3E8OA

Crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
TMVISHGTLSASAEHAAHLRQLLVHIAQATRQEDGCLLYLVSEDLSQPGHFLITEHWDNLGAMHTHLALPGVTQAIDALKHLNVTDLKITAYEAGEAINIMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_295823.1) from DEINOCOCCUS RADIODURANS at 1.40 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords uncharacterized protein with ferredoxin-like fold
total genus 26
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e8oA00
3KG0A 2N4CA 2AJ0A 2GO8A 1X7VA 2HLUA 3GZ7A 1JWWA 4DL0C 1N5SA 1Q8BA 2K7KA 3WDOA 3FGVA 4ZOSA 4NL5A 4Q2MA 4EFAC 1N5QA 2QIFA 2HLTA 1RJJA 2GGPA 2GGPB 1JK9B 2HIQA 2LQBA 3IWLA 4FNHA 1GXTA 1Y3KA 2CRLA 1CC7A 2EW9A 3FRYA 2LQ9A 3UDCA 1QUPA 1FVQA 1AFIA 1R6YA 2GFFA 2FHMA 2LDIA 4Q2LA 2XMVA 4A46A 4OJ1A 1S6OA 1Q8LA 2OFHX 1CPZA 1AFJA 5KAKA 2GV1A 4OIXA 3E8OA 3DCAA 3MZIA 1FD8A 1OSDA 2OAUA 3HHLC 4Y2IA 2AJ1A 4DN9A 1YG0A 1P6TA 3BF4A 2GCFA 1CC8A 2ZDPA 1N5TA 2XMWA 1VQSA 1FESA 1W2IA 2N4DA 3LO3A 2BJDA 3BGUA 2HQIA 2ASYA 1Y3JA 2VH7A 1TL4A 2BUNA 2XMMA 5B0CA 1KVIA 2XMTA 2RMLA 3HFKA 3TOQA 2GA7A 2BBEA 1SI9A 2Q3PA 3KNGA 4NPOA 2OD6A 1FEEA 1YRXA 2OP5A 3QMQA 2K2PA 2KKHA 3IWXA 5B08A 5IXUA 3DXSX 5B09A 4OJGA 2JDJA 3CJKA 1GXUA 1OQ6A 1Y0HA 2W4DA 5T7LA 3BR8A 4A47A 3T9NA 1V3ZA 1X8DA 1IUJA 1OPZA 1X0PA 2G9OA 1OQ3A 1S6UA 2K1RA 1YJRA 1YJVA 4DPOA 4OJ3A 5K9FA 3FMBA 2QLWA 3BM7A 1YJUA 5F0UA 4A4JA 1WD6A 1P8GA 2ROEA 1FVSA 3I9ZA 2AW0A 4HH1A 4HI1A 4HL9A 2FTRA 1KQKA 3KKFA 4A48A 1KVJA 2IYGA 2ROGA 2W4PA 5B0FA 2L3MA 4OJHA 2K1RB 4F67A 1VQYA 5B0BA 3MCSA 5B0AA 1K0VA 2BJEA 3F44A 1SQEA 3HHLD 2K7JA 3CJKB 5B0EA 2QYCA 2PD1A 1MWYA 1Q4RA 3K7RA 2VV5A 3TNVA 3TRGA 2PGCA 3BDEA 2XMUA 4Y2KA 4U9RA 1APSA 4HH0A 3HX9A 4Y2MA 1Q53A 2FIUA 2W4CA 4ZA1A 5F0WA 1AW0A 1LQ9A 5B0GA 1YJTA 2AP6A 1Y9OA 1FE0A 2ACYA 1URRA 2IFXA 3KG1A 2RU9A 2ZDOA 5B0DA 2OFGX 2XMJA 2OMOA 3BN7A 3HHLA 3HHLB 2ROPA 1ULRA 3VTIA 1FE4A 1TZ0A 2LXFA 2QLXA 2RSQA 5A6WA 1MWZA 2IYIA 2OD4A 2HFNA 2KT3A 1U7LA 4QOTA 2FB0A 2BYCA 5T7LB 5A6PA 3HDSA 3BB5A 2KYZA 3HF5A 2XMKA 1TL5A 2N7YA 4FNIA 4HI2A 2KT2A 1TUVA 4YEAA 1SB6A 2RILA 4YDXA 1N5VA 1XBWA 3LGMA 2HFOA 3LGNA 2OKQA 1TR0A 3QGPA
chains in the Genus database with same CATH superfamily
4MH8A 4UOGA 4O3PA 1NDKA 3H4BA 3OFEA 2P5VA 1JWWA 2EXUA 1HNXF 3HT3A 1S1WB 2OSQA 3MM7B 4NI2B 3V4MA 3SBMA 2KL8A 4YHHJ 3NRBA 4K4UA 1X5TA 1SC3B 1TP7A 1RTJB 1XK8A 2NS1B 3SFUA 1V6HA 3PJ9A 4KH1B 1MNEA 1HWJA 4LIWA 1A9NB 2OEJA 3K59A 1ZZFA 2Z2MA 4YY3F 2N3OA 2CVIA 1IVZA 1QE1B 4TVAB 3CCLS 3T5JA 3RBDA 1WG1A 5HMZA 3C46A 3PEHA 4WKRA 1AUSL 1UW9A 1HNXJ 4IR1A 3DCAA 2DKOB 2HS3A 3I5AA 2LQJA 4L3KA 4NYPA 5I42A 2YWWA 1UETA 3C14A 2F5GA 3PYDA 4ERDA 1HMVB 2FZCB 4ZVFA 2KG1A 1F5BA 2HBQB 1N32J 2XMMA 2R2SA 3NKYA 4QQBA 5HLFB 1IR2A 1VLYA 3BKUA 3DXBA 3MR5A 5J1PA 4CLWA 1M5VC 4N5SA 2OD6A 4ZDNA 1WI8A 1JJCB 3DC2A 3TA2A 3ZTQA 3HXMA 1UFLA 2CPEA 1TKXA 2NXNA 3EDQB 7FDRA 2ZH1A 1YWXA 3QFHA 3GU0A 1LXNA 2I2YA 2WAQD 1RYRA 2OPRA 5IQQA 1X4GA 5BJRA 2J76E 2RRAA 5HBMA 1KLMB 1R0BG 3QT5A 4RNMA 1WC4A 2YPZA 2W9CB 4FBTA 1IBMJ 2F4VF 2BJ7A 5D77A 3ZZOA 2AGOA 1OJ4A 1WHYA 2XG8A 4DPOA 2UVWA 4NCBA 3GQCA 3OSPA 5K14A 3RJMB 1JX4A 3EUNA 1FJEB 2GZOA 2I1RA 4K8RA 4Q8FA 2ROEA 2ZZNA 2UXCJ 4MIBA 1KQKA 4QWCA 1RAGB 1HBMB 1X4EA 3US5A 3CVKA 1U47A 3CTRA 4IKAA 1S1TB 4GKJJ 2L3MA 2MHNA 2UXDJ 5A8WA 5KG7A 1GMUA 4DFPA 4UZCA 1XNQJ 2PT0A 4E2FB 1KLMA 1ZOTA 3VAGA 5EUHA 1S6PA 5LMNJ 2H54B 2OPRB 1S10A 2K3KA 2YNFA 4DV2J 4FF1A 1FJGJ 1UP1A 5LSLA 1MWYA 2QMUB 4K2XA 3D54A 2GVDA 3ICLA 1RLDA 2OHDA 3QNWB 4KO0A 5DQHA 3FBBA 2CG8A 1FJCA 4Y2KA 1YRTA 3ZZPA 3ZTRA 1S99A 3D67A 4JUZA 4F25A 2VFRA 2FIUA 2ZBQA 2RNEA 3K5MA 4Q0BB 3M32B 3GSDA 2D9OA 2ZE2A 4WP9A 1HARA 1N36J 4DV4F 3BO3A 2QE5A 4ZHRB 5E41A 2GIRA 4R5PB 1QAYA 4KR0B 2R9LA 2ZFHA 3PW0A 3W5ZA 2HVHA 5J2NA 2WCXA 4LVNP 2HHTA 3KUGA 2RIJA 2XLJA 4J9RA 4M5JA 4FS2A 2CQ0A 4OZLA 1S76D 1HA1A 3A8JA 2E1MC 2CNOB 2HBRB 2QYGA 3GG1A 2VG7B 4WFXA 3EXYA 1TL5A 1DTTA 4JI2J 5KFVA 2OELA 3BYPA 4URGA 4DF8A 3NGTA 3NXZA 4ZPTR 2QJ3A 3R7BB 3I0RB 3MGJA 4BBYA 2JC0A 5L39A 5H1SV 5A2QU 2L41A 3HULA 3W9JA 3LWMA 4J91A 3M9OB 1M5KC 3PY8A 4EEYA 1F9EB 3NBPA 3POTA 2EBEA 2HZAA 3D5MA 4I68A 2ZC3A 4L75A 3U1LA 5IV4A 1QSSA 1PJ6A 2KT5A 2NYIA 2CQ1A 1ZM9A 1X5SA 3EE3A 4XTTA 5U47A 8AT1B 1UA1A 1Q0NA 2H3EB 4H54A 4P73A 3TUIC 3M30A 4ALZA 2ZNZA 2R2RA 4IQMA 1I6JA 2B4OA 2C2NA 3OBIA 4DSFA 2UUCF 4GKKJ 5ETPA 1FDBA 2ZH8A 1HL6A 2HIQA 4ED1A 1WEXA 2V9KA 5GAHI 4KGZB 4OZ3A 2FD2A 4UOCA 4OX9F 3CF5Q 2M5YA 3N79A 3T9ZA 3EPIA 2ZJQQ 2P9CA 1U6ZA 2CQHA 5AXNA 2X7IA 3C15A 1L5UA 1JLQB 1REVB 2V69A 3CDAA 1XR5A 1S1VB 3ILJA 4KQZA 2JSXA 2SXLA 4IFYB 2ZH2A 1N33J 2LA4A 2VU5A 3EGNA 1F5CA 2V8DA 3FVYA 3OR2A 4NLRA 1IWAA 3TEGA 3W2VB 3QBCA 5IFMA 4U6PA 4ZVEA 1GH8A 1K1SA 3GTYX 4CH1A 5HP1A 1YG0A 3M8SA 2HNYB 3W66A 1K8AT 3GJTB 2NXCA 4L76A 5D0EA 4Z7CA 3FZ2A 2UUAJ 3E01A 1D1UA 1M1GA 4PR6A 2VQEJ 1U45A 3MR3A 3MOJB 1N4LA 2HNYA 4CLLA 1CJKA 1TL4A 1L3VA 3DLHA 1B3TA 3PW7A 3TJ9A 2VDHA 3GB0A 3HSGA 1FCAA 4DBQA 8RUCA 3A8EA 3R3TA 1VQNS 3Q83A 1EJ7L 3KG4A 4U7UD 1S1VA 4DR1F 1O0PA 1MMDA 2Y0BB 4K4TA 4B08A 2DNRA 2WBMA 3U1MA 4MKVA 2JEIA 4TY8A 4AL7A 3G6ES 2DGTA 2UXDF 1R0CB 3RZAA 2A1BA 5BYSA 1FRLA 3SXLA 4O44A 1MU2B 2BE2A 1ZA1B 2RRBA 3M32A 3RW6A 4KKOB 4LF9J 4X4QA 3HD1A 2RQMA 2WW8A 4L74A 1XEZA 1VFJA 3S1TA 2V2ZA 3KKFA 5CD4H 3CW2C 3LA0A 2VPYB 5A8KA 5B0FA 1WOPA 1NHKL 3UVJA 3AOBA 3N9UC 1NPPA 3LPYA 3G6XA 3PW2A 4YOEA 3KHGA 5KT6A 2CPIA 2LQ8A 3CIMA 4J9OA 5KFRA 2ZITA 3TNVA 1SUQA 1TKZA 2ZOMA 4WCEQ 3HHDA 4LUBA 1HQEB 3UW1A 2YKPA 4EK2A 4DLGA 2MGZB 2ALZA 3H7HB 1UMJA 3K8VA 1XMOF 1D9FA 1VBYA 3RAMA 3KHRA 4WTOB 5IWAF 4Y65A 2ZH7A 3EGVA 1WEYA 3POTB 3UQSA 4N7TA 3M8RA 3N6LA 1H3DA 1VK3A 3V4IA 1IM6A 4Y0FA 4MFBB 4P10A 1XNRJ 2A10A 2COLA 5A0YA 2BACA 4CLFA 3THPA 5HBMB 1SIZA 2HFZA 3OFHA 1RT6B 2CA9A 2DGXA 4GVLA 4B3OA 4HR2A 3ENAA 4NLQA 2YWGA 1C1BB 3M8QA 3HDSA 4CM2A 4CLUA 3ZZZA 3R7SB 2DNGA 2LDYA 1QVGR 4X4UA 4OFZA 4DSEA 1UTAA 4I56A 5KFZA 2CPDA 1O8BA 1VDHA 2RUSA 2BV3A 3GCWP 4OYAA 4RUCA 1HHTP 3C19A 3VVTA 3KDOA 5GAEI 3K5PA 5L1LA 3KLGB 1U02A 1HKAA 1W25A 2J5AA 1XJWB 3NS6A 4ZP7A 5ETKA 4DI6A 5CXTA 3PKYA 2ZEJA 3TZWA 2HW3A 1IKYA 1NDLA 1R8CA 1G2EA 2R7VA 2ERRA 4IRCA 3MTJA 5I42B 2AJ0A 1IXKA 4W90B 1NNDA 4HTIA 2B8PA 4GO7X 5KFHA 1AA1B 2QSWA 4I0WA 3S01A 1VRUA 5IS2A 3P8BB 1Y11A 4DG1B 4GKJF 2H5EA 2CQIA 4A8WA 2IA0A 3W9IA 4ZPVR 2CWKA 2XY7A 1Y3KA 2XNRA 3UDCA 2UUBF 3H4DA 4IOBA 1HW9A 2YBVA 2H51B 4ILLA 1TKXB 3L3CA 4OL8A 2ATCB 3B82A 1KWMA 3MM9A 3M4XA 3SDEA 5RUBA 2XQCA 3T5LA 3LP1A 3Q2SC 4I2PA 4DL6A 1CEZA 1FERA 3RRKA 5D0GA 3SSSA 5D0HA 3D1OA 3U27A 4PQUA 3PRDA 2UU9F 2CZ4A 1RKJA 2G0IA 2QV6A 4AQYF 2ZDPA 3I5BA 5I4MA 4ANEA 3H5XA 4ED7A 4AQYJ 4XDDA 5CABA 3OPKA 2PIIA 3R6GB 2GIFA 1BC6A 3FQKA 1WOOA 1YRUA 4WF9Q 5HATA 1WOSA 1QD1A 2YQ1A 1SI9A 2EFNA 4C4WA 1FDAA 3LP1B 1XWLA 2V68A 2HZCA 1NRKA 3BPSP 5KFMA 4NZ6A 2R8IA 1CLFA 1FA0A 3OQ2A 5E5NA 2HGNA 1C4CA 4OI3A 4DCOB 3T9NA 5A76A 1N54B 3FFIA 1OPZA 1X0PA 1YBTA 3EYZA 1LV5A 1YBUA 3V4IB 2X1GA 2BXJA 2MTLA 3DRXA 2XS2A 3DNCA 4LRFA 4XPEA 2MEWA 1HNVA 4AT1B 3JSMA 4K4XA 1N6QA 2YKAA 4OJ3A 4LSLA 4J9KA 5HQLA 1P8GA 3D0IE 4HL9A 4TYBA 4HH1A 2C3PA 2C3MA 5EWGA 1DQ9A 2FUG9 3VAHA 2CXEA 3OR1B 2W2PP 3GYGA 3BGOP 1U49A 4MT1A 4IRKA 3UCZP 3PW4A 1FJGF 3R5JB 8ATCB 2IM1A 4WTYA 2IA6A 1YKWA 4OX8A 5C24A 1H6KX 3QGHA 5AXMA 5BXIA 2VG5B 5LT5A 3IN5A 5H9EK 2EI5A 1TK0A 2CPYA 5B0EA 4P6QA 5KFCA 2BDPA 1JLAB 4LSNA 2YKMA 2QN6B 2PMZD 5C5JA 5CYJA 2M8HA 3MECA 5F3TA 1ZTWA 2P2CB 3UR0A 4PG6A 5D4LA 3W60A 4I4BA 3DMJA 4LT6A 3BV8A 4CO3A 3JAMY 3SIPB 5KFBA 4UY85 2RU9A 1TQLA 2OPPB 3MM6B 2MKYA 1N0UA 3OHBA 4DUZF 1I94J 5L38A 2HQ3A 3W65A 5I3UA 4NLVA 4ED5A 2KYXA 4AUKA 2R7QA 4KSEB 4DV3J 2NYHA 1J5OB 2V67A 2VPZB 5A6WA 4HYKA 1MWZA 2IYIA 4LFBF 2DGOA 2XMAA 4PUOA 1YLXA 3B4MA 3OJUA 3D4JA 6AT1B 3Q0AA 2Z8QA 3UN5A 1UFKA 1G3OA 3IWNC 1Q7YT 1UWAA 1VISA 5ITHA 3HHEA 1XTZA 3HVTA 3TZYA 3EPGA 2VQFJ 4X4VA 3NMAA 4DPWA 4YB6A 1H2UX 1NJZA 4A8OA 1JLGB 3ZZ0A 4DZ6A 4LSNB 1TR0A 3ITHA 2M7SA 1GTEA 2YKMB 4M95A 4CCHA 2OTJS 1UW4A 4LF7F 4C11A 4QW8A 1K1QA 3D3CJ 3W5YA 3MUVP 2PO4A 1N5SA 1Y7PA 1DHMA 3FGVA 2VICA 4ZCKA 5F9NA 4YMEA 2M3DA 2HLTA 1RJJA 2VODA 2JLFA 4CLYA 1IBKF 5L9XA 2UXCF 1S97A 1P27B 4K4SA 1LWCA 1QUPA 4KAIA 4X4OA 3PR5B 3JSMB 1PYOB 3F56A 4FXWA 4F4AA 3GFZA 4ZVTB 3WBZA 3SSRA 2G13A 4P2MA 5KAKA 1G1XA 2GV1A 2Y1LB 4FS1A 3SZ2A 1M1KT 3H5SA 3MPYA 5HO4A 2AHOB 1VQLS 1R27B 5F8IA 1T8EA 3MM8A 3QWUA 3CC2S 5C25A 1TL7B 2BANA 4OQJA 2HQIA 4I69A 1KVIA 3I0RA 2XMTA 4ECSA 3DOMA 4LIRA 3KK1B 3J7YU 2MY8A 3Q8RB 3D2WA 1YRXA 1G6BA 4ECVA 3BREA 1B70B 2YNIB 5B09A 1NK0A 2B7BB 1T9VA 3CJ8A 3H8YA 4A47A 3BSNA 5IWAJ 4DR2F 1U2RA 1IR0A 4F26A 3DRPB 3SI8A 2R7SA 2GVZB 2HBZB 4OMFG 5LJ5Y 3BN4A 5D15A 3MECB 2FJWA 1C2PA 2YPYA 1VYAA 2K1RA 4QW9A 4F50A 1NK6A 5GADI 3PYFA 1DRZA 3MAAA 1YBAA 3TVKA 3NNCA 4RBVA 2XZTB 3J7ZT 2D7SA 2XEXA 4C3MA 4ZCMA 1U1RA 1AROP 4DQQA 2MJUA 2QLWA 1N8RT 1NM2A 2XWYA 2IJNA 1N34J 5ETOA 1UWBB 2W9BA 1BY9A 3RR8A 3DDNA 5J2PA 3D0HE 1W2BR 1U26A 2DNHA 1LWEB 4M5DA 3CPWR 3QJLA 4JI5F 3O2IA 5K5MA 1NB2A 2DIUA 2YNFB 3PCOB 1RWNB 4F0MA 4K4VA 3FRZA 4J7CA 1LW0A 3IR6B 3HHLD 4QCLA 3CJRA 1BD6A 2V2QA 3VALA 2C2DA 2PGCA 3T6BA 4GMKA 4F4KA 3KJVB 2ZHOA 2HHHJ 4KPYA 2QG9B 2YX4A 1YZ6A 3HX9A 4OYWA 3UI3A 1Q53A 3OVBA 3F0NA 4S0MA 1OWXA 1ZYQA 4QYZJ 2JEFA 1Y9OA 5E3QA 2IFXA 3G9CA 3RBZA 1FHTA 5CD4A 3DHXA 2OMOA 3LP0A 5MAOA 1TL3A 2FLOA 4ECRA 2ZH5A 3HO1A 4RBUA 4H4MB 1O5JA 3DM2A 5HSPA 1Z1ZA 5KFSA 4IQXA 4GC6A 1DTQB 2UUAF 1KP6A 3AOAA 3W8GA 4Q44A 3LAKA 5DG7A 2KI2A 2BRLA 4QWBA 2HHPA 1FRIA 2HFNA 2IRUA 3BGFA 4QOTA 3U1NA 4ZKAA 3SYZA 2JX2A 4UT4A 3P6YC 2KN4A 4OZ5A 2X3GA 4ECQA 3OT9A 2C2KB 2XMKA 3L9ZA 3T41A 4LF8F 1S4FA 3HVWA 1OSCA 4TXSA 1HR0J 5AJ3J 2PA8D 2DH7A 4OYZA 2H5JB 1NJWA 2R8HA 4EBEA 2NUUG 3IR7B 1B7FA 3W2WB 2EG2A 2PMWA 4TQSA 2IC3B 2DCUB 1H7WA 1LWFA 2Z4PA 3TAMB 1RXOB 4B3SJ 1SUQB 2VB6A 1PC4A 1U6FA 4ID8A 4UUWA 5AE3A 4USUA 3W62A 1PKUA 1HHSA 1FRMA 3MCNA 4KV8B 2LEPA 2QIFA 2HHVA 1JXVA 3N01A 4MIWA 3IWLA 3ILIA 3C2PA 4W92B 4V1Ak 1YJNS 4OHYA 2J9DA 2QL5B 1J27A 2BM1A 2CJ9A 2CRLA 1RWKB 3FRYA 4NYOA 4AE5A 3PNIA 4M94A 1WC0A 4E0DA 1FRKA 5KFWA 4N56A 4MKAA 1IBKJ 2K8GA 1U25A 2CQGA 3OTCA 4RW4B 2HHQA 2R2TA 4QR1A 2JVRA 4ES2A 3KLGA 1D9DA 3B54A 5ETLA 4ZITA 2GMJA 2B9XA 2AEJA 3ILLA 3OXGA 3LANA 2MKCA 5KTQA 1ZH5A 3Q8UA 3GIIA 5LSRA 4KGKA 3H2LA 2GO9A 4LR7A 3P45B 5A8RB 3TAPA 3GSIA 3J7YI 1JLBB 1I1GA 3R97A 2B6AB 3MURP 4W4MA 3KLHA 2VBZA 4DR6J 2O67A 3UDVA 1C0UA 5K8OA 4DV5J 3AD8C 2WVEA 3CDBA 4JYAF 5D3GA 5M2RA 2BBEA 3TUJC 3MXHP 4OZNA 1U0HA 1GMWA 2DT9A 3UN3A 3VWSA 3ZFVA 1HPZB 2I9SA 3HKWA 3HSJA 4OZ0A 2QFIA 4IH5A 3C16B 3DXSX 5DRKA 3LALA 1N36F 1VQ5S 5KFDA 1RTHB 3BGRA 4ZPBA 2MPUA 3NY0A 5HP1B 1IUJA 3MEEA 4LF6F 4RLEA 3WX8A 2F3JA 2B6AA 1RHKB 4CO1A 2XZDB 3MD1A 2BJ9A 4ITSA 1NXIA 4OI2A 3I55S 2CPHA 3IC1A 2Z2LA 3C15B 3ZZYA 2H48B 3FMBA 2DXDA 2ZM6J 4IDKB 3AD9C 3I9ZA 2XLIA 4A48A 1DJ0A 2Z30B 3T1HJ 3HD2A 4LRDA 4DJBA 1S0VA 2LLZA 3QSIA 3CCWA 4OJHA 1H2VZ 5DGAA 3NGUA 1VQ8S 1SH3A 2EFQA 1RA6A 2H1YA 2WW4A 2AV5A 3MEEB 2KXFA 3M2VB 5DM6Q 2V4RA 1RTHA 3BGRB 4DV1F 3J81Y 4B02A 3T5HA 4ZCLA 3TUZC 2VV5A 1WWHA 3NBPB 4H4OB 3MPVA 5EX3A 2ATLA 1Q79A 3D6FB 2F4VJ 2FVPA 1FFGB 2FGCA 3CB4A 3N28A 1LKZA 3NWRA 4HH0A 2B9YA 4M5HA 4U9RA 5HMYA 2W4CA 1IBMF 4GKKF 5KFGA 2B7CB 3OSNA 3GPAA 1FTCA 4QIFA 4ILMA 1Q5VA 4WK3A 3TAMA 1RDRA 1RSCA 3R2DJ 4A8MP 1RP5A 4ZVOB 2CNKB 4AXJA 3OV7A 4DSJA 1LWXA 6FDRA 3KLVA 2WVBA 1IM4A 1QUVA 2HBYB 4USMA 2XNQA 4CT8A 4CZCA 3GONA 4YP3A 2CJBA 1VBXA 2OGUA 4C8LA 4HLBA 1REGX 4KIAA 5A6PA 1FK9B 1NZ8A 5KFIA 1TTHB 2VHGA 1SKUB 1HYSA 5F8HA 1J5EF 1TUVA 2FGOA 3THTA 3M2RA 4QPXA 4DS4A 2RDIA 1WC1A 2HS4A 2C3OA 4FP9A 2RE1A 3VAKA 3V6DA 1H0HB 2CG4A 4B3MF 5FD1A 5KG3A 5IT9U 4HT7A 3HJFA 2P8IA 2IM0A 1MN9A 3LP0B 3N5FA 3T3FA 3MHYA 4IG3A 2N4CA 3A3NB 2VFVA 2W9AA 4DWIA 2WSFC 4K4ZA 2VG5A 1ZM3A 4QIEA 1HHQA 1S6PB 5ETNA 1ZPWX 3BQ0A 1VK8A 1S57A 5CH7B 3C6UA 2BOPA 3MF5A 4CLKA 1AZSB 4CRJA 4LBPA 4PEOA 4F3QA 3A12A 2EW9A 3I32A 3I0SB 4NLOA 1WORA 2WHOA 4R8UA 1L3KA 3KUEA 3UE2A 3WZ0A 4BCAA 3OUYA 3KK3B 3D66A 2BABA 1AFIA 3MUMP 3EVOA 1C4AA 4R0JA 3RB0A 2DTJA 1S6OA 2DK2A 2L9DA 2YWHA 3MAQA 4ZPAA 2J7UA 4ETZA 4A8QA 1PBAA 4PG8A 3EJMA 1RU1A 5G0RB 1L3SA 1FD8A 4ZVGA 1RISA 4OHXA 3LGHA 3RG6A 4ZLLA 1T9TA 4XK8C 4J9SA 1RAAB 2HK3A 4F3OA 5C42B 1WUUA 3H20A 4MKBA 2MQNA 2VBYA 4D3GA 1FESA 5IM0A 5KFKA 3LAMA 1HQUB 5BYQA 4Q45A 1RT3B 2W2QP 1QAIA 5KT7A 2ZH3A 1W26A 3CUNA 3M2RB 2DRDA 3PW5A 3PZPA 4JI6J 3K0JA 2E9ZA 5DZ7A 4IG0B 2L9WA 4ECXA 3EVMA 3QMQA 1PYTA 4TU7A 1IKVB 1GT8A 2HNDA 2IRYA 2DHAA 2V5HG 3DGVA 2QMXA 3MI7X 4PYDA 5E33A 5ADZA 3BJYA 3CMAS 2Z2YB 4DX5A 3TANA 1TL1B 1NEEA 1RU2A 2V8VA 5IQ6A 3I56S 2FLPA 2X1BA 4OYBA 4XO0A 5DLGA 2J6SA 2GVDB 5CZVA 2JH3A 1EHWA 5HVFA 4NOHA 3KJVA 1M0SA 5LJ3Y 4J9LA 5K9FA 1U48A 5E3RA 2LEAA 2CQPA 2I5JA 1YIJS 4JI7J 1JB0C 1WEZA 3RW7A 1FVSA 1HWLA 1WKLA 4KC5A 2MZRA 4CTAB 4DSLA 4JI5J 3QT6A 4C3LA 1URNA 4BHQA 3J7Z5 4JI8F 3KLFA 3DLLQ 1SQGA 1XR6A 1RQ0A 4F67A 4KHRA 2AJ4A 3THVA 2DNMA 4LFCF 4NXNJ 2O5DA 2KFYA 3EMTA 5E0OA 2PMHA 3GIKA 4C7QA 4J9PA 2R8GA 3CO9A 3DI6A 1FFSB 1MMNA 1NDCA 2QYCA 3EDRB 2V94A 4PG7A 4PABA 5L9NA 5E3PA 4ECUA 3J80Y 4ED0A 5D8HB 3BBCA 1U4BA 2DNNA 3ZNUA 4CI0B 4NA2A 2KHCA 3FUYA 4DPXA 2MZ1A 1KLNA 2GS8A 1Q16B 2VL1A 1IR1A 5F0WA 3AHPA 3G6YA 2AT1B 1FE0A 2L9NA 1KQSR 4X64J 2LMIA 3TARA 1SJ4P 2XMJA 4PXCA 5F9LA 3KYLA 2BA9A 5HMXA 1KEKA 1ULRA 1FE4A 1DLOB 2JC1A 2HSEB 1NHVA 2RSQA 1YI2S 1VQ4S 3NNAA 2CZ9A 4F02A 3A1YG 3BH7B 1MWQA 1KQFB 1T05A 2QLJB 4RW8B 2KT3A 3FBFA 4NRTA 1M5SA 3DHWC 5T7LB 1VQOS 3AXMA 1T03B 3H2UB 4NEZA 2R2UA 3JQKA 1H74A 3PV8A 2KTQA 3ENVA 2CJKA 2R8JA 4H4OA 1VC6A 2KT2A 4IH7A 2L48A 3WC0A 3DOLB 4OYXA 1HBUA 2ASDA 3ELHA 3GJQB 4YY3J 1B99A 1OS5A 1NUEA 3EWGA 2WONA 4Z37A 4JOUA 1HNIA 1UPMB 4QJVA 1WC5A 1F60B 1RTIB 1KQGB 1YSJA 1JJHA 2DGSA 2HNZB 2RF2B 3M6VA 5I3UB 4CQ1A 2JVOA 4TU8A 3AY0A 5DO2A 5C7PA 4FXVA 5LM7E 1RT1A 4PYAA 2HGLA 1UEKA 2E29A 2K7KA 2UP1A 2NXUA 1R43A 2DYAA 1N5QA 1RTJA 2OEKA 2XYGB 3B8HA 3I9V9 3TWZA 2GGPB 5IV3A 3KFWX 4HVZA 3RYLA 5H9FJ 3S8SA 1IN0A 3IO1A 4LF4J 2VBXA 5GVQA 2HWTA 3HSZA 4NRUA 3V6JA 2B5JA 1FNXH 2NSBA 4ZPDA 2BKPA 2XULA 1OMSA 4NLDA 4W98A 4YB5A 1NK4A 1RUSA 1FO1A 1X60A 2UUCJ 1RTIA 2C2OB 5K8NA 1HWUA 2GQCA 3PTWA 4B3TF 1S0MA 2CQDA 2PA3A 1JLFA 4F2RA 2DR6A 3MDFA 5KOWA 2YKNB 4JI4J 5ETRA 1UKUA 2DHXA 4C48A 4I64A 2GAHC 3KLIA 4RW7B 5GAHU 1FD2A 2BRKA 2F40A 2WSEC 4G1PA 3B4DA 2OUGA 3KLIB 4R25A 1HNIB 2X1FA 1KC8T 3QJPA 1T02A 1PC5A 1WELA 2KVQE 4BWMA 1WKJA 2AF6A 1HLWA 4JI3F 3HK2A 2MLZA 2DPJA 2E5JA 3UNGC 2I0XA 1J5OA 1VGYA 1X4FA 2F8EX 3GFHA 1H7XA 2DGQA 4RPFA 5D4PA 2RDDA 3JTOA 2JDJA 4LJMA 1R0AA 2FJAB 4MTPA 1WTBA 1CQNA 1XMOJ 5CHCB 3LUYA 2B5JB 2AYBA 5FDLA 4DL3A 4B9NA 4KFBB 4CIOA 2V2VA 4NLTA 2XI3A 4X62J 1NSKL 3MR2A 4DR7J 2GMHA 2R7TA 3QAEA 3MPDA 1HNZJ 4RUAA 4LREA 3KHHA 2QLBB 5LL6d 5HK4A 2DY1A 3BM7A 1KBRA 3Q22A 4JV2A 2JNJA 2HRUA 4K0KF 1X5OA 4DEZA 1FX4A 2LXIA 3LTOA 3Q86A 4HDHA 4CLZA 1WG5A 4DU8A 4K0KJ 2LKZA 1R89A 2JFDA 5G4DA 3NL0A 1NU4A 5ETTA 2IDEA 2HRTA 3UDEA 3H42A 3A8KA 1SV5A 5A8WB 3W2WA 2BQUA 3M2UB 2G4BA 2HHUA 5CYMB 2E1PA 3AB4B 3O8WA 3OLBA 2XC9A 4F4WA 1S49A 1UAWA 2BJEA 1LXJA 2WONB 3SCIE 2I38A 3QZ8A 3EGZA 4DR7F 1CJTB 1SQEA 4LF9F 1N56A 5AE2A 4YHHF 1B7YB 1H2TZ 5HMWA 5IC6B 1RK8A 1SCJB 2ZBCA 3P3DA 5J2MB 3HP6A 2ADBA 3IXQA 3PO5A 4DR3J 1T3OA 4ZIVA 2RQCA 2RT3A 1X0FA 1TMJA 4CLSA 3C3LA 4FKYA 2DH9A 1QVFR 1XMQJ 4JBCA 3RR7A 1IKXA 4NA1A 1JLEB 1GX6A 2ACYA 1DTQA 1CQMA 3KG1A 2KG0A 2RUGA 1LWFB 2G0JA 1DTTB 4M8LA 1JXLA 2HQCA 3NNHA 2B0GA 3IGNA 4WIQA 4RWWA 1KRPA 5L1JA 1J2VA 1TL1A 3AOCA 3GP9A 4RX6A 1S6QA 4JI6F 2XO6A 1D09B 1FX2A 4KT0C 4WXOA 2HVDA 2CIMA 3JS9A 1UJ6A 4OX6A 2APOA 4LBIA 4DUYF 1HMVA 3AJ1A 2FZGB 4QU6A 1PO6A 4ZVRB 5EDWA 2MB0B 1RB0A 4WIIA 1RT7B 3IFEA 3GIMA 1N5VA 3M6UA 2DD8S 4IO1A 3CULA 1ZA2B 4KRWA 4PQAA 4PXEA 1HI8A 5KFUA 4MIAA 4RW6A 1JQGA 2M4MA 3NGSA 1BLUA 5J2MA 1FRHA 3MM9B 5KFQA 3KG0A 2B4VA 2MDAA 3MR6A 1KFDA 5J2PB 4E98A 3NG8A 1CJTA 3VAJA 3ZTPA 2QL9B 2EBGA 3FCWA 3VV2B 1WI6A 4NL5A 1NSAA 1DFDA 5T41A 1KOOA 4O3QA 3MEDA 2BW7A 4YUDA 2IJRA 3QJJA 2GVZA 3JTNA 1CC7A 2N3LA 3L95X 4J37A 2VJVA 5K8MA 3OW2R 2E9TA 1FVQA 1OY9A 1EKSA 3PM9A 4Q2LA 4DR1J 2EPIA 4D3HA 3NGDA 4LF6J 1UJ4A 2DGWA 2OFHX 2QFJA 2HMIB 2DO0A 1AFJA 3IBCB 2Y1IA 2ZKUA 3EZOA 1PAEX 1JIHA 1VI7A 1ZS6A 2Y1RI 2Y3YA 3FZBA 4F3MA 3ZTSA 1RI7A 1SH2A 1ZM4A 5GMEA 3TO8A 4X4NA 1P6TA 4MJKA 1CULA 1RHJB 4JI2F 4IG3B 4YFUA 1KD1T 1D3WA 2CJAA 5LXYA 2NR0A 2BOAA 2N4DA 2WRMA 4NLPA 3AJ2A 3LO3A 3BGUA 3HKZD 2FLNA 5HLFA 2JLEA 3SQOP 2G1DA 4KGMA 4ATNA 4DUTA 5KFNA 2A2CA 3HFKA 2ZZTA 1NPRA 1P9YA 1SC1B 3VVUA 5A0YB 1BQMA 2KXNB 5DLFA 2R8KA 3KHLA 4I6WA 4PXDA 2JFKA 3CC4S 5DG8A 2LQ5A 2XCAA 5HVHA 1LW2B 3KLEA 3K5NA 1GXUA 1IKXB 2V34A 2VG6A 2W4DA 1SKWA 2AMCB 3M7VA 3W1YC 2FJVA 1XMBA 3FSYA 1CJUA 2QSFA 3AODA 3I5CA 1K47A 5DDQC 4EYIB 4JV1A 1LFPA 1FKOA 7AT1B 4GC7A 2PDAA 4WJBA 4DS5A 4LRCA 3TR5A 5BR8F 5CA5A 2V9WA 2G2ZA 3OJSA 5KFLA 2UV8A 4A8KA 3DMJB 4O44B 1A6LA 2L08A 3GIRA 1JJ4A 4NLGA 2KZZA 4OLPA 2FTRA 1ITPA 3OR2B 3KNAA 2IYGA 3I6PA 4FKXA 2IRXA 2VZ9A 4H4KC 4IFYA 4ZPCA 4DR5F 5HQ8A 4PCQA 1TFWA 3CD0A 1S1WA 1ZM2A 3DLGA 2CZVC 3BEGB 5B0AA 3MFHA 2P6SA 2IVFB 2XTJP 1FTRA 1MU2A 1S72S 4V19J 3BDEA 4LQ9A 2IAJB 4N8NA 4BC7A 2OSRA 1S9EB 4CH0S 2XS5A 4P7TA 4TY8B 4Y2MA 4YQWA 2CDRB 2ZM6F 3ZC4A 2KXHA 3IR5B 2H65B 1X4AA 1N34F 2HVIA 2D3ZA 3FNNA 3MEGB 4XPCA 2BX6A 1NK7A 4BS2A 1WSVA 4F36A 4ED3A 3JTPA 5L8RC 4AYBD 1FXLA 5M2UA 4C8OA 3VTIA 3CJ0A 3PX6A 2FHJA 5KFFA 1F2GA 4QIVA 1C0TA 3PR4A 1F1BB 3SMZA 1OYDA 3D7SB 1BE4A 3G8QA 1SXLA 1UZDA 1M5OC 3RAXA 1AB8A 2VG7A 4C0OC 3BSOA 1C1CA 1AUDA 1N88A 3ZTOA 5KFOA 3LWLA 5HJYA 2N7YA 2YX1A 2ZZMA 2DNQA 2MLYA 3BO2A 1JNZB 1CS4A 2FDNA 5D3GB 4B17A 2W2NP 2FJXA 1UVJA 2R7UA 5FLXY 4L6V3 4H4KA 3T1YF 1U24A 2D41A 4RBTA 4DU7A 4HDGA 5KT2A 1I5OB 1MG7A 2C3YA 2J9DE 4KBIA 2BEFA 4NLSA 1JLBA 3FDSA 4JI0F 3SSQA 4ZHRA 4LQ3A 2HURA 3BKTA 1XNRF 4ELVA 2DNKA 1NSPA 3JXOA 4OZ2A 2CNLB 2J8SA 2DJWA 2GJ2A 4RKUC 3JQMA 1LFWA 1RT5B 1X4HA 3DRRA 3PG9A 4I2PB 7FD1A 2E5LF 2IBOA 4O3RA 2E5LJ 2BZ2A 2QO3A 4KO0B 1PIEA 4RU9A 2VC1A 3O44A 2NQPA 3DLKB 3PHTA 2C1EB 2XMVA 4FYXB 2PI5A 1XIQA 4OJ1A 2DRBA 3QPIA 1Q8LA 2YX7A 5ETVA 2O01C 1U0HB 1T11A 3R9LA 1CJUB 2GNKA 1FFWB 1SJQA 1OY6A 4OI0A 4ED6A 4Y2IA 1S12A 3HHLC 4B3SF 1RWWB 4J90A 2GCFA 2IVYA 5B7WA 1CC8A 1WC3A 3GJSB 3TJ8A 1LNQA 3ZNJ1 3UN2A 1VBKA 2P9GA 4DFJA 2GMLA 2AYEA 4DSKA 3QRRA 3W3SA 2I8EA 2OPPA 2BJDA 3R5GA 4IG0A 3QRPA 2ZE2B 4ZVPB 3DRSB 4DQIA 4FF3A 3G2XA 4U7UK 1HBNB 4DL4A 1HWKA 4RW9B 4WPAA 1A0OB 4F0KA 5HROA 4DR4J 3TVZA 3PX4A 2W8LA 2R7RA 2BJ8A 1EP4B 4RNNA 1S9GA 1QM9A 1NCLA 1PILA 2J6TA 4WFZA 2GJFA 1TELA 4M5IA 2UU9J 1EQ0A 4L73A 1I51B 1IQTA 3HHKA 2YH1A 3FMWA 4F8RA 1S0NA 1Q8IA 2NSCA 5C24B 2D3O1 4FF4A 1K0TA 1G7CB 1WSRA 4K5SA 3OVAA 2MKIA 1ZETA 3ETMA 1W7WA 2G9OA 4FVCA 3H5YA 3CMES 3CJ4A 3TEHB 4EU0A 1SL0A 2DGUA 3RRGA 3M8PB 3KK3A 1OIAA 2JWNA 4HKQA 2JJ4D 2W2OP 2YQ3A 3FBCA 1WF2A 3GIJA 3K57A 5AT1B 4DCJB 3BQ1A 2B4UA 3I0SA 3WC2A 3PO4A 1BWEA 1IBLJ 4O3NA 3HZGA 1HQEA 2W4PA 2DHSA 1H73A 1KR4A 5L46A 2CQ2A 2DEIA 3Q23A 4FYVB 1VQYA 3WHIA 1TKZB 1S7HA 2A2DA 3L4BC 3SFGA 4EO8A 3T1HF 1E6YB 3NAIA 3CDUA 1RCOB 4QYZK 3F44A 2POKA 1T9WA 2G2OA 3IS9B 3OD2A 1HFEL 2FZKB 3QGGA 4F7VA 3TP2A 3KOAA 2VOPA 3UD4P 2PD1A 4K50A 4RO0A 3B78A 3TRGA 4LF2A 4CLPA 2XMUA 1MSWD 4OZJA 2XHWA 3M8QB 4USHA 2LU2A 1RT5A 4C98A 1YHQS 2ZOGA 3K58A 1NZAA 2AP6A 3FSIA 4ELTA 5EHHA 2JHEA 3Q2TC 3LQVA 2QGFB 2DBBA 4CYUB 4Q8EA 2J8AA 3BN7A 2LCWA 4OI4A 4TYAA 3AAWB 3VGUA 4ZP9A 4DV3F 4TU9A 4ED8A 1YTYA 5EGYA 2BW2A 3PACA 1U7LA 1K44A 2R7XA 1TAUA 3TI0A 5CYQB 4PPZA 4DPYA 2W7PA 1UVMA 3P5TL 1C1CB 2CNNB 3R1HA 4FNIA 2DXFA 2H4WB 3CJSA 2HEKA 3K89A 3OTEA 4WU2A 4RNHA 5DG9A 3IAM9 3NCRA 5H9FK 1UZHA 2W1BA 2Q6BA 3MMAB 1FWKA 3G8TA 2UV8G 2ABYA 3OLAA 4OYMA 1L3UA 1FWLA 2B8QA 4DMZA 5A8KB 1RAEB 1F3VA 1WF0A 4DF4A 1VMBA 3NGKA 1TAQA 4P2XA 4WYLA 2GO8A 3OVSA 2HLUA 3DFEA 4X84A 4DV0J 4AL6A 1HNZF 2XSFA 3M1VA 3M2VA 4F2SA 4JI8J 2VJUA 3IMQJ 2RDJA 5KFPA 1SH0A 2RVJA 3RTVA 2LQBA 2VIHA 4M5GA 4KHMA 3MM5B 4P74A 4AXIA 5KFXA 3CCSS 4ELUA 1UL3A 2LEBA 1RWOB 1VHFA 4ECWA 2OPSB 3GCXP 4EGLA 4C6AA 4EBDA 2ZH4A 2QX0A 3AA8A 2RS8A 1VQ6S 2HNZA 2RF2A 4DN0A 3FEXB 3T1YJ 2D3OR 3QLHA 4OYPA 5FDLB 1RHUB 4QR2A 2E7VA 3HCXA 2Q6CA 5KG6A 4ZLJA 4UQGA 1T03A 2HWIA 1KFSA 1P9QC 4C11B 4Y28C 3CGIA 2J0QD 2RHSB 1N5TA 1NHUA 4O4RA 1T7PA 1WC6A 2A6OA 2XMWA 1FK9A 2CJYB 2IJFA 3CCTA 4PWUA 3WQPA 4PUOB 1Y3JA 4X66F 4O4GA 4I7FB 2VFUA 2RMLA 4LFAJ 4I2QB 4DDFA 5KG2A 4WFBQ 3FCHA 4P2SA 4LFAF 1HD1A 5DS7A 2AX0A 3DOKB 1XN9A 1RBOB 4UF4A 2OP5A 2OH2A 4I67A 2DRAA 2JL9A 2IBKA 4J9NA 2IIHA 2DNLA 2IMWP 2UUTA 4GVBA 4DR4F 4C9DA 2MQLA 1YGYA 2J9CA 2LU1A 4FF2A 4IRDA 1FDDA 1JLFB 3ZZRA 4FZVA 2HHHF 1S9EA 2WVFA 4ANCA 1YJRA 4U95A 2IAJA 4WZQA 4RUBA 3NLCA 3IRWP 1Q86T 3L7OA 1YJUA 2YTCA 3Q8PB 1WD6A 1NSQA 2EEYA 1FEHA 4URSA 2MY7A 4USIA 3R7NB 3TQEA 3WIUA 4DV7F 1EARA 4EYHB 2EG1A 3ENWA 2ZBPA 2QLFB 3KLFB 3K17A 1CSJA 1JLQA 1RKIA 1REVA 2ZUAA 3JSBA 3DYAA 2F1FA 3FEZA 4KV8A 4X4PA 2M88A 1SL1A 1EB0A 3IS9A 1FJ7A 4NXNF 3CJKB 2NZ4A 4ZN3A 1Q1KA 2KHDA 1SQFA 3KLEB 2NPIA 4G1QA 1UJ5A 5HI7A 1Q7LB 2C22A 1DBDA 1FRXA 1M5HA 5DDRC 1RAOA 3I4HX 4I2QA 4ZA1A 3M1VB 2GX8A 1PBUA 5B0GA 4WWSA 2ZH6A 2ZC4A 1DQ8A 4DQSA 3QIDA 2PFDA 4G1IA 1HBUB 3VCDA 4K7QA 5ETMA 3HVAA 2HYIB 3OTDA 2E1CA 4K5RA 1NBEB 1SPBP 2HIYA 5BYRA 3PDNA 1RTDB 4JI3J 1FWPA 3V6KA 1IWGA 2FVQA 4WFYA 2AJQA 1KDNA 2HFVA 1S9FA 2BQ3A 2ZBRA 3QIPA 4LRBA 1B0TA 3MOZA 1M5PC 4NEYA 5EWFA 4UZBA 3BZQA 3MMCB 3G96A 2H4YB 1BMQB 3N6NA 1VLOA 2ZVSA 3PEJA 2Z57B 2OPSA 1LK7A 4I6AA 1N5YB 3ZZTA 3C66A 4ZIWA 3CCVS 2GHWA 3D6MB 3W61A 1AYEA 1V5VA 2Z0GA 1KVKA 2FYXA 3P96A 2J7KA 1WKKA 4X2BA 3VAIA 3CD6S 1EAYC 3CMQA 1HBMA 3NOGA 1UCNA 2ZH9A 4CT9A 4FXDA 4M5KA 1NH7A 1Y10A 4DFKA 2HPUA 3H59A 1LW0B 2QC3A 1YJWS 1Q8BA 1D8YA 3BO4A 4ZOSA 3F41A 5CCMA 4USKA 2FHJD 4B9VA 4EFAC 4OHVA 4NLYA 3VGTA 4MYTA 1AZSA 5AXLA 3U02A 2E44A 2HG4A 4CNZA 2AGPA 4IR9A 2QMWA 2FVSA 1UWBA 2W9BB 4DX6A 4JI0J 2PEBA 3O5TB 4IOAQ 3OTBA 3HI9A 1RT7A 2HKEA 1TVRB 3ISZA 1VQKS 4LF4F 2D69A 4CP5A 2AWZA 2LDIA 2AJ2A 2NREA 5CYMA 3MEKA 3VF0B 2R3VA 4CO4A 4KJIA 1Z2LA 4DX8H 1EKRA 3H40A 4K59A 2K06A 1DAXA 4OIXA 1KTVA 4QR0A 2FJEB 3BKFA 2XGPA 4WZMA 1F9HA 5E3CA 3ZXWA 1OSDA 1EZZB 5J2NB 1GMVA 2J6UA 4WFNQ 2DXEA 2YNIA 2DGVA 3I31A 1HYSB 2VFSA 4EZ9A 1VQPS 1W2IA 3KK1A 1MW7A 2HK2A 5HAOA 4I6YA 2V8PA 5GAGU 2VH7A 3BR9A 3L7UA 2WB1D 2BUNA 4Q5VA 3CXCR 3G71S 4KTQA 1Z4UA 5F8LA 2PFFB 5K8PA 3CC7S 5MLCV 2FVCA 4WXWA 3DM2B 4BLGA 2CJXB 2OI2A 1TL3B 2F8MA 3PX0A 3IWXA 4C2MA 1QE1A 2OLWA 4Z2XA 5B08A 1C1BA 1FXRA 2AIRB 2YNHB 2OIHA 2IPOB 1KSPA 2ILYA 3G6VA 2OTLS 3J7AN 1JLEA 4FYDA 3IRXA 3I82A 4B9TA 4YB1P 3I4PA 1Y5IB 3IAS9 4ANDA 1OQ3A 1MMLA 4O0NA 3E2EA 3LPEA 3OTOF 3DDIA 1SJFA 3SCLE 1U1MA 4U8VA 5KFJA 2OO4A 3Q8QB 2H5IB 3TUPA 4ILRA 5DQIA 2NUHA 2XB2D 1UEVA 2FJBB 4KB7A 2EKNA 3TZZA 2FVRA 1FKAF 2IM3A 1OY8A 2FY8A 1IKYB 2ROGA 2XHCA 2F8HA 4C3KA 4XAKA 5A2QY 1X5PA 4EZ6A 3P4UB 2W9CA 2W2MP 1Q95G 3M9MB 2MJNA 2Y0SD 2YH0A 3DU5A 4NASA 3HHNB 2V4JB 2XY6A 2E7WA 2Q79A 2D3UA 1Q4RA 2F63A 1KN6A 3MAAB 4YDDB 1S1UB 1HI0P 3CJQA 5HROB 3EICA 2YKQA 2Q66A 3K5LA 1UVNA 1PAUB 1YJTA 3RAQA 3TA0A 1JJ2R 3GLJA 5DDPC 1QAJA 4B9MA 1VRQC 2W24A 3ETOA 2HVEA 2OFGX 3M05A 2BKOA 4C8NA 2XYPB 3M8WA 4RNFA 4DX7A 2MZQA 1O6XA 2PSZA 5J1NA 4YR0A 2C2RA 1FKOB 3SCKE 3H2VE 3IA0A 3DOMB 4C8ZA 5D78A 2VD3A 3HMJG 9RUBA 2OD4A 3TA1A 3AJDA 3G86A 2N7CA 1TFYA 1EETA 1CS4B 2BYCA 2QTWA 4X4TA 4LR9A 4WKYA 2KYZA 3JYTA 2IVMA 3HF5A 4J9MA 1RWUA 2CQBA 2VASA 3E01B 1E6VA 4ECYA 5DETA 4NE9C 2CUYA 5CZXA 4CWBA 2QZ8A 1ZAWA 2E7XA 1S79A 1SB6A 2HVZA 3PYGA 2AYGA 1U8SA 4UQTA 4YDXA 3LGMA 5JJBA 5DZ6A 5IT9Y 2OKQA 3C8YA 2XSJA 1Y00A 4NLWA 5KG1A 2HQDA 2BJ1A 3IM9A 2HHXA 3DRRB 4RW4A 1N33F 5LOQA 3GILA 1EQMA 2B9EA 3V5RA 5AXKA 2X1AA 1PSDA 3ULHA 3QRQA 3QATA 3H90A 4X64F 3A3OB 2V4JA 3WDOA 3F73A 2D9PA 2UUBJ 2PN6A 5F3ZA 4Q2MA 2VA2A 3IGVA 1RE1B 1YJ9S 2MKHA 2V0NA 2E5HA 3FEYB 1FKPB 2U1AA 2AYMA 3OR1A 4KYZA 5HJXA 4B9LA 2V50A 2WK4A 2XBPA 5K20B 2ZBIA 3L7PA 2Q1LA 5E2QA 1KHWA 1XQIA 4DQRA 3EXCX 4QIWD 3MMBB 1F5AA 1ROFA 1SJ1A 2XSJB 4Y6IA 3SQGB 3UWTA 4PPDA 1IBCB 2R42A 1BQMB 4RNOA 3BDPA 4NCGA 5KFYA 1CG2A 3CD5A 2DR8A 3OL9A 2HWHA 2DH8A 1VHIA 2AJ1A 1X9SA 3C6TA 1IQZA 2VQEF 3OXLA 1E6VB 3QAUA 4KGXB 3C16A 1HQ2A 4EO6A 4DR2J 1SIWB 3BSCA 3ISNC 3R5AA 3G8SA 2YY3A 4KHPJ 1TMMA 2ASYA 3MEGA 5SUHA 1HNWF 3EGWB 3K8WA 1T94A 3TOQA 2J9EA 1RAFB 9ATCB 4R5PA 3UCUP 3DGPB 1IKVA 4UUXA 1GXLA 1JLCB 2GHPA 2K2PA 4DR3F 5IXUA 1HBOA 2WOMA 3N4WA 3Q89A 4OJGA 4ZN1A 1OQ6A 4ZLNA 4USTA 2HGMA 2RQKA 3KXDA 5IZHA 1VC5A 1YVFA 3DLGB 1F3FA 2ZVIA 3HPOA 4UW2A 5J1EA 3MEDB 1GEHA 4TNOA 1RTDA 1V3RA 1VQ9S 1S7IA 4LF5F 1IJEB 2GIQA 1TVRA 1YX2A 3DI6B 2B56A 5F0UA 4ZPWR 4A4JA 1RWXB 2P6TA 3H0PA 4JI7F 3I87A 5DDOC 1Y5NB 4ECZA 3HJVA 4WP3A 2XZWA 1X9MA 2UVUA 1UPPA 2DR7A 1S1TA 4B3MJ 4CLTA 4X65J 1NJYA 1LWEA 2K3IA 4M5DB 2J0XA 2Q43A 5IT0A 2XGQA 1T9YA 4DG1A 1IKWB 2E66A 1S1XA 4NLUA 4DQPA 5DQGA 3KUHA 4Q43A 2YNGB 1SKRA 1GNKA 5EWEA 3KK2B 4NZ7A 2RKIA 3DDKA 4HHHA 4Y3CA 3PXGa 4IH6A 5EN1A 1RT2B 5CYQA 1HI1A 1WHVA 4UOHA 3DKDA 4XDCA 1VIXA 1SBRA 2E5IA 4WE1A 2UXBF 4FN5A 5GMKa 3FQLA 5I3PA 3ET6A 1SKSA 3ONQA 3EZ5A 3U7JA 4QIGA 3GR0A 3H98A 4DV0F 3T5KA 2HHWA 5D4NA 1G4CA 3D6HB 2LXFA 2BJ3A 4LRAA 4RUHA 2FHOB 3CCES 2QA2A 3PVXA 3AD7C 5KFAA 4DV6J 4PG5A 3DLEA 3FCVA 4OV6A 1R0AB 1B64A 2NLWA 2DVIA 4X66J 2R7WA 3BB5A 1HQUA 2RB7A 3NCQA 4LMZA 1RHQB 5C25B 1R8AA 3GV7B 4Y34A 3RU0A 4ICLA 2UXBJ 4DV1J 1K73T 2AZ1A 1KKHA 4RW9A 3O1LA 3HLUA 3C6TB 4WE1B 1FT8A 3QO9B 3RB6A 3O6QA 2ASLA 3RBXA 3AXKA 5IC4B 2E9RX 3D9BA 3LGNA 4NCGB 4OYIA 2D1CA 5T14A 2ZWOA 4C8YA 4F04B 1P1LA 5LMUF 3E3XA 4AD6A 4Y00A 3R8YA 4M5NA 1S0OA 1U6BA 4JP8A 5F8MA 2YNGA 1VRTB 3QT7A 2DHHA 2CPFA 1F9FA 1S1XB 2YKNA 3GZ7A 3L09A 2DHGA 1YJ7A 2ZWPA 3QT8A 3QYYA 3TVYA 3VHQA 3CJ2A 3M8PA 4IOCQ 3GFYA 4YN3B 2BQRA 3ISND 3G87A 2W01A 3AQPA 4QWEA 4FNHA 5DM7Q 1KNZA 3UNYA 4M5LA 2ASJA 2ADCA 3DRYA 2VPXB 5DGBA 3T1AA 3GJRB 2ZHBA 4PRFA 2BE2B 2LQ9A 3A3PB 1RWMB 3DLKA 4KKOA 4LBHA 2DIVA 1P1TA 4BWJA 1ACMB 2H9ZA 2LYVA 1TKTB 3OFGA 4IFVB 4N77A 4PAAA 4RJVA 4A46A 5LMUJ 1SJ3P 1HD0A 1S9GB 2AKWB 2V4QA 2WTFA 1WTFA 2Y8YA 4WP8A 4DPTA 2A0FB 1TU0B 2IDLA 3HZEA 1ICEB 1S6QB 4OHWA 4DN9A 1RACB 4ED2A 4BDPA 1ZPVA 3DRPA 4ETXA 1BHNA 1LOUA 2MQQA 2F9JA 1DY3A 3SV3A 2RH3A 3AB2B 3KJFB 2Y8WA 2HHSA 3Q8YA 2MXYA 3Q24A 1FNMA 2UZAA 2ZOFA 4DHVA 2ZJRQ 2FHKA 1R31A 1YQHA 2YVSA 3DOKA 3KWMA 4KFBA 4ZS6A 5JXSA 4EI2A 3CCUS 3TAQA 4FYYB 4BC9A 4B3RF 4E8UA 4NPOA 4EMDA 4JV5J 2FJDB 3ZO7A 3VGVA 2KZMA 1Q78A 5F41A 1HPZA 2HS0A 5GAGI 4OI6A 3CD7A 3M6XA 1ZAVA 2DNZA 2G2YA 2QL7B 3FC9A 4OLOA 5T7LA 2XY5A 1RT4A 1QJHA 4LVOP 2MQOA 1T05B 2EWHA 2NXEA 1WDTA 1DARA 3ENQA 3M2UA 4HT5A 5IOLA 3UFCX 1KHVA 3N5BA 1S1UA 3NEKA 4Q7AA 1RABB 3RB3A 2VDIA 3LW5C 1YZ7A 3AFGA 4URQU 3MAHA 4IDKA 1LWCB 3NWGA 3CCMS 2AW0A 2Z56B 3W7BA 3Q8SB 3MTKA 1RCXB 2C42A 1U1PA 1R7IA 1XR7A 2RJZA 4ZVQB 3LF0A 4OX9J 1KONA 4CDIA 5B0BA 3CDEA 1I94F 3MD3A 5CAAA 1FNOA 2B3TB 2MZJA 2GAGC 1JXEA 3M30B 4J9UE 4LSZB 2RU3A 2RS2A 2KB2A 1UEUA 5DJBA 1VBZA 4X65F 1PJ7A 2DR9A 4K4WA 5F8JA 4KY3A 2JEJA 1NK8A 3GR1A 4ID5B 4FPRA 2BE7D 4C0BA 1APSA 1QSYA 4RW8A 2LP4A 3LP2A 4TN2A 1AW0A 2XO7A 4EWTA 3MMAA 3JB9k 1HWIA 1VJQA 3UCGA 5JMNA 2NZCA 3OHAA 1UFWA 4PZVA 4CM0A 5B0DA 2FLLA 1O51A 1ELOA 1RWPB 2YNHA 1QSLA 2KFZA 4FDFA 3HHLA 4ES1A 1V3SA 3JQJA 2IC3A 2ROPA 3TZXA 4QWDA 2GJIA 3OL7A 1WHWA 4DSIA 2EKYA 2C2ZB 3RUBL 1U2FA 2M9KA 4F0HA 2IY5B 4YB7A 2FB0A 5AJ3F 4RWXA 1FDNA 1GX5A 2Z58B 2MQPA 3OL8A 1D0EA 1JNRB 3D3BJ 2KJVA 4QYRA 1UVLA 2EFPA 2UUWA 3GYNA 1UVIA 4YEAA 1S77D 1TK5A 4EUVA 2MQMA 3AH6A 4Q0BA 2NXJA 3AA9A 1RA7A 2HFOA 3QFWA 2KM8C 2IMOA 2CYYA 2HMIA 4F4YA 3G82A 4KH0B 2GHVC 3UDLA 4N47A 3QGPA 1NK5A 2LA6A 2A3JA 1BUXA 4JI1F 3GV5B 1R8HA 1S59A 1CULB 1VC0A 3T6JA 1VRTA 2VUGA 1E6YA 1YK9A 1CVJA 2BE9B 3K5OA 4OV1A 2DB1A 2RHQB 2YWEA 4USVA 2MQ8A 2DCLA 3BSAA 3O3LA 1TV6A 3BPDA 3D6TB 3CEDA 3N0VA 1MLAA 1GXTA 3IP0A 4QU7A 2KDOA 4DL2A 3J81U 1RYSA 1KTQA 3CWJA 4R8UB 3JSRA 1NH8A 3HFZB 3OFFA 3EM1A 3FSXA 2UVRA 5KFEA 2FHMA 5ETSA 1Q5YA 5K14B 4ZJQA 1Q82T 4USJC 4UOFA 3IBFB 4G6VB 1PJ5A 3GWCA 4O3OA 2V6AA 3E8OA 3S6EA 3S7RA 4FYWB 4ZJLA 4ZLPA 3R1LA 4B9SA 4PWDA 2VC0A 5CQGA 4LF7J 2LXUA 3P5BP 3BF4A 3MPUB 1ZTTA 2DR5A 1DLOA 3X3UA 4RZRA 4IUFA 2V63A 2KU7A 2F65A 4ICLB 2OPQB 5BR8J 2B9WA 2EVZA 3G82B 3T19A 4CO2A 1GFWB 1KS2A 2QT7A 3GFXA 3QIPB 4DV4J 2DISA 3EVWA 4U96A 4C97A 1QY7A 4DV6F 4FBUA 3QGIA 3DRSA 2XS7A 4HHUA 5KG0A 1RLCL 2Q3PA 2ILZA 1FEEA 1M1HA 1R8PA 2CFXA 2RRNA 4KGVB 3QSYB 1I3OB 1U1OA 1NDPA 3C14B 1WG4A 4ECTA 5GAEU 4DZDA 2NCKL 1Y0HA 1CJVB 2HQFA 3BR8A 4KPCA 3TW0A 1V3ZA 2HAFA 5HL7Q 3G4SS 4DV2F 4YR2A 1NKBA 1B0VA 3KDNA 2J7WA 2MSSA 4OHZA 1S6UA 3UPFA 1TV6B 3V81B 1OPIA 1PGZA 1T3NA 1F6TA 2OPQA 4L72B 1WDDA 4HEA9 2MKKA 3MM8B 1KOHA 1D8ZA 1JMTA 2KH9A 4DL7A 4B3TJ 1OYEA 1J5EJ 2B4PA 2I5JB 1WJ9A 2CVEA 4A8XA 2FC9A 2KO1A 4HTJA 4HI1A 3K2YA 3VR1A 4TKTA 4P71A 2ZJPQ 1KVJA 5IT4A 1AXQA 1SV5B 3SV4A 1QLNA 1VQ7S 6FD1A 1RBAA 4CNYA 3BBFA 4RW6B 3UVJB 4O3SA 3TX0A 4Z7YA 2K1RB 3BH6B 2F9DA 5GMDA 4NWBA 4ZK7M 1EX8A 3MCSA 1FF2A 3GMGA 3TX8A 1X4BA 1TUWA 4NLXA 4C8KA 1X4DA 1SVDA 2N82B 1IJFB 2X3DA 1CJVA 3TQ1A 3D1QA 4ES3A 4MK7A 4NZ0A 4ED4A 1EIYB 3KJQB 1VR6A 1UVKA 2WOMB 3K7RA 3CIZA 4YR3A 4WYWA 4K4YA 3MMJA 2R7OA 2ZD1B 3ILOA 1U1KA 3BBBA 1SC6A 5J1EB 2GW8A 4LFBJ 3NMRA 4X62F 2DNYA 1V9OA 4ZVHA 1JKHA 2W7OA 4JYAJ 1URRA 1FRJA 2CADA 1RT3A 2O1PA 3CE8A 3E51A 1N5YA 2ZDOA 1TL7A 5H9EJ 1HR0F 3CT9A 4IO9Q 1EP4A 2EK1A 2YKOA 3HHLB 1JLCA 1MROB 4NMLA 1TZ0A 4G3IA 2QLXA 3ADAC 1XMQF 3M9NB 3MR7A 3J81j 2LECA 3VAMA 3VZHA 1RT6A 1C0TB 4B3OB 2QRRA 4PWDB 2V8GA 3TJAA 2D74B 4MFBA 3X1LB 1U0SA 2BANB 3MFIA 2KFNA 2DITA 4LF8J 1R6VA 3MUTP 1Q8KA 3PHEA 4P2FA 4TLQA 3CCJS 3PJWA 3DLJA 2C2MB 4OZ1A 4ENOA 5JVGQ 1BQNB 1C0UB 3P49B 2C3UA 2EFVA 1FKPA 2G0CA 3NOCA 4MYUA 1U09A 4QBUA 2ZNYA 3WIVA 4JB8B 3GE9A 3LOUA 2E1RA 2U2FA 4DUZJ 1X7VA 4HACB 4PKDB 3CCZA 2KRBA 3NAHA 4DL0C 4Y2AA 3FJ2A 3PRBA 4NCAA 4HHJA 1NO8A 2F7VA 2GGPA 1GAOA 1RAHB 1GTHA 2PE8A 2R4FA 2RAQA 3AT1B 4N41A 3NP5A 4B9UA 3D28A 3GG0A 5I3QA 2XYHB 2IHR1 5F8GA 2M52A 1IBLF 5HQMA 1SC4B 1VCTA 1B0PA 3SCJE 5J2QB 1LEOA 1HW8A 4OYOA 5HVGA 1N0VC 2EC2A 1H72C 2KJWA 4KE5A 4QZVB 4C0HA 2VPWB 3JYTB 1CPZA 4DR5J 3PRVA 1EETB 3MZIA 1U1LA 3MPWA 5J2QA 3PKMA 2OAUA 4A8SA 4HACA 2BR0A 4GVBB 1LW2A 4ZJOA 3JSYA 2YWKA 2VG6B 2VBWA 4FPIA 2A6MA 3QWPA 1NKCA 2QEXS 2EC0A 2YQ0A 1RZMA 1NKEA 4ZCIA 3KTQA 3R5CA 5GADU 1NB7A 5KOXA 2VFTA 3HSDA 4O4GB 3QO9A 1WF1A 4JV0A 1CJKB 4M5MA 2HQGA 1QTNB 4P72A 4ZP8A 2XCPA 2MLXA 2GA7A 2HFSA 2FC8A 3CDWA 3DOLA 3KNGA 3NS5A 3R5BA 2HRYA 2AZ3A 2M2BA 3R6LB 4DOZA 3KMQA 3KJNB 5JUMA 2YWFA 3BS9A 1FI4A 1T0TV 2KKHA 2AGQA 2JRSA 1TKTA 1T95A 2AU0A 4X4SA 4RU2A 1JKHB 1BGXT 2M0GB 2HZVA 3I96A 2CKWA 4C8MA 1T9UA 2DO4A 3CCRS 1U1NA 1LK5A 1WACA 2ZD1A 1MROA 3A13A 3W64A 1YJVA 3KLHB 4WU3A 4ZVSB 4M1KA 5A8RA 4UTGA 1XERA 3CO0P 3CCQS 1DZ5A 2VOOA 5JVHQ 4KHPF 3ET6B 3HM9A 2CPJA 2EFGA 2DNOA 2MSTA 3D68A 4U67Q 2WVDA 4PQUB 5KT4A 2AEMA 4V19X 2VONA 4MAKA 1HNVB 3PIPQ 1U1QA 5LSOA 4JI4F 4NXMJ 1K9MT 3NS7B 3RRHA 1QAXA 4NXMF 2B51A 4DPUA 4P75A 4CTAA 2MZSA 1R8BA 2MMYA 3FFIB 2UVVA 5KFTA 2JZ5A 3BQ2A 2WZ1A 2CDQA 4ZP6A 2K7JA 1WHXA 4P7VA 4MK8A 1N6QB 4DV7J 1Z2ZA 4R0EA 2M8DB 3QZ7A 3H25A 3VGSA 3V81A 2ACMA 1NMEB 3FKBA 1ZAXA 2DY9A 2VKZG 3Q8VA 4IYQA 5E7OB 1S48A 3DLEB 3J80U 3J7A1 1RAIB 2ALYB 3OL6A 1LQ9A 2P9EA 4CO5A 5C2GA 3R2CJ 2XWXA 3M6WA 4ER8A 1TK8A 1HIYA 3EX7B 2CPZA 2MYFA 4A8FA 1HNWJ 3BGLA 1WNEA 4PXBA 1M90T 3UR3C 2I6WA 4U7CA 3M8YA 1RADB 3ZZUA 4U8YA 1S4EA 1FXDA 1SJRA 1H98A 5THWA 1QTMA 2Y1JA 2JLGA 5F8NA 2FY1A 2CWXA 5HANA 1B4SA 3CJ3A 5AE1A 1HBOB 2IM2A 3PFEA 1QDUB 3SDEB 2O66A 2AD9A 2AX1A 3MMCA 3JAMU 3CJ5A 4CYUA 4X4RA 2XLKA 2OEMA 5KG4A 4JV5F 2PEHA 2J0SD 2RILA 2OJ3A 1VJWA 3RGIA 1XNQF 1TUGB 2G1HA 3TYTA 3PIOQ 1CBKA 2DEJA 2FQQB 2VKRA 1YITS 4F4XA 4NYZA 3HFVA 3DLBA 3FK4A 4F4ZA 2X51A 2YXLA 3LH2S 4H4MA 4OX7A 1X31C 1N52B 5HN0A 1F2HA 3A4TA 2GQ2A 3CSKA 4QWAA 1R3NA 4O23A 1Y5LB 3UO0A 1NJXA 2MKJA 2AJFE 3SEOA 1H38A 3D1HA 4PWWA 4WK1A 3R27A 5KG5A 1D9AA 2WB4A 1JK9B 2HAIA 3W8PA 3WX4A 2RKIB 1X4CA 4TQRA 4G1QB 3KK2A 1RBLA 1VRUB 1U2CA 2B43A 2OMLA 5SZTA 3OUYB 1BWVA 5ETQA 1R6YA 2GFFA 4JI1J 3DYAB 2HNDB 2Z2ZA 4OI1A 5LXRA 2C28A 4DXLA 3MCMA 3V6DB 3DGPA 3C6UB 2JEGA 4EBCA 4GRSA 4L3NA 4P52A 4P9SA 4DUYJ 2W7AA 2ZKTA 1NJIT 1RHMB 4CH7A 2CPXA 3W9HA 2BMBA 2HFUA 2BM0A 4TLRA 4TY9A 4YS2A 2KM8B 2LFVA 2FPHX 1BQXA 3GYXB 2XM3A 3H5UA 1A7GE 4N8OA 3CNQP 5EX0A 3W5XA 4K2JA 5IM0B 1YDLA 3OXFA 4QPTA 1VQSA 1JLGA 2EK6A 2MHEA 4MMOA 5C42A 2DPIA 4N76A 5L1KA 4AFFA 2NPFA 2Y9HA 1ZZNA 5B0CA 1VIOA 1HBNA 2XI2A 3V2UC 5G0RA 3HVTB 2C2EA 3GV8B 3NCPA 2RD5C 1GMWD 1RT2A 2RQ4A 5KT5A 3EZUA 2DNPA 3IG1B 2O3DA 4RR5A 1T9XA 4WBFA 3PYEA 3KMSA 2WSCC 1RTZA 2J0WA 2W8KA 4NMXA 3CJKA 5KT3A 4ZMMA 1X8DA 3D0GE 4J9QA 1IKWA 1UA0A 1S5ZA 1ZBTA 4ID5A 2MGZA 3VZIA 3UD3P 2CQ4A 3MWBA 4DLEA 1PG5B 2F4FA 4GO5X 4NX9A 2PI4A 2WBRA 5D0RA 2VA3A 4UY8T 5FJ4A 3VQTA 2CAJA 1VOMA 3MM6A 4DCPB 2CQ3A 3MCOA 1TKDA 1X9WA 4MKYA 4AL5A 2VF3A 2QA4S 1AT1B 3A8IA 5LMNF 3LP2B 3PFOA 2AEFA 4I1TA 4M63A 4DFMA 3QLHB 5L1IA 3RBEA 1SL2A 5C2CA 2ZUGA 3DN9A 3HVRA 1L3TA 2CQCA 4LFCJ 3HT0A 4ZVUB 4J9VA 4NA3A 5FIIA 3MMBA 2E5GA 3SQGA 3UD5A 5CCLA 3OTOJ 1N48A 1K0VA 1GQEA 3MM7A 1RT1B 4NI2A 1OO0B 2LVWA 5D6GA 1F0XA 1U8WA 4Y2CA 1Y4ZB 3IM8A 2M70A 2BKNA 1DQAA 4PG4A 4WFAQ 4MK9A 4O0IA 3VAFA 2ZHAA 1NK9A 2PC6A 2VQFF 2W25A 3RB4A 3V6HA 2GC8A 2WVCA 1RHRB 1BQNA 3NGRA 4I7FA 4LF5J 3PJXA 4FVMA 4LSLB 1MN7A 1NLKL 4LR8A 1PYSB 1RAJA 2AQ4A 3B6BA 3IBWA 3ITHB 4G65A 1XC9A 1RWVB 2JOQA 5FLXU 1RGVA 2V2KA 3IG1A 4J5OA 3W63A 4DL5A 4DR6F 4B3RJ 1VS3A 2BVZA 1BXNA 4DV5F 4A8YA 5E3AA 3IRXB 5M2PA 2MKSA 1RT4B 3W2VA 2MZTA 2EFOA 4USWA 1Q81T 1PCAA 1NPKA 1N32F 2CJQA 3FBEA 3BYRA 1JLAA 4RW7A 4HI2A 2E1AA 4RL1A 1DURA 1V5IB 2GQQA 1VQMS 3R5DA 1XBWA 2A18A 1GK8A 2KVIA 2V8HA 3CJTA 3DU6A 3MM5A 3QQCD 5D4OA 2KRRA 3VQSA 4XIUA 3N6MA 3M8ZA 1NAQA 3AQOA 2QA4G 4CO0A 4LF1A 2QA1A 4IFVA
chains in the Genus database with same CATH topology
4MH8A 4O3PA 3H4BA 1JWWA 3OFEA 2P5VA 1HNXF 3HT3A 1S1WB 2OSQA 3MM7B 3V4MA 2J6UA 4K4UA 3NRBA 1X5TA 1TP7A 1RTJB 1XK8A 2NS1B 3SFUA 1V6HA 1MNEA 1HWJA 4LIWA 1A9NB 3K59A 1ZZFA 2Z2MA 4YY3F 2N3OA 2CVIA 1QE1B 3CCLS 3T5JA 3RBDA 1WG1A 5HMZA 3C46A 3PEHA 4WKRA 4IR1A 3DCAA 2HS3A 3I5AA 2LQJA 4NYPA 5I42A 1UETA 4ERDA 1HMVB 4ZVFA 2KG1A 1F5BA 2XMMA 2R2SA 3NKYA 4QQBA 5HLFB 1VLYA 3MR5A 3DXBA 5J1PA 1M5VC 4N5SA 2OD6A 4ZDNA 1WI8A 3TA2A 3DC2A 3HXMA 1UFLA 2CPEA 1TKXA 2ZH1A 7FDRA 2I2YA 1YWXA 1LXNA 2WAQD 1RYRA 2OPRA 5IQQA 1X4GA 5BJRA 2J76E 2RRAA 5HBMA 1KLMB 4RNMA 4FBTA 2F4VF 2W9CB 5D77A 3ZZOA 2AGOA 1WHYA 2XG8A 4DPOA 2UVWA 4NCBA 3GQCA 3OSPA 5K14A 1JX4A 3EUNA 1FJEB 4Q8FA 2I1RA 2ZZNA 2ROEA 4MIBA 1KQKA 4QWCA 1HBMB 1X4EA 3US5A 3CVKA 1U47A 3CTRA 4IKAA 1S1TB 2L3MA 2MHNA 5A8WA 5KG7A 4DFPA 2PT0A 1KLMA 1ZOTA 3VAGA 5EUHA 1S6PA 2OPRB 1S10A 2K3KA 2YNFA 4FF1A 1UP1A 5LSLA 1MWYA 4K2XA 3D54A 3ICLA 4KO0A 1FJCA 5DQHA 4Y2KA 1YRTA 3ZZPA 1S99A 4JUZA 4F25A 2VFRA 2FIUA 2RNEA 3K5MA 4Q0BB 3M32B 3GSDA 2D9OA 2ZE2A 1HARA 4DV4F 3BO3A 2QE5A 4ZHRB 5E41A 2GIRA 4R5PB 1QAYA 4KR0B 2R9LA 2ZFHA 3PW0A 2HVHA 5J2NA 2WCXA 4LVNP 2HHTA 2RIJA 2XLJA 4J9RA 4FS2A 2CQ0A 4OZLA 1HA1A 3OLAA 2E1MC 4C9DA 3GG1A 2VG7B 4WFXA 3EXYA 1TL5A 1DTTA 5KFVA 4URGA 4ZPTR 5H1SV 3I0RB 3MGJA 4BBYA 2JC0A 5L39A 2L41A 3LWMA 3M9OB 1M5KC 3PY8A 4EEYA 1B7FA 3NBPA 3POTA 2EBEA 3U1LA 3D5MA 4I68A 2ZC3A 1QSSA 4N76A 2KT5A 2NYIA 2CQ1A 1ZM9A 1X5SA 5U47A 1UA1A 2R2RA 4H54A 4ALZA 3TUIC 3M30A 2ZNZA 4IQMA 1I6JA 2B4OA 3OBIA 4DSFA 2UUCF 1FDBA 2ZH8A 1HL6A 2HIQA 4ED1A 1WEXA 2V9KA 5GAHI 2FD2A 4UOCA 4OX9F 3CF5Q 2M5YA 3N79A 3T9ZA 3EPIA 2ZJQQ 2P9CA 1U6ZA 2CQHA 5AXNA 1L5UA 1JLQB 1REVB 3CDAA 5DETA 1XR5A 1S1VB 4KQZA 1J5EF 2JSXA 2SXLA 4IFYB 2ZH2A 2LA4A 3EGNA 1F5CA 2V8DA 3FVYA 3OR2A 4NLRA 5IFMA 4U6PA 3W2VB 3QJLA 4ZVEA 1GH8A 1K1SA 4CH1A 5HP1A 1YG0A 3M8SA 2HNYB 1K8AT 3FZ2A 3E01A 1D1UA 4PR6A 1U45A 3MR3A 3MOJB 2HNYA 1L3VA 1TL4A 3DLHA 3PW7A 3GB0A 1FCAA 4DBQA 3A8EA 3R3TA 1VQNS 3KG4A 1S1VA 4DR1F 1O0PA 1MMDA 4K4TA 4B08A 2DNRA 2WBMA 3U1MA 2JEIA 4TY8A 4AL7A 3G6ES 2DGTA 2UXDF 3RZAA 2A1BA 5BYSA 1FRLA 3SXLA 4O44A 1MU2B 2BE2A 2RRBA 3RW6A 3M32A 4KKOB 4X4QA 2RQMA 2WW8A 3S1TA 1XEZA 1VFJA 5CD4H 3KKFA 2VPYB 5A8KA 5B0FA 3N9UC 3LPYA 3G6XA 3PW2A 4YOEA 3KHGA 5KT6A 2CPIA 3CIMA 4J9OA 5KFRA 2ZITA 3TNVA 1SUQA 1TKZA 2ZOMA 4WCEQ 3HHDA 4LUBA 1HQEB 3UW1A 2YKPA 4DLGA 2MGZB 2ALZA 1UMJA 3K8VA 1XMOF 1D9FA 1VBYA 3RAMA 3KHRA 5IWAF 4Y65A 2ZH7A 1WEYA 3POTB 3UQSA 3M8RA 3N6LA 1H3DA 1VK3A 3V4IA 4Y0FA 4MFBB 2A10A 2COLA 5A0YA 2BACA 5HBMB 3THPA 1SIZA 2HFZA 3OFHA 1RT6B 4B3OA 2DGXA 4NLQA 2YWGA 1C1BB 3M8QA 3HDSA 3ZZZA 2DNGA 2LDYA 1QVGR 4X4UA 4OFZA 4DSEA 4I56A 5KFZA 2CPDA 1O8BA 4RUCA 1HHTP 2BV3A 5GAEI 3K5PA 5L1LA 3KLGB 3NS6A 1W25A 2J5AA 4ZP7A 5CXTA 2HW3A 3PKYA 1IKYA 1G2EA 1R8CA 2R7VA 2ERRA 4IRCA 3MTJA 5I42B 2AJ0A 1IXKA 4W90B 1NNDA 4HTIA 4GO7X 5KFHA 3S01A 2QSWA 4I0WA 5IS2A 1VRUA 4GKJF 4DG1B 2H5EA 2CQIA 4A8WA 2IA0A 4ZPVR 2XY7A 1Y3KA 2XNRA 3UDCA 2UUBF 3H4DA 4IOBA 1HW9A 4ILLA 1TKXB 3L3CA 4OL8A 3B82A 3MM9A 3T5LA 3M4XA 3SDEA 4DL6A 3LP1A 3Q2SC 4I2PA 1CEZA 1FERA 3RRKA 3SSSA 3D1OA 3U27A 4PQUA 3PRDA 2UU9F 2CZ4A 1RKJA 2QV6A 4AQYF 2ZDPA 3I5BA 5I4MA 3H5XA 4ED7A 4XDDA 3OPKA 2PIIA 1BC6A 3FQKA 1YRUA 4WF9Q 1SI9A 2EFNA 4C4WA 1FDAA 3LP1B 1XWLA 2HZCA 1NRKA 5KFMA 4NZ6A 2R8IA 1CLFA 1FA0A 3OQ2A 5E5NA 2HGNA 1C4CA 4OI3A 3T9NA 1N54B 3FFIA 1OPZA 1X0PA 3EYZA 1LV5A 3V4IB 2X1GA 2BXJA 2XS2A 3DRXA 3DNCA 4XPEA 1HNVA 4K4XA 3JSMA 1N6QA 2YKAA 4OJ3A 4LSLA 4J9KA 1P8GA 3D0IE 4HL9A 4TYBA 4HH1A 2C3MA 2C3PA 5EWGA 1DQ9A 2FUG9 3VAHA 3OR1B 1U49A 4IRKA 3UCZP 3PW4A 1FJGF 2IM1A 4WTYA 2IA6A 5C24A 4OX8A 5AXMA 1H6KX 3QGHA 5LT5A 3IN5A 2VG5B 2BDPA 1TK0A 2EI5A 2CPYA 5B0EA 4P6QA 5KFCA 1JLAB 4LSNA 2YKMA 2PMZD 5C5JA 5CYJA 2M8HA 3MECA 5F3TA 1ZTWA 3UR0A 4PG6A 5D4LA 4I4BA 3DMJA 4LT6A 4CO3A 3JAMY 5KFBA 4UY85 2RU9A 1TQLA 2OPPB 3MM6B 3OHBA 1N0UA 5L38A 2HQ3A 5I3UA 4NLVA 2KYXA 4AUKA 2R7QA 4KSEB 1J5OB 2VPZB 5A6WA 4LFBF 4HYKA 1MWZA 2IYIA 2DGOA 4PUOA 3B4MA 3OJUA 3Q0AA 2Z8QA 1G3OA 3IWNC 1Q7YT 5ITHA 3EPGA 3HHEA 1XTZA 3HVTA 4X4VA 3NMAA 1NJZA 4YB6A 1H2UX 4A8OA 1JLGB 3ZZ0A 4M95A 4LSNB 1TR0A 3ITHA 2M7SA 1GTEA 2YKMB 2OTJS 4CCHA 1UW4A 4LF7F 4C11A 4QW8A 1K1QA 3MUVP 2PO4A 1N5SA 1Y7PA 1DHMA 3FGVA 4ZCKA 5F9NA 4YMEA 2M3DA 2HLTA 1RJJA 2VODA 2JLFA 1IBKF 5L9XA 2UXCF 1S97A 1P27B 4K4SA 1LWCA 1QUPA 4KAIA 4X4OA 3PR5B 3JSMB 3F56A 4FXWA 3GFZA 3WBZA 3SSRA 2G13A 5KAKA 1G1XA 2GV1A 4FS1A 3SZ2A 3H5SA 3MPYA 5HO4A 1VQLS 1R27B 5F8IA 1T8EA 3MM8A 3QWUA 3CC2S 5C25A 2BANA 4OQJA 2HQIA 4I69A 1KVIA 3I0RA 2XMTA 4ECSA 3DOMA 4LIRA 3KK1B 3J7YU 2MY8A 3Q8RB 3D2WA 1YRXA 1G6BA 4ECVA 3BREA 2YNIB 5B09A 1NK0A 2B7BB 3H8YA 4A47A 3BSNA 4DR2F 3SI8A 1U2RA 1IR0A 4F26A 3DRPB 2R7SA 4OMFG 5LJ5Y 3BN4A 3MECB 2FJWA 1C2PA 4F50A 2K1RA 4QW9A 1NK6A 3NNCA 5GADI 1YBAA 3TVKA 4RBVA 3J7ZT 2D7SA 2XEXA 4C3MA 4ZCMA 1U1RA 1AROP 4DQQA 2MJUA 2QLWA 1N8RT 2XWYA 2IJNA 1UWBB 2W9BA 1BY9A 3RR8A 3DDNA 5J2PA 3D0HE 1W2BR 1U26A 2DNHA 1LWEB 4M5DA 3CPWR 4JI5F 3O2IA 5K5MA 2DIUA 2YNFB 4K4VA 3FRZA 1LW0A 3IR6B 3HHLD 4QCLA 1BD6A 3VALA 2C2DA 2PGCA 3T6BA 4GMKA 4F4KA 3KJVB 2ZHOA 4KPYA 2YX4A 3HX9A 3UI3A 1Q53A 3OVBA 1ZYQA 1OWXA 4QYZJ 2JEFA 1Y9OA 5E3QA 2IFXA 1FHTA 3DHXA 2OMOA 3LP0A 5MAOA 1TL3A 2FLOA 4ECRA 2ZH5A 3HO1A 4RBUA 4H4MB 1O5JA 3DM2A 4IQXA 1Z1ZA 5KFSA 4GC6A 1DTQB 2UUAF 4Q44A 5DG7A 3LAKA 2KI2A 2BRLA 4QWBA 2HHPA 1FRIA 2HFNA 2IRUA 3BGFA 4QOTA 3U1NA 4ZKAA 3SYZA 2JX2A 3P6YC 2KN4A 4OZ5A 2X3GA 4ECQA 2XMKA 4LF8F 1S4FA 3HVWA 1OSCA 4TXSA 2PA8D 2DH7A 1NJWA 2R8HA 4EBEA 2NUUG 3IR7B 3W2WB 2EG2A 4TQSA 2IC3B 2DCUB 1H7WA 1LWFA 2Z4PA 3TAMB 1SUQB 2VB6A 1PC4A 1U6FA 4ID8A 4UUWA 5AE3A 1HHSA 1FRMA 4KV8B 2LEPA 2QIFA 2HHVA 3N01A 4MIWA 3IWLA 3C2PA 4W92B 4OHYA 1YJNS 2J9DA 1N34F 2BM1A 2CJ9A 2CRLA 3FRYA 4AE5A 4NYOA 4M94A 3PNIA 4E0DA 1FRKA 5KFWA 4N56A 4MKAA 2K8GA 1U25A 2CQGA 3OTCA 4RW4B 2HHQA 2R2TA 4QR1A 2JVRA 4ES2A 3KLGA 1D9DA 2GMJA 2B9XA 3OXGA 5KTQA 3LANA 2MKCA 1ZH5A 3GIIA 5LSRA 4KGKA 3H2LA 2GO9A 5A8RB 3J7YI 1JLBB 1I1GA 2B6AB 3MURP 2VBZA 2O67A 1C0UA 5K8OA 3CDBA 4JYAF 5D3GA 5M2RA 2BBEA 3TUJC 3MXHP 4OZNA 3ZFVA 2DT9A 3VWSA 1HPZB 2I9SA 3HKWA 4OZ0A 4IH5A 3DXSX 5DRKA 3LALA 1N36F 1VQ5S 5KFDA 1RTHB 3BGRA 4ZPBA 2MPUA 5HP1B 1IUJA 3MEEA 4LF6F 4RLEA 2F3JA 2B6AA 4CO1A 3MD1A 4ITSA 4OI2A 3I55S 2CPHA 3IC1A 2Z2LA 3ZZYA 3FMBA 4IDKB 3I9ZA 2XLIA 4A48A 1DJ0A 4DJBA 1S0VA 2LLZA 5DGAA 3CCWA 4OJHA 1H2VZ 1VQ8S 1SH3A 2EFQA 1RA6A 3MEEB 5DM6Q 2AV5A 4DUZF 2KXFA 3M2VB 5J2QA 2V4RA 1RTHA 3BGRB 4DV1F 3J81Y 4B02A 3T5HA 4ZCLA 3TUZC 2VV5A 1WWHA 3NBPB 4H4OB 3MPVA 5EX3A 2ATLA 1Q79A 2FVPA 3N28A 2FGCA 3CB4A 4HH0A 1LKZA 4U9RA 1IBMF 2B9YA 5HMYA 2W4CA 4GKKF 5KFGA 2B7CB 3OSNA 4QIFA 1FTCA 4ILMA 4WK3A 3TAMA 1RDRA 4A8MP 1RP5A 4AXJA 3OV7A 4DSJA 6FDRA 3KLVA 1IM4A 1QUVA 3PR4A 1VBXA 2XNQA 4CT8A 4CZCA 4YP3A 2CJBA 4C8LA 4HLBA 5A6PA 4KIAA 1FK9B 5KFIA 1HYSA 5F8HA 1TUVA 2FGOA 3THTA 3M2RA 4QPXA 4DS4A 2RDIA 2HS4A 2C3OA 4FP9A 2RE1A 3VAKA 3V6DA 1H0HB 2CG4A 4B3MF 5FD1A 5KG3A 4HT7A 3HJFA 3N5FA 2IM0A 3LP0B 3T3FA 3MHYA 4IG3A 2N4CA 2W9AA 2VFVA 4DWIA 2WSFC 4K4ZA 2VG5A 1ZM3A 4QIEA 1S6P