3E8OA

Crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
b'TMVISHGTLSASAEHAAHLRQLLVHIAQATRQEDGCLLYLVSEDLSQPGHFLITEHWDNLGAMHTHLALPGVTQAIDALKHLNVTDLKITAYEAGEAINIMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_295823.1) from DEINOCOCCUS RADIODURANS at 1.40 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 26
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e8oA00
5B08A 1YJVA 3MZIA 1WD6A 1P8GA 1S6OA 1CPZA 2GV1A 4ZOSA 4EFAC 3HFKA 3LGMA 2LDIA 3TNVA 3HHLD 2EW9A 2XMTA 2HLUA 4HI2A 4FNIA 2OP5A 1Q8BA 1JK9B 2KT2A 2XMUA 1KVJA 5B0GA 3UDCA 1KVIA 1KQKA 2AJ1A 1Q8LA 1VQYA 2GCFA 3LO3A 2IYGA 1AW0A 1X7VA 1IUJA 2VV5A 3F44A 2AP6A 2AW0A 2ROPA 2BYCA 4Y2IA 2HQIA 2AJ0A 3DCAA 4OIXA 2XMVA 4A47A 1YJUA 2CRLA 4NPOA 2W4PA 3TRGA 4A48A 1TZ0A 3KG1A 5K9FA 2K7JA 1TL4A 2N4CA 4HI1A 1FESA 2JDJA 2XMKA 1Y3KA 5A6PA 2RSQA 1APSA 2L3MA 1SB6A 2QLWA 3BM7A 1K0VA 1SQEA 2Q3PA 2RMLA 3KKFA 2LXFA 3IWLA 5T7LB 2ACYA 2HIQA 4F67A 2N4DA 2OD4A 1S6UA 2LQ9A 3BB5A 2ASYA 2K1RA 4DPOA 3FRYA 5F0WA 1ULRA 2RILA 2ROGA 4HH1A 5B0DA 3I9ZA 5IXUA 1TL5A 3HDSA 3BGUA 1TUVA 2KYZA 1Q53A 4FNHA 3GZ7A 1FVQA 1U7LA 2QIFA 2K1RB 2XMWA 3BN7A 1N5QA 2PD1A 3HHLA 1OPZA 2HLTA 2QYCA 2BBEA 1QUPA 1W2IA 3BR8A 1MWZA 2XMJA 1XBWA 1FE4A 5A6WA 2FTRA 1N5SA 1FD8A 3KNGA 4OJ1A 4Q2LA 1URRA 5T7LA 3HHLB 1JWWA 3TOQA 1N5TA 2PGCA 4A46A 3BDEA 1P6TA 2N7YA 2FB0A 3DXSX 3HHLC 4ZA1A 5F0UA 5B0AA 3CJKB 2OAUA 2QLXA 1OQ6A 2LQBA 1YJTA 1YRXA 1FE0A 1Y3JA 2OMOA 1GXTA 3WDOA 2IFXA 5B0CA 3IWXA 1AFJA 3KG0A 1VQSA 3BF4A 2W4CA 4NL5A 1V3ZA 1YG0A 2BJDA 2OD6A 4DL0C 3QMQA 2OFHX 3HF5A 1YJRA 1AFIA 1FEEA 2RU9A 1MWYA 2GO8A 5B0FA 1N5VA 2FHMA 2G9OA 2K2PA 3VTIA 1OQ3A 1Y9OA 5KAKA 2XMMA 4QOTA 3FMBA 1FVSA 2VH7A 5B0EA 2OFGX 3CJKA 1R6YA 2FIUA 3E8OA 1LQ9A 1Q4RA 2GGPA 2KKHA 5B0BA 2KT3A 2ROEA 2ZDPA 3T9NA 1Y0HA 1GXUA 4U9RA 4HH0A 1OSDA 4Y2MA 2W4DA 4Q2MA 1CC8A 4Y2KA 3FGVA 3MCSA 2IYIA 2GGPB 1X0PA 4YDXA 1TR0A 4A4JA 2GFFA 3QGPA 2ZDOA 2OKQA 4OJ3A 4DN9A 2HFOA 4OJHA 2BUNA 5B09A 2GA7A 1RJJA 4HL9A 1SI9A 2BJEA 4OJGA 1X8DA 3HX9A 2HFNA 3K7RA 1CC7A 2K7KA 4YEAA 3LGNA
chains in the Genus database with same CATH superfamily
2AYMA 2OTLS 3KLIB 1K1SA 2NPFA 4F50A 1BQNB 3OTBA 2CNKB 2J7KA 2ALYB 4OHYA 1G6BA 2KXHA 5LXYA 3RBXA 4WCEQ 4DR7J 1M5OC 4HI1A 4HVZA 3S7RA 3QWUA 3NMRA 3CCSS 1KQFB 3I87A 3V6DA 2XO6A 1Y5IB 5B0DA 2YKAA 3OPKA 4LQ3A 4J9UE 4JV1A 3MMBB 3CUNA 1GMUA 2FHOB 3Q8QB 5HANA 2DNZA 1BXNA 3ADAC 1HD1A 2CFXA 4ZVQB 4PXEA 4YP3A 3KOAA 1Y10A 1H0HB 3IM8A 2VFUA 2LQBA 4WXOA 4OX9F 4L72B 5IC6B 5HJXA 4NWBA 1YI2S 3JTNA 1IKWB 4O44A 4U8YA 5G4DA 1WHWA 3GLJA 2IAJA 1XMQJ 3T5KA 1GNKA 3OLBA 3V2UC 1UEKA 3R9LA 2SXLA 4LSNB 1W25A 2NPIA 3HLUA 1FXDA 2RAQA 4ZVUB 2ZM6F 5L1JA 3I4HX 1LW0B 3NY0A 3T1AA 2A6OA 2CQ1A 4WFZA 2KFZA 3SV3A 2FHKA 1AUDA 3M8QB 3G6YA 2GMJA 4FYYB 4LFCJ 5KG0A 4CLTA 1LXJA 5T7LB 2DGOA 4QU6A 4HT5A 3FCVA 1HW9A 3PKYA 4XK8C 4NZ7A 2MKKA 3CJRA 4WXWA 2MQOA 3AXMA 1PYTA 3DGVA 2MZSA 3QT5A 2KH9A 1BWVA 3NG8A 4PZVA 1J5OB 1NPRA 2OGUA 4ANCA 2QLXA 2CPHA 1NK8A 2WW8A 2F1FA 2WONB 2F65A 2FLPA 2E5IA 5HMWA 5J2NA 3FMBA 1Y5LB 1R27B 2OFGX 4MIWA 3NCQA 2RQCA 3A1YG 1R8CA 1R0BG 1T94A 3PX4A 2IBKA 1Q79A 2DK2A 1EP4B 2HHWA 2H54B 3AD7C 2M0GB 3K5LA 4QIEA 3VAHA 2NXJA 3I4PA 2F4FA 1A0OB 2D3ZA 2QO3A 4RW4A 1XR6A 5A76A 5HQ8A 2KI2A 1IWAA 1HA1A 4A48A 4TNOA 1BQMA 2IBOA 3PW7A 2J9DA 3JYTA 4HACA 4KGMA 2W7AA 1YX2A 2CUYA 2J0QD 3G9CA 3W5XA 1U7LA 4B3TJ 4P52A 3C16A 1RCOB 1XBWA 2CPXA 4FXVA 4FVMA 3FMWA 2J76E 3GJRB 4RW9A 3W2VA 3JXOA 3IWXA 4PWWA 5F8LA 3OFGA 3UNYA 1RBOB 2QFIA 2KU7A 2LXIA 4F26A 2UUWA 4DG1B 3H5SA 4RJVA 1FNOA 3QWPA 2HBZB 4CTAA 1K9MT 3DI6A 4LBHA 1PGZA 5HBMA 1S5ZA 3PV8A 2MKHA 3GV7B 2K06A 5K8OA 6FDRA 2BJEA 1X8DA 1QTNB 3DMJB 4EFAC 1ZAWA 3POTB 3NBPA 3GU0A 5ETLA 3VGTA 4DLGA 3K5OA 2BYCA 5K14B 3UD3P 1HBOA 3GB0A 3PYEA 3MR3A 1X9WA 2VUGA 3MAAB 2VJUA 1X5OA 3GTYX 2RNEA 3MM8A 4GKJF 3M8RA 1S6PA 1WF0A 3PG9A 2R8GA 4QYRA 4WFNQ 4R0JA 5FJ4A 4KE5A 2GW8A 1WC6A 5F8JA 5CZXA 1IBMJ 4A8KA 2OSRA 1SUQA 5JVGQ 3T1HJ 2JJ4D 2LMIA 1SVDA 4ZP6A 3MM5A 2YXLA 3CJ2A 3VVUA 1VQSA 2FLNA 3KLFB 5IZHA 3OL8A 1FEHA 3G82A 5A8WA 5ETSA 2VFRA 2ZJQQ 1JJ2R 1YJWS 1IBLJ 4K50A 5DRKA 3TZYA 4U9RA 3BPSP 5DGBA 2A2CA 4TLQA 1X4BA 1UFWA 4DQRA 1RKIA 2WVEA 5B08A 2XI2A 3FCWA 3CVKA 3PJ9A 1VC6A 1UFLA 1AZSA 3R5DA 3HFZB 1ROFA 1Q8LA 1Y4ZB 2OTJS 4P74A 2BJ9A 4HLBA 1PO6A 2DVIA 5DQIA 4J9RA 4G3IA 2LXFA 2NZCA 4ILRA 2W9CB 3D68A 2D3UA 1TKZA 2XYPB 5EWEA 4A8YA 3D7SB 4P71A 2GNKA 4F8RA 3LP0B 1FJGF 1QAJA 2M9KA 3M8WA 1U2FA 3M32B 4D3HA 2QMXA 5GMDA 5DQGA 2PI4A 1VLOA 4FS2A 4YFUA 1FA0A 1QM9A 3KK3B 3T1YJ 1F3VA 4DUYJ 1KC8T 2LQ8A 2PA8D 4AYBD 2MSTA 4EI2A 3BQ1A 4DPXA 2C2ZB 1JJCB 2AKWB 4QR2A 1LW2A 1KVKA 3I32A 3K89A 5F8IA 1HMVA 3CCJS 1CC8A 4LF6F 5L39A 1HWKA 1IJFB 1YRTA 3L3CA 4DEZA 1DTTA 1ZBTA 5CH7B 3NGTA 1UW4A 4KHRA 5ETKA 4I64A 1FXRA 5GADI 3LO3A 1MU2B 3UCZP 3C8YA 2W2OP 1YJUA 2V2KA 4ECVA 3CE8A 2M7SA 3M2VB 1LFWA 8RUCA 3MWBA 2ASYA 3OT9A 3MEGA 1NDKA 1Q53A 2NXUA 4IG3A 3DC2A 1RT2A 1N34J 1N5SA 2MLYA 4LRBA 3GIIA 4ED1A 4DQSA 1SKRA 3IP0A 3U1MA 1CJUB 4LRCA 5KT4A 4Y3CA 2HVIA 1LWCA 3W64A 2IM0A 3U1NA 2U1AA 2XNQA 4UQGA 3C2PA 4UQTA 1DTQA 1XC9A 3EGZA 3FRZA 1K0TA 4IDKA 2UUCF 1HHQA 3DOLA 1TKTA 3RB6A 1OSDA 3SIPB 2X7IA 3W3SA 3CC4S 3QGPA 1EQMA 2HFOA 4RL1A 1ZA1B 3OBIA 3B78A 2FZKB 4IRKA 2LEAA 4C8OA 3HHLD 4CLKA 1Q8BA 2MSSA 4C4WA 2XCAA 5F8MA 1K47A 4KGKA 3GE9A 1T03A 2XMKA 4LFAJ 2IM1A 3SQOP 4RBVA 2Y1IA 1CS4B 4CLSA 3WIUA 1HWIA 1VQ7S 1Q8IA 4K4WA 4O3QA 2V9WA 3UR3C 3TQEA 4B9NA 3CWJA 2KT5A 4WU2A 1N5TA 2B7CB 2PEBA 2I2YA 1F9HA 3D1QA 3QJLA 4DFPA 5JMNA 2VZ9A 1Y3JA 2X51A 1E6YA 4ZJLA 1S79A 4QIVA 2IY5B 4CT8A 4PAAA 4RO0A 4E98A 2X1BA 2ZHAA 4K4XA 2XY5A 5KFPA 4P2MA 3LQVA 1S1WA 5JVHQ 5DDOC 1D9FA 2D9PA 3AJ2A 3UI3A 3LF0A 4QCLA 1QDUB 1S99A 2VB6A 2WOMA 2CADA 5EHHA 4WFAQ 1N5YA 2FVRA 1RHJB 4LRAA 4ZVPB 4I7FA 1TUGB 4KH0B 4LF7J 1S0VA 3IMQJ 3DLKB 2WVDA 2ZH1A 3R27A 4O0IA 1SB6A 2W8KA 1G7CB 4I68A 3JAMU 5F0WA 4CYUB 5KFGA 1OPIA 4URGA 2GIFA 4K8RA 4X2BA 4YHHJ 1X9MA 4LIWA 4IOBA 2HMIB 5D4LA 4OFZA 1FKAF 1S1UB 3DRSB 1XNQF 1FKOB 4RBTA 4J9NA 3CSKA 2V2QA 3KJFB 3AD8C 2IC3B 1FEEA 3I0SB 4OX7A 3DOKA 1EZZB 3CCRS 2ZH7A 2FLLA 4KTQA 3C6UB 1FRMA 5D15A 4U6PA 1VRUA 3MDFA 1WWHA 4R5PA 3FUYA 4MK9A 4ELTA 2RF2A 2B9XA 1OY9A 1QE1B 3CDUA 2GQQA 3DGPA 1VBZA 2C2RA 3SFGA 3KK1B 2GQ2A 4P6QA 4YR0A 1KN6A 3GMGA 3H5XA 3P96A 2AF6A 3ZZTA 5J1EA 4NA3A 4X64F 2ILYA 1NK5A 2YNIA 4MK8A 1WEZA 3D3BJ 1IR1A 3HSDA 5FDLB 2MYFA 1RAJA 2XS5A 2G4BA 2LU2A 2DH8A 3OHAA 5IXUA 1SV5A 3GPAA 4CLLA 1VGYA 4AL7A 3AY0A 3KUHA 3HKZD 1TAUA 4PG4A 3BR8A 5KFLA 4A8QA 4WP8A 1K44A 4I67A 2VG5A 2OD6A 4C98A 2MPUA 3GWCA 3SSRA 3LW5C 1TMJA 1VR6A 4FYDA 1RWVB 1U2RA 3PNIA 4CO4A 4L73A 2HFUA 2ZVSA 4KGZB 2HKEA 1QUVA 2OKQA 2DRBA 4PXCA 2J6SA 1BMQB 2HLUA 1PAUB 4QIWD 1O5JA 2R8JA 1BLUA 3IS9A 3KLVA 1ZAXA 5L1KA 3T9ZA 3MR2A 4FVCA 4UW2A 3KLIA 4DX8H 4C0OC 5GAHI 2LYVA 1BQNA 3LPEA 2UVRA 1FT8A 3G71S 1IM4A 1QAYA 1JLEB 4NZ6A 4P73A 4QU7A 3I9ZA 4RU9A 2QIFA 3HHLA 1DURA 1ACMB 3M8YA 1P6TA 1UETA 2E29A 2AJ4A 2J9CA 1BHNA 3MMBA 4ZCIA 4DV2J 3CXCR 2R7RA 4U96A 3OL6A 3W7BA 2BKOA 2CQ0A 1RLDA 4Y28C 4CO3A 4GC6A 4GKKF 5B0BA 2W2MP 2ZDPA 2YQ1A 1IKWA 3G8QA 1FD2A 2FC9A 1FHTA 5L38A 5FD1A 5J2PB 5KFDA 4X4VA 3P4UB 4P2FA 3LGHA 2MLZA 2O1PA 4LSNA 1KVJA 5IT0A 2B9WA 3CDWA 1EX8A 1TVRB 3HFVA 3T6JA 1D9DA 2DGUA 1HBMB 3C66A 2X3DA 3KK2B 1PG5B 3Q89A 1T9WA 4WBFA 4ED7A 3M8QA 4KT0C 1TUVA 4J9OA 3OD2A 2DRDA 4ELUA 1I3OB 4EGLA 1RYRA 5T7LA 4C7QA 2UUTA 1XN9A 3RGIA 1A7GE 1X4FA 2A6MA 3CJKB 3Q8PB 3TVKA 1KLMA 3PYDA 2ZHBA 5DG7A 2R7SA 3QJPA 3LP1B 2J7UA 2R42A 1F2HA 5DG8A 4ZVTB 2B5JA 1JXLA 1KP6A 1X4DA 4IYQA 4DR6J 4K4UA 3ILOA 1FFSB 3SEOA 4PWUA 2WONA 4PXDA 4Y65A 1RWWB 3JQKA 1WHVA 2R7UA 1RB0A 4X62F 3KLGB 1DY3A 1YRUA 2GAHC 3H20A 4NCGB 4ZLPA 1M1GA 4LT6A 2LDIA 2AYEA 4ZMMA 3L09A 4PPZA 1X7VA 2CVEA 1HR0F 3G4SS 4ECZA 2D3OR 1T05B 3Q8YA 3TRGA 2F9DA 2RVJA 2OPRB 3CJQA 4OV6A 4H4MA 4NXMJ 1S4FA 3OUYA 4W92B 1NSPA 3DHWC 3IA0A 3TAMB 4OYWA 2FC8A 3A4TA 2BBEA 2W9BA 3HJFA 1J2VA 2L08A 1NK4A 2HK3A 2HQCA 2KVQE 4DPUA 3H98A 4XDCA 2MKCA 4N41A 2CG4A 2QC3A 2EFGA 3ONQA 4RNHA 4Q45A 2MHEA 3CB4A 2HHPA 1NAQA 4NCAA 2IYIA 3EVWA 1HNZF 2JOQA 2QA1A 2AGQA 3F56A 1AXQA 4ZPDA 4CWBA 5C24A 2H5EA 4KIAA 3BKFA 5D4OA 2GV1A 4UZBA 3SMZA 4I6AA 2CVIA 2H9ZA 3M1VB 3DLEA 1IKXB 2D9OA 4QWCA 3IRWP 2R9LA 2MTLA 4W4MA 1HNWF 3POTA 3QLHB 4JI5F 2V2VA 3PHEA 1FK9A 4HT7A 4ANEA 3HHEA 1J27A 4J9LA 2UVWA 2B7BB 4KHMA 3ZO7A 1MWQA 3LH2S 3IRXB 4EBEA 5D3GB 1OPZA 3MAAA 5F8HA 1JWWA 3MEDB 1NHVA 4PUOB 2G2YA 2W1BA 4WU3A 5IWAJ 2VQFJ 3TI0A 1MSWD 1YG0A 3PZPA 1KD1T 1S49A 1NK7A 1SPBP 4TYAA 3VTIA 4QIFA 2HFSA 3I82A 2ZBCA 1PYOB 3HSZA 3BO4A 1IKYB 2V34A 1SH2A 5CXTA 1U1QA 4ZPBA 3LUYA 3A8JA 1NH7A 2G0CA 3O6QA 1WOPA 2V4JB 2H4WB 1SIWB 1RDRA 1CC7A 2LVWA 5HO4A 1VQ4S 3OVSA 4OX8A 2GS8A 4NRUA 5E3AA 2AJQA 4FKYA 3Q2SC 3JSRA 1JLQB 3BGLA 1WG5A 2BE2A 3NS7B 2JDJA 2C2MB 1UCNA 3UN2A 3G6XA 3HHNB 2UP1A 2QMWA 5E33A 4U67Q 3BBFA 2CWXA 4ED8A 2W9CA 1TKXB 1C4CA 3MM7B 2KG0A 1GXTA 3LAKA 1MW7A 3VAJA 5A0YB 2EFOA 2DGQA 3LP0A 2GC8A 3M32A 1D09B 4ZS6A 1XQIA 2HZAA 4FBUA 1WG1A 1TTHB 5K8MA 3ZZRA 2PO4A 2IHR1 3KK3A 1D3WA 3BSAA 5KFXA 4RBUA 4C8KA 5KFNA 2UV8A 4FYVB 3ZTOA 1VCTA 3LP2B 2LCWA 1ZPWX 3R6GB 2OEMA 1HYSA 3KLHA 1KTQA 3E3XA 2KT2A 2R8KA 1RZMA 2HQDA 3IGNA 3T5LA 1FXLA 1NHUA 3NCRA 3CMES 3KHGA 4O4GB 1JQGA 1IN0A 1FWLA 4NYOA 2V94A 2JZ5A 1JLGB 4E0DA 1FFWB 4USWA 1UPPA 2Z2YB 1YSJA 1MU2A 2DNHA 2K1RA 4AD6A 4FNHA 4DR7F 3OVAA 1R7IA 3FKBA 3H59A 3M2VA 3NOGA 5EWFA 3C15A 1KEKA 2R7XA 4I6YA 2H5IB 2HQFA 1WC4A 3G6VA 4X65J 2IA6A 3PCOB 4P9SA 3D67A 2BE9B 2Z57B 1QJHA 5KFBA 2VBXA 2P9CA 2WK4A 3GYXB 4ECYA 5B0FA 4CLFA 4GVBB 1VLYA 3U27A 5HATA 2IMWP 4F04B 4DS4A 3OR1B 2GX8A 5HK4A 3VAGA 1X0PA 1HW8A 2W9AA 2LA4A 2BXJA 2DO4A 3UVJA 1XMQF 3KJQB 1UEUA 3NGSA 2P6SA 3HP6A 4OHZA 4Q7AA 4OI4A 1RI7A 2R2UA 1RT4A 4F2RA 1RT1B 2DRAA 4CH1A 3GIMA 1M5VC 1PKUA 2XMTA 5T41A 1D9AA 1ELOA 4YN3B 1VQYA 2G0JA 4M1KA 5KT2A 4CDIA 2R7WA 2J6UA 2Y8WA 2DXFA 3BGRA 5KFWA 3GONA 2ABYA 1I6JA 1AT1B 3DRYA 5AE3A 5MLCV 1ZM3A 4LFCF 2AT1B 2HGNA 1H73A 1HHSA 3QATA 4F4YA 2PD1A 2R2RA 4DCOB 4RU2A 4WFBQ 4MFBB 2GVDB 4CM2A 3VQTA 1CS4A 4NLYA 2NSBA 3E01B 2GAGC 2IRXA 4KKOA 2U2FA 2KM8B 4LF5J 4Q43A 2DCUB 2HNYB 1S9GB 3AH6A 2BOPA 2VU5A 3DNCA 1FVSA 2VH7A 3FBCA 4IQMA 1U26A 1T3OA 1T3NA 4C8MA 5F8NA 1B7FA 3CO9A 4TU7A 4GKJJ 5GMEA 1ZM2A 2YWKA 3ILIA 3UQSA 3QSYB 4B02A 4BHQA 4NRTA 3UDVA 1T7PA 4I69A 2RDJA 3PRDA 3TNVA 1V6HA 3M05A 2F40A 4RKUC 1D8ZA 2V68A 4CO5A 2XS2A 3RAMA 1JMTA 2DO0A 1RT3B 3N5BA 1RWMB 2PEHA 4DSLA 2YQ3A 5IV3A 3PM9A 3OHBA 3Q83A 4B3MJ 1VIOA 5KFJA 3VCDA 1QUPA 3ENWA 4MKVA 2HURA 3IN5A 2DT9A 2ZVIA 4FYXB 4NLQA 3HHLC 1B0TA 4LBIA 2C1EB 4B3TF 2H65B 3TUPA 4C3KA 3CJ4A 4YS2A 3J81j 1WDTA 3DDIA 1N6QB 4GMKA 1R43A 3BV8A 4UTGA 2XLIA 1K8AT 1MNEA 3RUBL 2IC3A 4DU7A 2JLFA 3I0SA 1Q86T 1VJQA 4ZPAA 1OWXA 2ZC4A 4GO7X 5A8RB 1F2GA 3C14A 3HVRA 4C8YA 4DZDA 4ED5A 4F0KA 2DHAA 1QE1A 3QBCA 1RHRB 1C0TB 1IUJA 1WC3A 4IQXA 4J7CA 4CNZA 5K9FA 3KK1A 2XZDB 3RG6A 2AJFE 4KPCA 2W7OA 2JRSA 4WP3A 2NYHA 5KFSA 2BR0A 1REGX 4O3OA 1X4EA 2KHCA 3M4XA 4LR8A 2V67A 1NJXA 1F0XA 2LA6A 3OR2B 2XI3A 1WTBA 3OQ2A 1FWKA 4PYDA 3JQMA 1VHFA 1W26A 4W90B 2UUAJ 1TL1B 1IBMF 3T1HF 1U2CA 1S0MA 2G1DA 5JUMA 4AFFA 3VAFA 4HH0A 1X4CA 4YB7A 2WZ1A 1YBUA 2F8MA 4WE1B 3RRKA 1IBLF 2KN4A 3M2RB 3F0NA 4DV0J 1SJ4P 2LEPA 2RB7A 3HFKA 2UXBJ 2QL9B 2YH0A 5IC4B 4NX9A 3D54A 2AIRB 4WK3A 4EUVA 1VK3A 2BRLA 2FGOA 3H7HB 2MKJA 1JLAB 1TL7B 2XQCA 5K8PA 2CG8A 2RHSB 1VQLS 5E41A 3SFUA 1PC5A 4OJ1A 1JLEA 3I5CA 1OIAA 2EFVA 1F5BA 1GMWD 5KFOA 4DXLA 2B6AA 4GC7A 1QVFR 4CM0A 1F5CA 3FC9A 1YJRA 2DD8S 1U25A 2XHWA 2ZOGA 3EE3A 3ELHA 1MROA 2L9WA 2UVUA 2E5LJ 1R6YA 2XY6A 4FPIA 4Y2KA 4WKRA 2CQIA 4DUYF 4YDXA 3CIMA 3RW7A 2GQCA 1NK0A 1PJ6A 3K57A 2DPJA 5BJRA 1JNZB 2HNZB 4NLSA 2CDRB 4MH8A 3W8GA 1VQOS 3H2LA 1F1BB 2VONA 1WKLA 5HL7Q 2F8HA 3MCOA 3TZXA 1JK9B 3DLHA 2IRUA 2LLZA 2CPYA 2AJ0A 4PCQA 4J9QA 2GJ2A 2QX0A 2PIIA 3T3FA 1KOHA 2XM3A 1KQGB 2FJEB 4Z37A 2LQ9A 4YB1P 1P27B 5LL6d 1TL5A 3GIJA 2HS4A 2C2EA 2XMWA 4Q0BB 1HBMA 2KB2A 3K5PA 4OI2A 3ET6A 4EEYA 3KK2A 1QAIA 4JI0J 4JI8J 3VAIA 3EVMA 1S6QB 1RHUB 1HBUB 1L3TA 4ETZA 2BX6A 1X5PA 4ZVFA 3IR7B 3BH7B 4USMA 1RWOB 3LP1A 3KUGA 4C8LA 3FFIB 3A12A 1RAFB 1NMEB 2IDLA 4KO0B 1FKPB 1WOSA 3B82A 2J6TA 4YR3A 3W63A 3QGHA 2RQKA 2YNGB 4QPXA 4DQPA 2IJNA 3TZWA 5FLXU 5M2UA 4ZVRB 4USVA 5KG1A 2XMUA 2Q6BA 1L3UA 2BQRA 1KBRA 1VBXA 1L3VA 3KLGA 4N7TA 3C6TB 1CJTB 4HDHA 2AGOA 1B64A 1TZ0A 2XHCA 3PYGA 4WIIA 3W8PA 3JQJA 1RHKB 1LWFA 1R3NA 3HT3A 5KG4A 3TWZA 2B3TB 5J2MA 3PRVA 1T05A 2ZHOA 4P72A 4YB6A 5K5MA 3UD4P 2OPRA 4LFAF 4C11A 5ETVA 4ZPVR 3TUIC 3VALA 2HVZA 5F0UA 3JSBA 2E7WA 3S1TA 2IVFB 1ZH5A 5E7OB 5U47A 1FTRA 5KFHA 4K5SA 3ZNJ1 1FDAA 4OI1A 1GXLA 2OPSB 4CO1A 4QYZJ 3PVXA 3M2UA 3DRXA 2FJXA 2YPYA 2VPWB 3H42A 4ED6A 5A8KB 1RAAB 2CIMA 3UPFA 2F8EX 2XYHB 5CQGA 4ZHRB 1FX2A 3CD7A 5KG3A 4MYUA 1A6LA 1C1CA 4WK1A 4ZN3A 4PPDA 2Z2ZA 2V4QA 3MPDA 3LWLA 1MN9A 3W62A 3P5TL 2D41A 3DOMB 2GMLA 4IFVB 1NHKL 3F44A 3HCXA 3PEJA 2HHSA 4GVLA 3TA2A 1SC3B 1P9QC 2DBBA 5D78A 5H9FK 4M5KA 4J9VA 2JEJA 4HEA9 4LF7F 1IQTA 1JLBB 3SCIE 3QLHA 4EK2A 2Y0SD 1YK9A 1NK6A 4HTIA 4AL6A 5C25A 4V19X 2DR8A 5C42B 5D3GA 1VOMA 4NL5A 3T41A 1ZAVA 4YHHF 3EDRB 4ECWA 3PJWA 4PUOA 1U02A 2ZH8A 5HAOA 1VMBA 3HVTB 4B3SF 1WKKA 3H4DA 1WHYA 1TV6A 4WTOB 1OYDA 3MCSA 1NM2A 2UXCJ 3CIZA 1G2EA 4RWWA 2PN6A 3R1LA 1PIEA 1UJ4A 4ED0A 1IKYA 3V4IA 2YWWA 3N5FA 4N8OA 3DXBA 4F2SA 2J7WA 2V4JA 2MQLA 4Y2IA 5I3UB 5KG5A 2ERRA 3I0RB 4ZPWR 4NXNJ 1Y3KA 5G0RB 2RSQA 1SQEA 2OLWA 2EC2A 4C8ZA 4GKKJ 2BE7D 4ZLLA 2WW4A 2Y3YA 2C3PA 4D3GA 3V4MA 3S6EA 2QYCA 5THWA 2A18A 2RRNA 4MK7A 4WFYA 1RYSA 2MLXA 5DQHA 1U0HA 2OJ3A 1UP1A 2IFXA 3TANA 1SQGA 2QE5A 3MMAB 1T9UA 1OS5A 1AB8A 2BANA 2NCKL 3AQOA 2E9TA 1NLKL 3NAHA 1RT7B 2DY9A 1Q95G 4LSLB 4F0HA 3UW1A 3ZZ0A 1C2PA 1JJ4A 1H72C 4F36A 4K4TA 4AT1B 5BR8J 3D0GE 4WWSA 3U1LA 1TFWA 3ULHA 2OHDA 3J80Y 2E1MC 3HMJG 3CJ0A 5CCMA 4KFBB 4BC7A 4G1IA 4A8SA 4QW8A 5HN0A 1IR0A 3PTWA 4B9SA 2V4RA 1FJ7A 3I9V9 2W8LA 1RXOB 2ZBPA 4JP8A 3TUJC 4DHVA 4DBQA 2HZCA 3OSPA 4J90A 4O4GA 2HVHA 2FLOA 1JLGA 1SH0A 5DM7Q 2GIQA 1RAGB 4JBCA 2D69A 3EZUA 3DRPA 2BQUA 3ISND 5KFFA 4QWEA 4DL3A 4R8UB 1L5UA 3M8SA 1S76D 4LIRA 1V5IB 2CWKA 2RKIB 4S0MA 1WHXA 3E8OA 3V6KA 4ECXA 2RDIA 5D0RA 3KYLA 5CHCB 2PDAA 4WP9A 2ZKUA 4H4OA 1I51B 2F7VA 1LEOA 2HBQB 4ZOSA 3V5RA 1JLCB 3FEXB 3MM9B 3QIPB 4B9UA 1RT1A 1S72S 2WSEC 1Q7LB 4OLOA 2RMLA 1YJNS 5L1IA 4DV5J 1U1LA 3MMJA 3GR1A 2FJBB 3N6LA 2IJFA 3F41A 2XSJB 3K8VA 2W2QP 2HEKA 4LRFA 3GV8B 3T6BA 5DZ6A 1VYAA 1NCLA 2P2CB 4X4PA 4F4XA 4DSFA 2ZE2A 1S0OA 4IO9Q 3V6JA 1YRXA 2IPOB 5C2CA 1M1HA 2FJAB 4XIUA 4MFBA 1GT8A 5BYRA 1RT6A 1RTIB 2BJ1A 4YY3J 3JB9k 5B0EA 4KY3A 4L3NA 2GGPA 3E01A 2VICA 1HBNB 1KFSA 3OXGA 4DR6F 1V9OA 3EXYA 2UU9J 3S01A 4ID5A 4N56A 2CPDA 4M5GA 2KL8A 3QT8A 5ADZA 1WD6A 2B4PA 2RJZA 3MEEA 4DF4A 2W7PA 3L4BC 2FYXA 1SJ3P 5B7WA 3TAQA 1ZYQA 2Z58B 3KMSA 3V6HA 4OHWA 3TZZA 2L3MA 3SQGB 4B9VA 3ZZYA 1U48A 3KDOA 2ROGA 3HSJA 2J9EA 1RTJB 2YX7A 3BN7A 1FDBA 3K59A 3UN3A 5CYMA 1SBRA 3G8SA 3KNGA 4NXMF 1HI0P 1RU1A 2CQ3A 2ACMA 4C97A 3K5MA 1YBTA 2DNQA 2XG8A 3OFHA 1BGXT 4WTYA 4PABA 5GAHU 2LDYA 2YNHB 1WC5A 5KAKA 5M2RA 2DR9A 1PBUA 4DSIA 2DNPA 3IG1B 3RW6A 1GXUA 1U6ZA 3QRRA 2XWXA 2E66A 2Y8YA 1N6QA 1XMOJ 2B8QA 1NH8A 1U09A 4ILLA 3Q2TC 2OEJA 3LGNA 2YKMB 3HO1A 2V69A 3G6ES 4IO1A 4N8NA 2VQEJ 3KG4A 4DV1J 2AJ1A 4ERDA 2AD9A 5A8RA 1KQSR 4MKBA 1RHQB 5DETA 3EM1A 3MPUB 2PA3A 3BM7A 4KV8B 2QV6A 3DYAA 1C0TA 2Z30B 1ZZFA 1WSRA 1M5PC 1DQ9A 2B9YA 2JNJA 4ZCLA 3R5CA 5A6WA 1S7IA 3B6BA 4ETXA 6FD1A 1T95A 4P7VA 2RQMA 4M95A 1JB0C 3UO0A 1OJ4A 4OLPA 2JX2A 1N4LA 1AFJA 3BF4A 3IXQA 2M4MA 4CT9A 4DL4A 3MURP 1N56A 3KHHA 1SL1A 1UVMA 2DGTA 2AX0A 1K1QA 3ZZZA 2A2DA 3BQ2A 5IWAF 1FJEB 4QYZK 2VQFF 2AGPA 4JV2A 4HYKA 1ZPVA 3R7BB 2AQ4A 4RW7B 1TL1A 1B4SA 3MAQA 1RWKB 4DV3J 5L9NA 4ECSA 4OJHA 5B09A 2EC0A 1DAXA 5CAAA 2CPJA 3GJSB 3NWGA 3ITHB 3GG0A 2WHOA 4NLDA 4F0MA 4ZVSB 2AW0A 3DFEA 4OX6A 3TVYA 4I2PB 4G1QB 2HHVA 5HLFA 2EKYA 4CZCA 1SC6A 5GAGU 3OTOJ 2X1GA 4NMXA 1FDDA 3MCMA 2EFNA 3AB2B 2PFFB 3A3PB 2HHUA 3D0IE 2R2TA 1JLAA 1S7HA 5FIIA 3SV4A 1N52B 1TL7A 3TP2A 2RDDA 1HQ2A 4TY8B 4FKXA 1R89A 5LXRA 3NGDA 3FJ2A 3EJMA 3NWRA 3BSOA 1CLFA 2WTFA 1HPZB 3SI8A 3BO2A 1LQ9A 2FDNA 3IO1A 2DXEA 3EPIA 1XEZA 3FEZA 4FZVA 1LFPA 2W01A 1Z2LA 2ZH9A 3AODA 4DV4F 4ZP9A 4ECQA 1N54B 1I1GA 2C3OA 4OZ1A 3VAMA 2KG1A 2EXUA 4MYTA 2YNFA 1LK7A 4OL8A 3SBMA 3RU0A 3KNAA 1VS3A 4H4KC 5CD4A 1APSA 4IFYB 2KFNA 4ITSA 5C7PA 2EI5A 2VF3A 1VQKS 5ETTA 3TUZC 2DB1A 3V6DB 2CNLB 4K0KJ 2VIHA 1VQPS 1NKEA 2PGCA 3K0JA 3FNNA 3OXLA 4DX7A 4Q0BA 2JHEA 1P1TA 2OEKA 4IOCQ 3HF5A 1HARA 3R2CJ 4ZLJA 4X65F 3N6MA 1RTHA 1HBUA 2IAJB 1HNIB 2JH3A 4ID8A 4Q2MA 4KYZA 2PT0A 3O1LA 4DUZJ 3D5MA 1N33F 1RJJA 1C0UA 2VKRA 4YDDB 3MI7X 2FHJA 3FFIA 3D1OA 1G3OA 4DJBA 3IR6B 3K17A 3AAWB 2EBEA 5HVHA 2CJQA 5EX3A 2GHWA 3CEDA 2YNGA 2G2ZA 1TL4A 4NLGA 1XTZA 5DZ7A 1BE4A 4F67A 5KFKA 2G0IA 4ALZA 2CKWA 4Y0FA 3H5YA 3CDEA 3LPYA 3C6TA 3W61A 1CJTA 4UOFA 2AZ3A 3NS5A 2IA0A 2V50A 1IQZA 1S57A 2RUGA 3EICA 2QA2A 2CXEA 3ZZPA 4DPTA 3EGWB 2L41A 3L7UA 1BC6A 2FVQA 1XK8A 1GFWB 2HNDA 2QMUB 2CJXB 5KFTA 4PQUB 5IT9Y 4ZVHA 2YX1A 5J2NB 1LWEB 1FWPA 1RU2A 3AOAA 2HRYA 3B4DA 4LF5F 2ZZNA 2VPXB 3OLAA 2W2PP 4BLGA 1NDPA 1KNZA 1GH8A 2RU3A 4ZLNA 1UVLA 3PO5A 4HR2A 3ZFVA 2QZ8A 2FJDB 1PILA 2OPQA 4X84A 4RW4B 4RW6A 2H5JB 3X1LB 3RR7A 4M5NA 4OIXA 2DEIA 3D6HB 3R5JB 4Q5VA 2X1AA 3DOMA 3PW4A 1YVFA 4ZKAA 1UA0A 4IFVA 1KHVA 1BQMB 3BB5A 2CA9A 1NB7A 4IG0B 4JB8B 1M90T 2EBGA 2DH9A 2N3OA 2J0SD 4NCBA 3DRRB 2QLFB 4A8WA 4MKAA 1RAEB 3MUVP 3H40A 4KQZA 3MR5A 4B3MF 4QQBA 1Y11A 4RW9B 3OL9A 1UA1A 4TVAB 1J5EJ 3CD0A 2MHNA 3BJYA 2EK1A 1HFEL 5C42A 3UD5A 4KAIA 3BDPA 4CTAB 1B70B 1RK8A 1S1XB 1NSQA 3HVTA 1CJKB 5C5JA 4WYLA 1NUEA 4K2XA 2AU0A 3TYTA 2WB1D 2OUGA 4ER8A 3P3DA 1KR4A 2AP6A 2ROPA 2WVFA 3RTVA 4X66J 5AT1B 3RAQA 5A6PA 2DHGA 4I4BA 1HBOB 3O5TB 2D7SA 3CMAS 1RADB 1U24A 2N82B 2QLBB 2B4OA 5I3UA 5SUHA 2EVZA 1S6PB 2AHOB 5G0RA 5L8RC 4Z7YA 4UUXA 4RR5A 1SJFA 1I94F 3GCXP 4LQ9A 3ZZOA 5B0CA 1EJ7L 5IT4A 3MM5B 2Q1LA 3QFWA 2MQQA 4FF4A 4EBDA 3Q8RB 1NJIT 2V8VA 1B0VA 2F9JA 1GX5A 2JWNA 4NMLA 3AQPA 1AUSL 3GIKA 1NKCA 2FGCA 4P7TA 3MMAA 4JV5J 4Y6IA 5A8WB 5ETOA 2BOAA 1T9TA 3WIVA 3CCWA 1RT7A 3N28A 2UUAF 1T9VA 1Q81T 2XTJP 2YKNB 1FF2A 2OELA 3I6PA 4X4OA 4B3RJ 2ZITA 3HI9A 3L7PA 3CCLS 4HL9A 5CABA 1O0PA 5HQLA 3TR5A 3M9NB 1EKRA 3R8YA 4ELVA 2DY1A 2G13A 2W25A 2CJKA 1TKDA 2O01C 2IVMA 4NA1A 3GJQB 4NEYA 2ZJRQ 4NI2A 2Z4PA 1AZSB 1PCAA 4DV0F 4A47A 1SQFA 1H74A 3RB4A 2B8PA 5CA5A 2UXBF 3WBZA 2WB4A 4ED3A 3B54A 3NP5A 1XR7A 4ES1A 2WAQD 1JXVA 2CNNB 4WJBA 3TJAA 1TKZB 1CULA 2LXUA 3MOJB 2D1CA 4NEZA 4ZP7A 4M5DB 3RZAA 5F3TA 3AB4B 1YZ7A 1HQEB 3ZTPA 2MJNA 2RRAA 1S9FA 5CCLA 5L9XA 1MN7A 4ZVOB 4RZRA 1PSDA 3JS9A 4R8UA 1TR0A 1R0AA 4UZCA 3KUEA 3AFGA 2ZDOA 1O8BA 3QRQA 2E5LF 2RKIA 5LJ3Y 4L76A 4TYBA 4YEAA 2BQ3A 2E1CA 2MJUA 2RD5C 5AXLA 1BUXA 2ZKTA 3R1HA 1RWXB 3PW5A 1N0UA 2ZZMA 5KT7A 4AXJA 1DHMA 1CJVA 2KRBA 2NUUG 3DU6A 1JLCA 3BSCA 3THVA 1SJRA 3P5BP 1DFDA 5I42B 3CPWR 3HKWA 4NZ0A 2HHQA 3HDSA 2HSEB 2CQHA 3D0HE 1H2TZ 2L9DA 2AEMA 3BGFA 3NGUA 3MEGB 3NLCA 4C48A 1VQ5S 1HI1A 1WKJA 2XY7A 2N7YA 3CDAA 5DM6Q 3BSNA 1RT2B 4AQYJ 2PE8A 2V63A 2V8DA 2WRMA 3Q8SB 4UUWA 3I96A 2V0NA 4JI0F 2HW3A 3UCUP 1VRTB 4JI8F 3K58A 1T02A 5HROA 3N4WA 3CCZA 1C1BA 4OZJA 4ILMA 4NA2A 2IMOA 4IDKB 2BKNA 2JC0A 4LRDA 1TKTB 2MY8A 5SZTA 2HYIB 4NLRA 4JI3J 2EFQA 3FSYA 4CLWA 3LAMA 2VG7B 4KHPJ 4HKQA 3FZ2A 1HBNA 2X3GA 4L6V3 4L74A 3ISNC 4C9DA 4DSKA 2DXDA 1O51A 3D2WA 4I2QA 3Q0AA 3I55S 2HFZA 1U1KA 3HPOA 4B3SJ 4JYAF 4RWXA 1TL3B 2DNKA 2NYIA 3N79A 3SQGA 2J5AA 7AT1B 1JXEA 4F3MA 3NRBA 2I0XA 4RX6A 1RTJA 3M6UA 4NOHA 4J9PA 3QAEA 2Z56B 2OPPB 1LWXA 2BJ8A 4O3SA 4ZIWA 4FDFA 3T9NA 4U7UK 3CDBA 1G4CA 2P6TA 2HRUA 4TLRA 5LJ5Y 1S1WB 2YNHA 2ZBQA 2XNRA 3KWMA 3IG1A 2ZZTA 2WOMB 1T9XA 1NRKA 4XPCA 3LGMA 1N5YB 1F60B 1RTDB 2C2OB 3QO9A 1S1TA 4I7FB 1OO0B 3J7ZT 2LEBA 3WQPA 2XGQA 2YKMA 2OIHA 2N4CA 1BY9A 4JI2J 1ZTWA 3DDNA 2ATLA 2Q3PA 4AL5A 1RT5A 3PR5B 2VPYB 2DGVA 4DCPB 1OY6A 2ZH6A 4JI1J 2FPHX 2RE1A 3LALA 1N32J 5H9EJ 4KV8A 2AX1A 1S9EA 4I0WA 4Y34A 2E1RA 3IC1A 1RP5A 1QSLA 2XB2D 1IM6A 4RUBA 1MWYA 1RAIB 3EGVA 3GFZA 3MR7A 3NXZA 5D0HA 4N47A 2BJ7A 4IKAA 1P9YA 1HD0A 2QSWA 3TJ9A 2JEFA 3GR0A 3QYYA 3MFIA 2VG6B 1MMNA 2HGLA 3DOKB 3PW0A 1AYEA 2VFTA 1RBAA 3SYZA 2XS7A 3ZTRA 3NEKA 4DL5A 4TU8A 2RF2B 4FPRA 1JIHA 4RW7A 3M8PB 3HD1A 3TVZA 2UXCF 2OP5A 3FVYA 2QRRA 2CJBA 5B0GA 3TX0A 2XMAA 2CYYA 4C8NA 5KFUA 2KRRA 2AEFA 2ZH5A 3PW2A 2A1BA 3FCHA 1WEYA 2DNRA 1YKWA 2N4DA 4EO6A 4KJIA 3EZOA 4HHJA 3ETOA 4G1QA 4OMFG 3DLBA 4O4RA 1YTYA 1NZAA 4NXNF 1RWUA 2DNNA 3MD1A 1LV5A 2FTRA 2VASA 1HIYA 3D66A 3DKDA 3OVBA 5K8NA 4CH0S 2VOPA 2JSXA 3FSXA 1UEVA 5AXMA 1EARA 1B3TA 2VG5B 1RQ0A 2JFKA 2FIUA 3SCJE 4RNOA 2V8PA 3ZTSA 5CYQB 4J9MA 1Z4UA 2KJVA 4RPFA 4JUZA 1R8BA 1UKUA 4ZCKA 1HPZA 3FK4A 1LW0A 5AE2A 3KXDA 4OJGA 2F4VJ 2K7KA 4LVOP 3F73A 5BR8F 4NE9C 1TP7A 1CQMA 5D6GA 1HQUB 4DUTA 3IBFB 2LP4A 3I56S 2VHGA 5J1PA 1KTVA 2E5GA 1U45A 4MKYA 2ZOFA 4H54A 2VBYA 5F9NA 1FO1A 4OQJA 3U7JA 1J5OA 4IFYA 1T0TV 3NGKA 4FF2A 4ZDNA 3HHLB 5KT6A 3GFHA 3DXSX 1T11A 3PEHA 3P8BB 2LECA 1EETB 5GAGI 4KGVB 2PMZD 4UOCA 3JAMY 4ICLB 1EP4A 1NPPA 1RABB 2YQ0A 4IH7A 1GTHA 1IBKJ 2P8IA 4B08A 2XC9A 1XERA 2XYGB 3IWNC 4QJVA 1ZM9A 1UTAA 1TK8A 2YKPA 2DGWA 1DLOB 2BKPA 1HNIA 5EN1A 2PFDA 3MUTP 4FNIA 2J8AA 2XLKA 3C3LA 1VI7A 2VC0A 2DR7A 3DCAA 2JFDA 1VHIA 2CRLA 4NPOA 4DR1J 2K7JA 3M7VA 3OJSA 1UW9A 5HQMA 3RB0A 4U7CA 1X9SA 3RBEA 4LSZB 3PKMA 1L3SA 1IR2A 5IOLA 3FBEA 5D77A 1ULRA 4F4WA 4XAKA 2I1RA 3MECB 5C2GA 3GG1A 1R8AA 4DV5F 3EUNA 4HTJA 3EXCX 3ZXWA 2NLWA 3LTOA 4NLTA 5MAOA 4DG1A 1KLMB 3BKTA 4F4AA 2VBWA 2B4VA 3BN4A 1Y9OA 2MY7A 2B5JB 4TQRA 3OFEA 2VA3A 1WORA 3WX4A 2HQGA 1KOOA 4RNFA 1WJ9A 4P2XA 1HL6A 3PFEA 5E2QA 2I38A 3CCES 1Z1ZA 3K8WA 3W5YA 2RS2A 3DMJA 4YY3F 4ZJOA 1VIXA 2E7XA 4PQUA 2QL5B 3TW0A 3K7RA 1LWEA 2F63A 4Q8EA 4Q44A 5K14A 1U8SA 3UDCA 2HWHA 2UU9F 1NKBA 4MAKA 3MPVA 4W98A 3LA0A 1UVKA 2ADBA 1LOUA 4ENOA 4H4MB 3D6MB 3OUYB 4MTPA 4TXSA 4FXDA 2QT7A 1JLFB 3W2WB 2MXYA 2XBPA 2MZTA 3MGJA 1VC0A 3CJTA 4IG0A 4OZLA 2WBRA 3NNHA 1E6VB 2W9BB 2VFSA 1XWLA 3CMQA 3BEGB 3KLFA 3QZ7A 3DRRA 3KHRA 2CPFA 3AJDA 4QOTA 3FZBA 5JJBA 3QFHA 4O0NA 4U7UD 5GAEU 1Y0HA 2KXFA 1UAWA 3HXMA 3BS9A 2HS0A 2GIRA 5JXSA 2VL1A 4DN9A 1GEHA 1EHWA 3CO0P 2DH7A 4M5IA 1YJVA 1CBKA 2VOOA 5C24B 1S1XA 3M6VA 3LANA 1XMOF 2VPZB 1CJKA 3OJUA 1YZ6A 3AOBA 1SJQA 2DHXA 3KG1A 1HWLA 3DLEB 3LWMA 1H3DA 2AMCB 2VQEF 1Q8KA 4DV1F 1WDDA 3H8YA 1S48A 2RILA 3UE2A 2DHHA 2ZBRA 1FK9B 1UZHA 3HM9A 3AOCA 3JSYA 1MLAA 2VBZA 1RGVA 4DV4J 4OYBA 5ITHA 2F5GA 1X5TA 5KG2A 2R7VA 2XZWA 2ZUAA 1NBEB 3HHKA 2IRYA 4M63A 2M8DB 3VGSA 4J9KA 1PJ5A 3Q8UA 1RA7A 2BRKA 2FVCA 1Q4RA 3RJMB 2KTQA 1B7YB 2ZOMA 5D0EA 3H2VE 1JJHA 2EFPA 4X4UA 2GJFA 1U49A 3SCLE 3CD6S 4R0EA 2AYBA 2MKIA 2YKNA 5ETMA 4DV3F 2XWYA 5M2PA 4DMZA 5F41A 2A10A 1NK9A 3UNGC 1MG7A 3NNAA 2FUG9 3OW2R 1FX4A 1S97A 3EPGA 3A8IA 2BM1A 1H2VZ 2BE2B 1RUSA 4DR2F 2H4YB 1S1VB 3IAM9 4BC9A 1NXIA 3CF5Q 2HFVA 1CJUA 4QBUA 5H9EK 1N33J 3OTOF 4CI0B 4ZCMA 3S8SA 2HVDA 4DQQA 2RUSA 4OHVA 1WSVA 2KVIA 1XNRJ 2NR0A 5E3RA 3W1YC 2HHHJ 3R3TA 4BDPA 2QA4G 4M5DA 1YITS 2BVZA 4O3PA 1HQEA 4PG7A 3H90A 4L75A 2KZMA 1YGYA 3VF0B 3THTA 3OTDA 2ADCA 1KVIA 2GCFA 1HYSB 3KLHB 1VC5A 2ZH4A 2FY1A 1HNVB 2QLWA 1WG4A 1QD1A 1GTEA 1RTZA 3P6YC 2ZFHA 4HH1A 5EGYA 4DLEA 1FDNA 3VZHA 2K1RB 2QEXS 1OY8A 5I42A 5DDPC 2R2SA 3M30B 2HAFA 3C15B 4Z2XA 3I31A 3WZ0A 2Y1JA 4K0KF 5HJYA 4A8MP 3ILJA 2OFHX 1DQ8A 4QW9A 2JLGA 5DG9A 4RNMA 4CLZA 1H6KX 4K4ZA 3J7YI 3VR1A 1TQLA 2Q6CA 2ROEA 3NL0A 3JSMB 1PC4A 2R4FA 3CCTA 5DO2A 2YH1A 1HI8A 1VRTA 2VFVA 4HHHA 3WC2A 2WVBA 2GA7A 2HPUA 2QG9B 5IV4A 3AD9C 2ZJPQ 3UVJB 4K5RA 3NOCA 3EGNA 2HWTA 2ASLA 4UT4A 4DUZF 1RT4B 3DLKA 5KFRA 4IR9A 5KFAA 1TK0A 2FY8A 4FF1A 3SZ2A 2VG7A 3BPDA 4PXBA 4IH5A 3R5GA 2CJYB 4CYUA 3BGRB 2JL9A 2Y9HA 2JVRA 1RLCL 1NSKL 2HMIA 1RCXB 2YWGA 4YMEA 1S1UA 3B8HA 1EQ0A 3DRSA 1MMDA 3CGIA 1FKOA 1TL3A 1NB2A 3VAKA 3MXHP 2ZH3A 2K3IA 4NLVA 5HMZA 2R7TA 5A2QU 1YQHA 2BJDA 3UN5A 3D6FB 2ZD1B 1N5VA 5DGAA 2G9OA 3C6UA 4KKOB 4DL2A 3PDNA 2UXDJ 3GV5B 2DTJA 4CO2A 3KMQA 2XSFA 3I5BA 3FQLA 4X4RA 3AHPA 2OPPA 8AT1B 4ECTA 3BREA 3O44A 5LMNJ 4BBYA 4BWJA 5LT5A 3HX9A 3GILA 3P49B 4A8FA 1SL2A 2APOA 3QPIA 3Q22A 1I94J 2N3LA 1U1RA 2J8SA 2V6AA 4I1TA 2VV5A 4USIA 1U1PA 3M8ZA 3AA9A 5FDLA 3HK2A 1VQ9S 1HKAA 1Q16B 3IWLA 1RTDA 2AEJA 2E5HA 5AJ3J 4LF9J 3TAPA 1FRIA 4HHUA 3AJ1A 3PR4A 1Q5VA 3BYRA 5KT5A 1X4GA 5BXIA 1FCAA 3GFXA 1FFGB 4DI6A 4EZ9A 3G8TA 1HNXJ 1H7WA 4ZPCA 1DBDA 3MFHA 4DR4J 1V3ZA 2RU9A 2BZ2A 1V3RA 4Y2CA 1J5EF 1N8RT 4B17A 1S12A 1U6BA 3L95X 2RRBA 3GSIA 3HZEA 1NPKA 1EB0A 2BM0A 2VG6A 2NZ4A 3R5BA 1CEZA 3HD2A 4TN2A 1FJCA 3C14B 3CD5A 1NU4A 3W9JA 2DISA 3RYLA 3TA1A 2BACA 1OSCA 4DSJA 2EG2A 3M8PA 3IFEA 4PG5A 3UR0A 3FBFA 1VFJA 3T5JA 3G86A 2PI5A 1RBLA 4OYMA 1RACB 4QR0A 4X66F 2CPZA 2LU1A 3NMAA 1TK5A 1XMBA 4P10A 2MQPA 3U02A 5I3PA 2KO1A 7FD1A 2QN6B 3UFCX 1RWPB 1SC4B 1DJ0A 1T8EA 2A0FB 1DZ5A 3CCQS 1B99A 4F7VA 2VD3A 3OTCA 1EIYB 5IM0B 5J2PA 5J2QB 4KBIA 2BUNA 5CYQA 2HFNA 4JV5F 4ZJQA 1WTFA 3L7OA 4DPYA 3OSNA 2QGFB 1TVRA 2CPEA 3VHQA 3D6TB 4B3RF 3QT7A 3MMCB 3KJVB 1BD6A 4J91A 2DIUA 1FRLA 2J0XA 4FYWB 2CZVC 4CH7A 1HQUA 1R31A 4RLEA 2AV5A 4JI4J 3BH6B 3CJKA 1TAQA 4DV7J 3BBCA 1D8YA 5L1LA 3HVWA 2BW2A 4NLUA 4EMDA 2B6AB 2VDHA 3DHXA 4LFBF 1EETA 2HQ3A 1SCJB 1RAHB 5EUHA 1S4EA 3RRHA 1MROB 1Y00A 4JYAJ 3CJ5A 3MPYA 4NCGA 4ICLA 2C28A 4OI0A 2KJWA 2Z2LA 4QIGA 1X4AA 4K4VA 3SDEB 3VVTA 1JX4A 1Y7PA 4DR5J 2IYGA 4DN0A 1DLOA 3DM2B 4DR3J 1Y5NB 2Q66A 2C3YA 3RR8A 1KONA 5AXNA 5LMUJ 3MM6B 1N88A 5HVGA 3OL7A 3TAMA 5A2QY 1QVGR 2OSQA 4UOHA 4DV6J 1Q7YT 2K3KA 3HULA 3H0PA 4K2JA 2I8EA 3M9MB 4B9TA 2DHSA 5HMYA 4G1PA 1PJ7A 3ET6B 1OQ6A 3PHTA 4JI6J 2M8HA 3MECA 2POKA 3D4JA 3J7A1 3KG0A 3C46A 1N36J 3D1HA 4AQYF 4U8VA 2KDOA 4V19J 1ZETA 2Z0GA 2XGPA 3OFFA 3ZNUA 4WZMA 5LSLA 1REVB 2ZC3A 3T19A 2ZH2A 2DEJA 2DNYA 2IDEA 3IR5B 3M1VA 4A8OA 4PG8A 2BABA 1IKXA 4LF4J 2NSCA 4JI3F 3ICLA 2MZQA 4KHPF 3M9OB 3QNWB 5HI7A 2NXEA 3VV2B 2YY3A 1XIQA 3IRXA 2UUBF 2M3DA 3FRYA 4CNYA 3MAHA 4ZVEA 3KFWX 1LWFB 1YHQS 3MEDA 5J2MB 2YKOA 1UVNA 1QY7A 5J1NA 4CLUA 4C11B 4DL6A 2GVZB 4MIBA 4ZVGA 3CJSA 1JLFA 3W2WA 3H4BA 4CO0A 1R6VA 1E6VA 3W60A 1R0CB 4PQAA 2RQ4A 3M2UB 1Q0NA 2HRTA 4EWTA 1UWBB 1ZTTA 4WYWA 4NYZA 4XDDA 1QLNA 1HWJA 4Y2AA 4OZ2A 1EAYC 4LF8J 2BJ3A 2QYGA 4FXWA 2JLEA 1C1CB 2H48B 4YUDA 2NXCA 2HBRB 1JLQA 1WACA 4YQWA 4OZ0A 4JV0A 2NUHA 1HLWA 3EZ5A 4E2FB 4IR1A 2CAJA 4PRFA 4QWDA 3KKFA 4HDGA 3MUMP 2OD4A 4LVNP 1DARA 3GYNA 3R7SB 2CQGA 2EPIA 4OZNA 4JI2F 4AE5A 1TKXA 2UZAA 3MM7A 2PMHA 1ZA2B 3TOQA 5DS7A 4RUHA 4JI1F 3M6XA 4V1Ak 5A0YA 1N32F 1X4HA 3VQSA 4FF3A 3WX8A 4B3OB 3WHIA 4OYOA 1KHWA 5C25B 2XULA 4RW8B 3UCGA 2IIHA 3OXFA 2YTCA 5HMXA 2GO9A 4LMZA 1VK8A 2KT3A 4Y2MA 1XR5A 2RH3A 2HVEA 1ZOTA 4FP9A 1TV6B 3US5A 1XJWB 2I5JB 3SSQA 3LP2A 4WIQA 3CC2S 4CLYA 3GSDA 1YIJS 4MIAA 4OYAA 3A13A 3V4IB 1VQNS 5T14A 5GVQA 4ZPTR 5GAEI 2CDQA 2MZ1A 1AA1B 3AA8A 4OYXA 2F3JA 2OH2A 2DGXA 3GYGA 3NKYA 1ITPA 4EYIB 2CQCA 2HIQA 3A8KA 4LREA 1KDNA 1SJ1A 5GMKa 1M5KC 2Z8QA 4OX9J 2EWHA 4CLPA 3FSIA 2GHPA 3Q8VA 4NLOA 2WSCC 3GQCA 4DFKA 2CQ4A 2MGZB 4KRWA 1W2IA 3TQ1A 1FE4A 4WPAA 5FLXY 3DLGB 3RBDA 3DLLQ 5HP1B 1U0HB 2QL7B 1S1VA 4NLWA 4GVBA 3CCUS 3WC0A 1U1MA 2B43A 1WC1A 5D4NA 4UY85 1AFIA 4P75A 5RUBA 2BANB 4N5SA 4JI7F 1L3KA 2W2NP 2CQBA 3OR1A 2E1AA 5ETQA 2ZM6J 3EVOA 2VODA 3TO8A 4PYAA 1RWNB 4X4SA 4DX5A 4M5MA 2UVVA 2H3EB 1M5SA 5E5NA 4ED4A 3FDSA 5EDWA 1SC1B 1VBYA 2Q79A 1GAOA 1WNEA 2NREA 4DDFA 1R8HA 2EW9A 5CYJA 3PACA 8ATCB 3D9BA 1QSSA 1Q82T 2F4VF 2DKOB 2C3UA 2XMVA 2R3VA 2HGMA 2WCXA 4ED2A 2YKQA 1S6UA 5DDRC 4BS2A 2KFYA 2GVDA 1HNVA 3E51A 1N5QA 4F02A 4C0HA 4MT1A 2DNOA 1U4BA 4DOZA 4LJMA 1VBKA 1CSJA 4OI3A 3QJJA 1QTMA 2HNYA 1S9GA 2CPIA 3QT6A 3TARA 2CZ4A 4Q8FA 3M30A 3DRPB 1TELA 1F9FA 3CULA 1WF1A 5KFVA 2AZ1A 1Z2ZA 3MR6A 4J9SA 3TA0A 1RE1B 4XTTA 3N0VA 1IBKF 3JSMA 1KWMA 3MZIA 1FRXA 2LQJA 4B9MA 3IBCB 4DWIA 4H4OB 2VDIA 3G96A 4IUFA 3R5AA 2B0GA 2B56A 4FN5A 2QFJA 5ETRA 5KFYA 2MMYA 1RT3A 1NO8A 1Q78A 1JKHB 3MOZA 2CZ9A 9RUBA 1P1LA 2ZNZA 4O3NA 4OYZA 4DR1F 3V81B 5H9FJ 2FHJD 1MWZA 2PSZA 4FS1A 1KS2A 2VC1A 2AWZA 3GFYA 4WZQA 2JVOA 2ZE2B 3GIRA 3CT9A 1G1XA 3KLEB 2MQNA 5F9LA 2CNOB 3N9UC 3H2UB 5KTQA 4P2SA 1NJYA 2IM3A 4NLXA 1EKSA 2BDPA 1RT6B 5D0GA 2DNLA 5LSOA 4J37A 2G1HA 3FGVA 2ZD1A 2GGPB 4PWDB 3HVAA 3NAIA 4OJ3A 1V5VA 2FZGB 5DLFA 1H2UX 4ID5B 2MDAA 2P9EA 3PIPQ 4AUKA 4X4NA 3CCVS 4ECUA 3SCKE 4B9LA 1BWEA 3ENAA 1U8WA 4WFXA 2H1YA 3BR9A 5DJBA 3MEEB 2E1PA 2VJVA 5KOWA 1U0SA 3OTEA 1FRHA 1FTCA 4MJKA 4OI6A 3L9ZA 2CQ2A 1X31C 4F3QA 5E3PA 2HG4A 2L48A 3GZ7A 3OR2A 2HBYB 4PR6A 3QRPA 2ZWPA 3P45B 4PEOA 2HHXA 1FD8A 4Q2LA 1U1OA 4A46A 2V8GA 2MB0B 1UVIA 5CYMB 4A8XA 2W24A 3O2IA 3ZTQA 2DNMA 4MMOA 1TMMA 5D4PA 2ZBIA 5BYQA 3QMQA 3BO3A 1I5OB 2D74B 3N01A 1FERA 2DPIA 2IM2A 2E5JA 4I6WA 3MPWA 3QSIA 4WE1A 3CNQP 1IKVB 1CG2A 2QSFA 4QWAA 2YX4A 4DR2J 3M2RA 3JTOA 1GMVA 1SI9A 2PMWA 3T5HA 3R97A 2X1FA 1NDLA 2RHQB 3ENVA 4C3LA 3MD3A 4F3OA 3MTKA 1HHTP 1X5SA 4F4ZA 3R6LB 2QTWA 3HSGA 3MF5A 4KC5A 1LKZA 2B4UA 2ACYA 1FJGJ 3A8EA 4Z7CA 1YLXA 3DYAB 3TEGA 2GMHA 3QGIA 1FI4A 1S59A 2XO7A 2XZTB 4EBCA 1SIZA 1FNXH 2NS1B 4G65A 2V9KA 2OAUA 4LBPA 2KHDA 1PBAA 4YR2A 4USHA 2GO8A 4LF6J 2K2PA 2BV3A 2XEXA 1SKSA 1K73T 2EK6A 1V3SA 3PXGa 4X4QA 3A3OB 1WF2A 3X3UA 4U95A 2J0WA 2COLA 2AYGA 2FJVA 3H5UA 4OHXA 2IVYA 4A4JA 2HNZA 1YDLA 1M1KT 4USTA 3A3NB 1KRPA 2O3DA 2OMLA 1GQEA 2XLJA 1BQXA 3UWTA 3BKUA 2WBMA 2C3MA 1H98A 1UVJA 4M5JA 5IM0A 5J2QA 1X60A 3VGVA 1KQKA 4KB7A 5KFZA 4DS5A 2Y1RI 1NJZA 4DZ6A 3RRGA 1AROP 5KG7A 5HLFB 2ZUGA 1SH3A 3PY8A 3MMCA 4G6VB 3KJVA 2E9ZA 5IQQA 3PX6A 4NYPA 4O44B 1VQMS 1YJ9S 1S6QA 5KFEA 3UDEA 2UUCJ 3RB3A 5IS2A 4C0BA 4XPEA 4L3KA 2KKHA 4KO0A 1W7WA 1FKPA 1XNRF 2BA9A 2W4DA 2XCPA 1D0EA 2MEWA 4E8UA 5KFIA 2HHHF 1CVJA 2MKSA 4URSA 1RHMB 3HHDA 4F4KA 2EEYA 3MCNA 1IWGA 1H7XA 5HVFA 4DFMA 3FEYB 2DGSA 4HI2A 1F5AA 3VZIA 4IOAQ 3T1YF 2HQIA 2HWIA 2R8IA 2YNFB 4ATNA 3SDEA 4ANDA 4DSEA 2LFVA 3FBBA 2O67A 3TEHB 2ASJA 2E44A 3DM2A 3RBZA 4DCJB 1DQAA 3GCWP 1YWXA 3ISZA 4RUCA 3MM6A 2WSFC 5DDQC 3BQ0A 3J80U 2RS8A 3HJVA 3VWSA 1ZS6A 1N48A 2Z2MA 2OPSA 3M6WA 2C42A 2FHMA 5A8KA 5E3CA 2M2BA 3EDQB 1OMSA 3THPA 1WI8A 1TUWA 4ZHRA 2Y1LB 3W5ZA 2FJWA 1RTHB 3W65A 5KFMA 5KT3A 2Y0BB 1VDHA 1N34F 4KR0B 2XMMA 2L9NA 4RNNA 1CPZA 1WI6A 1S77D 2ALZA 1C0UB 1REVA 3DLJA 9ATCB 1GK8A 3JYTB 1WEXA 4HACB 2OI2A 1FRJA 4UOGA 5CD4H 2P9GA 2GJIA 5DLGA 1FESA 4DU8A 3C16B 1IJEB 1VQ8S 1HWUA 1SKUB 4K59A 3SXLA 1JLBA 3J81U 4ZK7M 4ZP8A 4ES2A 1UJ6A 2R7QA 2M88A 2R8HA 2KYZA 1ZM4A 3W2VB 1WUUA 1XNQJ 4LUBA 4KPYA 3G87A 3BGOP 3QIDA 2CJAA 2YBVA 3DI6B 2HIYA 4UF4A 1M5HA 1UL3A 5HBMB 2GVZA 3BYPA 2M5YA 3QZ8A 2HNDB 4RUAA 1YJ7A 3DDKA 3KJNB 4TKTA 4DFJA 3GJTB 2C22A 3NBPB 3PIOQ 2YVSA 2UXDF 4N76A 2NQPA 1KSPA 1TU0B 4X64J 3Q23A 1LXNA 4ZITA 1P8GA 1UWBA 1LK5A 3K5NA 1NZ8A 3ENQA 3BZQA 4OZ3A 5LMNF 5D8HB 3MM8B 3R7NB 3I0RA 2I9SA 4USJC 2OPQB 4PKDB 3LOUA 3C19A 4RW6B 1RAOA 2W4PA 5E3QA 4YB5A 4EO8A 1VISA 1RISA 4DX6A 2KYXA 1SUQB 4I56A 1F9EB 4H4KA 3BGUA 4QPTA 4LF2A 4BCAA 1Q5YA 1FNMA 5AJ3F 3IBWA 4LF9F 1M0SA 4CIOA 2R7OA 3G82B 2BMBA 1JNRB 4KH1B 2FVPA 2JC1A 4CRJA 2I6WA 4LSLA 1VRQC 4FBTA 2KXNB 2DR6A 2KM8C 1PYSB 3NGRA 1WC0A 2H51B 1HNXF 4B3OA 2LKZA 3Q24A 4DR4F 5GADU 5LSRA 3KHLA 4RW8A 2IJRA 1ZZNA 4KFBA 1S10A 4EZ6A 2P5VA 3TX8A 4WF9Q 2HHTA 3TJ8A 4GO5X 2CQDA 2I5JA 4O23A 1GX6A 6AT1B 3MHYA 2YWHA 3CW2C 1GMWA 1D1UA 5EX0A 3J7YU 5AXKA 5I4MA 2MZJA 1QSYA 2YPZA 4LFBJ 4ES3A 2EKNA 2M70A 4OYIA 1FVQA 3J7Z5 3NS6A 3QQCD 1UZDA 2HLTA 2D3O1 3D3CJ 4USUA 3CJ3A 3BDEA 5KFQA 5F3ZA 2O66A 3EMTA 4CQ1A 3ILLA 2K8GA 4LR9A 5IQ6A 2MGZA 1LW2B 4YOEA 1HMVB 3QAUA 3DLGA 4JOUA 4M5HA 5HP1A 4M8LA 2DNGA 3I5AA 2C2NA 1DTTB 2DYAA 1SL0A 2QJ3A 1F6TA 2VKZG 5EWGA 5LM7E 2HAIA 5KFCA 2ZEJA 2CJ9A 2G2OA 3MM9A 4DPWA 4TQSA 3QIPA 4DQIA 3J7AN 4QWBA 2FVSA 4DF8A 2YWFA 4NI2B 4IRDA 3GP9A 4IG3B 1U6FA 4AXIA 1K0VA 2XSJA 3B4MA 1Q1KA 3MEKA 3CC7S 1CQNA 3W9IA 4DPOA 5ETPA 1PAEX 3AXKA 4NASA 2DJWA 1LWCB 2JEGA 1W2BR 3NCPA 1NDCA 5CZVA 1CULB 4IRCA 1OYEA 3RAXA 1DTQB 1C4AA 2B51A 3ZC4A 3DOLB 1RTIA 2MQMA 4JI4F 2ASDA 4DV7F 4PG6A 4X62J 2LQ5A 5KOXA 1VJWA 3R2DJ 5H1SV 1O6XA 2JEIA 2HS3A 2QLJB 1U1NA 1URNA 3G2XA 2UUBJ 2E7VA 4QR1A 1ICEB 1HR0J 1R0AB 4C3MA 1RSCA 3PFOA 3N6NA 1T03B 1UFKA 1T9YA 3J81Y 4M94A 4DV2F 4CCHA 3SSSA 2C2DA 3CTRA 5L46A 4EU0A 4ZN1A 1SKWA 1S0NA 2V2ZA 4URQU 1H38A 2NXNA 2HZVA 1A9NB 3CCMS 7FDRA 2V8HA 1RKJA 3PX0A 1B0PA 1CJVB 4DR5F 4NLPA 4M5LA 2FZCB 1MMLA 4TU9A 1QAXA 3O3LA 4DR3F 1E6YB 1JKHA 3HZGA 1YBAA 3W66A 5LMUF 1X0FA 3PRBA 2V5HG 2DCLA 2FQQB 2ILZA 2FB0A 4DV6F 3UDLA 4ZA1A 5B0AA 4ZIVA 5KG6A 4LR7A 2DIVA 5BYSA 3V81A 2W4CA 3Q86A 4K4YA 3FQKA 1FRKA 1UJ5A 1HNZJ 1OQ3A 1UMJA 1UWAA 4BWMA 4JI6F 1NSAA 3KLEA 3ZZUA 3EX7B 1N36F 1UPMB 3PYFA 5HROB 1C1BB 4LF1A 5ETNA 4QZVB 2GFFA 1N0VC 3EWGA 2EG1A 2MQ8A 4OV1A 4Y00A 4C2MA 4EYHB 4IH6A 2YWEA 2UV8G 5E0OA 1HNWJ 1S6OA 3E2EA 3IAS9 2A3JA 2VA2A 4JI5J 1LNQA 1DRZA 2ZNYA 1NNDA 4PWDA 4WKYA 1IXKA 3OV7A 3W9HA 3EYZA 3DU5A 4I2QB 1NEEA 4LF4F 2N7CA 3AT1B 3O8WA 2RT3A 5I3QA 2BEFA 2PC6A 1F3FA 1SXLA 2KZZA 3QGGA 2AJ2A 4ECRA 2XMJA 1NJWA 3IGVA 3JTPA 3NNCA 1YJTA 1FE0A 3HT0A 1KFDA 3WDOA 5K20B 2HK2A 2QA4S 1VRUB 4KGXB 4R5PB 5HSPA 3PO4A 2C2KB 2CQPA 3VGUA 3DGPB 1WOOA 2OO4A 3ETMA 4O3RA 4OYPA 4CP5A 2Q43A 3DN9A 4N77A 5J1EB 2BW7A 2B9EA 3D28A 4R25A 3ITHA 4K7QA 2YNIB 1IVZA 3KDNA 4OZ5A 1IBCB 1IKVA 1KKHA 4K4SA 3CJ8A 2J9DE 1U47A 3KTQA 3IM9A 4I2PA 1AW0A 2ZWOA 4LF8F 2ATCB 2DR5A 1SV5B 3BBBA 1S1TB 3QO9B 5IFMA 1KLNA 4JI7J 4J5OA 3H25A 2FD2A 1RA6A 5IT9U 4X4TA 2E9RX 1RT5B 2MZRA 4TY9A 1TFYA 4F25A 1URRA 4TY8A 4DL7A 2M52A 5F8GA 2DITA 1S9EB 5LOQA 2OMOA 4XO0A 1VQ6S 2O5DA 4GRSA 4DL0C 4USKA 3K2YA 5AE1A 4UY8T 1WELA 4KSEB 2MKYA 2GHVC 3MTJA 3PJXA 2WVCA 2RIJA 3IS9B 4C6AA 1R8PA 2GZOA
chains in the Genus database with same CATH topology
2AYMA 2OTLS 1T7PA 3KLIB 4ELVA 4I69A 3IR5B 1K1SA 2NPFA 2RDJA 2G13A 3PRDA 3M1VA 3TNVA 4A8OA 1BQNB 2W25A 4PG8A 4F50A 2BABA 1IKXA 1V6HA 3M05A 2CJKA 3OTBA 1TKDA 2O01C 2F40A 2IVMA 2NSCA 4RKUC 1D8ZA 4NA1A 2J7KA 2ZJRQ 4CO5A 2XS2A 4OHYA 4JI3F 1G6BA 2KXHA 2Z4PA 3ICLA 5LXYA 4DV0F 3RAMA 4WCEQ 1JMTA 4A47A 2MZQA 2DO0A 1M5OC 3RB4A 5CA5A 4KHPF 4HI1A 4HVZA 3M9OB 2UXBF 3S7RA 3QWUA 2WB4A 3WBZA 1RT3B 3NMRA 5HI7A 3CCSS 4ED3A 1KQFB 3I87A 2YY3A 3NP5A 3N5BA 1XR7A 3IRXA 3V6DA 2UUBF 2M3DA 2PEHA 4DSLA 3FRYA 1Y5IB 4DF4A 2YQ3A 4ES1A 4CNYA 2WAQD 5B0DA 2YKAA 3OPKA 3MAHA 3PM9A 4ZVEA 4LQ3A 3KFWX 3MMBB 1LWFB 3CUNA 4JV1A 3OHBA 1VIOA 5KFJA 4WJBA 1YHQS 1TKZB 3MEDA 3VCDA 2FHOB 3Q8QB 1QUPA 3ENWA 5J2MB 2DNZA 2LXUA 3IN5A 3MOJB 2YKOA 2DT9A 1UVNA 4NLQA 1QY7A 1HD1A 2CFXA 3KOAA 2D1CA 4PXEA 5J1NA 4YP3A 4C11B 3HHLC 4DL6A 1B0TA 1H0HB 2VFUA 2LQBA 4WXOA 4OX9F 4L72B 4MIBA 4B3TF 4ZVGA 4ZP7A 4C3KA 3CJ4A 4M5DB 3RZAA 5F3TA 1JLFA 3AB4B 4NWBA 3W2WA 1YI2S 3JTNA 1IKWB 4O44A 5G4DA 1WHWA 3H4BA 1HQEB 4CO0A 1N6QB 1E6VA 2IAJA 4GMKA 2MJNA 1R43A 2RRAA 4PQAA 2RQ4A 1S9FA 3T5KA 3M2UB 5CCLA 5L9XA 2XLIA 1K8AT 1GNKA 1MNEA 3OLBA 3V2UC 2IC3A 4EWTA 4RZRA 1UWBB 1PSDA 1ZTTA 4R8UA 4WYWA 2SXLA 4NYZA 4LSNB 2JLFA 1W25A 1TR0A 3I0SA 4XDDA 1R0AA 1Q86T 2NPIA 3HLUA 1QLNA 1HWJA 1FXDA 2ZDOA 1O8BA 4Y2AA 4ZPAA 1OWXA 2E5LF 2RKIA 2ZC4A 4GO7X 5A8RB 5LJ3Y 4TYBA 2ZM6F 4YEAA 5L1JA 3I4HX 1F2GA 4FXWA 2JLEA 2BQ3A 1LW0B 2E1CA 2MJUA 3HVRA 2RD5C 5AXLA 1C1CB 3T1AA 4C8YA 2CQ1A 4WFZA 2KFZA 4YUDA 2ZKTA 4ED5A 3R1HA 1JLQA 1WACA 2DHAA 4YQWA 3SV3A 1QE1A 3PW5A 4OZ0A 1C0TB 4JV0A 2NUHA 2FHKA 1N0UA 1IUJA 2ZZMA 4IQXA 5KT7A 3EZ5A 1AUDA 3M8QB 4AXJA 3G6YA 1DHMA 2GMJA 4CNZA 4IR1A 5KG0A 5K9FA 3KK1A 1LXJA 2KRBA 2NUUG 4PRFA 3DU6A 2AJFE 1JLCA 2W7OA 3BSCA 2JRSA 4QWDA 3KKFA 3THVA 4HDGA 1SJRA 5T7LB 3MUMP 5KFSA 2BR0A 1DFDA 2OD4A 2DGOA 5I42B 3CPWR 4LVNP 1DARA 4HT5A 3HKWA 4QU6A 4NZ0A 1HW9A 3GYNA 3PKYA 2HHQA 4XK8C 3HDSA 4NZ7A 4O3OA 2MKKA 4WXWA 2MQOA 1X4EA 2CQHA 2KHCA 3D0HE 3M4XA 2CQGA 1H2TZ 2EPIA 1NJXA 2L9DA 2MZSA 4OZNA 4JI2F 4AE5A 1TKXA 3BGFA 2KH9A 2UZAA 1F0XA 3MEGB 3MM7A 3NLCA 2PMHA 2LA6A 3NG8A 3OR2B 2XI3A 5DS7A 3TOQA 4RUHA 1HI1A 1WTBA 2XY7A 2N7YA 1J5OB 1VQ5S 4JI1F 3CDAA 5DM6Q 3BSNA 3M6XA 3OQ2A 1RT2B 2QLXA 5A0YA 2PE8A 1N32F 2CPHA 1X4HA 1NK8A 2V8DA 2WRMA 1VHFA 2WW8A 3VQSA 3Q8SB 4FF3A 4B3OB 2F1FA 2WONB 4UUWA 4W90B 1KHWA 2FLPA 5C25B 2XULA 2E5IA 4RW8B 3UCGA 3I96A 3OXFA 2V0NA 1TL1B 4JI0F 5HMWA 1IBMF 2HW3A 3UCUP 2YTCA 5HMXA 1VRTB 4JI8F 2GO9A 5J2NA 3K58A 3T1HF 4LMZA 3FMBA 1VK8A 1Y5LB 1R27B 2OFGX 4MIWA 1S0MA 3NCQA 2RQCA 2G1DA 1T02A 5HROA 3N4WA 3CCZA 1C1BA 5JUMA 3A1YG 1R8CA 2KT3A 4AFFA 4OZJA 4ILMA 1T94A 2IBKA 3PX4A 1Q79A 2DK2A 1EP4B 4HH0A 3VAFA 4Y2MA 2HHWA 1XR5A 1X4CA 4YB7A 2RH3A 4NA2A 2IMOA 4IDKB 1ZOTA 2M0GB 4FP9A 1TV6B 2JC0A 4QIEA 3US5A 3K5LA 3VAHA 2I5JB 1TKTB 3SSQA 2F8MA 3I4PA 2MY8A 4WE1B 3RRKA 3LP2A 5SZTA 2HYIB 4NLRA 2D3ZA 1IBLF 3CC2S 2KN4A 3M2RB 1SJ4P 2EFQA 3FSYA 3GSDA 2QO3A 3LAMA 2VG7B 4RW4A 2LEPA 1XR6A 2RB7A 1YIJS 4MIAA 3HFKA 5HQ8A 4HKQA 3FZ2A 3V4IB 1VQNS 1HBNA 2YH0A 5T14A 2X3GA 2KI2A 4L6V3 4NX9A 3D54A 5GVQA 4ZPTR 3ISNC 5GAEI 4C9DA 2CDQA 4DSKA 2MZ1A 4WK3A 4EUVA 3AA8A 1VK3A 2BRLA 1HA1A 1O51A 3D2WA 4I2QA 3Q0AA 2F3JA 4A48A 2FGOA 2OH2A 2DGXA 4TNOA 2MKJA 3I55S 1BQMA 2IBOA 3PW7A 3NKYA 1JLAB 4EYIB 2HFZA 2CQCA 1U1KA 3HPOA 2HIQA 2J9DA 3JYTA 4JYAF 4KGMA 2W7AA 1SJ1A 5GMKa 4RWXA 5K8PA 1M5KC 2Z8QA 1TL3B 2J0QD 3G9CA 2EWHA 3FSIA 1U7LA 2DNKA 2GHPA 4NLOA 2WSCC 3GQCA 4DFKA 2CQ4A 2MGZB 2NYIA 1VQLS 3N79A 4KRWA 1W2IA 3SQGA 3TQ1A 2J5AA 1XBWA 2CPXA 5E41A 1FE4A 3SFUA 1PC5A 4FXVA 4OJ1A 5FLXY 1JXEA 1JLEA 4F3MA 3NRBA 4FVMA 3I5CA 3FMWA 2J76E 1OIAA 4RW9A 2EFVA 1F5BA 2I0XA 4RX6A 5KFOA 3DLGB 2B6AA 1RTJA 3W2VA 4GC7A 5HP1B 3RBDA 3DLLQ 1QVFR 3IWXA 1S1VA 4NLWA 5F8LA 1F5CA 3M6UA 3OFGA 3CCUS 3WC0A 1U1MA 2B43A 4NOHA 5D4NA 4UY85 1YJRA 1AFIA 4J9PA 2DD8S 1U25A 2XHWA 3QAEA 2KU7A 2LXIA 4F26A 2ZOGA 2UUWA 2OPPB 2BANB 4DG1B 3H5SA 4N5SA 4JI7F 1MROA 2L9WA 2UVUA 1FNOA 3QWPA 4O3SA 1L3KA 1R6YA 4CTAA 2XY6A 2CQBA 1K9MT 3OR1A 2E1AA 3DI6A 3T9NA 1PGZA 4U7UK 2VODA 3CDBA 3TO8A 5HBMA 2P6TA 4Y2KA 4X4SA 2HRUA 4WKRA 4TLRA 5LJ5Y 1S1WB 2YNHA 2CQIA 4DUYF 3PV8A 4YDXA 2MKHA 2UVVA 1M5SA 3CIMA 3GV7B 3RW7A 2GQCA 5E5NA 2XNRA 5K8OA 1NK0A 3FDSA 6FDRA 5EDWA 2BJEA 3KWMA 5BJRA 1JNZB 1X8DA 2HNZB 3IG1A 4NLSA 3K57A 2DPJA 3DMJB 4EFAC 1VBYA 4MH8A 2Q79A 2WOMB 1NRKA 4XPCA 1VQOS 1GAOA 1WNEA 1ZAWA 3H2LA 2NREA 3POTB 4DDFA 1R8HA 3LGMA 2VONA 1N5YB 5HL7Q 2F8HA 2EW9A 5CYJA 3NBPA 3PACA 1JK9B 3DLHA 1F60B 2IRUA 2LLZA 1RTDB 3QO9A 1S1TA 4I7FB 4DLGA 1QSSA 1OO0B 2CPYA 3K5OA 3J7ZT 1Q82T 2F4VF 2BYCA 2LEBA 2AJ0A 5K14B 2C3UA 2XMVA 2XGQA 2YKMA 3UD3P 4PCQA 1HBOA 4J9QA 2GJ2A 2PIIA 3GB0A 2HGMA 2OIHA 3MR3A 2N4CA 2VUGA 1X9WA 1BY9A 3T3FA 2WCXA 1ZTWA 3DDNA 1KOHA 4ED2A 2YKQA 2ATLA 2Q3PA 1KQGB 1X5OA 4AL5A 1RT5A 2FJEB 2RNEA 3PR5B 2VPYB 4Z37A 1S6UA 2DGVA 2LQ9A 3MM8A 3M8RA 4GKJF 1S6PA 2ZH6A 1WF0A 5DDRC 2R8GA 4YB1P 1P27B 5LL6d 2FPHX 4BS2A 2RE1A 4QYRA 3LALA 2KFYA 1TL5A 4WFNQ 3GIJA 2HS4A 1HNVA 3E51A 2C2EA 2XMWA 1N5QA 4Q0BB 4F02A 1HBMA 2KB2A 3K5PA 4C0HA 4KV8A 4R0JA 5H9EJ 5FJ4A 4KE5A 2GW8A 4OI2A 2AX1A 1S9EA 2DNOA 4I0WA 4EEYA 5F8JA 4Y34A 3KK2A 1QAIA 5CZXA 1U4BA 4DOZA 4A8KA 2E1RA 2OSRA 4LJMA 1SUQA 3IC1A 5JVGQ 2JJ4D 3VAIA 2LMIA 4ZP6A 1CSJA 1RP5A 3MM5A 1S6QB 4OI3A 1QSLA 2XB2D 1HBUB 3QJJA 3CJ2A 1QTMA 2HNYA 1S9GA 1VQSA 2CPIA 1L3TA 3TARA 4ETZA 2CZ4A 2FLNA 1MWYA 3KLFB 4Q8FA 5IZHA 3OL8A 3GFZA 1FEHA 3M30A 1X5PA 4N47A 4ZVFA 3DRPB 5A8WA 3IR7B 4IKAA 1HD0A 2QSWA 1F9FA 2VFRA 2JEFA 2ZJQQ 1JJ2R 3GR0A 3QYYA 3MFIA 1YJWS 3LP1A 4K50A 2VG6B 1MMNA 5DRKA 2HGLA 3CULA 3DOKB 3PW0A 1WF1A 4C8LA 4U9RA 5KFVA 2VFTA 3FFIB 5DGBA 1Z2ZA 2A2CA 3MR6A 4KO0B 4J9SA 3SYZA 2XS7A 4TLQA 1FKPB 1X4BA 3B82A 3TA0A 4DL5A 2J6TA 1UFWA 4YR3A 4DQRA 3QGHA 1RKIA 3N0VA 2RQKA 4TU8A 2RF2B 2YNGB 4FPRA 1JIHA 5B08A 2XI2A 4QPXA 3JSMA 1IBKF 3MZIA 4DQPA 1FRXA 2LQJA 2IJNA 4B9MA 4RW7A 3CVKA 5M2UA 1VC6A 4DWIA 3M8PB 4H4OB 1UFLA 3TVZA 2UXCF 3R5DA 5KG1A 2OP5A 2XMUA 2Q6BA 3FVYA 1L3UA 2BQRA 2QRRA 2CJBA 5B0GA 3G96A 1VBXA 1L3VA 1ROFA 3KLGA 1Q8LA 4IUFA 3R5AA 2CYYA 1Y4ZB 2B0GA 2B56A 3C6TB 4FN5A 4C8NA 2QFJA 4HDHA 2OTJS 5KFYA 2MMYA 1RT3A 5KFUA 4HLBA 2AGOA 1B64A 1NO8A 1Q78A 2KRRA 1PO6A 2DVIA 1TZ0A 5DQIA 1JKHB 2ZH5A 3PW2A 4WIIA 4J9RA 3MOZA 2A1BA 3FCHA 4G3IA 1WEYA 2DNRA 2LXFA 4ILRA 2W9CB 1LWFA 2N4DA 1P1LA 2D3UA 1R3NA 3HT3A 2ZNZA 4EO6A 5KG4A 1TKZA 4KJIA 2B3TB 5J2MA 4O3NA 1T05A 4HHJA 2ZHOA 3ETOA 5K5MA 4YB6A 4G1QA 5EWEA 4OMFG 4DR1F 3UD4P 3DLBA 4O4RA 1YTYA 1NZAA 3V81B 4NXNF 4A8YA 1RWUA 2DNNA 2OPRA 3MD1A 2FHJD 5H9FJ 1LV5A 4LFAF 4C11A 1MWZA 2PSZA 4FS1A 1KS2A 2VC1A 4ZPVR 2GNKA 2FTRA 2VASA 3LP0B 3TUIC 4F8RA 1FJGF 2AWZA 1QAJA 3VALA 2HVZA 2M9KA 3OVBA 3GFYA 4WZQA 1U2FA 3M32B 5K8NA 2JVOA 3JSBA 5F0UA 2ZE2B 4D3HA 3CT9A 2E7WA 2QMXA 1G1XA 3S1TA 4CH0S 2IVFB 3KLEB 1ZH5A 2VOPA 2MQNA 5E7OB 5U47A 5F9LA 2JSXA 3N9UC 1FTRA 5DQGA 3H2UB 2PI4A 5KFHA 4K5SA 4FS2A 4YFUA 1FDAA 1FA0A 3FSXA 1QM9A 4OI1A 1UEVA 5AXMA 3KK3B 5KTQA 4P2SA 1GXLA 1KC8T 2OPSB 4CO1A 1NJYA 2VG5B 4QYZJ 3PVXA 3M2UA 2IM3A 2PA8D 4NLXA 4AYBD