL C;  4PA6 A;  4MS2 A;  1ORQ C;  1V55 C;  2QKS A;  4CBC A;  4PDR A;  2Q6A A;  4XDL A;  1R3J C;  4MW8 A;  4TWK A;  3ZJZ A;  2Y69 C;  4PDV A;  3FB8 C;  3LDD A;  2DWD C;  3PJS K;  3FB6 C;  2JK5 C;  3K04 A;  2DYR C;  3T2M A;  3AG3 C;  4P9P A;  3E8H A;  2EIM C;  3R65 A;  3STZ C;  2WLI B;  2X6C A;  2DYS C;  4LBE C;  2H8P C;  3TCU A;  3ASN C;  4G28 B;  4MW3 A;  3OUS A;  1OCO C;  3K0G A;  2A79 B;  2HFE C;  4MTG A;  4XDJ A;  4I9W A;  5KUM A;  4MTO A;  3RW0 A;  2Q67 A;  1QLE C;  4RO2 A;  3X2Q C;  2HJF C;  1V54 C;  2WLH A;  5B3S C;  3RVY A;  3T4Z A;  4MVU A;  4MTF A;  4PDL A;  5EBM C;  2X6A A;  1LNQ A;  4H37 A;  4HYO A;  3STL C;  4PA3 A;  3T4D A;  3OGC C;  4WFG A;  2YEV A;  3AG2 C;  5EC1 C;  3GB7 C;  1M57 C;  4PA7 A;  1K4D C;  5EK0 A;  5B1A C;  1G4Y B;  4MVZ A;  4WFE A;  2WLI A;  5E1A C;  3IGA C;  4RUE A;  3LUT B;  4JTC B;  2Q68 A;  2QTO A;  2WLJ A;  4H33 A;  1OCZ C;  2ZD9 A;  3SPI A;  2ITD C;  3AG4 C;  2AHY A;  4X8A A;  4WFH A;  1R3I C;  3F7V C;  1XL6 A;  3K0D A;  4X89 A;  3E8G A;  3SYP A;  3T1C A;  5CBF A;  2ITC C;  3KG2 A;  4R50 A;  4P9O A;  2KB1 A;  4MVQ A;  2K1E A;  4BW5 A;  4GX2 A;  4G27 B;  4R7C A;  3OR7 C;  5B1B C;  3ABM C;  1J95 A;  1P7B A;  4QE9 A;  3WG7 C;  3E8B A;  3E86 A;  2Q69 A;  5EC2 C;  2WLN A;  4RUF A;  4KFM A;  2DWE C;  4J9Z B;  2IH3 C;  3OUF A;  4EKW A;  4MVM A;  3JYC A;  1R3L C;  2WLL B;  2P7T C;  2EIN C;  4RAI A;  3LDE A;  2BOC C;  4GX0 A;  4F4L A;  4DXW A;  5EBW C;  3F5W C;  3K08 A;  3SPH A;  3LNM B;  3SYO A;  3ABL C;  2NLJ C;  2ZXW C;  4OXS A;  4PA9 A;  1K4C C;  2W0F C;  4XDK A;  3IFX A;  3RBZ A;  4PA4 A;  4QE7 A;  1ZWI C;  4GX5 A;  3E8F A;  5BZB A;  3LDC A;  2A9H A;  4ZBM A;  1R3K C;  4R6Z A;  2BOB C;  2HG5 C;  3SYC A; 
#chains in the Genus database with same CATH topology
 4DV2 O;  4DR1 O;  4J9Y B;  4LCU C;  1H2L A;  1GAX A;  4QPK A;  2BE3 A;  4B3M O;  5GW7 A;  3ASO C;  5DM6 V;  1BL8 A;  4JI8 O;  1I94 O;  4YJ3 B;  2RDC A;  1ZX3 A;  3A2F A;  2F43 G;  3JAR B;  4GX1 A;  2EIL C;  3JAW B;  3JAM N;  2IJK A;  4ZIB A;  3CB2 A;  2F95 B;  5CN0 A;  2QKS A;  1YJW V;  3D8C A;  4IT5 A;  5CMU A;  1AVM A;  1KYO F;  1DLB A;  3I55 V;  2UXC B;  5BY1 A;  5L3C A;  1N0J A;  2WLI B;  1HNX B;  3CCJ V;  1HNW B;  2VS0 A;  3J80 N;  1Q81 W;  2CUG A;  2RCV A;  2WSS G;  5H5N A;  1ZUQ A;  3JSL A;  1DF4 A;  3CRC A;  1ZL8 A;  2Q4P A;  3STL C;  4DW0 A;  5KLV H;  4WFG A;  3L72 H;  4LF5 B;  3WU2 Z;  2XAF A;  1FXK A;  5JQG B;  2FL4 A;  4WFE A;  4WF9 V;  4FM2 A;  1SC5 B;  1R6T A;  4LF9 B;  4UXN A;  4R7C A;  1P7B A;  2QM4 A;  5FNV A;  3BY6 A;  4I7Z B;  2DWE C;  1SZX A;  4JF3 A;  1Z5W A;  4JI4 O;  2YXL A;  2WLL B;  1OCO B;  5IYD O;  4DXW A;  2UXD B;  2NLJ C;  4PA9 A;  4ZOL A;  4I50 A;  4DO2 A;  4GKJ O;  3FD9 A;  5B1A B;  4TV8 A;  4TQD A;  1QLN A;  4W4L A;  1X59 A;  3SPC A;  2XND G;  4LF7 O;  3ZRX A;  4GYC B;  4BR6 A;  2CTQ A;  3CX5 F;  3A0B Z;  3FB5 C;  5CB4 A;  3ABM B;  2RQ6 A;  3WG7 B;  3G6B A;  1BHA A;  2BSK B;  3H1L H;  1KMI Z;  1VQ6 V;  1YTF B;  2N05 A;  3GVM A;  3SJQ C;  2B9Z A;  4JI6 B;  4NXN O;  3E22 B;  3E83 A;  3M8A A;  2IU0 A;  5J9P C;  2IM9 A;  3K58 A;  4PEL A;  1S5H C;  1F4N A;  4ABM A;  2KSD A;  1MZF A;  4WBN A;  4JYC A;  4NTW A;  2AZ0 A;  4JAV A;  3UQ8 A;  1RM1 C;  1NVP D;  1KKC A;  3I5D A;  1VEW A;  1JCH A;  5IT9 N;  1AJQ A;  1XI1 A;  3TCU A;  1FJG O;  4X20 B;  1M56 B;  1JFF A;  5ITZ A;  5J2T A;  4K8Z A;  1XDC A;  5LP6 A;  3C3S A;  3OGC C;  1O9H A;  1SES A;  1WN7 A;  1LUW A;  4Q20 A;  4D6T H;  2QJ1 A;  2HHH O;  4DR3 O;  1GN6 A;  2QKA A;  4JI3 O;  1GK9 A;  3G6E V;  4DV2 B;  4DR1 B;  3UT5 B;  1U96 A;  2Y0I A;  3CME V;  1ROP A;  1YF2 A;  2ZR2 A;  4B3M B;  1HP8 A;  4IYH A;  4GCZ A;  4QE9 A;  4K3A A;  1S77 D;  3D36 C;  4X1K A;  1N33 O;  4JI8 B;  1UFI A;  1I94 B;  3ASN B;  4B7K A;  3FX7 A;  3JD0 A;  1B3Q A;  1KP3 A;  4GX0 A;  4LR3 A;  1YJN V;  3B8N A;  1A32 A;  2UU9 O;  2CAZ C;  1H2K A;  3AG2 B;  4LFB O;  1M57 B;  2BOB C;  1XBL A;  4A5U B;  1VQO V;  2CK3 G;  3TET A;  1DTO A;  3LNN A;  4TSF G;  2PYL A;  2XUM A;  1Q43 A;  4GUN A;  2CH7 A;  2ZDI C;  2R9R B;  4LF8 O;  2LW7 A;  3EXA A;  5IY5 C;  5H9C A;  1N36 O;  4K0K O;  3JAT A;  4P30 A;  3S3X A;  3TXS A;  4ASU G;  4IIJ A;  2A3Q A;  5H6R A;  3SDL A;  4MVO A;  4FLZ A;  2ZXW B;  3K79 A;  4HAM A;  4CH4 A;  1ZL8 B;  4J10 A;  4PDR A;  1H2S B;  2Q9L A;  3RYC B;  1G1X B;  2PZS A;  1YVW A;  2OWO A;  1FXK B;  1SQV H;  4I0X B;  3ZN0 A;  1FXH A;  4P9P A;  1W0K G;  1MG1 A;  4QPJ A;  5KHH A;  3L75 H;  2F4V O;  5J2U A;  4MTG A;  2UXX A;  1PNM A;  3G67 A;  3RYH B;  4JI4 B;  1V54 C;  2B5U A;  1MSW D;  4XBF A;  5KHK A;  1QVG U;  2WPD G;  5FNV B;  1H8E G;  5EC1 C;  4TQF A;  4TV9 A;  3O9O A;  2P4V A;  4JI5 O;  4GKJ B;  5JCO A;  5KHG A;  2P22 C;  1SA0 A;  3RYI B;  1N32 B;  2M6Y A;  2RJZ A;  4LF7 B;  4GX2 A;  2CE4 A;  1PNK A;  5GTH Z;  5B1B C;  3E86 A;  1XNR O;  5BMV A;  4O4L B;  2WLN A;  3ABK B;  2ETN A;  4FZ0 A;  1XEQ A;  4MVM A;  3M7M X;  3DC5 A;  2GUZ A;  1PV0 A;  4NXN B;  5B3S B;  3B8M A;  5CB4 B;  1IXB A;  1S3J A;  2E5L O;  3OE7 G;  1OHH G;  5HFM A;  1PNL A;  3G80 A;  3U10 A;  3RWR D;  1NH2 B;  4R6Z A;  4J41 A;  3ZHU A;  3QG5 A;  2R72 A;  2XAH A;  3IJ4 A;  2N04 A;  2Q0O C;  1BZK A;  4WBN B;  1M9N A;  2YI9 A;  4PV1 B;  3B09 A;  4WFA V;  3B77 A;  1XUQ A;  1FJG B;  1NT2 B;  1Z2G A;  3OEE G;  1KUQ A;  1LUV A;  4NYK A;  3SYQ A;  1FAF A;  2F23 A;  2YXH A;  3OR6 C;  1TUE B;  1JFF B;  1VQM V;  4IHJ B;  5J2T B;  4DR3 B;  3K9S A;  3NXS A;  5LP6 B;  4MW8 A;  4JI3 B;  3ZIA G;  4YHH O;  3K5N A;  3T2M A;  4H0L B;  2FYU H;  4X1I A;  1Y66 A;  1E79 G;  2UUA B;  4I9Q A;  2WA4 A;  4CS2 A;  3OUS A;  2A7W A;  2P67 A;  1K7D A;  3E35 A;  1N33 B;  3CCS V;  1M5I A;  4MVU A;  5JH7 A;  2QKC A;  4UV8 A;  3JCU Z;  1BQ0 A;  4X1K B;  3N2G A;  3CP1 A;  1G4Y B;  2UU9 B;  3VQV A;  1VQK V;  2ZKO A;  5KA5 A;  4LFB B;  3W7S A;  2EIJ B;  2QA4 V;  1TA8 A;  2LW1 A;  4J11 A;  4Z1M G;  4DW1 A;  1SQQ H;  1NTM H;  1AB3 A;  2E76 B;  2JJ1 G;  4RUF A;  3TXQ A;  4LF8 B;  2EUL A;  5DN6 G;  1N36 B;  4K0K B;  1WB7 A;  4CC5 A;  1YEW A;  4NVP A;  3UCS C;  1AR4 A;  4FPP A;  5EZY A;  3DTU B;  1K5S A;  2PTM A;  4H44 B;  3RBZ A;  1SQX H;  1WLE A;  1PP9 H;  1QR9 A;  3F5T A;  1VQL V;  3JAT B;  4IIJ B;  1CP9 A;  4F6R A;  4MVS A;  2YXY A;  4TT3 G;  3JAS A;  3VBB A;  3SJC C;  3ABK C;  2OTJ V;  1IBL O;  3QVN A;  2ZQM A;  1AR1 B;  2Q5Z A;  4UVA A;  1H38 A;  5KMG A;  3U0Z A;  3ZMZ A;  5J2U B;  3JCZ A;  2EIN B;  3OGI B;  4JTD B;  5L3D A;  4B7E A;  4UB6 Z;  3ETE A;  5BR8 O;  1VQN V;  5D5Q A;  3CCE V;  4JI5 B;  1T5E A;  3FB8 C;  5DED A;  1I5Y A;  1SQF A;  2DOS A;  4JI2 O;  4TV9 B;  2OIG A;  4DR2 O;  1W59 A;  3P30 A;  1PL0 A;  1SA0 B;  1QLE C;  1SS3 A;  4JI0 O;  1B06 A;  1FD9 A;  2ZR3 A;  1Y74 A;  5GON A;  5EBM C;  1LNQ A;  1PM9 A;  5KHI A;  5EIB C;  1WPB A;  2E5L B;  4EEQ A;  1YCI A;  4JZG A;  4MT8 A;  3LUT B;  4DUY O;  2GUZ B;  4JTC B;  2PI5 A;  1Y4M A;  3SPI A;  4O4J A;  4UB8 Z;  5LGT A;  3JAL B;  4UCO A;  2KB1 A;  4UV9 A;  4U3F H;  2GTA A;  4H13 B;  3HKB A;  5LYJ B;  1KB9 F;  4QJF B;  3ZHV A;  5C8Y A;  4DV1 O;  4RWU A;  1M93 A;  2YIB A;  4U7N A;  3F5W C;  4LH6 A;  3BRC A;  1YHQ V;  1EN5 A;  4OXS A;  2JJ2 G;  1WNS A;  3E8F A;  2IW5 A;  3KCY A;  1E1R G;  2GHY A;  4YXW G;  4JI7 O;  3VQW A;  3IC7 A;  4YHH B;  4IYI A;  4LH7 A;  4LFA O;  1HNZ O;  4MSW C;  1Y67 A;  4UCR A;  1GM9 A;  3F7Y C;  1WP7 A;  2AHZ A;  1G6U A;  3HKC A;  1NVP B;  3APO A;  4X1I B;  2P6J A;  2QWN B;  1EN4 A;  2M7W A;  3ABU A;  1X4T A;  4N23 A;  2OCC C;  1GMG A;  2YI8 A;  3CCV V;  1Q8I A;  2E3C A;  1N34 O;  1V55 C;  4UCS A;  1Q3E A;  1YXB A;  3W7X A;  4DK0 A;  1L8D A;  4BIU A;  2JGD A;  1URF A;  3QNE A;  3AG1 B;  4LBE C;  2ADP A;  3G4S V;  3GWK C;  1OCR B;  1OV9 A;  1YIJ V;  2HJF C;  2P5O A;  2KQX A;  3BAA A;  3RVY A;  5B1O A;  1S76 D;  4CS4 A;  4CH5 A;  2YEV A;  1UPG A;  1K9M W;  3IAY A;  4K8X A;  1VQP V;  2UUC O;  4ZI7 A;  3AG4 C;  2R9A A;  5JWP A;  1XL6 A;  3ETD A;  1I0H A;  1Y76 A;  4B08 A;  3ML0 A;  5KX5 A;  5JVD B;  4G27 B;  1IXM A;  3A0H Z;  3OR7 C;  4O2B A;  1V9P A;  2IU3 A;  2Q69 A;  4KFM A;  4LC1 A;  1BQZ A;  4DV6 B;  2Y4T A;  2ZIN A;  4B3T O;  1R3L C;  4PJ0 Z;  1IBL B;  3H1I H;  2VQE O;  4JZ2 A;  1Q6H A;  3CCR V;  1IX9 A;  3BPZ A;  4DYL A;  5KMG B;  5IYB O;  2F93 B;  5BR8 B;  3ZHR A;  4DK1 A;  4FVM A;  2W6I G;  4E2L A;  1BSM A;  4EFE A;  1WA8 A;  4HZ3 A;  1ENV A;  5LA6 A;  2C2A A;  5HFL A;  4WFB V;  1P7G A;  4JI2 B;  1Q90 D;  4DR2 B;  2GBO A;  3RFR A;  1EN6 A;  1FXV A;  5A2Q N;  3I56 V;  4QNH B;  3ABT A;  2QR4 A;  2PF4 E;  4DUY B;  4PA6 A;  2HLD G;  4O4I A;  1SQG A;  5GON B;  2VWK A;  4XDL A;  2UXB O;  1BE3 H;  4NXM O;  1IVS A;  3AEI A;  3AG3 C;  2YDE A;  3ZRW A;  2X6C A;  2DYS C;  1AP6 A;  2X0L A;  2HEP A;  2V4D A;  2VRZ A;  3JAK A;  4O4J B;  1XHX A;  2HFE C;  1SKV A;  3SJB C;  3TK1 A;  1UJW B;  1MA1 A;  4DV0 O;  4DUZ O;  5D5P A;  4DV1 B;  5EYP A;  4O2A A;  3HKB B;  3ZN1 A;  1FFX A;  1K3E A;  4HNA A;  3OMN B;  2L35 A;  2CDY A;  2ITD C;  4JI7 B;  3OTF A;  2QE7 G;  1M4U A;  1NTK H;  3LSQ A;  2YIA A;  4R50 A;  1GN2 A;  1HNZ B;  5K1X A;  3CCM V;  2ZT9 B;  1S5J A;  1QNM A;  2EJ7 A;  4WCE V;  4TUY A;  2JS5 A;  2P7T C;  2Y0P A;  4RAI A;  2ZIM A;  3KCX A;  1JJO A;  3ZMS A;  3RN4 A;  1K4C C;  2XHB A;  4GX5 A;  1I08 A;  2GTS A;  1GO3 F;  1VP7 A;  3BVO A;  5CA1 A;  1N34 B;  5LGN A;  2GV9 A;  3OT7 A;  3MHS C;  4UUJ C;  1NZ6 A;  4LFC O;  1JVM A;  1XNQ O;  4QIW F;  1JOY A;  2R70 A;  1O9G A;  3CC4 V;  2FML A;  1DF5 A;  1GKF A;  4NB5 A;  3ZRV A;  4YIO A;  1D5A A;  4N21 A;  2EX3 A;  1K73 W;  2OYQ A;  4OGQ B;  2WLM A;  1NJI W;  2UUC B;  1R3J C;  3LDD A;  3MAQ A;  4QGP A;  1KD1 W;  5LBQ A;  3E8H A;  1FKA O;  2VQF O;  4ZI7 B;  1XIL A;  4JYA O;  4DV5 O;  4MW3 A;  3CHX A;  1OCO C;  2QM7 A;  4UFZ A;  3OEH G;  5F2V O;  3NR7 A;  4FJC C;  5KX5 B;  1Y76 B;  4B3T B;  3CS5 A;  4OPA A;  3BA8 A;  1QCE A;  5TIS Z;  3ZS8 C;  4HYO A;  2VQE B;  2VWJ A;  4UCU A;  1Q7Y W;  5B1A C;  3CJH A;  3ZMT A;  1DK1 A;  2CGO A;  4YJ2 A;  4OPH A;  1W0J G;  1EZV H;  1EBO A;  3C90 A;  1N4C A;  3T1C A;  5CBF A;  3KG2 A;  1HR0 O;  2CTP A;  1TVK A;  4X1Y A;  3ABM C;  3WB2 A;  3WG7 C;  1ZAU A;  1D5N A;  2DYR B;  2EIM B;  1J5E O;  2DN9 A;  2RMK B;  1K92 A;  2OIE A;  2JVD A;  5IWA O;  3ZCC A;  1AP5 A;  5LA6 B;  3GWO A;  4X9Q A;  4DV4 O;  2Q7E A;  4J42 A;  1VF6 C;  3H1H H;  3CRA A;  2CGN A;  5BZB A;  2XAJ A;  4FMT A;  4ZOL B;  1KC8 W;  1VQ7 V;  2ZM6 O;  3Q4H A;  3SPJ A;  2K9P A;  4I50 B;  2UXB B;  1VF5 B;  2B1G A;  3UO2 A;  4TV8 B;  1OCZ B;  2H94 A;  4NKG B;  3ZHS A;  2LP7 A;  3UO3 A;  4FFB A;  4PI2 A;  1KKD A;  3T1H O;  4O4I B;  2YIB D;  4GKK O;  1AJP A;  1M56 C;  2Y48 A;  5CBH A;  2JDI G;  3QO7 A;  3EVK A;  2XT9 A;  5H6Q A;  2PY5 A;  2Y4U A;  1I7F A;  3HR0 A;  3ZRW B;  4DV0 B;  1DGS A;  4DUZ B;  4JTA B;  3MHH C;  2OT5 A;  3OW2 U;  3JAK B;  4E4E A;  4R8C A;  2NR5 A;  1XMO O;  3BHP A;  2A06 H;  4FIP C;  1R6K A;  5EYP B;  4DR4 O;  1F23 A;  4PDV A;  3W7W A;  2DWD C;  4O2A B;  2LO1 A;  1P4R A;  2YUA A;  3K04 A;  1FFX B;  1SRY A;  1BGY H;  4TOI A;  3OMI B;  4HNA B;  3ASN C;  1D2D A;  2NN4 A;  1US6 A;  3M99 B;  5LMU O;  5B1N A;  5ITZ B;  2JIZ G;  2HHH B;  2MW2 B;  3AG2 C;  1M57 C;  4PA7 A;  1OCC B;  1K4D C;  5EK0 A;  5E1A C;  3L9D A;  3CRR A;  1IBK O;  2CTR A;  2D3O W;  2DQ3 A;  1JQ0 A;  1R3I C;  3K0D A;  3SYP A;  2OTL V;  1CEZ A;  1M90 W;  3ZED A;  4ZKI A;  1SQP H;  3WFV A;  1S5L Z;  4LFC B;  1GM7 A;  1QHT A;  1TAE A;  5CA1 B;  2B1I A;  1XMQ O;  4LF6 O;  1XNQ B;  4O4H A;  5IYZ A;  1QBZ A;  4ZHQ A;  2AZ2 A;  1OJH A;  2BOC C;  5EBW C;  3SPH A;  3SYO A;  1PKX A;  2NNU A;  2OCH A;  2ZXW C;  2LFR A;  4KXR A;  4XDK A;  2YIC A;  1BCC H;  3SGI A;  3CYO A;  1KEC A;  4ZBM A;  4DR6 O;  1FXK C;  3ZRS A;  3OAA G;  3UM7 A;  2FTK A;  4D7T A;  2X6B A;  5CBG A;  4DV7 O;  1L0L H;  2VQF B;  4B3S O;  1GRJ A;  4JYA B;  3JAR A;  4DV5 B;  2HVK C;  4LF4 O;  1CXZ B;  3JAW A;  2CH7 B;  1XHZ A;  1JR9 A;  2QSA A;  1NR1 A;  2LJ2 A;  1AIL A;  4U7O A;  3ABL B;  4I55 A;  1L0N H;  4KUM A;  2ZE8 A;  5KAF Z;  1HWY A;  1R6N A;  3D36 A;  3HKE A;  2F4V B;  1R73 A;  1BS3 A;  3CJH B;  3ZHQ A;  1HR0 B;  1KU9 A;  2JEU A;  2JRI A;  4PD4 F;  1J5E B;  3ASO B;  3PN1 A;  5KUM A;  3RW0 A;  1F51 A;  2WLH A;  5B3S C;  5IWA B;  1TVK B;  4X1Y B;  4DV4 B;  3THO A;  3AK1 A;  4NR1 A;  3K59 A;  1QU7 A;  2EIL B;  4MVZ A;  3IGA C;  2LGW A;  3N27 A;  4JI1 O;  4Z1V A;  2KKW A;  2WLJ A;  4H33 A;  1P84 F;  2LFS A;  3MD0 A;  1H2G A;  2ZM6 B;  1XNR B;  1NTZ H;  1H2N A;  2QWP B;  2K1E A;  2ZDI A;  2QTS A;  1WJZ A;  5CA0 A;  3CSX A;  3T1H B;  4GKK B;  1QR8 A;  1GM8 A;  5BMV B;  3CXC U;  3BFR A;  3JD1 A;  1Q82 W;  4FFB B;  2DW4 A;  1FFT B;  2HP8 A;  3P3P A;  1XMO B;  5AG2 A;  5LP6 C;  1U97 A;  1BHB A;  3L71 H;  1NI8 A;  5LOV A;  4JYY A;  1NR7 A;  3SYC A;  3T1Y O;  1M1K W;  4DR4 B;  2IH1 C;  2AXT Z;  4J7K A;  2P06 A;  4DRX A;  2WLK A;  4CH3 A;  3CCQ V;  4J7Z A;  2ZE7 A;  3CWB H;  1JJ2 U;  2JS3 A;  3OFN G;  5EIB D;  4FLY A;  2GSM B;  4LP8 A;  5LMU B;  2KG7 A;  4PI0 A;  1VF6 A;  3E89 A;  5JJE B;  1JPX A;  3CMA V;  2Q7H A;  2PUS A;  2EIJ C;  3A0R A;  2EBO A;  1IBK B;  2Q7G A;  4TWK A;  1CPY A;  2HR3 A;  3PJS K;  3FB6 C;  4KHP O;  1Z5V A;  4NTY A;  4KL1 A;  4MTX A;  4FLU A;  2YSU B;  5LXT A;  1XMQ B;  1YI2 V;  4AQY O;  2P90 A;  4LF6 B;  4CZZ A;  3J7A U;  3CC2 V;  3N2K A;  4MTF A;  2FB5 A;  2DE0 X;  2ODM A;  3CXH F;  4O4H B;  1ARO P;  5IYZ B;  5JH7 B;  4ZHQ B;  4AHC A;  2DJV A;  3N2G B;  4DR6 B;  4OX9 O;  2F66 C;  3VQX A;  1SET A;  4P9O A;  3ZX6 A;  1Q5O A;  4ICG A;  1RM1 B;  3E8B A;  4DV7 B;  3HB3 B;  1SF9 A;  2ADQ B;  2FKX A;  3JSN A;  3K5L A;  4B3S B;  3OUF A;  1RPO A;  1ZTE A;  4LF4 B;  2EIN C;  4LWS A;  2EIK B;  2HKO A;  2Q0A A;  2D2C B;  1RSO A;  5IE9 A;  3U11 A;  1K33 A;  1BT8 A;  1E1Q G;  5EZY B;  1IBM O;  2Y69 B;  3K5M A;  2Z3Y A;  3RYF A;  1L1F A;  3BA9 A;  5JCO C;  5JJN B;  4I55 B;  1S72 V;  1QVF U;  2ATK C;  3X2Q B;  4F6R B;  4JAU A;  1VQ9 V;  4P2Z A;  1H2M A;  3HKE B;  2XAS A;  3CCU V;  3UKM A;  4X88 A;  1K34 A;  3K06 A;  3JAS B;  3B2E E;  1JX9 A;  1FYJ A;  4LNU A;  3B4S A;  5KUK A;  1F4M A;  3OMA B;  1FPO A;  3QTC A;  3H9V A;  4PDM A;  1AR5 A;  3RYC A;  3CPW U;  4WFF A;  1ORQ C;  4JI1 B;  4J80 A;  4I0X A;  4FM1 A;  3C3T A;  1QQC A;  5FPR A;  1GN3 A;  3STZ C;  2AGA A;  4BW9 A;  1MAB G;  3RYH A;  4JI0 B;  3LSU A;  1YZB A;  5LL6 Y;  4MTO A;  1K8A W;  2Q67 A;  1AI7 A;  3T4Z A;  5CA0 B;  3K3W A;  5IY5 B;  4F6E A;  5FPO A;  3T4D A;  1TUB A;  5KA6 A;  4DR5 O;  1Y74 B;  3DXR A;  3TGU H;  2G38 A;  3RYI A;  4IL6 Z;  2V7Q G;  2E74 B;  1Q6U A;  3F7V C;  3T1Y B;  3E8G A;  4O4L A;  1N8R W;  3ZHT A;  5L3E A;  1N32 O;  2ARH A;  5LOV B;  4UCV A;  1Y6X A;  4DRX B;  2RNB A;  3LDE A;  4F4L A;  1JA8 A;  1V54 B;  3K08 A;  3LNM B;  5C8Y B;  5LMN O;  1YSC A;  4JYB A;  1GH6 A;  4PA4 A;  3LSS A;  4QE7 A;  3OM3 B;  1IUR A;  1KQS U;  4FLX A;  3JYC A;  2HG5 C;  4LFA B;  2KG7 B;  3AG1 C;  1NKD A;  4BIO A;  3ZMV A;  2HVJ C;  4CH6 A;  1MMM A;  4KHP B;  1OCR C;  3ETG A;  4FZ1 A;  4IGG A;  5B1B B;  1XL4 A;  3KKY A;  2HJD A;  4AQY B;  4BAY A;  3RGB A;  3HPL C;  4YY3 O;  2UUB O;  1PPJ H;  3BEH A;  3W7T A;  4GLX A;  3OD4 A;  3HKC B;  2EIK C;  3SPG A;  2IJJ A;  5LXT B;  3K03 A;  4IHJ A;  4UVB A;  2QWR B;  2XTA A;  5EBL C;  3N2K B;  4NTX A;  4CBC A;  2Y69 C;  1FS0 G;  4X64 O;  5IJ9 A;  4OX9 B;  2XAG A;  3FYI B;  2ILM A;  1SQB H;  2H8P C;  2JGD B;  3AK2 A;  3K9A A;  2UUA O;  1H8H G;  4I9W A;  3X2Q C;  4CS3 A;  2EZP A;  1HW7 A;  4JAS A;  4PDL A;  1Q6I A;  3QO5 A;  5E79 Z;  4FLT A;  1WB8 A;  4H37 A;  3CRQ A;  3CRM A;  4PA3 A;  4BIZ A;  3D3I A;  4UCT A;  3GB7 C;  3AK3 A;  2YEV B;  3L73 H;  4LWS B;  1IBM B;  4WFH A;  2IJI A;  4X89 A;  3CCL V;  2JGU A;  2ITC C;  4D7S A;  3OTO O;  1RSO B;  4BW5 A;  1WPX A;  5CA3 A;  4O2B B;  5LHH A;  2QEX V;  3JD4 A;  1W2B U;  3FFQ A;  3RYF B;  1VF7 A;  4JV5 O;  3HKD A;  4Q6G A;  2JEX A;  2W0F C;  1ZWI C;  1XOU A;  3LDC A;  2A9H A;  4LNU B;  4X62 O;  5IDJ A;  4MVR A;  4JGS A;  3EHB B;  1XQ8 A;  2QGN A;  3CE2 A;  2ZCE A;  4YIP A;  1WA8 B;  1NU1 H;  4GT1 A;  3RVZ A;  5GTI Z;  4B3R O;  3H1J H;  2YS8 A;  4I4T A;  4JPR A;  5FLX N;  4DR5 B;  2WWW A;  2F1M A;  4NXM B;  4CC6 A;  4DR7 O;  2DQ0 A;  2LGQ A;  3ZJZ A;  2V1D A;  1B04 A;  1YTF D;  1TUB B;  2LQT A;  5B5E Z;  3DXR B;  3R65 A;  4X65 O;  2Q8V A;  3DC6 A;  3VQY A;  2MK3 A;  3TJT A;  2UXN A;  1WP8 A;  1MZE A;  2YC0 A;  2O57 A;  5LMN B;  1S0V A;  1AI4 A;  1NBM G;  4J7J A;  4EFB A;  3WB0 A;  3JAL A;  4X8A A;  2XAQ A;  2EZO A;  1N0N A;  1VMG A;  3CC7 V;  5LYJ A;  1BMF G;  4RQE A;  1P49 A;  3ZMU A;  2Q73 A;  1YDX A;  5L3F A;  2IH3 C;  1MSD A;  5IJ0 A;  1MNG A;  2XOK G;  3L74 H;  4YY3 B;  2UUB B;  4L8J A;  1QLE B;  4TUY B;  4UVC A;  4C7U A;  1EZJ A;  3G71 V;  3BAB A;  3O65 A;  5LHG A;  4X66 O;  5K1P A;  1OZ0 A;  1RFY A;  1AI5 A;  2W6J G;  3J81 N;  4HBN A;  4K35 A;  4X64 B;  4FK5 C;  4FLW A;  2BTQ A;  2PGG A;  2A0L A;  3FB7 C;  3FAV A;  4FLV A;  4BWA A;  4U3J A;  3CD6 V;  5IYC O;  5IJ9 B;  1EM1 A;  3EFF K;  4EB6 A;  3VOU A;  5LGU A;  1LR1 A;  2Z0A A;  5C93 A;  3WB1 A;  4DV3 O;  2IJH A;  3MDS A;  2QM8 A;  4FM0 A;  2Q6A A;  2ZIO A;  4YJ3 A;  3DSQ A;  4AIL C;  3R66 A;  1VAR A;  2DYR C;  4JAA A;  3OTO B;  2EIM C;  2RN9 A;  2ZNJ A;  1SZT A;  5KHJ A;  2R9I A;  4G28 B;  3KZI Z;  2A79 B;  3E2E A;  3ICX A;  4I5S A;  4RO2 A;  3JD2 A;  1Q86 W;  3K57 A;  2X6A A;  4JV5 B;  2N74 A;  1PD3 A;  2WLI A;  4RUE A;  2OCC B;  2GDS A;  2Q68 A;  3BCC H;  3P32 A;  1OCZ C;  5H2F Z;  3QO8 A;  2AHY A;  5JVD A;  3HKD B;  4YJ2 B;  4X62 B;  3ETQ A;  2QDO A;  1V55 B;  2UXC O;  2P4K A;  1VIB A;  3H1K H;  3L70 H;  1HNX O;  1NQT A;  1HNW O;  1SER A;  5DEC A;  5BXZ A;  5A9G A;  5JQG A;  3SJA C;  2W0X A;  3AG7 A;  3RT3 C;  4EKW A;  4B3R B;  1GTO A;  4DV6 O;  4W4K A;  1YJ9 V;  3FYE B;  4LF5 O;  3S3W A;  1KP2 A;  1NS1 A;  4PHZ A;  1VQ5 V;  1R3K C;  2DMX A;  4DR7 B;  4AI8 A;  4I4T B;  4LF9 O;  3JD3 A;  2WA3 A;  3SYA A;  1G8M A;  2WLL A;  3AG4 B;  3Q4H B;  1GN4 A;  3K5O A;  4GZR B;  5KAI Z;  5FL7 G;  4X65 B;  4RQF A;  2E75 B;  1K97 A;  5L3B A;  3APQ A;  1I5X A;  1NH2 D;  1AI6 A;  5L3G A;  1IZ3 A;  3IC9 A;  2UXD O;  1OCC C;  1VQ4 V;  1HDJ A;  3D3Q A;  1R1B A;  2QWQ B;  4FFK A;  3ZBH A;  4MS2 A;  2ZNI A;  2IBZ H;  2L6L A;  2BSK A;  1RP3 B;  1F7Y A;  2JK5 C;  1WAZ A;  2EJR A;  1MOF A;  2BTO A;  2PI4 A;  3E22 A;  2ZE6 A;  4L87 A;  3P3N A;  1YIT V;  1PL4 A;  1TGO A;  2H3O A;  3H01 A;  3K0G A;  4XDJ A;  3QF7 A;  1XRE A;  4JI6 O;  3B40 A;  1ZSP A;  2WAM A;  2Z5U A;  3W7U A;  1JMK C;  5JJJ B;  3SR2 C;  2X7R B;  5IJ0 B;  4X66 B;  2QTO A;  2ZD9 A;  4X20 A;  5B66 Z;  2YID A;  4MVQ A;  2BCC H;  5LHI A;  4Z2W A;  1IDS A;  1J95 A;  2ZE5 A;  5EC2 C;  3AG3 B;  1RPR A;  1COW G;  1THZ A;  2DYS B;  4J9Z B;  1EFR G;  2AW9 A;  2QWO B;  1B6Q A;  1K5Q A;  4KP4 A;  2BTQ B;  3DGE A;  3FAV B;  2CTW A;  3ABL C;  3FKS G;  1AJN A;  3UT5 A;  1KBH A;  4U3J B;  3IFX A;  4DV3 B;  3CEI A;  3A8T A;  4G2K A;  1VQ8 V;  2PYJ A;  4EB6 B;  1ZLZ A; 
#chains in the Genus database with same CATH homology
 3SPJ A;  1VQL V;  4J9Y B;  2B1G A;  1NKD A;  3AG1 C;  4LCU C;  4QPK A;  3ZMV A;  1OCZ B;  2HVJ C;  1CP9 A;  2H94 A;  2LP7 A;  5GW7 A;  3ASO C;  1OCR C;  5DM6 V;  4MVS A;  1KKD A;  3ETG A;  1AJP A;  4TT3 G;  1BL8 A;  1M56 C;  2Y48 A;  1XL4 A;  5B1B B;  3VBB A;  5CBH A;  2JDI G;  3QO7 A;  5H6Q A;  3ABK C;  2OTJ V;  4BAY A;  1AR1 B;  2ZQM A;  3HPL C;  4UVA A;  2F43 G;  1H38 A;  3BEH A;  4GX1 A;  3ZRW B;  3W7T A;  3ZMZ A;  2EIL C;  4JTA B;  3MHH C;  2OT5 A;  2EIN B;  3JCZ A;  2EIK C;  3SPG A;  2IJJ A;  3K03 A;  4JTD B;  3OW2 U;  4R8C A;  4UVB A;  5L3D A;  2IJK A;  3ETE A;  5CN0 A;  4FIP C;  5EBL C;  1R6K A;  2QKS A;  1VQN V;  4CBC A;  1YJW V;  3CCE V;  1F23 A;  2Y69 C;  4PDV A;  3FB8 C;  3W7W A;  1I5Y A;  2DWD C;  5CMU A;  1FS0 G;  1P4R A;  1DLB A;  3K04 A;  3I55 V;  2XAG A;  1SRY A;  5L3C A;  2WLI B;  3FYI B;  3CCJ V;  3P30 A;  3OMI B;  2H8P C;  1PL0 A;  3ASN C;  3K9A A;  1Q81 W;  2WSS G;  1H8H G;  4I9W A;  1QLE C;  3X2Q C;  1DF4 A;  3M99 B;  2EZP A;  2ZR3 A;  4JAS A;  4PDL A;  3QO5 A;  5EBM C;  1LNQ A;  4H37 A;  5B1N A;  3STL C;  2JIZ G;  4PA3 A;  4BIZ A;  3D3I A;  4WFG A;  3AG2 C;  2XAF A;  1M57 C;  1FXK A;  1OCC B;  1K4D C;  3GB7 C;  4PA7 A;  5EK0 A;  4MT8 A;  4WFE A;  5E1A C;  3LUT B;  4WF9 V;  2YEV B;  4JTC B;  2PI5 A;  1Y4M A;  2D3O W;  2DQ3 A;  3SPI A;  1JQ0 A;  1KC8 W;  4WFH A;  1R3I C;  2IJI A;  4X89 A;  3K0D A;  3SYP A;  3CCL V;  2OTL V;  1CEZ A;  4UXN A;  5LGT A;  2ITC C;  1M90 W;  2KB1 A;  4BW5 A;  4UV9 A;  4ZKI A;  3WFV A;  4R7C A;  1P7B A;  1WPX A;  1GM7 A;  2B1I A;  3BY6 A;  5CA3 A;  5LHH A;  2QEX V;  2DWE C;  3JD4 A;  4JF3 A;  1W2B U;  1QBZ A;  4QJF B;  3JYC A;  2WLL B;  1OCO B;  5IYD O;  2BOC C;  4U7N A;  4DXW A;  5EBW C;  3F5W C;  3SPH A;  1YHQ V;  3SYO A;  1PKX A;  2NNU A;  2NLJ C;  2ZXW C;  2JEX A;  4OXS A;  4PA9 A;  2JJ2 G;  2LFR A;  2W0F C;  4XDK A;  1ZWI C;  3CYO A;  3E8F A;  4DO2 A;  2IW5 A;  1KEC A;  3LDC A;  1E1R G;  2A9H A;  4ZBM A;  2GHY A;  5B1A B;  4YXW G;  1FXK C;  5IDJ A;  1QLN A;  3ZRS A;  3IC7 A;  4MVR A;  3OAA G;  3SPC A;  2XND G;  3UM7 A;  4JGS A;  3EHB B;  3ZRX A;  2FTK A;  2X6B A;  5CBG A;  4MSW C;  3FB5 C;  1GM9 A;  3F7Y C;  3ABM B;  4GT1 A;  3RVZ A;  3WG7 B;  1BHA A;  2HVK C;  2AHZ A;  1VQ6 V;  1YTF B;  1NVP B;  3SJQ C;  3E83 A;  2P6J A;  1NR1 A;  4JPR A;  2IU0 A;  5J9P C;  2M7W A;  3ABU A;  4PEL A;  1S5H C;  1F4N A;  4N23 A;  4U7O A;  2OCC C;  1GMG A;  2WWW A;  3ABL B;  3CCV V;  4JYC A;  1V55 C;  2DQ0 A;  4JAV A;  3ZJZ A;  2V1D A;  4KUM A;  3W7X A;  1HWY A;  1R6N A;  1YTF D;  3D36 A;  1RM1 C;  1NVP D;  4BIU A;  1R73 A;  1JCH A;  3QNE A;  3R65 A;  3AG1 B;  1AJQ A;  2JEU A;  4LBE C;  3TCU A;  3G4S V;  3ASO B;  1OCR B;  5KUM A;  3RW0 A;  1F51 A;  1YIJ V;  2HJF C;  2WLH A;  1M56 B;  2MK3 A;  5B3S C;  3RVY A;  5B1O A;  1S76 D;  2UXN A;  3OGC C;  2YEV A;  1SES A;  2EIL B;  4Q20 A;  1S0V A;  1K9M W;  1AI4 A;  1NBM G;  4MVZ A;  3IGA C;  1VQP V;  2WLJ A;  4H33 A;  1GK9 A;  2LFS A;  3AG4 C;  3MD0 A;  4X8A A;  1H2G A;  3G6E V;  1XL6 A;  2XAQ A;  3ETD A;  3ML0 A;  2EZO A;  2K1E A;  2ZDI A;  1IXM A;  1ROP A;  2ZR2 A;  3OR7 C;  4G27 B;  3CME V;  3CC7 V;  4GCZ A;  4QE9 A;  1S77 D;  1BMF G;  2IU3 A;  4RQE A;  2Q69 A;  3ZMU A;  4KFM A;  4LC1 A;  1QR8 A;  1GM8 A;  5L3F A;  2IH3 C;  1R3L C;  3ASN B;  3CXC U;  2XOK G;  3JD0 A;  3JD1 A;  3G71 V;  1QLE B;  1Q82 W;  1KP3 A;  4GX0 A;  1EZJ A;  4UVC A;  2DW4 A;  1YJN V;  1FFT B;  3B8N A;  5LHG A;  3CCR V;  3AG2 B;  1M57 B;  1OZ0 A;  1BHB A;  1AI5 A;  2W6J G;  5IYB O;  2BOB C;  1NR7 A;  3SYC A;  1M1K W;  2IH1 C;  2CK3 G;  1VQO V;  3TET A;  1DTO A;  2W6I G;  4E2L A;  4HZ3 A;  1ENV A;  4FK5 C;  2C2A A;  2WLK A;  5HFL A;  4TSF G;  4WFB V;  3FB7 C;  2A0L A;  3CCQ V;  1JJ2 U;  2ZDI C;  2R9R B;  1FXV A;  3CD6 V;  3OFN G;  5IYC O;  2GSM B;  5IY5 C;  5H9C A;  3EFF K;  4LP8 A;  3I56 V;  3VOU A;  4QNH B;  5LGU A;  5C93 A;  3E89 A;  4P30 A;  4ASU G;  1JPX A;  2IJH A;  5H6R A;  3ABT A;  4MVO A;  3CMA V;  2ZXW B;  3K79 A;  2EIJ C;  4HAM A;  2HLD G;  2QM8 A;  4PA6 A;  3A0R A;  2EBO A;  2Q6A A;  4PDR A;  4XDL A;  4TWK A;  1CPY A;  2HR3 A;  3PJS K;  3FB6 C;  1FXK B;  2DYR C;  3AEI A;  3AG3 C;  1FXH A;  1W0K G;  4P9P A;  2EIM C;  3ZRW A;  3ZN0 A;  1MG1 A;  2X6C A;  4QPJ A;  4MTX A;  2DYS C;  1SZT A;  2YSU B;  2R9I A;  2X0L A;  4G28 B;  1YI2 V;  4MTG A;  2A79 B;  2HFE C;  2P90 A;  2UXX A;  1PNM A;  4CZZ A;  3E2E A;  3TK1 A;  4I5S A;  4RO2 A;  1V54 C;  1UJW B;  3JD2 A;  2B5U A;  3CC2 V;  1Q86 W;  4MTF A;  1MSW D;  2X6A A;  4XBF A;  1QVG U;  2WPD G;  1H8E G;  5EC1 C;  1ARO P;  3ZN1 A;  1PD3 A;  2WLI A;  4RUE A;  1K3E A;  2OCC B;  3OMN B;  2Q68 A;  3P32 A;  1OCZ C;  2ITD C;  3QO8 A;  2AHY A;  2QE7 G;  1V55 B;  3LSQ A;  4R50 A;  1SET A;  4P9O A;  4GX2 A;  1PNK A;  3CCM V;  1NQT A;  5B1B C;  1RM1 B;  1SER A;  3E8B A;  3E86 A;  3HB3 B;  2WLN A;  4WCE V;  3ABK B;  3OUF A;  1RPO A;  4EKW A;  4MVM A;  2P7T C;  2EIN C;  4RAI A;  1GTO A;  2EIK B;  2HKO A;  3B8M A;  5B3S B;  1YJ9 V;  3FYE B;  3ZMS A;  1S3J A;  4G2K A;  1K4C C;  1KP2 A;  1K33 A;  3OE7 G;  1OHH G;  5HFM A;  4GX5 A;  1E1Q G;  1PNL A;  1GO3 F;  1VQ5 V;  1NH2 B;  1R3K C;  4R6Z A;  2Y69 B;  2Z3Y A;  3JD3 A;  3SYA A;  5LGN A;  1L1F A;  2XAH A;  1G8M A;  3MHS C;  2WLL A;  3AG4 B;  4UUJ C;  1M9N A;  5FL7 G;  1S72 V;  1JVM A;  4QIW F;  4RQF A;  1JOY A;  1QVF U;  4WFA V;  2ATK C;  1K97 A;  3B77 A;  3X2Q B;  5L3B A;  4JAU A;  1VQ9 V;  4P2Z A;  3CCU V;  1I5X A;  2XAS A;  3OEE G;  3UKM A;  4X88 A;  1AI6 A;  3SYQ A;  1K34 A;  3K06 A;  5L3G A;  1NH2 D;  1JX9 A;  3CC4 V;  5KUK A;  1OCC C;  1DF5 A;  1F4M A;  3OMA B;  1GKF A;  1VQ4 V;  3ZRV A;  4PDM A;  3OR6 C;  4N21 A;  1TUE B;  1K73 W;  1VQM V;  3CPW U;  2WLM A;  4WFF A;  1NJI W;  4MS2 A;  1ORQ C;  3NXS A;  1R3J C;  4MW8 A;  3ZIA G;  3LDD A;  2JK5 C;  1KD1 W;  3T2M A;  5LBQ A;  2EJR A;  1MOF A;  3E8H A;  3STZ C;  2PI4 A;  1Y66 A;  1E79 G;  1MAB G;  4L87 A;  4MW3 A;  1YIT V;  3OUS A;  1OCO C;  3K0G A;  3H01 A;  2P67 A;  2QM7 A;  3OEH G;  4XDJ A;  4MTO A;  1K8A W;  1K7D A;  2Q67 A;  3E35 A;  4FJC C;  1AI7 A;  3CCS V;  3T4Z A;  4MVU A;  1QCE A;  2WAM A;  3K3W A;  4UV8 A;  4HYO A;  2Z5U A;  5IY5 B;  3W7U A;  3T4D A;  5KA6 A;  1Q7Y W;  3CP1 A;  5B1A C;  1G4Y B;  3ZMT A;  1VQK V;  2X7R B;  5KA5 A;  1W0J G;  3W7S A;  1EBO A;  2QTO A;  2V7Q G;  2ZD9 A;  2EIJ B;  3F7V C;  3E8G A;  3T1C A;  5CBF A;  2QA4 V;  3KG2 A;  4Z1M G;  4MVQ A;  1N8R W;  5L3E A;  5LHI A;  3ABM C;  1J95 A;  3WG7 C;  2DYR B;  5EC2 C;  2JJ1 G;  3AG3 B;  2EIM B;  4RUF A;  1RPR A;  1COW G;  1THZ A;  2DYS B;  4J9Z B;  1EFR G;  1K92 A;  3ZCC A;  1B6Q A;  1K5Q A;  5DN6 G;  3GWO A;  3LDE A;  4KP4 A;  4F4L A;  3DGE A;  1V54 B;  3K08 A;  3LNM B;  3ABL C;  3FKS G;  1AJN A;  1YSC A;  4FPP A;  4JYB A;  3DTU B;  1K5S A;  3IFX A;  3RBZ A;  4PA4 A;  3LSS A;  4QE7 A;  3OM3 B;  5BZB A;  2XAJ A;  1KQS U;  1WLE A;  4FMT A;  1QR9 A;  1VQ8 V;  1VQ7 V;  2HG5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...