3E8OA

Crystal structure of a putative antibiotic biosynthesis monooxygenase (dr_2100) from deinococcus radiodurans at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
TMVISHGTLSASAEHAAHLRQLLVHIAQATRQEDGCLLYLVSEDLSQPGHFLITEHWDNLGAMHTHLALPGVTQAIDALKHLNVTDLKITAYEAGEAINIMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (NP_295823.1) from DEINOCOCCUS RADIODURANS at 1.40 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 26
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e8oA00
4FNHA 1OSDA 1P6TA 4FNIA 4Y2IA 2OD6A 2IYIA 4QOTA 2W4PA 5T7LB 3HHLB 3DCAA 1CPZA 5B0BA 2OD4A 4ZOSA 5T7LA 3HHLA 4OJ1A 1IUJA 2QYCA 2W4DA 2HIQA 4DL0C 2ROEA 3GZ7A 3DXSX 2GCFA 1TR0A 1SI9A 2RILA 4OIXA 1K0VA 5B0GA 3FGVA 2XMMA 5B0FA 1FEEA 2PD1A 5B0AA 1AW0A 4EFAC 2FIUA 1Y3KA 2Q3PA 1U7LA 2GV1A 1S6OA 4F67A 1N5SA 4Q2LA 1FVSA 2ROGA 2LXFA 1GXTA 3VTIA 1ULRA 2IYGA 1FE4A 3HF5A 2BYCA 5KAKA 4Y2KA 2HFOA 1Q8LA 1P8GA 2QLXA 1MWYA 4A47A 1URRA 2PGCA 3TNVA 1Y0HA 1AFIA 4OJ3A 1CC8A 2AJ1A 1Y9OA 2K2PA 3WDOA 1FE0A 5B0DA 4HH0A 3LO3A 1Q53A 1LQ9A 3I9ZA 3BB5A 1OQ6A 3QGPA 4OJGA 2ASYA 2FTRA 2N7YA 4NPOA 2GO8A 5B09A 4A48A 2LQBA 4Y2MA 2BJEA 1YG0A 5B08A 3MCSA 1TZ0A 2KKHA 2FHMA 3HFKA 4OJHA 4Q2MA 2EW9A 2RSQA 3F44A 1JK9B 2ACYA 3UDCA 1VQYA 1KVJA 3FRYA 2LDIA 2OFGX 3BR8A 4U9RA 2HQIA 2FB0A 3BM7A 2ZDOA 1N5TA 2N4CA 5B0CA 3KNGA 4HI2A 4NL5A 1AFJA 1S6UA 5IXUA 4A4JA 2HFNA 3CJKB 1FVQA 1W2IA 2AJ0A 2L3MA 4HI1A 3CJKA 3TOQA 1TUVA 1Y3JA 2GFFA 4YEAA 1OPZA 2GA7A 2HLTA 1Q8BA 2BUNA 1SQEA 2BJDA 1V3ZA 5F0UA 3HX9A 2ROPA 1OQ3A 3KKFA 1SB6A 3KG1A 1Q4RA 1JWWA 1KVIA 2CRLA 1N5VA 1QUPA 1VQSA 3HHLD 2OAUA 3BDEA 1APSA 4HL9A 5A6PA 4A46A 3BN7A 1N5QA 5F0WA 3QMQA 2G9OA 3IWXA 1YJTA 2XMWA 1YJVA 2JDJA 3HDSA 2OKQA 2ZDPA 1YJRA 2BBEA 3MZIA 2KYZA 1XBWA 3IWLA 2XMVA 1WD6A 2OFHX 2KT2A 2GGPB 1FD8A 1FESA 1TL5A 1X0PA 2AW0A 2XMUA 4DPOA 2GGPA 1X7VA 2QLWA 2VH7A 2XMKA 3E8OA 5K9FA 3T9NA 1R6YA 3KG0A 4HH1A 1TL4A 2XMTA 5B0EA 3K7RA 2KT3A 2K1RB 2QIFA 5A6WA 2K7JA 2N4DA 1KQKA 2OMOA 2K1RA 2K7KA 4ZA1A 2IFXA 3BF4A 1GXUA 2HLUA 2LQ9A 2W4CA 3FMBA 4YDXA 3LGNA 3TRGA 1CC7A 1X8DA 2AP6A 2VV5A 2RMLA 1YJUA 3LGMA 1YRXA 1RJJA 2OP5A 3BGUA 3HHLC 2RU9A 4DN9A 1MWZA 2XMJA
chains in the Genus database with same CATH superfamily
3ISZA 2YXLA 3IM8A 1L3TA 4AQYF 1FRIA 3H40A 3T1AA 3V81B 1VC0A 1R0BG 1KFSA 4ECZA 1P1LA 4ILLA 3HHKA 5M2RA 3AB4B 2OI2A 2MEWA 4Q0BA 1N34F 3PW4A 1FT8A 5H9FJ 2JL9A 5IC4B 4BC7A 5LXYA 1S97A 1KQSR 4ECSA 3V6DB 5L1JA 4PZVA 3I31A 2FY1A 1B0TA 4UOHA 2CQ1A 5I4MA 4J9MA 1FDAA 3HCXA 1Q4RA 1NJZA 3SYZA 3TZWA 4PR6A 2HNYA 4ZCMA 2NXCA 5K9FA 2J9DA 1TL3A 1F3VA 1X5OA 3EVMA 3MUMP 2LQ9A 4YS2A 1N33J 2B9XA 2ALZA 3H5XA 2OD6A 2IHR1 3EGZA 2G13A 1BHNA 2EFGA 1NZ8A 1SIWB 2ZBRA 5KFXA 5ETNA 1Q81T 3QLHA 1S1WA 4CO4A 3JTPA 3CJ0A 2D41A 2RDJA 1FE4A 4HR2A 4NASA 1HQUB 2P9CA 3G6YA 2YQ0A 3LALA 3KMSA 5BYSA 4ED0A 1NDLA 3HFKA 4WZMA 3SDEA 1GFWB 3J7AN 3D67A 3MUVP 2KXNB 3PIOQ 2JEGA 4RUBA 2N4CA 1ACMB 4K50A 3DI6A 4OLPA 2AJ0A 1NB2A 3FNNA 1Q8BA 4EZ9A 5F0UA 2ROPA 3AXMA 3M6WA 4ID8A 5JXSA 4CLKA 2VG7B 5DJBA 4NI2A 1ZAXA 5HSPA 1GEHA 2JVOA 3A1YG 2Z4PA 1CC7A 1SH3A 1WKJA 1HARA 1N32J 3Q8RB 3DM2A 3PV8A 4LRCA 1WC3A 2OPPA 1RA7A 3G8SA 1JLCA 3B4MA 1FHTA 4DPWA 4WXOA 2Q1LA 5GMEA 4RUAA 3CB4A 4DQIA 1SPBP 2VPZB 2QGFB 3OD2A 3IO1A 1IR0A 2XI2A 3KK2B 3CJRA 2NXJA 4ANCA 4AXJA 3ZZYA 1QVGR 2K8GA 5KFKA 1JKHA 1HHSA 3TZYA 2R7WA 2KHCA 4L3NA 1O51A 1Y11A 5I3UB 1TK0A 2HGNA 2OPQB 1R0AA 1FJ7A 2BVZA 4DPTA 1LW2B 3EVWA 3FZ2A 1MG7A 2JDJA 4D3HA 3MZIA 3MD1A 5FLXY 2DKOB 2DO4A 2HFUA 2OFHX 1XMOJ 3ZO7A 3PEJA 4YR3A 1VJQA 1KQKA 2J76E 2KT5A 5CCMA 4GC7A 1N36F 1SUQA 2R7OA 3KOAA 2HFZA 1TL1B 1BE4A 2I9SA 1F60B 1WEZA 1IUJA 3FKBA 2HWTA 2HIQA 3W9JA 3MM7B 1H72C 1UFKA 1FKOB 1RWUA 3OFGA 1PO6A 4GKJJ 4CO2A 3K8VA 4PXBA 4OYBA 1RT3B 3PCOB 3VALA 4BBYA 4KHRA 1IBKJ 3FBBA 1KP6A 1NLKL 2HBZB 4CO5A 2EEYA 4IH7A 3VWSA 3K89A 4O44A 1OS5A 4U9RA 4FDFA 4HDHA 3MPYA 2LYVA 4PUOB 1XQIA 4C6AA 1JNZB 2QL5B 3D5MA 4TQRA 3CO0P 1PYSB 4NZ6A 4X64F 5KFRA 3W61A 3QMQA 3GIIA 2XM3A 2KB2A 2BANB 4YB6A 1FA0A 1VK3A 1HD1A 2OUGA 4DPOA 3QRPA 1VGYA 2UXDJ 4RBUA 3SFUA 4OI0A 3AQPA 4URSA 3BGLA 5HLFA 3GR0A 3MURP 4NE9C 1DAXA 4DFKA 3Q89A 1IBLF 2OSRA 4DV0J 1P9QC 4N5SA 3BS9A 2KFNA 3MM6A 3D28A 2ROGA 5C5JA 2IY5B 2ZUAA 1D8YA 4PQUA 3ET6B 3HJVA 4ETXA 2CPDA 5B09A 2YTCA 5EWFA 3TANA 1UVKA 1VLOA 4QR0A 1VRUB 4L75A 3H25A 2VA2A 3P6YC 3OJSA 2RRAA 2UXBJ 4Y2AA 2FJAB 1FD2A 2E7XA 3IGVA 2E5GA 3FRZA 3NCQA 3V2UC 4DFPA 1VMBA 2HFSA 2FHKA 5LM7E 4OI4A 4ZVGA 3HSZA 1RWOB 1X4FA 2ZBPA 2BMBA 1FJEB 4RX6A 1K0VA 1IVZA 4X66J 4F04B 2FJXA 1TKXB 2UUWA 3HZGA 3TZXA 3ENAA 2W7AA 2GC8A 4DR3F 2E5LJ 5D0HA 4AXIA 2BM1A 4DV6F 2BM0A 2HQDA 2CYYA 1NBEB 1S99A 2DHSA 1TKZA 1SVDA 2R8GA 4C8KA 3DHXA 3AT1B 4GO5X 1URNA 5A0YA 2O5DA 1B0PA 3JTNA 2R2UA 1IJEB 4I1TA 4DS5A 5JMNA 2RNEA 3VAHA 2X1BA 3WHIA 3BBBA 4G3IA 4AE5A 2J7UA 2M9KA 1C0UB 1LEOA 4X65F 2HVDA 3H5UA 3LGHA 5BJRA 5CD4A 1HFEL 4RKUC 4FXDA 5LMNF 1R6YA 4XPCA 1JQGA 2ZKTA 3BYRA 4NYOA 3RUBL 1VK8A 5HROA 3HHLC 2CVEA 3DLKA 2EFOA 3BZQA 3KHLA 2CDRB 2DNRA 2NXNA 4RW9A 3PIPQ 3HKWA 1JLGB 3QRQA 4ZIVA 2FVCA 4M5MA 2E9ZA 1W25A 1HNWF 1PCAA 4JI1J 4O3RA 1FTCA 4JI5F 1URRA 3MF5A 3RR8A 3CJ3A 2V0NA 1NCLA 1HBUA 2XG8A 3GFXA 3DDKA 1FXLA 1QJHA 4CM0A 1X31C 4XDCA 1T03A 4IO9Q 1XNQF 4X4UA 2JLFA 1M5KC 4JYAF 2W24A 4M63A 2C2KB 4TYAA 3W8PA 1V3ZA 3HX9A 5DRKA 1C0TB 4A8MP 2ZHAA 2KG0A 2EXUA 3L9ZA 1WELA 1EKRA 3UN3A 2JOQA 2FVQA 2HHWA 4X4QA 2GQCA 3OSNA 3PHTA 4M5GA 1C1BB 4JB8B 2VFSA 5HO4A 3LGNA 5KFJA 5EHHA 4K5RA 1QAYA 3N6LA 2IRXA 2ATLA 4XO0A 1RWKB 1FKPA 4UUWA 2XHCA 3A12A 3HMJG 3SSRA 4DL0C 1MROA 3C15B 5LSRA 4IG3A 2XLKA 2Y8WA 1FWKA 2CUYA 2QA2A 2Z0GA 4ED1A 2F4FA 3H90A 1UVNA 4QZVB 3C6UB 2DTJA 3VR1A 3RG6A 2LA6A 5KTQA 1I94J 3LAKA 3AOBA 2WB4A 2HHHF 4ES2A 1PJ5A 4MT1A 1Z2LA 5HANA 2CQCA 3DHWC 4J9SA 4KH1B 5CABA 4K2XA 1KKHA 2MY7A 4X4SA 2QN6B 4Y0FA 1D9AA 1YITS 3X1LB 2ZE2B 3TP2A 1WG1A 1C1CB 4IKAA 3RU0A 2W9BA 1V3SA 2QC3A 2XMKA 1U02A 2K1RB 3I96A 3HI9A 3LP2B 3MD3A 4H4OB 2KL8A 2VBXA 2GIRA 3ADAC 4LF7F 2F63A 2W01A 3OL8A 4B9NA 2F7VA 2JZ5A 3UD3P 4R0JA 3RRHA 3NOCA 2ZFHA 1O8BA 3JXOA 3N01A 4JOUA 1T05B 3CCMS 2QLFB 2VBZA 2XY7A 1Y7PA 1ZTWA 1YVFA 3O44A 2FPHX 3EVOA 3M9MB 3TA1A 1NO8A 1UL3A 1B0VA 3O3LA 4CLFA 2UUBF 3CMES 1FRJA 1HWLA 2WVEA 4ZMMA 5LSOA 5CD4H 3QRRA 3A8KA 2AMCB 1RADB 4OYWA 4QU7A 1OYEA 1H2TZ 4XK8C 4K4SA 5AXNA 2C3PA 4B3SF 3I87A 2OAUA 4CLUA 1HYSB 4C98A 3ZNUA 5J2NA 2XWYA 1TKTB 2V4RA 1D9DA 2W8KA 2FGOA 5C25B 2RH3A 4M5KA 4U95A 4ZLJA 5IQQA 4G1QB 3GCXP 2OP5A 3TNVA 4RLEA 4RW8A 3DOKA 5DLFA 1DBDA 1U1RA 2JEFA 3BGRA 5AE2A 4DX5A 3G6VA 4WU2A 3T41A 5KT5A 2RD5C 3BPSP 2QE5A 2ZD1B 4R8UA 5HJXA 3D54A 4NX9A 2LA4A 5HP1B 4UZBA 3R27A 1Q53A 2N7YA 3MOZA 2KXHA 2VKRA 3TARA 3OBIA 2AQ4A 4B3TF 1LWCA 4DUYJ 4CYUA 1RU1A 4PG4A 5C2GA 1TQLA 4AQYJ 4MKAA 5F9NA 2V2KA 3ITHA 1RT6A 5D6GA 2M8DB 3GFHA 1VQSA 4OFZA 3ZZOA 5A6PA 2GVZA 4IDKA 1KQGB 4YY3J 4USVA 4NLSA 3H4DA 1WD6A 3DLLQ 8ATCB 4JI0J 1Q8IA 3K7RA 1RWNB 3OW2R 4LF5J 1FJGF 1REVA 1B7FA 2RU3A 2K7KA 4Q43A 5KG0A 1ZH5A 2AP6A 4EYHB 1ZOTA 4O23A 4TY9A 4CH7A 2DCLA 4TXSA 3HHLB 2MHNA 2CPHA 3OVBA 1BGXT 1HI8A 3KK3A 4K4VA 3J80U 2MHEA 3R9LA 2QZ8A 2HVHA 2BEFA 4K4UA 3MR6A 2PEHA 1KHVA 3W63A 3VZHA 1R8AA 1U1MA 3BB5A 3DRXA 3TUJC 1RE1B 2LQBA 4OI6A 5IM0A 3M2RA 4W4MA 2AU0A 1X4EA 2G1HA 4FYDA 4YR2A 4ZLLA 1M90T 4ILMA 5HBMA 2H65B 2Z2YB 2YNHB 3E2EA 1FKAF 3GIJA 4GO7X 1Z1ZA 3K17A 5E0OA 3A8JA 4ZIWA 3D1HA 2NZ4A 1NK7A 1IKWA 4CTAB 1O0PA 2QTWA 2LQJA 1TMMA 5CA5A 2IAJB 4DUTA 2Y8YA 1R8CA 2HK3A 1VDHA 4LIRA 1UPPA 2MLXA 2MPUA 2CPXA 2ZOGA 1O5JA 1CEZA 3SQOP 3UR3C 3CCTA 2XS7A 3KLGB 3W5ZA 1YLXA 1X0FA 3UW1A 2ZEJA 4EO6A 5C42B 1Q79A 2VUGA 3EPGA 2VL1A 3HHNB 1ZZFA 2FDNA 4TYBA 3CJQA 4ZS6A 4ICLB 4K2JA 3SQGB 2K2PA 1RB0A 5CZXA 3EDRB 3DDNA 3KTQA 4O0NA 3DLGB 1S1UB 4LFAF 1BQMA 3MR5A 4F8RA 2DGTA 4JI4F 2HEKA 2FLLA 4F2RA 4JUZA 4WPAA 2Y1RI 4NL5A 4RW7A 1M5PC 4KKOB 1MNEA 3I0SA 2AD9A 2RKIA 1LFPA 3EYZA 2NPFA 3ZTSA 5EDWA 2A6MA 2VOPA 2OTJS 1UFLA 3BN7A 1YSJA 3IBCB 5DS7A 4AL5A 3A3NB 2ZOFA 3I56S 1NHVA 3C16A 5EX3A 2ERRA 1WKKA 4ZJOA 1R8PA 4B08A 3T1HF 3JS9A 3CNQP 1F2HA 4QYZK 2EPIA 4EBDA 3GQCA 1NKEA 4NCGA 3CMAS 1JLBA 1U47A 3P4UB 4PYAA 3BSOA 2XY6A 4ES3A 2W2QP 1NDPA 2C2DA 2XSJA 2R2RA 4KB7A 2EKYA 1ELOA 2YH0A 2MZQA 2BZ2A 2BRLA 1XR5A 3GYGA 4XIUA 1Q5VA 2YNIB 3KK1B 2OIHA 1VQ9S 1V5VA 3OFEA 3MAAB 4ZITA 1SBRA 3S8SA 2YPYA 5CAAA 3C14B 2DIVA 1VQYA 4ECQA 1KC8T 5E3RA 4OLOA 5HMZA 1F5BA 2GVDA 5B0CA 2CQ2A 3CJKB 1LW0B 3TOQA 3QSIA 4KHPJ 2ZWOA 2RF2A 5F0WA 3NEKA 2KYZA 4J5OA 2MQOA 4B3RF 2QJ3A 4RO0A 1J27A 3QGGA 2QA4G 2IFXA 3Q2TC 2BV3A 3BDPA 1IKVA 3L7UA 3R5AA 3UVJB 1E6VB 1XWLA 5KFUA 4PABA 1WNEA 2UVUA 2BYCA 4DEZA 3M8PA 4X4TA 2XGPA 1S1VB 1N88A 2IMOA 2J7KA 3DOMA 5K5MA 2W7OA 4DR4J 2GHWA 2A3JA 1OQ6A 2VDHA 2B7BB 3CTRA 2EW9A 3N79A 1EX8A 1KVJA 4TY8B 5KFCA 3G96A 2D7SA 1HD0A 2FLNA 1N5TA 3H5SA 3FBFA 3UNGC 3AOAA 5KFDA 3W64A 5EUHA 4RNOA 2V63A 4RU9A 2CQ4A 3OLBA 4ELUA 1VQ8S 3JYTB 3I4PA 4ZPVR 2AT1B 4MH8A 2DY1A 2ZBQA 1LOUA 1YJVA 2OKQA 5D3GA 1WSVA 1U6FA 1T0TV 2UUAF 1RU2A 1CG2A 3QT7A 3O6QA 4JV1A 1S9EB 2DNLA 4ZPTR 3GIMA 3P3DA 3J7ZT 4I2QB 3W62A 4DUZF 4RW6B 5J2MA 2VB6A 2RDDA 3OUYA 3J7Z5 2XS5A 4HACB 2E1AA 3MHYA 3N28A 4GVLA 2Y9HA 3T1YJ 2HS3A 4ITSA 3A3OB 3O2IA 3CD7A 2QG9B 3ENWA 2AHOB 4C8MA 2QLXA 3GV7B 2EK6A 3JAMU 4HVZA 3VGTA 4D3GA 2AJFE 4YFUA 4KV8B 1HMVB 3Q83A 3CCES 1MN7A 2AJQA 3LANA 1UZDA 5H9FK 4HLBA 1S1XA 1IQTA 2ATCB 2ZBCA 4USHA 4X62J 3CW2C 2GAHC 1NH7A 3IG1A 3M8SA 1KDNA 2GJFA 2MZJA 4K4WA 4UOCA 4RUCA 2XULA 1TK5A 4KGKA 1MSWD 5CH7B 1P1TA 3L3CA 5MLCV 1S57A 1VS3A 3VAJA 2K7JA 4P6QA 2CQ3A 1N54B 2HRUA 4KAIA 3Q8YA 2GQ2A 3TI0A 1UA1A 1Z4UA 2BABA 5KFOA 4DMZA 4FKXA 5E3AA 4CT9A 1LV5A 3QNWB 2H51B 4YHHJ 5G4DA 4X4OA 5KG3A 3V81A 1DQAA 1RISA 3LWLA 2LQ8A 4X65J 1ZETA 4DZ6A 4LRDA 2CPZA 4JBCA 2R2TA 4NXMF 4UQTA 4L76A 2VQFJ 3U1LA 3GE9A 4LBIA 2BQRA 3RBZA 4F4YA 2GHPA 5KFWA 2LU1A 1N5YA 2MXYA 3KNGA 2XZTB 1S6UA 1JLAB 3V6DA 1IN0A 3M8RA 5DQGA 3L4BC 4MK8A 2OELA 2CPYA 4USUA 1UJ5A 4ECXA 2B8PA 2CZVC 1HNWJ 1BC6A 2WVFA 3VGVA 4G6VB 2MKSA 1YRTA 2UUCJ 3Q0AA 4B9SA 3NGRA 2KT3A 3NMAA 1JXVA 3R97A 2OMOA 1D1UA 3DDIA 3G4SS 2NLWA 4Q2MA 2EG2A 1X9MA 4WIQA 5DQHA 3P8BB 1L3SA 3N5BA 3VGSA 1HQEB 1FFSB 1NEEA 2NCKL 2ZVSA 2B5JA 1F9HA 2QLJB 1F0XA 2L9WA 2RB7A 4RWWA 1HQUA 2XZWA 1BUXA 5AXKA 3J7YI 1IM4A 3PYEA 3BJYA 3ZZPA 2ASYA 3FUYA 1HW9A 2M0GB 3BSNA 3KDNA 4C8NA 3W5XA 2CA9A 4R25A 2JFDA 2PEBA 1RKIA 1S4FA 4U8YA 4LF6F 1GNKA 4I68A 2MTLA 5E3PA 3CDUA 2EFNA 2BE7D 2OH2A 3THPA 2MY8A 4GRSA 4LVOP 3P45B 4BWJA 4DL7A 1H2UX 1EIYB 1NNDA 2VG7A 3F56A 3V6KA 3A8IA 3DC2A 2NYHA 3M2VB 1EP4B 1TVRB 4N56A 1C2PA 3HHEA 2PMHA 4F4XA 1QUVA 4FNIA 3MM5A 4LSNB 2UXCF 4OJ1A 1N52B 2F5GA 5HQMA 2JLEA 1CLFA 1HBNB 4CLLA 2JEIA 3J7A1 3N4WA 2ZH7A 4X2BA 4EBEA 4MYUA 2W2NP 4IFYB 8AT1B 2PGCA 4E8UA 4IOBA 2CQDA 2HG4A 4QR2A 4TVAB 2HHVA 3T3FA 3MMJA 4QWCA 5E7OB 1RLDA 3RZAA 3KK2A 5ETQA 2J0SD 4DX7A 4NYPA 3D3BJ 2M70A 2XCAA 1HKAA 1R8HA 3BBFA 1NDKA 4PRFA 4DBQA 2MZTA 1J5EJ 3RB0A 3NMRA 4QIEA 1YZ6A 4CLSA 5LMUJ 1ZAWA 4YN3B 3KDOA 4WYLA 2IA6A 2IDEA 4WF9Q 2ACMA 4BLGA 3OJUA 3LPEA 3TX0A 2LVWA 3R5CA 1I51B 4FBUA 1AROP 2B8QA 5KFVA 1TL1A 1HHTP 3ILIA 1TELA 1T9VA 2W4DA 4RBTA 3WIUA 4PG7A 3MM7A 2RJZA 3AJ1A 3KHGA 4HDGA 2G1DA 1FKOA 3L95X 5ETKA 3SV3A 1YHQS 3OXGA 5F8IA 3CCLS 3QFHA 1AYEA 4OQJA 5I42A 4U8VA 3EGVA 1RT3A 1EETB 2JFKA 3CCZA 4QCLA 4UQGA 4ZCLA 3OR1B 1HNZF 1PJ6A 2FJDB 1CBKA 5H9EK 4TLQA 1SC4B 1JJCB 4IRKA 3CEDA 4PUOA 3J7YU 1HWIA 3TW0A 4F25A 2QFJA 1U6ZA 3BEGB 1RYSA 3TR5A 5AJ3F 2YWKA 4YOEA 3CJSA 2DR7A 4U7UD 4X4RA 2FLOA 1TL7A 2IIHA 4CO0A 2BANA 1LKZA 4DS4A 1H6KX 4LRAA 2C2RA 4DQRA 2LU2A 1SJ3P 5ADZA 2ASJA 1QSYA 2KO1A 1MWZA 1K44A 5KFAA 4HHHA 4NLVA 2PA3A 3NGKA 2HMIB 1WHYA 2BQUA 1NKCA 2UU9J 1U8WA 4PWUA 2FQQB 1YI2S 2YX4A 4B9MA 1DARA 3UCGA 2GJ2A 1WTBA 3AA8A 3ET6A 3A8EA 4LF4F 5B0DA 4JP8A 2DNZA 3G87A 5JJBA 4LRBA 2ASLA 4RNFA 3PXGa 1VRUA 3G71S 3M6XA 2HK2A 5J1EB 2LCWA 3NXZA 4WFYA 1FVQA 1PG5B 5D0GA 4JI7F 1ICEB 4USTA 1S0NA 5D4LA 2VC1A 2FJWA 1RWWB 3RJMB 4ECWA 3CVKA 4GKKF 1JJHA 1M5OC 4ED5A 4WU3A 1RT1B 5JUMA 2DRBA 2L9NA 1SCJB 2EC2A 2NUHA 3IA0A 3GSDA 1ZYQA 3LGMA 3OTDA 5ETPA 4M5LA 1N56A 3C46A 4BDPA 3RRKA 4JI2F 3QT6A 3JSYA 1NSQA 1MMLA 2BE2B 4NLQA 3DOLB 1QAIA 2F40A 4IYQA 3K0JA 1RT5B 3KMQA 1XK8A 3M30A 3BPDA 4DR2J 2CJBA 2Y0SD 3DU6A 4MK7A 5F8LA 4I0WA 5KFTA 2DY9A 3BH6B 3L7OA 4OZ2A 5GAGU 2KG1A 4RW4B 2HNZB 3AXKA 3EICA 4JV2A 1VQNS 4DV2F 2E5IA 4PAAA 2VFVA 4F36A 4DR1J 1FWLA 1HNIB 2WVCA 4LF9J 1KNZA 5KG5A 2CQPA 2QLBB 1H74A 1YJNS 4NLGA 2B4UA 4K4ZA 4E98A 1X4GA 2D3O1 3KUGA 3UN5A 1FESA 2XMUA 2CPJA 1VYAA 1FDDA 2HNDB 1WUUA 4DV3F 3MMAA 1E6YB 4FNHA 3V4IA 2X1AA 3CSKA 1H2VZ 1AW0A 3KLFA 3T19A 1JLGA 1SJQA 4WTOB 1R43A 4DCJB 2ZH4A 3W60A 2U1AA 4YUDA 2FHJD 5KT7A 2RT3A 3FVYA 1R8BA 2F65A 4EEYA 1X4DA 1RA6A 3AODA 4EMDA 1WORA 2JHEA 1VHIA 3I9V9 3H5YA 4OYXA 1PBAA 3QO9B 2F9JA 3EJMA 7AT1B 3CCQS 3NNHA 3BREA 7FDRA 1PAEX 4L73A 1GXLA 1Y5LB 2RHSB 3G82B 5L9XA 2O66A 1C0TA 3HT0A 2HRYA 2VD3A 4CLWA 2CADA 4YMEA 4JV5J 4I7FB 5FJ4A 3QQCD 5E41A 2XLJA 3N6NA 5EWEA 1FJCA 3OTOF 2V2ZA 1IWAA 1S6PB 4IFVB 2XI3A 5T14A 2FC9A 2DNKA 3Q2SC 1PJ7A 2ZH5A 4KFBB 4KC5A 2OEJA 2XEXA 2IJFA 3K59A 1UPMB 3LPYA 3C15A 2Q43A 2E1RA 4PG6A 3TUZC 2WVDA 1N6QA 4OV6A 4NOHA 1U1PA 3ZTRA 3NCRA 2QL9B 1U6BA 3ZNJ1 5DQIA 2MLZA 3MEEB 1LWXA 3C6UA 1RSCA 2B4VA 1N8RT 4ENOA 3KHHA 1F2GA 3UNYA 2FB0A 1KEKA 4FVMA 1HWJA 2VFUA 1N0VC 5J1PA 4DXLA 2D9OA 4NEYA 3CCJS 4HT5A 4DV4F 2V4JB 1WEXA 1T11A 3GMGA 1QE1B 2XC9A 1FXRA 1T3OA 5HVHA 4BWMA 1RHMB 1WJ9A 3AY0A 5M2PA 4O3OA 5HJYA 4CWBA 2AW0A 1C1CA 2P6SA 2YKAA 3M32B 2O3DA 2K1RA 4RUHA 4KQZA 3FEYB 1WACA 2W25A 2CNKB 3LP2A 2HNYB 4MIWA 5EGYA 4U7CA 2DNPA 3BKTA 3OR2B 4DI6A 2X7IA 2ZITA 4K4XA 3EDQB 3G8QA 1LK5A 1RGVA 1XNRJ 2XCPA 2XSFA 4AD6A 1D3WA 4KGMA 2ZJPQ 3TJ8A 2WSCC 2VODA 4PPZA 2DH9A 4Y2MA 3R5GA 3MM9B 2JWNA 1S1WB 1YBUA 4DQQA 3QZ8A 3GV5B 3KLHB 3FRYA 3ELHA 3SCIE 4C3KA 1YJ9S 4DWIA 2WSFC 2XMAA 1QLNA 1NAQA 3RGIA 2QL7B 2BJDA 3R8YA 2QMUB 3CO9A 3G6ES 4DV7F 2GW8A 3QT8A 1TFWA 2M7SA 1HYSA 2L41A 1SKSA 3EE3A 2IA0A 1FF2A 1TKTA 1BQNB 1UKUA 5DDPC 2DHGA 4M94A 3PX0A 2CJXB 5C25A 4NZ0A 4DOZA 3OHAA 9ATCB 4HTJA 2M4MA 3NNCA 5L46A 1VQLS 4OHVA 1YKWA 2OD4A 5A8RB 4WP3A 3F41A 4CDIA 1UJ4A 3CCSS 2W2PP 3QWUA 1NM2A 1S0VA 4KGVB 4OYAA 2ZD1A 4M5NA 1RTIB 1Y0HA 4MTPA 1VQKS 1JLCB 2KRBA 4KH0B 1WG4A 2J9DE 3VV2B 4UOFA 4JI8F 1RBOB 4QWBA 3FK4A 2HAIA 4LFBJ 5L9NA 1K9MT 1NKBA 3RAQA 3JSRA 3H4BA 4AT1B 3D3CJ 2FVRA 3M7VA 3NGTA 2ZJQQ 2EWHA 1Q8KA 4EI2A 4I6WA 4LF8F 1APSA 2W1BA 4WYWA 4WK1A 1YJRA 1JXLA 2VG6A 5KG1A 2J0WA 2HS4A 4AL6A 3MFIA 1D09B 1LNQA 2ZH3A 1SV5B 4J9VA 1YRXA 1SQGA 3DMJA 1Q5YA 1JLFB 3U1MA 4C8ZA 5HAOA 4NCAA 1X4BA 4I4BA 2J6TA 1RAEB 3HHLA 4CRJA 5HMYA 2Z30B 2HBRB 2XBPA 2YNGB 1UJ6A 5GADI 3W2VB 4LJMA 2B43A 4DPYA 4FXWA 2D3OR 2Z57B 1BXNA 4Z37A 2BJ7A 1FE0A 1VIXA 1S79A 5DDQC 5T41A 1VBYA 4WJBA 2JH3A 1EHWA 2NSBA 4L3KA 5JVGQ 2L9DA 3MM8A 4EBCA 1VQ7S 3C6TA 2GMLA 4Y65A 2XQCA 1HR0J 3S6EA 2JSXA 5LJ5Y 2LEBA 4DDFA 4CTAA 1M0SA 2DO0A 1VQOS 4P72A 2IAJA 3JSMB 2MYFA 4QQBA 5J2QB 1ZPVA 5ETTA 1AA1B 3GTYX 4J91A 4ELVA 2XNRA 4YDXA 1S6QB 1LWFB 3R6GB 4F0MA 3P49B 5CYJA 1LXNA 1SIZA 1RBAA 3TQEA 4OIXA 3MPDA 5C42A 4PQAA 3ENQA 4MKVA 2HVIA 2LXIA 4ED4A 2DGWA 1J2VA 4J9RA 2YKNB 2W2MP 4ICLA 3SQGA 5KFFA 3SCKE 1B3TA 2ILZA 2BKNA 3H20A 3U7JA 2AYEA 2Q6CA 3TYTA 3DLGA 2CNOB 2LDIA 1S1UA 2DH8A 3PYGA 4XTTA 1G1XA 3CDBA 1HBMB 3HVWA 2CPEA 4KKOA 2GA7A 3JTOA 1G3OA 4PXCA 4ZDNA 1S49A 1VRTB 1B7YB 2I8EA 2UVVA 1M5SA 1NPKA 1YJTA 5LOQA 1FNXH 2KZZA 2ADBA 2FUG9 2KVQE 2W7PA 3E01B 1X0PA 4IOAQ 3FBCA 3PO5A 1U24A 2J0QD 1HBOA 1YJUA 4DL5A 1WOPA 3PO4A 1WKLA 3GCWP 4QR1A 4AL7A 1NK4A 2XZDB 1DFDA 4NLRA 1LFWA 1L3KA 4C0HA 3K5MA 2WHOA 4A8WA 4O4RA 4NA2A 4UUXA 3PKMA 1HWKA 1A0OB 1HA1A 2YNIA 4FXVA 1YGYA 1KBRA 1SC3B 3MAAA 3QJJA 4TU8A 2PC6A 3MR2A 1SKRA 4CLZA 5GADU 4H4MA 4ZVHA 3BQ0A 3C14A 4DU8A 1KONA 1V9OA 2MKKA 4Q8FA 4NXNJ 2OEMA 1F1BB 2E7WA 3CJKA 3FMWA 1LW0A 3LP1B 2M8HA 3MR7A 1RTHB 2L48A 2WZ1A 1S9GA 1FDBA 2X1FA 5EX0A 3MEDA 5A0YB 3PR5B 1CJKB 1EB0A 2WSEC 1EARA 2K06A 1RLCL 1IQZA 1OIAA 2XYPB 2R7TA 1O6XA 1E6VA 1DTTA 1ZS6A 1TTHB 2PFFB 1WHXA 1F9FA 4B9TA 3T5KA 4DR6J 1RDRA 1RP5A 5CYQA 3UD5A 1RHKB 2JC0A 2J6SA 1X4CA 3BYPA 1S1VA 2HURA 4MK9A 3GG0A 1RCOB 1U8SA 1KSPA 2OJ3A 2HZAA 4PXEA 3UPFA 4ED8A 3NG8A 1CSJA 4ZHRB 2P6TA 3PRVA 1S7HA 4FKYA 4A4JA 4HYKA 4HI1A 3NS6A 3THVA 4Z7YA 4OYMA 3OVSA 3KXDA 3JYTA 1T03B 4TU9A 1WI6A 4RZRA 1N33F 2AKWB 4CCHA 3U02A 3FFIB 2HFVA 1CJVB 2PI5A 2E7VA 2QIFA 2CPFA 2N82B 1PKUA 4UW2A 1X8DA 1S9EA 4I2QA 4DSKA 4RW6A 4QOTA 2YWFA 4DR7J 4HACA 1FRLA 1Q7LB 3GPAA 1KTVA 2NQPA 5I3QA 5GMKa 1EAYC 1FX2A 2JC1A 2E1PA 1UWAA 2BJ8A 5KG2A 5BYRA 2EKNA 2P9GA 4GKKJ 2W9CA 3SMZA 4HH0A 3DYAB 3I9ZA 3PNIA 3TUPA 3IC1A 2IBOA 4KV8A 1HMVA 4IRDA 4IG3B 3PACA 2XGQA 1FWPA 1YK9A 2QEXS 3EUNA 2CZ4A 1WI8A 3H42A 4MYTA 3R6LB 3U27A 1WOOA 4ATNA 4ZPWR 2DEIA 4EZ6A 4C0BA 1SKWA 2OHDA 4I56A 1N32F 5A8WA 2HBYB 1Z2ZA 2CQBA 2ZNYA 3I5AA 5DG7A 4N8NA 4DQSA 1TV6B 1JLQB 2PE8A 4BHQA 4URGA 2I2YA 1EQ0A 5D4PA 4B3MJ 5C24B 4K7QA 2BXJA 2OMLA 3JQKA 2ADCA 1SI9A 2QSFA 2QYGA 2V6AA 3MR3A 2QV6A 2VKZG 4F26A 3KLEA 3PFEA 1R0CB 2VQEJ 3QGPA 2CG4A 2IM1A 2HKEA 3W3SA 3KUHA 3H0PA 5EN1A 3GILA 4ECUA 3JQMA 1RAGB 1EJ7L 1W7WA 4WBFA 3CD5A 3NOGA 4DPUA 2RQMA 1B4SA 1HPZB 2R7UA 3UCZP 4K5SA 2QFIA 4OI3A 1AFJA 1JLAA 3NS5A 3T5HA 1XMOF 2LQ5A 1YZ7A 2R7VA 5L39A 1VC6A 4RWXA 3ZZRA 1ZPWX 2FY8A 5LT5A 3UFCX 1PIEA 2AV5A 5FD1A 4NRTA 2E9RX 4LQ9A 1S10A 4GKJF 2Q66A 3K5OA 4DJBA 5D8HB 2RU9A 2MKCA 4F0KA 3ICLA 1OMSA 3QATA 2AYBA 1C4AA 4KGXB 2NR0A 1SL2A 1IBKF 5B0FA 4DLGA 1K8AT 2H4YB 1Y3KA 4Q2LA 1HQEA 2Q79A 2G0CA 5KG4A 1NU4A 4I69A 2ZZTA 1VQ6S 3VVTA 3JAMY 1UTAA 4BCAA 4OJGA 2F8EX 4KHMA 3K5NA 2GS8A 2XWXA 2WK4A 2DGQA 2QT7A 4DPXA 2VBWA 2WBMA 3VAGA 3EMTA 3ENVA 2HQ3A 2UXDF 2KZMA 3IBWA 2E29A 4P7TA 1K73T 4FYYB 1XERA 2E66A 2EBGA 1JLEB 2P9EA 2OTLS 4G65A 4CYUB 1UWBB 1QSSA 3ZZ0A 3EGNA 4DV0F 3M2VA 1EP4A 4IQMA 3NWRA 3MXHP 3T6BA 5C7PA 3V6HA 3KJFB 3R5DA 5H1SV 1Q78A 4KTQA 1RWVB 2MQMA 3B82A 2H5IB 3H98A 4EO8A 3F0NA 3PRDA 4LSNA 1SKUB 1RTDB 5B0GA 2FJBB 2KFYA 3FEXB 4H54A 1DY3A 1HBNA 3TVZA 3M9OB 1RWXB 2WOMB 4WKRA 3DNCA 4IFYA 2NYIA 2DXDA 4KIAA 2UXBF 1Y5NB 4CH0S 3KK3B 2XYHB 4DV1J 1WDDA 2HZCA 2BJ1A 2HQIA 4RNMA 1ZM9A 2FHOB 2C3UA 4DFJA 3EPIA 2HFNA 1TUWA 1T95A 1W2IA 2G2OA 4CNYA 1KOHA 3KYLA 5DM6Q 4C8YA 3BDEA 4OX9F 3DGPB 2F4VJ 2G9OA 2YKOA 2HWIA 5HBMB 1FRMA 1VQMS 2DRAA 2V2QA 2DD8S 1IKYB 3Q8SB 1FK9B 3UE2A 2CNNB 2XMTA 4DR5J 5KFQA 3M2UB 4X66F 3M1VB 1RHUB 2YY3A 2RRNA 4LFCJ 2AIRB 5F8GA 3H7HB 2E5LF 2R8IA 2PMWA 5A8KB 2CG8A 1NSKL 3EGWB 1OSCA 2A0FB 3HVTB 5GVQA 3UO0A 5KT2A 2AZ1A 1WF2A 4Q5VA 1KTQA 2XMMA 1FEEA 2V8HA 2UUTA 3Q22A 4M5JA 2A10A 3TJAA 1HNVA 2RDIA 4DLEA 3PX4A 1FO1A 1SXLA 1HNXJ 4I2PB 1OY8A 3IM9A 3PDNA 1A7GE 4JI6J 5HATA 4O3QA 2CJKA 5I3PA 1DTQA 3HFZB 5IWAJ 5EWGA 1Q0NA 2GO8A 4OZ0A 2OO4A 1UCNA 3OR1A 3DRSA 3M8QB 4KPYA 2BOAA 1KS2A 5BR8J 3Q24A 1U26A 3VAMA 2CVIA 4EGLA 4LSLA 3BO3A 3W9IA 2KTQA 3ULHA 2ZC3A 4F3MA 2IBKA 4QWAA 2BJ3A 1JWWA 3ETMA 1BMQB 4TNOA 2L08A 2KT2A 1B64A 2B9EA 2C2ZB 2BQ3A 1W2BR 3DKDA 2VOOA 3D6MB 3PKYA 2RKIB 1IKXB 2AF6A 1IBMJ 3KLIA 1UETA 2WONB 4JI1F 5D78A 2GIQA 2GZOA 5HMXA 4W92B 4HT7A 3AHPA 3W1YC 5AE3A 1XR7A 4H4KA 1QAXA 1Q7YT 2HMIA 5E3QA 3VTIA 1GX6A 3MPVA 4RL1A 4LQ3A 5SUHA 3B54A 4ZVRB 4OHWA 3D9BA 2UZAA 3KNAA 4OZLA 4ZPBA 4P75A 4C9DA 3EWGA 2Y1LB 4USJC 2V67A 3GG1A 2A2CA 1G4CA 3GB0A 3CT9A 3K2YA 1ZM3A 3ZZZA 5J1EA 1NK5A 1VR6A 5DM7Q 1KN6A 3KKFA 3MAQA 3BKFA 4IR9A 4CP5A 4ZLNA 2ZVIA 4RBVA 3BSCA 4USIA 3CD6S 3IN5A 1RABB 4DV5J 5AXMA 1RT1A 4YB7A 4XAKA 3SCJE 4FVCA 2RF2B 2VV5A 2FYXA 3UWTA 3NL0A 1RJJA 3M8ZA 3AD7C 3BN4A 2R8JA 4NA3A 4ZOSA 3TAMB 1VBXA 3GZ7A 1R31A 4RU2A 2BE2A 4QYZJ 3Q8UA 1EZZB 4G1IA 1RT4B 2WW8A 1RT5A 3C19A 4B02A 1I94F 1RTJB 3DGVA 3QYYA 4WFBQ 2VU5A 1MU2B 3MECB 4IO1A 3GJQB 1ZA2B 2AYGA 5K14A 2HNZA 3UQSA 1SH2A 3CDAA 3DLEB 4N47A 4M5IA 3UR0A 4O0IA 2VG5A 4K59A 1I5OB 3BM7A 2DEJA 1C4CA 1U2CA 5KFGA 5F8MA 5GAEI 9RUBA 3LA0A 5F8HA 3HLUA 2HBQB 1NDCA 4CQ1A 3LQVA 1CULB 3GJTB 3CD0A 2KH9A 1ZBTA 1I6JA 4NLTA 2HNDA 1T7PA 2WB1D 3FMBA 5L1KA 4MJKA 2E9TA 3CCWA 1E6YA 2RVJA 2LKZA 3DCAA 1IWGA 3OFHA 1PSDA 4JI3J 2DNHA 4J9NA 3PFOA 3GJRB 2DYAA 3VAKA 3R1HA 5J2MB 5G0RB 1FTRA 1OY9A 5HVFA 4PG5A 2XO6A 3OUYB 3M4XA 4X4PA 2X3GA 4ALZA 4OYZA 4ZLPA 3LO3A 5ETLA 4WFAQ 3MCSA 4OI2A 4C0OC 5A76A 1VIOA 2YWGA 1TAQA 3G2XA 4PG8A 5E5NA 3W9HA 2ZC4A 1UEUA 1WEYA 2JEJA 4NRUA 3B6BA 1N34J 2MGZB 3G82A 2R7RA 2RIJA 1AXQA 3OT9A 4I7FA 4OZ1A 2JJ4D 3Q23A 1LK7A 5GAHI 2N4DA 2BACA 3LAMA 1VBKA 3VVUA 2H48B 3L7PA 4C3MA 4IFVA 3OVAA 4K0KF 1GQEA 3GFYA 4UTGA 5HMWA 1QM9A 4QWDA 1I3OB 1FRKA 1TR0A 1R7IA 4P71A 4B17A 2I38A 1NB7A 4IG0B 5IC6B 3NKYA 2IVFB 4YDDB 2DHHA 5ETRA 2ZM6F 1T9UA 1AFIA 4DUYF 3WDOA 1WF0A 5KFMA 4B9VA 1S1TB 4ED2A 3LWMA 3MEEA 4N8OA 2BA9A 4KYZA 5KOWA 4M5DB 2N3LA 4A8YA 4YY3F 4NWBA 3ZXWA 2WAQD 2IC3A 3THTA 5L1IA 4JI0F 1OPZA 4LF5F 4P10A 2V4JA 1QE1A 4DG1B 3CJTA 3B4DA 3W5YA 2HS0A 1N5YB 1SH0A 5GAEU 6FD1A 2Y3YA 1RK8A 2XO7A 4ZP8A 2VH7A 3D7SB 4OI1A 4OX6A 3GIRA 2HGLA 4GC6A 3M32A 2YBVA 1G7CB 3M6UA 1TU0B 3TA2A 1S72S 2DH7A 2NXUA 3A4TA 3M6VA 3ILJA 5AT1B 3TA0A 2COLA 3OR2A 1U09A 3D0IE 1UFWA 3TVKA 3W8GA 2YX1A 1MMDA 1NH8A 5KAKA 2NUUG 2YKQA 4B3OA 4QU6A 3CGIA 4F0HA 4Z2XA 3HFVA 3UI3A 3WX8A 2KHDA 1BY9A 3RBEA 3MM9A 2QA4S 2B5JB 4AUKA 3GU0A 3KJNB 2UV8A 1RAAB 3KLHA 3C3LA 4V1Ak 3RB4A 5CYMB 1N4LA 1RCXB 1XN9A 3IAM9 3Q8QB 2E1MC 3MEGB 4ED7A 2DR8A 4X4NA 1XJWB 3MTJA 5KFIA 2ABYA 2XMVA 1BQNA 1QTNB 1DRZA 3QFWA 4HH1A 3QAUA 3MEKA 1FRXA 4ZA1A 4PEOA 1M1HA 2KYXA 4OZ3A 2C28A 2D3UA 2DK2A 3EZOA 3MPWA 3BKUA 5A8RA 3US5A 4YR0A 5GAHU 2A6OA 2P2CB 2R7QA 1N36J 4J9UE 2E5JA 2UV8G 1CJTB 3MM5B 1RHQB 2DNGA 2EI5A 1RTIA 5F3TA 2N7CA 4F4AA 3K8WA 5E2QA 4ZVFA 2DNYA 1KRPA 2RSQA 5AE1A 3D66A 3CIZA 3LUYA 1NSAA 3LOUA 1D9FA 1NRKA 1RT2B 2MSSA 2QX0A 1UAWA 3PHEA 5JVHQ 1NHUA 2DPJA 3D0GE 4KSEB 1H7XA 2V68A 3IRXB 1H0HB 1Y4ZB 2C1EB 3BR9A 4LMZA 2AYMA 2J8AA 4MFBB 2YWHA 1SV5A 4X64J 3FSYA 4DN9A 3QT5A 2QRRA 5LL6d 1LWEA 1JLFA 3GR1A 2B6AA 5KFPA 5IFMA 1RUSA 4QPXA 2G0IA 4ED3A 2VC0A 2YNGA 3CXCR 5KFSA 5DDOC 4HHJA 1KHWA 3W2VA 1IBLJ 1NK6A 3NBPB 3PW5A 4KHPF 2BKPA 3MGJA 4O4GB 4ETZA 3KUEA 4NLWA 1NUEA 3LF0A 3VHQA 5I42B 4DX6A 5E3CA 2F1FA 3MMBB 1WTFA 1Y3JA 4Q7AA 1GX5A 4OHZA 1PBUA 2NXEA 2JX2A 4V19J 3D2WA 3SFGA 4DF8A 2G4BA 1M5HA 5A2QY 3JSMA 1NJIT 5J2QA 3IS9B 4CLYA 3RAXA 5KFHA 2DGOA 4CIOA 3PG9A 1S6QA 1TL7B 3T5LA 1LWFA 2V8PA 2CPIA 3ZZTA 4DQPA 2RAQA 4DR4F 1DLOB 3POTB 3IWNC 2EC0A 4FF2A 3IR7B 2FZGB 2GV1A 3R7NB 4P52A 1XEZA 2ZH9A 2C42A 1GXTA 4FPIA 4IH6A 4CT8A 5KT4A 1Q8LA 3SZ2A 2HPUA 3D0HE 1YBTA 1K1QA 4GVBA 2YKNA 3EM1A 1KLMA 3CDWA 4MKYA 4PWDB 3CC7S 2VASA 1XR6A 4OJHA 1UVLA 2VA3A 3TQ1A 2V2VA 5M2UA 4DR3J 1CS4B 1JIHA 3HSJA 3GYNA 4PPDA 4DV6J 1JJ2R 2YKMB 1CJUB 1HBMA 1HIYA 2BUNA 1RT7B 2VICA 5H9EJ 3C8YA 5DDRC 2WTFA 1VRTA 1X60A 3FJ2A 1SJ1A 1WDTA 4IR1A 4DZDA 3CPWR 3TZZA 1S48A 5D0EA 3E01A 3T1YF 1WHVA 3S1TA 1HHQA 5HQLA 1FFWB 4OMFG 1J5OB 4LIWA 4P74A 3I5CA 2W4CA 4U6PA 2LEAA 2MQNA 3NRBA 2IPOB 3ZZUA 4WCEQ 5KG6A 2IYIA 2CWKA 2CJYB 2MQLA 2PMZD 5LMNJ 2CQIA 3GLJA 3TEGA 3KJVB 2Q3PA 4PYDA 4LR7A 1FVSA 1IBCB 1KR4A 2J0XA 1ULRA 1IR2A 4OX9J 4C2MA 2E1CA 4X62F 5IZHA 1P27B 1XC9A 1MLAA 3CE8A 1RWPB 1F6TA 2LDYA 5E33A 3F44A 2HZVA 4J7CA 3M30B 1U1QA 3CUNA 3LP0B 4JI5J 4F4KA 4ED6A 5IT9Y 5L1LA 4HI2A 4EUVA 1RQ0A 2YQ3A 3AA9A 4QPTA 2O1PA 3R2DJ 1S0OA 3LP1A 4KT0C 1RHRB 4B9UA 1RWMB 2ZKUA 1XIQA 1T94A 3KJQB 3CC4S 2OPSB 1NSPA 1RTHA 1XNQJ 1A6LA 2MQPA 1S12A 1ZM4A 2LFVA 2Z58B 2DITA 2HVEA 3ZTPA 3QIDA 3B78A 1CJKA 1QSLA 2YNFB 4JYAJ 2WVBA 4XDDA 1RBLA 4LF2A 3TJ9A 4YHHF 5D15A 1UMJA 2ZH6A 4ZVOB 4BC9A 1OSDA 2CJ9A 5T7LB 2B3TB 4OZNA 4RNNA 4I67A 4G1PA 5J2PB 2O01C 4OX8A 2AEJA 2UVRA 2VQFF 3TVYA 4EFAC 5BYQA 2BW2A 4GMKA 2IYGA 3MMAB 4LT6A 3V4IB 2POKA 2I5JB 3H2LA 3U1NA 2MJUA 2J9EA 5ETSA 4F2SA 4C8LA 3I82A 1RACB 3KLFB 4R0EA 1U48A 4ZKAA 2KXFA 3EXCX 3F73A 3OFFA 4C4WA 2VONA 1OWXA 3NWGA 1U2FA 4ZHRA 2VIHA 2XLIA 2HQFA 2R8KA 1R3NA 2ZWPA 2UUCF 3HVRA 1KQFB 3W65A 3W2WB 3HSGA 4R5PB 3RB3A 3MMCB 4USKA 3WQPA 2DGXA 4L6V3 4MMOA 3IWXA 2HHHJ 4O3NA 2W2OP 5FDLB 3FFIA 4URQU 2HHTA 1CJVA 1ZM2A 2DISA 3O8WA 1S4EA 3I4HX 2NZCA 4CI0B 3J81U 1XTZA 2DXFA 2A2DA 4ZCIA 2X3DA 2W4PA 4P2MA 1P9YA 4K4TA 4NLOA 4UT4A 4I6AA 1S5ZA 2O67A 2R42A 1XMQF 1AUDA 1RAFB 4LF7J 2D1CA 5I3UA 2YWWA 3DYAA 3T9ZA 4CO1A 2OPQA 2BW7A 2SXLA 1N6QB 1LW2A 5KFBA 4J9LA 2EFQA 1PAUB 3HK2A 1QVFR 2C3YA 1V6HA 2DHAA 1TUVA 4ZP7A 1IR1A 1SJ4P 2UUBJ 4A46A 4WE1B 4QIGA 4KO0B 3ZTQA 1U4BA 1TV6A 1TL4A 5B0EA 4ELTA 1JLQA 4ZJQA 2E5HA 4ZVUB 4B3SJ 1VRQC 4DL6A 3NAHA 3H2VE 4QW8A 2DT9A 5C24A 1Y5IB 2AX1A 4ZN3A 5DO2A 1S6OA 2OPRB 4WP8A 3ISND 2GO9A 4FYXB 3PVXA 2QSWA 2HWHA 3GJSB 3R3TA 5MAOA 2UP1A 3HD2A 3T6JA 4Q8EA 3RW7A 4W98A 2HHPA 1J5EF 4A48A 5DZ7A 1GTEA 5LMUF 1TZ0A 3PR4A 1NXIA 2R9LA 1K1SA 2FVSA 3R2CJ 4OHYA 2E44A 1R27B 2HHXA 1U0SA 1HPZA 4ZP9A 5D77A 2YWEA 2NS1B 3SSQA 3RRGA 1N5VA 4MKBA 4DCPB 4B3TJ 4DSLA 2BBEA 2ZZNA 3IGNA 2GGPB 2DNNA 1UZHA 4P2XA 5F8NA 4MAKA 3DRPB 3GSIA 1NJXA 3OHBA 3CMQA 4C97A 1JXEA 3AB2B 3K5LA 1PYOB 4Y2IA 2IJRA 3JB9k 3DRYA 1EKSA 1B70B 3IR6B 3T5JA 3FGVA 1FJGJ 4ECTA 2CDQA 3FCVA 4C11B 2F8HA 4CM2A 3I0RB 2CAJA 3EZ5A 2C2OB 3NGSA 3G6XA 5FIIA 2HGMA 4NPOA 4O3SA 3N6MA 1SQFA 4ILRA 5DLGA 1Q82T 2H5EA 1U25A 1U0HB 4NLYA 2DJWA 4K0KJ 1JJ4A 3K57A 5IXUA 1CVJA 2HLTA 3E3XA 1EQMA 1NHKL 2M3DA 1RXOB 3DN9A 1L3UA 3GV8B 2ILYA 3AH6A 1JLEA 2ZM6J 3DLBA 1UWBA 4DU7A 5HN0A 1X7VA 1KFDA 2J6UA 4KR0B 5CQGA 2YX7A 1JNRB 2PFDA 2DGVA 3MCMA 4FF1A 2NREA 5F9LA 2V9WA 5K8MA 4DL3A 4IUFA 5HQ8A 1K47A 2UU9F 1TKXA 1S0MA 1UVJA 1DZ5A 2DGUA 2VG6B 4EYIB 2LP4A 1RTDA 2AJ2A 2GCFA 4P9SA 4F3QA 4ANDA 1GK8A 2AGPA 3HF5A 1VLYA 3GFZA 3DMJB 2WOMA 3FQKA 5J1NA 3DRRB 1UEKA 3PJXA 4P7VA 4WFZA 2LXUA 3J81j 1S7IA 3UDLA 4TKTA 1AB8A 1C0UA 3S7RA 3HSDA 1V5IB 3UD4P 4OHXA 2R7SA 1TKDA 2A18A 2FHJA 4CLPA 1PILA 2FGCA 4ZP6A 3TUIC 4DN0A 4PCQA 1VISA 3MM8B 1SJFA 4WIIA 3NAIA 4LFAJ 3DGPA 3UN2A 3C6TB 1X9SA 4JI4J 1U2RA 3OPKA 2ZNZA 2J7WA 1IKYA 1FK9A 2I6WA 3PZPA 3M2UA 3M1VA 2MJNA 1REGX 1UVIA 4DR2F 2XMJA 1X5SA 2DNMA 2J5AA 4L74A 5A8KA 3MCOA 4RPFA 2K3KA 3HVTA 2QYCA 2RILA 3T1HJ 1NZAA 4U7UK 2DPIA 3DXBA 3VAFA 1T02A 2BR0A 1TMJA 1MWYA 2QMWA 4I2PA 4QBUA 4ID5B 4OV1A 1SL0A 2EVZA 4DR1F 1X4HA 4UY8T 1X5TA 1L5UA 4FBTA 3RR7A 2CKWA 2MKJA 4PXDA 1FCAA 3Q8VA 4TLRA 4UY85 1T9WA 4LF9F 2C22A 1Y00A 4CLTA 3BR8A 3BQ1A 3M8QA 1AZSB 4A8XA 4QJVA 3BGOP 1PC5A 4ZPAA 1ITPA 2MQ8A 2VHGA 2B4PA 3VZIA 4YQWA 1SQEA 1C1BA 3QIPB 4LR8A 2V94A 2N3OA 2M52A 1CQNA 5L38A 2RRBA 2HAFA 2QLWA 1GTHA 4WTYA 2EG1A 2H3EB 4HHUA 1IKXA 3CWJA 4FS1A 2WW4A 2B9YA 4YP3A 2XHWA 2WONA 3C66A 2CXEA 4B3RJ 4J9QA 4C8OA 3KG4A 2HIYA 4X4VA 1N5SA 1HBOB 2IDLA 2GHVC 4A8OA 3FCHA 2MZ1A 5RUBA 2FZCB 2AJ1A 1YQHA 3OTBA 4TN2A 2MQQA 4Q0BB 3FCWA 2DNQA 3KLVA 1OJ4A 4QIVA 5IT4A 4HTIA 2J9CA 3TO8A 3PW7A 4JV5F 3PRBA 2ZE2A 2ASDA 1WF1A 3QJPA 1BWEA 1U1KA 5KFZA 4J9OA 3CCVS 4ZVEA 1VOMA 4H4MB 1KOOA 3OL9A 1RHJB 2FC8A 4H4OA 1WC1A 3E51A 2KVIA 2DR6A 5FLXU 3K58A 1PGZA 1BLUA 1TL3B 2CQHA 3TAPA 4DSIA 3BV8A 4M8LA 3HT3A 2HLUA 2APOA 2WBRA 1T05A 1ZZNA 1S9GB 4WFXA 4USWA 5LXRA 4FN5A 2OGUA 3MEDB 2DCUB 3PYDA 2UUAJ 1GMUA 2RS8A 2Q6BA 3HHDA 1NJWA 3TAMA 2DNOA 3QLHB 1UP1A 1T3NA 2QO3A 2MSTA 1RT4A 2LXFA 4DUZJ 4J9KA 3SEOA 4NEZA 1RTJA 2ZBIA 5DZ6A 2MKIA 1MU2A 3MECA 1DTTB 2ZOMA 2KDOA 3PJ9A 4ZVSB 4DSEA 1RAIB 3SDEB 4CZCA 2HSEB 5CYQB 2C2EA 3DLEA 1DURA 3DI6B 4YB1P 5CHCB 2M88A 4YEAA 4PWWA 4LREA 4G1QA 3G9CA 4WKYA 2CRLA 1RTZA 4NI2B 1N5QA 5HK4A 1S9FA 1CULA 1SJRA 2VJUA 4QW9A 4QYRA 5SZTA 3OV7A 1KVKA 2D74B 2KN4A 2GMJA 5CCLA 2ZH2A 3NGDA 3WC0A 3H8YA 4BS2A 3AJ2A 3I6PA 3FEZA 3M8WA 1XNRF 3IR5B 3DM2B 4DSJA 3AOCA 2MKHA 2OPPB 4HKQA 3N9UC 1B99A 1N48A 5HP1A 2I0XA 2KU7A 4U67Q 3NLCA 3OSPA 5B0AA 1H7WA 2MMYA 2R4FA 1OYDA 1RAJA 2WRMA 3OTEA 5G0RA 2HYIB 2VPWB 1GMWA 3SI8A 1VQ4S 3BQ2A 4M95A 2EK1A 3ILLA 1VQPS 2X1GA 1SC1B 1JKHB 3MDFA 2W9CB 1HWUA 1NK0A 2PI4A 3RAMA 1MMNA 4NXMJ 2FJEB 1R0AB 3L09A 2CFXA 3ZTOA 4KGZB 2MGZA 1FDNA 3P5TL 4DSFA 2XMWA 3HDSA 2KJWA 1ZTTA 2RUSA 3NGUA 1TL5A 2W9AA 5KG7A 2C2MB 2VBYA 3ONQA 1TK8A 3Q86A 1DQ8A 3QPIA 4FZVA 1DQ9A 5D0RA 2AWZA 4LUBA 1SUQB 2IMWP 5A8WB 1WWHA 2YH1A 2V9KA 1P6TA 5K20B 4ZPDA 4DX8H 4J9PA 3RB6A 3O5TB 1WHWA 4IG0A 3DLJA 4LFBF 1OY6A 2P8IA 4H4KC 1IJFB 5ITHA 2YNHA 2H54B 1FX4A 1S1TA 4NZ7A 2LEPA 4O44B 3W66A 2DR5A 4Q45A 3VQTA 3ISNC 4M5DA 3KLEB 3LH2S 2G0JA 1L3VA 4N76A 1WSRA 4A8SA 2Z2MA 3FC9A 2GQQA 2KI2A 3CC2S 4DG1A 1RKJA 2AEMA 4LF6J 2CQGA 3KLGA 2KRRA 5KT3A 3MI7X 4ECYA 1DJ0A 5HLFB 4WZQA 3TX8A 4FPRA 4ZJLA 3K5PA 4E0DA 1AUSL 1FNMA 1BQXA 2D69A 3LTOA 3MM6B 2PD1A 3SXLA 4NLDA 1T9TA 2ZHBA 4PQUB 3VAIA 1NJYA 3CJ2A 4KJIA 2F9DA 4Y2KA 1OO0B 1S77D 4W90B 1BWVA 2UXCJ 1Y9OA 2MB0B 1WC4A 5IV3A 1HR0F 2PN6A 2BJEA 2D9PA 3EZUA 2M2BA 2RQ4A 1ZAVA 2ACYA 4ANEA 1WC0A 1X4AA 4XPEA 5KFYA 5CYMA 3KWMA 2XNQA 2MLYA 2CIMA 4ZPCA 3P5BP 3KG1A 1LXJA 1W26A 3MEGA 1G6BA 2VJVA 4HL9A 4ZVQB 4B9LA 1XMQJ 3NY0A 2VPXB 3FSIA 5IV4A 3DFEA 1GT8A 4N77A 1M1KT 4NMXA 3J80Y 2B51A 3BGUA 4P73A 3MWBA 3KK1A 3R5BA 3JSBA 2GJIA 1KWMA 4C48A 3CJ4A 2RQKA 3G8TA 4K4YA 2DBBA 3PX6A 5U47A 3RBDA 3IRWP 3MUTP 1CJTA 4Q44A 5IOLA 4OL8A 4WP9A 1TKZB 4LR9A 5B08A 1Q1KA 4IRCA 2PO4A 1HLWA 1QAJA 2B0GA 3HZEA 2YQ1A 3D6HB 3WC2A 2F8MA 4KPCA 4A8FA 4J37A 2HRTA 1U45A 2PT0A 2C3OA 1RT2A 2R8HA 3M8YA 4PKDB 3MFHA 1HNZJ 1QDUB 1YWXA 3EX7B 2ZUGA 3UVJA 3IRXA 4ZVTB 3D1QA 3TWZA 1H3DA 5F3ZA 1IXKA 1GAOA 5AJ3J 4MFBA 5HROB 3P96A 3DLKB 2MZSA 5F8JA 5C2CA 4RW9B 1QY7A 2P5VA 2CZ9A 4WFNQ 4DL4A 3FZBA 2ROEA 2EBEA 3UDVA 3CDEA 4FYVB 3G86A 3FDSA 3GWCA 4ZK7M 4C3LA 3CCRS 5KFNA 4N41A 2R2SA 3IMQJ 5D4NA 4TY8A 2PA8D 4NXNF 3WBZA 1HBUB 1S59A 2HHQA 3I32A 2R3VA 2BJ9A 3FBEA 3NBPA 4WXWA 1HNVB 1YX2A 5GAGI 1HI0P 1NPPA 2CQ0A 4O4GA 2B9WA 3PY8A 4LF4J 4LVNP 3GONA 2DRDA 4DHVA 1DTQB 2RQCA 3IAS9 5ETVA 3MMBA 2OEKA 4ER8A 2V50A 1MW7A 2B4OA 3DRSB 2YVSA 1VBZA 5CXTA 5IS2A 2GMHA 3IWLA 2V8VA 1YTYA 5IT0A 4LSLB 3NS7B 1Q95G 4JI7J 3D68A 3GIKA 4U96A 4DR6F 2VDIA 3IS9A 3HO1A 3CF5Q 3TRGA 1I1GA 4OYOA 1FKPB 1MROB 3BSAA 3LW5C 4UZCA 1DLOA 1S76D 3POTA 3GYXB 3KLIB 3ZFVA 2MDAA 1NK9A 4RJVA 4F67A 3HM9A 4C7QA 3AD8C 2QMXA 4JI2J 3MTKA 4I64A 4F50A 1UVMA 5KFEA 4PWDA 3ILOA 3QBCA 1PC4A 4QIFA 1CS4A 5DGBA 3FQLA 3V4MA 2A1BA 2Y0BB 2JLGA 2L3MA 2YKMA 4NMLA 1CJUA 4FS2A 4FF3A 1QD1A 1RT7A 2XB2D 4DV2J 1KVIA 2KJVA 2Y1IA 3NCPA 2AEFA 4DR7F 2W9BB 1FD8A 4WK3A 1TP7A 4IOCQ 2VPYB 4ECVA 5HL7Q 1J5OA 2FD2A 2DB1A 4A8QA 5B0BA 4LF1A 3QSYB 1HI1A 4V19X 1R6VA 3QAEA 3PTWA 1PYTA 3CULA 3KJVA 2DR9A 4DV3J 2FJVA 2YPZA 3SIPB 5GMDA 2ZJRQ 5B7WA 1FEHA 2V8GA 2WCXA 3OLAA 3QGHA 2V8DA 4ERDA 1F5CA 2GNKA 2KKHA 2Z8QA 1WOSA 2CJQA 3AAWB 2K3IA 2QA1A 4KBIA 3GP9A 3LP0A 4CH1A 4FYWB 3V5RA 5HI7A 5K14B 3HP6A 3MAHA 1RYRA 4HEA9 6FDRA 2C3MA 2AZ3A 2BRKA 1UA0A 1NK8A 5J2NB 4B3MF 3AQOA 2VG5B 2OPSA 2VFTA 2HVZA 3HJFA 3BGFA 1FXDA 3O1LA 1WG5A 3WZ0A 2FLPA 2V5HG 1Y10A 2BOPA 3N5FA 3KG0A 2YNFA 3BF4A 3D6FB 5DG9A 3S01A 3R1LA 4RW8B 1H98A 3DOKB 4MIBA 1VC5A 3BGRB 2BE9B 5T7LA 2VQEF 5J2PA 4QIWD 1X9WA 4AYBD 3OTOJ 1U7LA 3C2PA 1NPRA 3TEHB 4R8UB 4YB5A 4A47A 3RYLA 4WWSA 4OJ3A 3OTCA 2G2YA 2I5JA 2ALYB 4Y3CA 2BX6A 4NYZA 3VF0B 3M05A 2HQCA 4FP9A 3OXLA 4ZN1A 1JK9B 2OFGX 1Q86T 1D0EA 4DFMA 2GIFA 2BKOA 4LRFA 1LWCB 4LBPA 1ZA1B 3N0VA 2GFFA 1TVRA 3ITHB 3W2WA 3UCUP 4OZJA 1OPIA 1RT6B 4R5PA 5K8NA 2B7CB 3MMCA 1UW9A 1Q16B 1XMBA 2GVZB 4IDKB 3AFGA 2GX8A 1XBWA 4AFFA 4Y34A 3WX4A 2F3JA 1VCTA 5FDLA 1REVB 4DV4J 2G2ZA 3DU5A 1JMTA 1YRUA 3V6JA 3HKZD 4S0MA 2PIIA 2LLZA 4Y6IA 3B8HA 3VGUA 1X5PA 2HHSA 2XY5A 3A3PB 1RAHB 1F3FA 5CZVA 2DHXA 4F7VA 1IM6A 1VI7A 3RW6A 5LSLA 1U49A 1T8EA 1YJWS 3AJDA 1RAOA 2KM8C 1RI7A 5IM0B 3M2RB 2PDAA 2IRUA 1MWQA 1JX4A 3RBXA 1H38A 2ZH8A 2FHMA 3ETOA 2HW3A 1F9EB 1FI4A 2ZDOA 4KRWA 2Z2ZA 2EFVA 3PW2A 2KFZA 2RHQB 4F4WA 4TQSA 1IKWB 3Q8PB 2Z2LA 4WE1A 2U2FA 4X84A 4KO0A 1GH8A 2IC3B 3NP5A 2V69A 5ETOA 4DF4A 2W8LA 5DGAA 4DV7J 1HL6A 2RMLA 5DETA 4DCOB 1CPZA 2X51A 2OSQA 1EETA 2C2NA 3PYFA 1MN9A 4NLXA 4LBHA 1DHMA 1RZMA 1T9YA 2RE1A 4DV1F 3BH7B 2OPRA 2RUGA 2NSCA 3OL6A 2R7XA 4MIAA 1AT1B 1F5AA 1LQ9A 1HQ2A 2FTRA 3HVAA 4Y00A 3WIVA 3IXQA 1FRHA 1U1LA 4ZVPB 4KY3A 1BQMB 1WC6A 3RTVA 4N7TA 2F4VF 3CCUS 4NCBA 4B3OB 3MPUB 4K8RA 4RW7B 2OLWA 3I0SB 2VFRA 4EWTA 4M5HA 4JI8J 4DR5F 1SB6A 1WC5A 4LFCF 3SSSA 2IVMA 1T9XA 1TFYA 2IM2A 2DVIA 3C16B 1U1OA 1VHFA 3D1OA 2V4QA 3HXMA 4UOGA 2GGPA 1SC6A 3E8OA 2J8SA 2GAGC 3DRPA 4NCGB 1JLBB 2XYGB 1HNXF 4LF8J 1U1NA 4TU7A 2CNLB 3BBCA 3D6TB 3J81Y 4JI6F 2XSJB 5A2QU 2ZZMA 1SL1A 2VF3A 5IWAF 2FVPA 7FD1A 2FZKB 4EK2A 3OL7A 3FSXA 2NPIA 1K0TA 4ZCKA 3R7BB 5BR8F 4QWEA 4C11A 3I0RA 3TAQA 5ETMA 5AXLA 3MCNA 1VJWA 2ZH1A 1QTMA 1ROFA 3BO2A 4IH5A 3EXYA 5D4OA 5BXIA 2GVDB 5KOXA 1U0HA 5HVGA 3VCDA 1BD6A 3KFWX 4ECRA 2LMIA 3NNAA 4L72B 2XS2A 1IBMF 2V34A 4M1KA 2IRYA 1YJ7A 1FERA 5L8RC 2UVWA 3OQ2A 1G2EA 4P2FA 2EFPA 1YIJS 2CWXA 3PJWA 1NMEB 2DXEA 2H4WB 3VQSA 3X3UA 3T9NA 4OZ5A 3DOLA 5A6WA 1VFJA 3IP0A 1IKVB 4USMA 2DGSA 3BO4A 3D4JA 4OYPA 2IM3A 2DIUA 1M5VC 1UEVA 5DG8A 1M1GA 3CJ5A 1FNOA 4IQXA 4NLUA 4RW4A 3AD9C 2VZ9A 4KE5A 5IQ6A 1GMWD 4OYIA 2JVRA 3PW0A 4NA1A 3M8PB 4CNZA 4DL2A 4RR5A 1P8GA 1A9NB 1LWEB 3DOMB 1CC8A 3DRRA 2B6AB 3A13A 1HNIA 1YG0A 1FFGB 2RS2A 4LSZB 5K8PA 4EU0A 4J90A 2XTJP 4Y28C 5KT6A 4E2FB 4I6YA 4DV5F 1N0UA 2LECA 3MOJB 4F4ZA 3HD1A 3QGIA 1TUGB 5F41A 4ES1A 1V3RA 1OQ3A 2M5YA 3JQJA 3I5BA 2AX0A 3HHLD 2B56A 3HPOA 4FF4A 2ZHOA 5D3GB 3OXFA 2MZRA 3SCLE 1VQ5S 5IT9U 3SV4A 1GMVA 1KLNA 1GXUA 1KD1T 4OX7A 8RUCA 3CIMA 5THWA 4A8KA 2Y1JA 3QWPA 1UW4A 3DXSX 2FIUA 3ZC4A 3H2UB 3QO9A 2I1RA 2YKPA 2HFOA 3UDEA 3R7SB 2H9ZA 1H73A 3IBFB 4Z7CA 4RNHA 4ID5A 2IM0A 2HHUA 2JRSA 2IJNA 3CJ8A 2KM8B 2BDPA 3PM9A 5LJ3Y 4F3OA 4Y2CA 3KHRA 3UDCA 1HW8A 1S1XB 3SBMA 2JNJA 2HQGA 2Z56B 1AZSA 5K8OA 4UF4A 3PEHA 4GVBB 4NLPA 4CO3A 2D3ZA 1KLMB 2MKYA 3IG1B 4O3PA 1YDLA 3R5JB 2AJ4A 1D8ZA 3QIPA 2IVYA 1QUPA 3DLHA 1S6PA 2H1YA 3QZ7A 4JV0A 2ZDPA 3HULA 2CJAA 2AGOA 6AT1B 3QJLA 4KFBA 3W7BA 1JB0C 4F02A 3H59A 5KFLA 1CQMA 4JI3F 3M9NB 2H5JB 1TAUA 1YBAA 4P2SA 2PSZA 3IFEA 2AGQA 1R89A 3I55S
chains in the Genus database with same CATH topology
1X5SA 2DNMA 2J5AA 3ISZA 3H98A 5A8KA 4EO8A 3PRDA 2EG2A 4LSNA 1X9MA 2K3KA 1L3TA 5DQHA 3HVTA 1RTDB 2QYCA 1L3SA 4AQYF 1FRIA 2RILA 5B0GA 2FJBB 2KFYA 3H40A 1NZAA 3FEXB 4H54A 4U7UK 2DPIA 3T1AA 1HBNA 3DXBA 3N5BA 1HQEB 3TVZA 1NEEA 3V81B 3VAFA 3M9OB 1VC0A 1T02A 2ZVSA 2B5JA 2WOMB 2BR0A 4WKRA 3DNCA 1KFSA 2QMWA 1MWYA 4I2PA 4QBUA 1F0XA 2L9WA 2RB7A 4RWWA 4IFYA 4ECZA 2NYIA 1HQUA 2XZWA 4ID5B 5AXKA 4OV1A 1SL0A 2EVZA 4DR1F 1X4HA 4UY8T 4KIAA 1X5TA 3J7YI 1L5UA 1IM4A 2UXBF 3BJYA 1Y5NB 1P1LA 4CH0S 3ZZPA 3RR7A 2ASYA 2CKWA 3HHKA 5M2RA 4FBTA 2MKJA 4ILLA 3AB4B 4PXDA 3KK3B 1FCAA 1HW9A 2M0GB 3BSNA 4Q0BA 4TLRA 1N34F 4UY85 4LF9F 2C22A 1Y00A 3PW4A 1FT8A 5H9FJ 2HZCA 3BR8A 4C8NA 2HQIA 2JL9A 3BQ1A 4RNMA 3M8QA 4R25A 1ZM9A 4A8XA 2JFDA 4BC7A 5LXYA 1RKIA 4QJVA 1S4FA 2FHOB 1PC5A 2C3UA 1S97A 4DFJA 4ECSA 3V6DB 3EPIA 1KQSR 4LF6F 1GNKA 4I68A 2HFNA 4ZPAA 5L1JA 1T95A 1W2IA 3I31A 5E3PA 2FY1A 2B4PA 1B0TA 3CDUA 3VZIA 4YQWA 2EFNA 2OH2A 4CNYA 1KOHA 1SQEA 2CQ1A 2MY8A 3THPA 5I4MA 1C1BA 3KYLA 5DM6Q 4J9MA 1FDAA 3QIPB 4LVOP 4C8YA 4BWJA 4DL7A 1H2UX 1Q4RA 3BDEA 4OX9F 1NJZA 2V94A 3SYZA 1NNDA 2G9OA 4PR6A 2HNYA 2N3OA 2YKOA 2HWIA 4ZCMA 2VG7A 2M52A 5HBMB 1CQNA 1FRMA 1VQMS 3F56A 3V6KA 2DRAA 3DC2A 2DD8S 5L38A 1IKYB 3Q8SB 1FK9B 2RRBA 3M2VB 3UE2A 1EP4B 5K9FA 2QLWA 1GTHA 2J9DA 1TVRB 1TL3A 2XMTA 4WTYA 5KFQA 2EG1A 3M2UB 1X5OA 4X66F 4N56A 3M1VB 3MUMP 1IKXA 1C2PA 3HHEA 3CWJA 2YY3A 2RRNA 2LQ9A 4FS1A 5F8GA 2PMHA 4F4XA 2B9YA 2E5LF 2R8IA 4YP3A 2B9XA 2ALZA 1QUVA 2XHWA 3H5XA 2WONA 3C66A 4FNIA 5A8KB 2OD6A 2IHR1 3MM5A 4LSNB 3EGWB 1OSCA 5GVQA 3HVTB 2UXCF 3EGZA 4OJ1A 2G13A 1N52B 5KT2A 4J9QA 2EFGA 1WF2A 4Q5VA 2JLEA 1SIWB 5KFXA 4C8OA 3KG4A 1KTQA 2XMMA 1FEEA 1CLFA 1HBNB 2UUTA 2V8HA 1Q81T 3QLHA 3Q22A 2A10A 2JEIA 1S1WA 4X4VA 1HNVA 2RDIA 4CO4A 4DLEA 3PX4A 1FO1A 1N5SA 3JTPA 3CJ0A 1HBOB 1SXLA 2D41A 3N4WA 2ZH7A 1FE4A 2RDJA 3J7A1 4X2BA 2GHVC 4I2PB 4A8OA 4MYUA 4EBEA 4IFYB 3FCHA 1HQUB 2PGCA 4E8UA 2P9CA 3PDNA 1A7GE 4IOBA 2MZ1A 2CQDA 3G6YA 4O3QA 2HG4A 2AJ1A 3LALA 4QR2A 2CJKA 5I3PA 1DTQA 5EWGA 1YQHA 2HHVA 3OTBA 3T3FA 3KMSA 3MMJA 4QWCA 5E7OB 2GO8A 4OZ0A 2OO4A 4TN2A 5BYSA 2MQQA 4Q0BB 3RZAA 4ED0A 3KK2A 2DNQA 3OR1A 3HFKA 3KLVA 4WZMA 3DRSA 3SDEA 4QIVA 5IT4A 4HTIA 2J0SD 2J9CA 4NYPA 3TO8A 3MUVP 2KXNB 3M8QB 4KPYA 2M70A 3PIOQ 1KS2A 3Q24A 3PW7A 2JEGA 1U26A 2XCAA 3VAMA 2CVIA 1R8HA 2N4CA 4EGLA 4JV5F 3PRBA 4LSLA 2ZE2A 4K50A 2ASDA 4DBQA 3DI6A 2MZTA 3BO3A 4PRFA 2KTQA 4OLPA 2AJ0A 3ULHA 1WF1A 3QJPA 1BWEA 2ZC3A 3FNNA 1U1KA 4F3MA 3RB0A 5KFZA 3NMRA 1Q8BA 4J9OA 4EZ9A 5F0UA 4QIEA 2ROPA 2IBKA 4QWAA 3CCVS 4ZVEA 1VOMA 1ZAWA 3M6WA 4H4MB 1KOOA 4ID8A 3OL9A 1JWWA 5JXSA 2FC8A 4H4OA 2VG7B 5DJBA 3E51A 4WYLA 1ZAXA 2KVIA 4TNOA 2L08A 2IA6A 3K58A 2JVOA 2KT2A 1PGZA 1B64A 4WF9Q 1BLUA 2BQ3A 1W2BR 2VOOA 1TL3B 2CQHA 3PKYA 3OJUA 3A1YG 3TAPA 2RKIB 1IKXB 4DSIA 2Z4PA 2AF6A 3KLIA 2LVWA 4M8LA 3HT3A 2HLUA 2APOA 1UETA 2WBRA 1CC7A 1SH3A 1T05A 1HARA 3R5CA 1ZZNA 1S9GB 3Q8RB 4WFXA 2WONB 4FBUA 3DM2A 4JI1F 5D78A 5LXRA 4FN5A 1AROP 2GIQA 3MEDB 3PV8A 2DCUB 2OPPA 5KFVA 1RA7A 1TL1A 1HHTP 5HMXA 3G8SA 1JLCA 3B4MA 4W92B 2RS8A 2Q6BA 2W4DA 4HT7A 3HHDA 1NJWA 3TAMA 2DNOA 3AHPA 5AE3A 1XR7A 3QLHB 4RBTA 4PG7A 3MM7A 1FHTA 4H4KA 2RJZA 3AJ1A 3KHGA 1UP1A 4HDGA 1QAXA 2G1DA 1FKOA 3L95X 4WXOA 1T3NA 1Q7YT 2QO3A 2HMIA 2MSTA 1RT4A 2LXFA 5E3QA 3VTIA 2Q1LA 1GX6A 3SEOA 4J9KA 3SV3A 1YHQS 4RUAA 3CB4A 1RTJA 3MPVA 3OXGA 5F8IA 4DQIA 2ZBIA 3CCLS 4OQJA 4LQ3A 2MKIA 1MU2A 3MECA 2VPZB 5SUHA 5I42A 1DTTB 3IO1A 4OHWA 1RT3A 2UZAA 3KNAA 1EETB 2ZOMA 2KDOA 4OZLA 2JFKA 3CCZA 4ZPBA 4QCLA 1IR0A 2XI2A 3KK2B 4UQGA 4ZCLA 4DSEA 4C9DA 3OR1B 1HNZF 3SDEB 4CZCA 4USJC 2FJDB 4AXJA 3GG1A 3ZZYA 5CYQB 1QVGR 2A2CA 2C2EA 3GB0A 3DLEA 4TLQA 3CT9A 2K8GA 5KFKA 4IRKA 3K2YA 1DURA 1ZM3A 1JKHA 1HHSA 2R7WA 3CEDA 2KHCA 3ZZZA 4L3NA 3DI6B 5J1EA 1HWIA 1O51A 3J7YU 4PUOA 1NK5A 5I3UB 1TK0A 3TW0A 5CHCB 4F25A 4YB1P 2HGNA 1U6ZA 3BEGB 2QFJA 2M88A 2OPQB 5DM7Q 1RYSA 4YEAA 1R0AA 1FJ7A 3TR5A 5AJ3F 4G1QA 1KN6A 3KKFA 2YWKA 4YOEA 3G9CA 4WKYA 2CRLA 2DR7A 2BVZA 3MAQA 1LW2B 1N5QA 1S9FA 4X4RA 3FZ2A 2FLOA 4IR9A 2JDJA 4RBVA 4D3HA 3BSCA 3MZIA 1SJRA 3MD1A 4USIA 3CD6S 3IN5A 5FLXY 4QW9A 4CO0A 4QYRA 5SZTA 2BANA 2DO4A 3OV7A 5AXMA 2OFHX 1LKZA 2D74B 2KN4A 1RT1A 4DS4A 2GMJA 5CCLA 2ZH2A 3NGDA 3PEJA 4YR3A 3WC0A 3H8YA 4YB7A 3AJ2A 1H6KX 3I6PA 4BS2A 4XAKA 1KQKA 2C2RA 4DQRA 2J76E 2LU2A 1SJ3P 5ADZA 3FEZA 1XNRF 2KT5A 3SCJE 4FVCA 2RF2B 5CCMA 2ASJA 3IR5B 2VV5A 1QSYA 4GC7A 1N36F 3UWTA 3DM2B 1SUQA 2KO1A 3NL0A 1RJJA 2R7OA 3KOAA 4DSJA 1MWZA 3BN4A 2R8JA 2MKHA 2OPPB 4HKQA 2HFZA 4NA3A 1TL1B 3N9UC 1N48A 2I9SA 1F60B 5KFAA 4ZOSA 5HP1A 4NLVA 1WEZA 3TAMB 1IUJA 2HWTA 2PA3A 2I0XA 2KU7A 2HIQA 1VBXA 4U67Q 3GZ7A 3NGKA 3MM7B 1R31A 4RU2A 2BE2A 3NLCA 4QYZJ 3OSPA 5B0AA 1H7WA 1FKOB 1RWUA 2HMIB 1WHYA 4G1IA 1RT4B 3OFGA 2BQUA 2MMYA 2WW8A 1PO6A 1RT5A 1NKCA 4PWUA 4B02A 2R4FA 1YI2S 1I94F 2YX4A 4CO2A 4B9MA 1DARA 3UCGA 1RAJA 1RTJB 2WRMA 3K8VA 2GJ2A 3OTEA 5G0RA 4PXBA 1WTBA 2HYIB 3QYYA 4WFBQ 3AA8A 3A8EA 2VPWB 1MU2B 3MECB 4LF4F 4IO1A 5B0DA 1RT3B 3VALA 3SI8A 2AYGA 2DNZA 4KHRA 4BBYA 5K14A 1VQ4S 3BQ2A 5JJBA 2HNZA 3UQSA 4CO5A 1SH2A 4IH7A 4M95A 3VWSA 2EK1A 3CDAA 3DLEB 4N47A 2ASLA 4O44A 1VQPS 4RNFA 3UR0A 1OS5A 4U9RA 2X1GA 4O0IA 2VG5A 4HDHA 3MPYA 4K59A 3PXGa 1JKHB 3BM7A 3MDFA 1VRUA 3G71S 2LYVA 3M6XA 5J1EB 4PUOB 1C4CA 2W9CB 2LCWA 1HWUA 5KFGA 1NK0A 2PI4A 5F8MA 3RAMA 5GAEI 4WFYA 1MMNA 1FVQA 1JNZB 4JI7F 2FJEB 1R0AB 1S0NA 3L09A 2CFXA 5F8HA 3HLUA 3D5MA 5D4LA 4TQRA 4CQ1A 2VC1A 2FJWA 2MGZA 4NZ6A 1FDNA 3LQVA 3P5TL 5KFRA 4X64F 4DSFA 3QMQA 3GIIA 2XMWA 3HDSA 4ECWA 2KB2A 2KJWA 1ZTTA 3CVKA 2BANB 4YB6A 4GKKF 1JJHA 1M5OC 4ED5A 1FA0A 3CD0A 1VK3A 4WU3A 1HD1A 1RT1B 2KH9A 4DPOA 1TL5A 1ZBTA 2W9AA 5KG7A 1I6JA 2VBYA 4NLTA 1VGYA 2HNDA 1T7PA 3ONQA 4RBUA 1TK8A 1DQ8A 3SFUA 5JUMA 2WB1D 4OI0A 3QPIA 2DRBA 2L9NA 3AQPA 4FZVA 1DQ9A 3BGLA 4URSA 2AWZA 3FMBA 5HLFA 4LUBA 3GR0A 1SUQB 3MURP 2NUHA 3IA0A 4MJKA 5L1KA 3GSDA 5A8WB 1ZYQA 3LGMA 2IMWP 3OTDA 1WWHA 2YH1A 2E9TA 1DAXA 2V9KA 4DFKA 1P6TA 3CCWA 1E6YA 2RVJA 1N56A 1IBLF 3C46A 4BDPA 4ZPDA 2LKZA 3RRKA 3DCAA 4JI2F 3JSYA 4DX8H 2OSRA 1MMLA 3OFHA 1PSDA 2BE2B 1P9QC 4NLQA 4N5SA 3DOLB 2DNHA 4J9PA 4J9NA 3PFOA 3BS9A 1QAIA 2F40A 4IYQA 2KFNA 3MM6A 3RB6A 3K0JA 1RT5B 3KMQA 3O5TB 1WHWA 4IG0A 3D28A 2ROGA 5C5JA 3VAKA 3DLJA 1XK8A 4LFBF 3R1HA 5J2MB 5G0RB 1D8YA 3M30A 4PQUA 1FTRA 2CJBA 4ETXA 4PG5A 3OUYB 2Y0SD 3DU6A 3M4XA 4X4PA 2X3GA 4ALZA 4MK7A 5F8LA 4I0WA 4H4KC 1IJFB 5KFTA 2YNHA 4ZLPA 3LO3A 5ITHA 3L7OA 2CPDA 5GAGU 5B09A 2YTCA 5EWFA 4RW4B 2KG1A 1S1TA 3TANA 2HNZB 1UVKA 4NZ7A 2LEPA 4WFAQ 3MCSA 4OI2A 4C0OC 4JV2A 1VIOA 1VQNS 4DV2F 4O44B 2YWGA 1TAQA 2E5IA 2DR5A 4QR0A 4Q45A 3VQTA 1VRUB 3ISNC 4M5DA 3KLEB 2VFVA 3LH2S 5E5NA 4PG8A 3H25A 2VA2A 1L3VA 2ZC4A 3P6YC 4N76A 1UEUA 3OJSA 2RRAA 1WEYA 4Y2AA 1HNIB 2FJAB 4A8SA 1FD2A 2Z2MA 2GQQA 2E7XA 2KI2A 2JEJA 3CC2S 3IGVA 4NRUA 2MGZB 1KNZA 2R7RA 2E5GA 2RIJA 3FRZA 3NCQA 5KG5A 2CQPA 4DG1A 3V2UC 4DFPA 1AXQA 1YJNS 4NLGA 2B4UA 1RKJA 4K4ZA 4E98A 1X4GA 1VMBA 1FESA 4I7FA 2XMUA 2CPJA 4OZ1A 2CQGA 2FHKA 1FDDA 2HNDB 2JJ4D 3KLGA 2KRRA 5KT3A 3Q23A