3E8XA

Putative nad-dependent epimerase/dehydratase from bacillus halodurans.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
GMRVLVVGANGKVARYLLSELKNKGHEPVAMVRNEEQGPELRERGASDIVVANLEEDFSHAFASIDAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFIMVSSVGTVDPDQGPMNMRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVTVSPHFSEITRSITRHDVAKVIAELVDQQHTIGKTFEVLNGDTPIAKVVEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative NAD-dependent epimerase/dehydratase from Bacillus halodurans.
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords Putative NAD-dependent epimerase/dehydratase
total genus 72
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e8xA00
2W98A 4Y6RA 5U1PA 3UGKA 5DF1A 5FFFA 4EUHA 2FHSA 5I9MA 1JAYA 4NFYA 3HFGA 2E48A 1OBFO 4R1TA 4GLOA 1GYQA 3QWIA 3GVCA 1AUPA 3RKUA 3Q3CA 3L4SO 1LDNA 2O7SA 2RBEA 4WUVA 3KV3O 3WB9A 1WPQA 2AA3A 3VTFA 4ALIA 4GVLA 5FI5A 1Z73A 3BMQB 4YYZA 2AEFA 2NU7A 2CNBA 2B4TO 4PLZA 2EF1A 4EUFA 3G1TA 3I1JA 1Z75A 5COQA 1EQ2A 4CMGA 1NNUA 3OEWA 2PKQP 3GRKA 2Q2VA 3ZNNA 5BR7A 2OL4A 2V65A 1X7DA 2Q1UA 1XSEA 4Z0HO 2CFCA 4LISA 3JQFA 2O3RA 4TKMA 4XJSA 2AG5A 4Q3NA 3WGQA 4II2A 3JYNA 2Y0DA 1EE9A 1TXGA 1OMOA 4NBTA 4PLPA 3UUWA 4BGIA 5U9CA 4XYGA 4BMNA 2YHUA 5DBFA 1BRMA 3H2ZA 3E5RA 3SEFA 4RPLA 3JQAA 4WLFA 3RU9A 2O2SA 2Y99A 4PVDA 3G49A 3E9QA 5HBRA 2P91A 1MFPA 4J1TA 2DUUA 3CZMA 3WGTA 4XYBA 3ZV3A 1ZO8A 1P77A 3NAQA 2ZYDA 4JROA 4OJNA 3ZNPA 5EQDA 4AJPA 1HKUA 3SLKA 3BMCA 4JQCA 4D3SA 1A9ZA 3PGJA 1L1FA 3S2EA 1C14A 1A7KA 1V35A 4RVHA 2J5KA 4RPJA 3I9JA 1KETA 2FR1A 3U5TA 3VZRA 2AW5A 4CMCA 4BQRA 4YACA 1Y9AA 4BGEA 3L77A 2JAPA 3TWOA 2NNLD 4JCOA 3U09A 1ZJYA 4FBGA 4NMHA 3ZWOA 4A10A 2HK7A 2JJYA 2PV7A 3JQ8B 4PG7A 3TNLA 3VZSA 4E5MA 2PH5A 2BFAA 3CUKA 4TROA 3GPDG 1A27A 3WSVA 4D79A 5C37A 1PJCA 1S6YA 4MVJG 1OC2A 3K31A 4GVXA 5C7OO 1GUZA 5ITWA 4DQXA 5A5FA 1G6KA 2AE2A 1M2WA 3GAFA 5DOVA 5JYDA 3DZBA 1O95A 1X1TA 3DONA 4GGOA 3TN7A 1WWKA 2GYYA 3R0IA 3T4EA 3A28A 4G2NA 3GG9A 3VTZA 1DRVA 2VT2A 5I8WA 3KSUA 3GK3A 3K73O 4CMJA 3TZHA 3E9NA 4PZEA 3AWDA 1DJQA 3AI1A 4RVUA 2NM0A 3DZKA 4A0SA 1ISIA 3JYLA 1BW9A 4CQMB 3ZW9A 4IS2A 1DXYA 3PP8A 4AJ4A 4CM4B 5IN4A 1XWFA 2NQTA 2NVUB 2BFPA 5AOVA 1UR5A 4FDAA 1MA0A 4D43A 1RPNA 4G5HA 4PRKA 1DOHA 2VOJA 1T25A 2YZ7A 5AYVA 2VHYA 5JPIA 1NR7A 3M2TA 5AXBA 3S8MA 2WD7A 3AM3A 1MC5A 3MOIA 4P8RA 4CLDA 3ITKA 3S1LA 4FC7A 2VYVD 3PDUA 4J91A 4PLCA 4XGIA 4XIJA 1KEPA 3E1KA 1HDOA 1P74A 1SZJG 1YL7A 2J8ZA 3PRJA 3V2UA 2GN9A 3ZCXA 1UXHA 5ILOA 4N18A 3WGOA 2XAAA 5A9SB 2PLAA 4PVCA 1DC3A 2DPGA 1GV1A 1GADO 4NH4A 5CDSA 4BVAA 2EKPA 1LSJA 4KQXA 2NUAA 3JQFC 3MJSA 1LSSA 3EAGA 1A71A 3DC2A 3H5NA 1M75A 1E5QA 2EIHA 2J6IA 1R37A 2D8AA 3HHPA 4J16A 4K26A 3PJGA 3U62A 3WGZA 1L7EA 1K0UA 3I4CA 4CMEC 1N7HA 2HQ1A 4D41A 4X54A 1E1MA 1DEHA 3DBRB 3CIFA 4CMAA 4ZQFA 4UULA 1YOVB 3OSUA 3COSA 1QXSA 5CFZA 3LK7A 3AOEA 3FPLA 4KTTE 5F3RA 4WNIA 3KHUA 2B69A 4H7PA 3ADOA 4PLTA 4BNGA 2FWMX 2RH8A 3KYCA 3I4FA 1MUUA 1PS8A 5DCYA 5TT1A 4RPKA 1IYZA 3JYOA 1UUFA 5DP1A 3VHRA 5JFOA 3ZHYA 2VNSA 1X0XA 1C0PA 1EUDA 3RBVA 2CMDA 2ZIZA 5IDQA 1UP4A 5BQFA 4BNKA 4J7CA 3RFTA 2EWMA 1M66A 1QLHA 1DAOA 1D4FA 4WCDA 3RQSA 3C1TA 3R3JA 1ZEJA 2HRZA 3O8QA 2WE8A 4AJIA 4XGKA 5TF4A 1GY8A 1VSUA 5K6AA 2BKAA 1I0ZA 3BMCB 2QX7A 2CVQA 4BNWA 1R0SA 4LW8A 1Y7TA 3KSDO 5CPFA 1DFIA 4AJKA 2HCTA 5G0SA 4WEOA 5CEFA 1GPJA 5BSFA 4J4HA 2C5EA 2BFMA 2CSUA 3BHMA 4MVJA 3U4CA 4BUCA 1HE2A 2PZJA 3GN2A 3V5NA 4D0SA 4LGVA 1G1AA 4OXNA 4ALNA 3FBGA 4PLYA 5KWEA 1UXKA 2QIOA 2OGUA 3VKVA 4FIZA 1OC4A 3TZ6A 3AJRA 3GVXA 5ILGA 1EUZA 3X2EA 4CPDA 4M54A 4FSHA 4IXWA 2QQ5A 4DVJA 3WNVA 4U8GA 1UDAA 1FXSA 2EGHA 3NJ8A 2PD3A 2VOEA 2B0JA 5KVSA 2DVMA 2B35A 1DDOA 1G0OA 1Y8RA 5JDIA 5IN5A 4B7UA 1I8TA 4FOSA 4ND2A 3V2HA 3ROPA 2UAGA 4IZIA 3QA9A 5IDWA 4XGNA 1UH5A 1W4ZA 2IEBA 1PGNA 4ONEA 2Z95A 2GN6A 1DAPA 1B15A 4IIUA 3NJ4A 4NZ9A 4XQ9A 3OIGA 1NXQA 1ZW1A 2QZ9A 1YONA 3NT5A 3TJRA 1OOEA 1TI7A 3WTBA 2IODA 4WCFC 4Y9DA 3TOZA 2O3QA 2DM6A 5DT9A 3DTYA 4BO9A 3CH6A 4JBHA 4MP3A 5LC1A 3RC2A 5L51A 2IRWA 3CZRA 2WMDA 3MEQA 1F14A 4WKGA 4PFJA 2J3JA 3M6IA 4GX5A 3JYQA 4G65A 4TVBA 4YVFA 1EMDA 1O0SA 2GR9A 1LU9A 1HDGO 1DIAA 2J3KA 3ZWBA 2CVZA 2JCXA 3TQHA 3ASUA 5IJZA 3DR3A 1X7HA 1DLIA 1VJ1A 4R4JA 1V6AA 2PD6A 3WYCA 4Y8VA 1KVRA 3E18A 3RFXA 1ISGA 1P33A 1T1RA 2CY0A 4EUEA 2PKRA 3OHSX 3CMCO 3DZHA 4UVDA 4DLAA 1Q7GA 1Z74A 4JX8A 3RC7A 3M2PA 2X0IA 1MG5A 5KVQA 3IDSA 3GPIA 2CF6A 2EXXA 2C29D 2H5LA 2OP0A 3OP4A 3RFVA 1KEWA 1LDBA 3GVPA 2B4RO 3MJ4A 1HT0A 4OKIA 2Q2QA 1R66A 4BIIA 1E3WA 3ANLA 4D42A 4FPXA 5I7SA 2WTBA 3PVZA 4RDHA 5HM8A 2GASA 2ZTMA 2VHZA 2ZATA 2ZTLA 2AHRA 3WICA 1ISHA 3BYZA 3KETA 3AY7A 2QZZA 3HSKA 3FBTA 5T8KA 1E1NA 1C0KA 1ZVMA 2POQX 4ZQBA 4MPDA 5TS3A 2I3AA 3PYLA 4HADA 4DIBA 1B7GO 1RYEA 3GVHA 2ZQZA 4I9UA 4TZTA 3JQBA 4IS3A 4IDFA 3F3SA 2YDYA 4QFCA 5CP8A 2I99A 5IG2A 2FPIA 2BLLA 2VHXA 2VUTA 4FFLA 1H0KA 2ZYGA 3B6ZA 1ZK3A 3GFBA 1QKIA 4RCVA 4F3YA 2HJRA 2RAFA 5L4SA 5ITVA 1DIHA 2E6UX 2Y1EA 3WJAA 2V7PA 3NTOA 4C4OA 2SCUA 2NLOA 1I33A 3JD0A 2XF8A 5C7IO 2P4QA 5G2OA 3ZW8A 5IXSA 5T57A 1BDBA 1PJBA 5IZCC 2V6MA 1FK8A 2X1HA 2B36A 3HG7A 4KDFA 3KEOA 4CR7A 1PGQA 2YW9A 4R51A 4J1QA 5GY7A 4LCEA 3UN1A 1NFFA 4P4LA 1HLPA 1V8BA 5KOIA 1LLCA 2OFPA 4R9RA 3A1NA 1U7HA 4NJOA 4ESOA 1BVUA 2DQ4A 2X5JO 5TJHA 3VH1A 1P1IA 4CM9D 5JW6A 3ABIA 4I1IA 1R4MB 2H6EA 3H5AA 3MWEB 4YTEA 2VNAA 1A4IA 1QP8A 4NHEA 3E5MA 3MOGA 4NDNE 3AI2A 1PGPA 4OSPA 3G3EA 3QY9A 5F1KA 2IYOA 1FDWA 5CDGA 4CODB 3ZNQA 2A4KA 4UVHA 3WYEA 4E2ZA 3FNGA 1EVIA 2CDBA 4O63O 1N92A 4NI5A 3FR7A 3WIDA 1DRUA 3UCXA 4OOEA 1H9AA 3VZQA 4ILKA 1ENZA 3GR6A 5TIIA 2EP7A 2VTDA 2DAPA 4CM6A 1JAXA 3ZN2A 3JD4A 2NTVA 2GLXA 2VHVA 1T24A 3QVXA 1PSDA 3ULKA 3L4BC 3NX4A 2Q1TA 4J7UA 1RKXA 1R0KA 1VC2A 3ZWMA 3AFMA 1MLDA 1W6UA 3AI3A 4OIMA 4ID9A 4GBJA 3L0DA 3E6AA 4K6FA 2GCGA 2Y1FA 3ZU5A 1Q2XA 5L95A 1F12A 2IE0A 3ZU3A 1CYDA 2HJSA 1N1GA 2E82A 4C7KA 2I5PO 1DSSG 4E5PA 3FNEA 3TZQA 1QYVA 3ZWYA 4E2YA 5T5QA 2OZPA 5L4LA 4YJFB 2UV8A 4F45A 4BNJA 2O4CA 1SMKA 3DDNA 4R9SA 4BNLA 1UP6A 3GOHA 4M1QA 4BKRA 5AXCA 2EW8A 3WFIA 2JFHA 3ENKA 1NQTA 3ETDA 3NTQA 4QTZA 2IZ0A 4RQTA 4B4OA 5T6BA 5A06A 1U3TA 1IHYA 4GGPA 3GGGA 5JAIA 2O3JA 4PG6A 3JQBC 1SCUA 1MB4A 4HP8A 5CEJA 4NG5A 1EBUA 3QVTA 4F6CA 1I5RA 3KVOA 4URFA 3RSHA 5EL0A 1LRLA 2NVBA 2B5VA 5K6AC 4MOWA 5A5EA 4D7AA 1P3DA 1ZSNA 8ADHA 3H9UA 4W99A 4K9DA 1T4BA 5A3JA 5LDHA 2EG9A 2I76A 3QVSA 3DZGA 3IL2A 4KDEA 3K30A 3ZHBA 3FRJA 2IZ1A 2ZJ1A 3LT2A 3BHIA 1Q7BA 2NSDA 2DTEA 1X14A 4CLHA 4BKOA 4JK3A 1T2EA 4OGWA 5G0UA 1DFGA 1F0YA 1NTOA 4AVYA 1ARZA 2NU9A 3AUAA 4L9RA 1ONNA 1UXJA 4QT0A 3DAPA 4GWKA 2FP4A 2X0NA 1DB3A 1JKJA 3IS3A 4R16A 1FJHA 1AHIA 4HKTA 1XGKA 5IF3A 3FR8A 5F5LA 4CM3A 4CQMD 3GA0A 3VPXA 1P1RA 2YDXA 1IPEA 1UXIA 5I7FA 3FNFA 4J1NA 1LUAA 4EITA 4R5MA 3LQFA 4YQZA 4CR6A 4Y67A 3Q6IA 3S55A 1J5PA 2HMWA 3LC1O 1LEHA 3WGIA 4MKXA 4A26A 3OICA 3MZ0A 3ZHXA 1BXZA 3NYWA 5EQFA 5I7VA 5A05A 3PJFA 2Y1GA 4O0LA 4NBRA 1SO8A 4WOKA 1LLDA 3KOUA 2Y0EA 3HB4X 3CXRA 4PLGA 4DMMA 1XKQA 4CQLB 4W7HA 5KJ1A 5F21A 1YVEI 1IOLA 1EEHA 2VYND 3GRPA 2E37A 1B3RA 2B4QA 2Q50A 4OQZA 4ALMA 2PNFA 5KNLA 5GZ6A 3VC7A 2GERA 1PGOA 4B79A 3WGYA 2CZCA 1PQUA 1Q0HA 3U4HA 1PJ3A 2VUUA 1GYPA 4R69A 5GMOA 3C24A 4M89A 1E7QA 3UXYA 1KC1A 2Y1CA 4N54A 3WS7A 4DA9A 2HKIA 1J49A 1GFSA 5CDUA 1J6UA 2HMTA 3UHAA 1U8XX 2ZKLA 2BH9A 2VYVA 1B14A 3RU7A 1OFGA 2I66A 3DO5A 2O48X 2B5WA 1HRDA 3KYBA 5JO0A 2C0CA 5F1OA 1HL3A 3NUGA 4UUPA 5FF9A 3AFNA 1P44A 3KRTA 3WQSB 3D0OA 1YL6A 4E2XA 5MGBA 1CJCA 2NACA 4I8XA 4R41A 3I9OA 4I5EA 2QRJA 4NR0A 3MJTA 4E30A 4RORA 3V1UA 3NDRA 2D59A 4PZDA 5JC1A 1VKNA 2JAHA 2JD0A 2PGLA 1CDOA 2VTEA 1C1DB 3PZRA 4W7IA 2YV3A 5DCUA 2VRCA 4ZJUA 4JP3A 2QW8A 1NQOA 1QYDA 3I9MA 2JHGA 3U4DA 3G79A 3W6UA 1PJTA 1JLLA 4BMSA 4WLOA 2O50A 5KIAA 2BMAA 1EZ4A 3OJLA 4DPMA 1VL8A 2IEDA 4GKVA 3LC7O 1UZNA 1A7AA 4D45A 1EFKA 3B1JA 3OJEA 4HFMA 7MDHA 1YBVA 5THKA 1U3VA 4Z6KA 4QQRA 3O9ZA 1HTBA 1W73A 1E7MA 4MVJF 1B0AA 2D3TA 3DBLB 3QVOA 4NU5A 1UAGA 4UUMA 3UICA 4DQUA 5TX7A 1E6UA 5ER9A 5BNTA 6ADHA 2HU2A 1BSVA 2FY8A 2NQ8A 4BO6A 1O9BA 2IDZA 3R3SA 3VZPA 2GN8A 3ZV6A 2BHLA 3HWRA 2CDCA 3ZWVA 1BMDA 1KY5A 5DZSA 3SJ7A 2Q46A 3PWZA 4DPKA 1WDMA 2VT3A 3RD5A 7ADHA 2FPGA 4XJTA 3F6YA 4XQEA 4P38A 3U3XA 4F46A 2H1SA 3ROKA 1B26A 3PK0A 3CINA 1TT5A 4CM1A 5JCJD 3RC9A 3I9KA 2EJVA 4BO3A 2DPHA 3TRIA 5C3MA 1VSVA 2FZEA 3P7MA 4L73A 4RGBA 4YJGA 1V3TA 4CLOB 2WM3A 4MVJP 3JQ6A 5FWNA 2ZTUA 4ND3A 2GF2A 3BA1A 1ISFA 1NYTA 4OKNA 5L45A 2O3SA 1NWCA 3EVNA 3QIVA 4L0QA 1XHLA 3ZH2A 2D4AA 1HDZA 1IZ9A 4PGFA 4CMKA 1U28A 4RL6A 4PLHA 4OYRA 1JVBA 3ZGYA 3PQDA 3MJEA 4ALLA 3E48A 4BNZA 1T26A 3QRWA 3TZCA 1PJLA 3OQ1A 1XU9A 2EW2A 3GZ4A 3JQAB 1JA9A 2EERA 1LJ8A 2YFQA 4RF3A 4EDFA 1WDKA 3GGOA 2Y1OA 1QV6A 1NPTO 5L4NA 2WWRA 5IDYA 5KKAA 3NKLA 2DBVO 3CE6A 5TSDA 3ZWXA 2BGLA 1PS0A 2FPPA 4E33A 2AEJA 4GSKA 3MTGA 2B83A 1PGJA 4CLXA 4YPOA 5BNIA 4XWYA 4C7JA 1Y1PA 4CM7A 4JBGA 2QRKA 3WXBA 4B7XA 1ZSYA 5B37A 4EJ0A 3JCZA 2JL1A 2HMVA 4MIYA 1WDLA 2JCVA 2X8LA 2YJZA 3E03A 2NV6A 2AQKA 3P5SA 4CMHA 3KZVA 4E3ZA 4TSKA 2JHFA 1X0VA 3IP1A 1EDZA 3JQCA 1XA0A 5EERA 4B4UA 2HSDA 1HLDA 3OF2A 1W8DA 2RHRA 3F4LA 1P9LA 1E3LA 2W8ZA 2A9FA 4OL9A 1C1DA 1EFLA 5I7EA 4BO7A 5JAZA 4ZQHA 1RM0A 2BELA 3GUCA 3JD2A 4E31A 3GZNB 4WPGA 4B4VA 1LRKA 5HTOA 2EP5A 4TRMA 4J4TA 1U3UA 5COBA 2HK8A 1NVTA 1JQBA 3UF0A 4E32A 1U7TA 4YAJA 2ZB8A 1HDCA 4BO1A 4E21A 1IHXA 1K5HA 1XG5A 3O38A 4ZQEA 3R1IA 4YAIA 5JBIA 3CSDA 3PYXA 2F1KA 5G0TA 3N58A 4CQLA 4D3FA 5CDYA 4CM8B 1BHSA 3BMOB 4EZBA 1T1SA 3PIDA 3INGA 3BMQA 3VOSA 3LLSA 2CF5A 4JJIA 5DULA 3K2BA 5A4DA 5KJ6A 3ICPA 1GAEO 3EMKA 3JSAA 2X86A 4J90A 1X7GA 2W2LD 1QYCA 4FGWA 1DBVO 5L7WA 3OETA 3OMLA 4U6SA 3V2GA 5K0ZA 4Q3BA 4ZGWA 5A03A 3WLFA 5TRTA 3OA0A 4JGBA 1ONOA 3E82A 1CERA 1H6BA 1F06A 1I2ZA 5IAAA 1LA2A 3EW7A 4P4GA 5KJFA 1U1IA 5A02A 3PZBA 2OHXA 1YWGO 5JYEA 1NR1A 1A4UA 3AU8A 1X13A 4XCVA 1B16A 2C20A 3Q9UA 4CLOA 2QG4A 2QYSA 1GDHA 1Q0QA 4NNJA 3DBRA 3AUTA 4R54A 2OO5A 3GQVA 3UW3A 3H8VA 1UDCA 2X0JA 2VN8A 3GG2A 3RC1A 4DYVA 5ADHA 3WQRA 1ADGA 3QV1A 1GL3A 3ZWNA 5HS4A 4JBIA 4UUNA 3CKYA 1ENPA 3F1KA 4U7WA 3JV7A 3MJCA 2OUIA 1C0IA 2P9CA 4UEJA 2P5UA 4TWRA 4HY3A 1U4OA 1PL6A 2XPCA 3AK4A 3JQ8A 4EJMA 2LDBA 4F6LA 3G1UA 1Y5MA 4G81A 1E6WA 5JXWA 2X0RA 1JW9B 2V6FA 3VPHA 5MDHA 2H9IA 4B8WA 5TLSA 4QUKA 4DBZA 3CTMA 4EBFA 2Q1WA 4BGUA 2C7VA 4IY1A 5AXDA 4BV8A 3OIFA 3HN7A 4NQZA 2DC1A 1QRRA 2DKNA 4TRNA 4IDGA 3TFQA 4OMUA 1YKFA 4KOAA 3LT0A 3B70A 1KEUA 1JN0A 2NTNA 3BXXA 2DTDA 3OFSA 4KUGA 4FS3A 3FCOA 1O5IA 1I2CA 2X9VA 3PEFA 5LCXA 1KC3A 2AEMA 3HDQA 1KS9A 3DHEA 4HBGA 4P4NA 3OIDA 3CMMA 3WWYA 4EW6A 2I65A 3PHIA 1VE9A 3C3XA 1BXGA 1ENOA 4HFRA 3PJEA 3VH2A 4DUPA 4QX6A 3QLJA 4D44A 3JD3A 2Y1DA 4PCVA 3PHJA 2X9GA 1KVUA 1SOWA 4CUJA 3I5MA 3RUAA 5JSFA 5GZ1A 3DQPA 5EMHA 2Q45A 1QYWA 2GN4A 2PZKA 2OORA 3T4XA 2V6BA 1HYHA 3I9NA 3OEYA 4NFSA 5KTKA 3RUDA 1HSOA 1Z45A 1NVGA 3DOOA 5A04A 4LSMA 4A27A 4N7RA 1ZUD1 3W4IA 4LN1A 2OMEA 1EBFA 2DBRA 1Y5RA 3F5QA 4BNTA 4E4YA 4CM8A 4WOJA 3ZWAA 3LYLA 4O1MA 1PJ4A 1ZIDA 3IQDB 3SLGA 3MJVA 2YV1A 3PQFA 4MKRA 1EDOA 2XOXA 3LLVA 1U5AA 1XCBA 4J2OA 1ZEMA 2TMGA 4XD2A 1JWBB 2BRUA 1V3VA 1R12A 5I9NA 2CVOA 4E0BA 2VUSA 1AN9A 3IJPA 4YT5A 4M49A 4B3HA 1N5DA 3A06A 1LLUA 4DC1A 4XYEA 1EVJA 5L53A 5K9ZA 2HLPA 1RM3A 1A72A 4WECA 1T4DA 5JY1A 4Q9NA 4N5MA 1I36A 1WNTA 1ZZEA 1SPXA 2BI7A 4WK6A 1GUYA 1KBZA 3KYCB 4B8ZA 1C1XA 3MCVA 1CETA 2ZCUA 1MP0A 4QO7A 2ET6A 1HF3A 2PZLA 4MJLA 3WSWA 4XR4A 4XQCA 5HA5A 1YQGA 2NVUA 3DWFA 2X58A 1XR3A 2I3GA 5DDIP 3GMSA 5F5NA 2Y93A 5T64A 3GDOA 1LDGA 4AFNA 4O59O 2O4UX 4J43A 1TLTA 3O03A 3RIHA 4AJHA 3KYDB 4R1NA 3WFJA 4LK3A 2BGKA 3VDQA 3W6ZA 4BNYA 2ZB3A 4IMPA 4PRLA 4Q3AA 3UFXA 3D4PA 3P19A 2NADA 3PGXA 2ZCVA 4WLUA 5DP2A 2G1UA 3TPCA 2X5KO 1ENYA 2FR0A 2O2YA 3F4BA 1A9YA 4IQGA 4YJDA 1C1XB 2AQIA 4JP2A 5TT0A 2RH4A 1PWXA 1D1SA 3D4OA 3HADA 1I10A 1LBEA 4CLEA 3RJ9A 3IKTA 1QR6A 1VKOA 1PZEA 3BZUA 3KBOA 3F9IA 3WGGA 2I9PA 5DBIA 3DOCA 1TT7A 3HNPA 1H6CA 1VJ0A 3ANNA 2C7GA 1I01A 2R2GA 3NGXA 2G0TA 4L4XA 4QSMA 4RF5A 4RF4A 2PK3A 1U9JA 2BFOA 3DZIA 4OOFA 1F8FA 2YQ4A 3EZYA 3BTSA 3KYDA 3WIEA 1KVQA 4FFPA 1LC0A 4YJHA 3TOXA 5T8KC 5CEEA 1C0LA 3ROQA 4IBOA 3CPSA 1YE3A 4BKPA 3QSGA 2TMDA 1K6IA 1QORA 4XA8A 2R00A 4GX0A 2VZ9A 4GWGA 4JLWA 1NPDA 3DZJA 2FSVA 1HDRA 4MINA 4PN3A 4IPTA 3D7LA 1AHHA 4O6VA 3RBZA 3ADPA 3BTUA 2Q99A 4BNFA 1BVRA 1O94A 2C54A 3JQAD 4HUJA 1OZAA 1RWBA 4NBWA 1E1KA 2YV2A 4KTVE 3H9GA 1Z82A 3UCFA 4FCCA 4L4RA 4XRGA 3ON5A 3UAGA 1R4NB 3DFUA 3IOYA 5LDGA 3VPFA 3RJ5A 1BG6A 1LDMA 3ICCA 2PFGA 3R6DA 4XDZA 4QXMA 3PLNA 3L07A 4R01A 4A7PA 4FN4A 2O3UA 4JN6B 1JVSA 4NPCA 2NU8A 4YXFA 3DAFA 4IDCA 2C82A 1KVTA 4HXYA 4J9VA 2GDZA 1SC6A 3STHA 4Q3DA 1TA4A 4DTIA 1MC4A 1BXKA 3WX0A 1VJTA 3IUSA 5TQVA 3JQEA 5BNFA 4AICA 3Q11A 4KWIA 3GHYA 1M76A 2GGSA 5TJ9A 1PIWA 1GQ2A 2WD7B 3WBFA 3OECA 4L75A 2Y67A 1N9GB 3DB2A 1PJSA 4E13A 2YY7A 2GD1O 1Y9EA 2ZB4A 1NAHA 3IIEA 3W8DA 1D7OA 2OBYA 3DL2A 1GD1O 4TRRA 3B1KA 1E3IA 3PJDA 1P1KA 2FSSA 3KXDA 3HN2A 1GV0A 1IZ0A 1YDEA 4DREA 9LDBA 3FI9A 2VHWA 4KP7A 2W2LA 3ZI0A 5FEUA 4A5OA 1R4MA 2OP1A 1FDTA 2HO5A 1I2BA 4YRDA 1I3LA 4DLBA 3DEYX 4YT4A 3DMTC 4OH1A 4BO0A 4I5GA 4IDDA 4XZ3A 3AUUA 1K3TA 1T2AA 3F46A 3H65A 2BI8A 3LC2O 1ZXBA 1LQTA 4LVUA 1P31A 3EHEA 1Y8RB 2Q1SA 2XXBA 3TDKA 2D2IA 1YGYA 2FRDA 2QRLA 3OH8A 5CG1A 1L7DA 5JLAA 1HE3A 5HWSA 2DUWA 2D0IA 3BTOA 1YBMA 1UXGA 2DLDA 3FF4A 4R3WA 4XYMA 5B4TA 1DC5A 4UUOA 2O7QA 3HQ4O 2PGJA 3I83A 1N8KA 2Q3EA 4FJ1A 1OAAA 2IXAA 1W0CA 1ZJZA 4BO2A 3FTPA 3QHAA 4MIOA 3NT4A 3EZLA 4MVJI 4CUKA 2P4HX 4DGSA 1KEVA 2X23A 4BKUA 3P2YA 4I5FA 1VL0A 4WE3A 3QQPA 5DN9A 1YBAA 3D3EA 4MVJH 3DBLA 4ZA2A 1MGOA 5TNXA 3RROA 1YQXA 1R6DA 3WDSA 1K89A 1C3VA 1ZKMA 1RJWA 3H5RA 3PIIA 2EKQA 4LCJA 1WW8A 5AVOA 4Z0PA 4BNIA 1AGNA 1ULSA 4YJHB 2W2KA 2DU8A 3INTA 4PZCA 4GX1A 1B3BA 2YUTA 1CRWG 1I3MA 3INRA 4ROSA 3QE3A 2Q4EA 2Z5LA 1ZXLA 3Q0EA 3I23A 1VRWA 3VVCA 3GFGA 1DJNA 2A92A 4IDBA 3ITDA 1YJ8A 1CF2O 4BKQA 3BHJA 3LU1A 1CWUA 5KKCA 4OXYA 4BNUA 2JD1A 3PFFA 5JS6A 5I8ZA 4IJVA 6LDHA 4BQPA 4GQAA 1R16A 3JYPA 2V6GA 1ZMTA 4MKZA 1IULA 2QYTA 2GZ1A 2Y68A 3L6EA 2A35A 4E2WA 3FPCA 3SJUA 1IE3A 5F1PA 1U2DA 4WEQA 5G0VA 4AJ1A 1D8AA 1CQJA 4IQ8A 4JNKA 1UDBA 3HDYA 4EEZA 3SBOA 2PGDA 3RUIA 3DTTA 5EJ2A 3HB5X 3ZDFA 1PZGA 3C7DB 3LZ6A 1H94A 2YHIA 3QW2A 4CMIA 4I08A 2FOIA 1NQAO 4RVFA 4CJXA 4EYEA 4LSWA 4WLNA 1E77A 2DT5A 4GSLA 2ILTA 2CD9A 4IINA 4RZHA 4UVGA 1Y8QB 4L74A 4XQGA 1K6JA 1YL5A 4Y6PA 4NJMB 1YDWA 2Y05A 4A73A 4HFJA 4S1VA 4DPLA 1ULUA 4W6ZA 3K5PA 5L3ZA 2D5AA 2QHXA 5HS6A 2NTJA 1H9BA 2C07A 3W1VA 3GNSA 4IMRA 3QWBA 1QYXA 3AY6A 2CUKA 3NTRA 4MP6A 4BGVA 2JKVA 3U0BA 3NEPX 4YAGA 1TVEA 4U0KA 1HE5A 4U6QA 2YHIB 1YJQA 3UVEA 1GQYA 1G0NA 1GU7A 4O5OA 3SVTA 3UCEA 1ZCJA 2JFFA 4Z3DA 4INAA 2NWQA 3LT4A 3GEGA 2O3TA 1LTHR 3I6QA 9LDTA 1PZFA 1LRJA 4CL8A 2W90A 1BDMA 3QWAA 4BNVA 3GN1A 1RM5A 5JNLA 2ZB7A 3FWZA 3PWSA 4MVJE 4UVIA 1FF9A 4XKJA 4CMBA 4AJOA 5JCXA 2C59A 2G76A 1ZBQA 3D64A 3IMFA 4ZRNA 3A4VA 2C5AA 3U4IA 4H3VA 5JE8A 1V0JA 3S2GA 1ISJA 4GLLA 4LVCA 4UAGA 5KJEA 1X1EA 4W9NC 3EDMA 3VKUA 4ZHSA 4OXKA 3C7CB 3UH1A 1HETA 1XU7A 4DWVA 4S3MA 4U0JA 3MTJA 4PLVA 5JY6A 1XELA 1F8GA 3S2FA 1NBOA 3H7AA 3RAJA 1E1LA 2FN7A 4KMSA 4KWHA 4TVOA 1VM6A 4QECA 4L4SA 3OJFA 5A1TA 3HJAA 5CAEA 3JQ9A 4TRJA 5L7YA 5DNAA 3GDGA 1E3EA 2GZ3A 3B1FA 3N7UA 1E7YA 4Q39A 3ZNOA 4GAEA 3S2IA 3DBHB 3JQ7B 1B8VA 2WEKA 5IXYA 4CLRB 1M6WA 4R1SA 1ML3A 4UEKA 2VZ8A 4BO4A 1I30A 4LRSB 5JAQA 2I6TA 4Y98A 1SEVA 2D1YA 4J9UE 1TT5B 2Y0CA 3ANMA 1WMBA 3KO8A 4A2CA 1H93A 4KUEA 1MXHA 3T7EA 3GNTA 4KQWA 4XDYA 2DTXA 4YJFA 3O8QB 4P22A 4CV3A 4GPD1 4FW8A 4N5NA 3RUEA 1YB5A 3NDIA 5DBGA 2VYNA 1F17A 2EKLA 1SEPA 4B3IA 5BSHA 5L9AA 4W82A 1CIVA 4FFRA 4H15A 1P1HA 3K2EA 3PWKA 3EGOA 3L6OO 1DIRA 1N7GA 4WCFA 4IZHA 4ALKA 2UUOA 4DLLA 2G17A 2HRBA 5FYDA 5BSGA 2VRBA 4CV0A 1LDYA 1E3SA 1K2WA 1NAIA 1R0LA 4PIVA 3D3WB 3DXFA 3RI3A 3HZZA 4CM5A 1YB4A 4YRAA 4XIYA 1WXDA 4YAKA 3U9LA 3NV9A 4FB5A 1H6AA 4MO2A 1FDSA 2EV9A 4TZKA 3ZWCA 4NFHA 1V9LA 3BIOA 3GAZA 5C7LO 1DIGA 1I24A 4BS9A 5KVCA 1YRLA 2PTGA 1NFQA 1R15A 1BGVA 1ID1A 1XLTA 4M55A 1ADFA 4WGGA 2AQHA 3PPIA 2OXIA 3SXPA 2C2XA 2XXJA 1WP4A 1JWAB 4N5LA 1PL7A 3NGLA 1H5QA 2WSBA 3KLPX 3PTZA 4LMRA 5T67A 2YQ5A 1ZK1A 3U49A 1I3KA 3FNHA 4DRYA 3KM0A 3MWDB 4PG8A 3FHLA 3I6IA 5TC4A 1NVMB 1LI4A 4CMEA 2A94A 2P9EA 3HE3A 4MDHA 3JTMA 1OI7A 3GDFA 1KIFA 2FR8A 1XEAA 2GSDA 2X5OA 4J2HA 3DFZA 1ISMA 3GGPA 1M67A 3H9QA 3VDRA 4XR9A 5C5IA 5JC8A 3IP3A 2OOSA 3WOHA 1EUCA 1ONPA 3V1YA 3LF1A 1BXGB 1U2GA 3VVBA 2HDHA 1DIBA 4W9NA 3OQBA 1IPFA 4BNNA 2X7HA 1D1TA 3NT2A 3GEMA 4IJUA 4DIOA 4Q3CA 2LDXA 4RVDA 5JDCA 3DZFA 4HWKA 3C85A 4AJNA 4BOYA 3H2SA 4FGSA 3DMYA 1YOVA 1MXFA 2JD2A 2UDPA 3QVWA 3K96A 1IY8A 1NHWA 2VQ3A 2YYYA 1O89A 2HMUA 3Q2KA 3VPSA 4K28A 4CLRA 4J0EA 1DFHA 5KCZA 4XB2A 1WZEA 2G5CA 3OJ0A 4GH5A 2ZJ0A 4J6FA 3P2OA 1MG0A 3AU9A 1NM5A 3I9LA 2BF7A 4RO0A 1ZK4A 3L9WA 5KVVA 3Q2IA 3ZU2A 1YH3A 1SB8A 1EVZA 3PHHA 4ALJA 3AW9A 5CDTA 2W4QA 3QWFA 3EK2A 4YWJA 1E7WA 3IUPA 2EJWA 4EGFA 1XDWA 2WD8A 5IZ4A 5IZCA 4MVJM 3GUYA 1HXHA 4YQYA 3K92A 4ZN6A 1U4SA 4RLHA 3PFWO 3BAZA 3WBBA 4GL4A 4FOOA 1PWZA 4B4WA 4L76A 3M1LA 3A14A 1HWYA 3ONEA 3WMXA 4RZIA 1U5CA 3L6DA 1YO6A 2PA3A 2YFHA 4XEHA 1GCOA 1HEUA 1E5LA 2AQ8A 1E3JA 2H63A 3ONDA 3Q1LA 4EEXA 3LVFO 4ND4A 5G4KA 3K8ZA 2Z1MA 5JCJA 4TQGA 1VPDA 2Q2WA 3DHYA 3WQQA 1QV7A 4OHUA 3PLRA 2IXBA 3OJOA 1E6EA 1LXCA 4Q3EA 1Z7EA 4FFMA 4QFDA 4RPGA 4W4TA 2X6TA 1GQQA 1Q0LA 5A9RA 4RLSA 5EPOA 1PJ2A 3VPGA 5A3VA 4AJEA 4ZQGA 4YT8A 1HYEA 3H3JA 3V8BA 3VAZA 4BNXA 3ST7A 4E12A 5FI3A 5CPBA 3VH4A 4BV9A 3ROMA 3GC6A 1RM4A 3H4VA 1SAYA 3VH3A 4YAEA 3PHLA 2RCYA 3KTDA 4II3A 3GNQA 1PL8A 1PQWA 3H6KA 4IJKA 5G4KB 3H9JA 3GHHA 3L9XA 1CQIA 1PR3A 3LDHA 3JQDA 1EK5A 4ND5A 2DFVA 3ZWWA 3PHGA 4R68A 1T2FA 4WJZA 5I9LA 1DHRA 2FZWA 4I9NA 3PXXA 4EI2A 5U4QA 4GKBA 1WMAA 4GI2A 5JO9A 4BO8A 4CL3A 1E3WB 1QMGA 4Z0TA 3KLMX 3PI7A 4EJ6A 2DFDA 2VWGA 1N1EA 3FSRA 4B7CA 4GMGA 1GEEA 2VWQA 5TGDA 4M87A 4OQYA 1O8CA 1I32A 1JU9A 4ND1A 3EYWA 1Y81A 1YB1A 1WLYA 4UREA 5L7TA 2ZYAA 3TZKA 4ZVVA 3IJRA 3QJ5A 3ONFA 4L8VA 4MVJD 3BMOA 1NWHA 3JD1A 3RKRA 4QEDA 1PR9A 2CDAA 4BNMA 5IFLA 3SX2A 3Q9NA 2WYVA 4IXTA 3W8EA 3ENNA 3H3FA 1LNQA 1QG6A 4M86A 2WYWA 3ETGA 4UVEA 2WDZA 2EGGA 2IZZA 3RUFA 1UP7A 3QP9A 1PJQA 4FJ0A 3AY3A 3D5QA 4TKLA 3RBXA 2Q49A 1XYGA 3PDJA 4NIMA 1H6DA 5ENVA 3AOGA 4FC6A 1SNYA 2E4AA 3JQGB 1XIVA 2PH3A 4GX2A 3DAGA 2Z1NA 1EQUA 1HYGA 2OBNA 3IC5A 4DL9A 4BNHA 4MP8A 1J0XO 4XYLA 4FFNA 1O6ZA 3AUSA 1XQ1A 3ORFA 4OO3A 1DC6A 5EESA 1E7SA 2GRAA 4R3NA 4NU6A 4PG5A 1BWSA 4FJ2A 4Y6SA 2NVWA 3JQ9C 5EIOA 1HZZA 3PQEA 1MV8A 2PD4A 3WYBA 3F5SA 3V1TC 1GTMA 1TB4A 4NBVA 5JMPA 1DPGA 2UUPA 3KB6A 3GH3A 3LF2A 4I9HA 4RJTA 2ZQYA 3D4NA 4I5DA 2O23A 1MFZA 2HK9A 1N2SA 3AM4A 3WNQA 4XX0A 5L40A 3GY0A 3DHNA 4JIGA 4PLWA 1IUKA 5AXAA 5ER6A 1Y8QA 4ZRMA 3M1AA 2WJPA 2ZK7A 4M8SA 5H82A 1UZMA 1PEDA 5ES3A 1E0DA 5ENDA 5G4LA 1U8FO 5B1YA 4CV1A 3OQ6A 3SC4A 5B4UA 2R6JA 3WR5A 3TL3A 1BW9B 3FD8A 2J3IA 4IM7A 3RVDA 4CQMA 1A5ZA 3ZZNA 1DC4A 3RASA 2RHCA 3G0OA 4TMFA 2VRCD 1Z6ZA 3I52A 4NJMA 3OM9A 3C8MA 1WZIA 4KZPA 4J3FA 1NQ5A 1ADCA 4YJGB 1NASA 2BD0A 3W4KA 1T2DA 1Y6JA 2EHDA 8LDHA 1ZFNA 1HDXA 1CEQA 1HZJA 4LRTB 3WGHA 2FMUA 2VZ0A 4AJLA 3EUWA 4YDRA 1Q7CA 1GUFA 3I3OA 4FD3A 3HUDA 5J23A 4OAQA 4R1UA 3RUHA 3K9QO 3RUCA 4HV4A 5JDCC 3ASVA 1JKFA 1P45A 3N74A 4NBUA 3TL2A 4H16A 3L4BA 4DMLA 1N9GA 2I67A 3HDJA 3C1OA 4YRBA 4J0FA 4AJ2A 3PYMA 1V3UA 1H2HA 3W4JA 4RPHA 4WASA 2J5RA 2X4GA 4YEDA 1U3WA 2VCYA 2Y66A 3AM5A 4DYDA 3B20A 1E92A 3LSYA 1KY4A 1KVSA 4YT2A 4BMVA 4RF2A 3F47A 3TSCA 4DC0A 2HUNA 4CUZA 4AJJA 1NFRA 4IGFA 2D5CA 4IUYA 4B3JA 3C1AA 5B12A 3T7CA 4QO8A 2R00C 4DQVA 3EC7A 3RWBA 4J1SA 4RVGA 3FN4A 4R5HA 2P5YA 1ADBA 1HE4A 4DBVO 1GEGA 1P1FA 3GMDA 4DXHA 4ZU3A 3WLEA 2RIRA 5H83A 4YR9A 4BL5A 1WVGA 1LSOA 1VI2A 3ZHZA 3KEQA 1GZ4A 4HX5A 1PQPA 2G82A 3GEDA 3ETEA 1EE2A 2DBQA 2WYUA 3TF5A 1GCUA 1AE1A 3E9MA 2PWZA 4FQ8A 4WLEA 3WMWA 3O26A 3NRCA 3LT1A 3OA2A 1EVYA 3IKVA 1SOVA 4CMIB 5ICMA 3X2FA 5JMWA 1KYQA 3DBVO 3KSZO 1NP3A 4NK5A 5AQ1A 4FR5A 1DRWA 1KOLA 1PU2A 1NPYA 1ZNQO 3SC6A 3EVTA 3KUXA 2DBZA 2Q4BA 4K1LA 3ZV4A 4XRRA 1R4NA 1LDEA 2F00A 1ZSVA 3K6JA 3RCBA 2E49A 5DCWA 1WAMA 3OBBA 2AE1A 1T2CA 4NK4A 5CHEA 2B37A 5JAMA 3O4RA 1HDYA 2PKQO 2HMSA 4CM9A 3GT0A 1M6HA 2UVDA 3IAHA 1BTOA 4FFOA 4RQUA 4UEOA 3DBHA 3JQ7A 4A03A 2NU6A 4E5NA 3G17A 3BMNA 1Q1NA 3GF4A 1NX6A 1JDJA 4LMPA 4MIEA 4GMFA 2GNAA 2PZMA 4ZICA 1UJMA 2GUGA 4BB5A 4KUHA 1JKIA 1RYDA 4AL4A 3AOEC 1UAYA 4J49A 4IDEA 3A9WA 1K6XA 3E8XA 3ZV5A 4JJFA 1P0FA 2GO1A 4IGEA 4J4BA 5EINA 3DMTA 4HNHA 3C7AA 4JJGA 3FTNA 4RDIA 3HFSA 1KERA 1SB9A 2AG8A 1S7CA 2GZ2A 1PS9A 3BMNB 4IIVA 2AMFA 3JQGA 2VWHA 3CEAA 5H81A 4IDAA 1X15A 3DOJA 5HRUA 3D1LA 1P1JA 4OSOA 4DIFA 4WNCA 1XQ6A 5EN4A 2AXQA 4K6CA 5KJCA 3H9EO 1B2LA 3ZWPA 1LC3A 2ZTVA 4XB1A 3TFOA 4E5YA 3NDJA 3GZNA 1AXEA 3D5TA 1QLJA 4E5KA 2WE7A 2HAEA 3GLQA 1LX6A 1UZLA 2W2KB 5BSEA 1ORRA 3D3WA 4HNGA 4J7XA 3UOGA 4Z3KA 5CG2A 4BHTA 1HSZA 5GZ3A 4BO5A 1GPDG 3BTVA 2PY6A 2IYPA 1YQDA 1GR0A 3WG9A 2PR2A 4D3DA 5THQA 1Z7BA 3WJ7A 1JTVA 2BGMA 1LLQA 2GPTA 2P68A 1J4AA 1FDVA 4YB8A 5A9SA 1D3AA 4OM8A 1YS4A 1YXMA 1SBYA 3WTCA 1DLJA 4IJWA 3W8FA 4JXKA 4HFNA 4Z9YA 1LQUA 1NHGA 5DOZA 4YBZA 2X22A 4Z9XA 4RV9A 4D46A 2JFGA 1FMCA 5COAA 2X9NA 4YCAA 1H2BA 5A9TA 1GZ3A 5B4VA 4Z9FA 1VLLA 1DO8A 1IB6A 2P2SA 4PG4A 5IDXA 4WCFB 3HDHA 1PTJA 3EY4A 3QWHA 1GZ6A 1ZH8A 4IQ0A 2EEZA 4BB6A 4E6PA 1LSUA 1PX0A 3WWZA 2J5QA 4YA6A 4U5QA 2J3HA 5BT9A 4CV2A 1QSGA 4CM4A 1ZK0A 2VWPA 3ZU4A 4CR8A 1VL6A 2UYYA 3UKOA 1AXGA 4ITUA 4RVSA 2JCYA 4PLFA 4WLVA 5ICSA 1PZHA 5JDIC 1GYRA 4ZD6A 3FWNA 1ZK2A 2P9GA 1E7RA 4D0RA 1P0CA 1EK6A 1I3NA 1ZMOA 1FDUA 1B8UA 1MX3A 4AG3A 3F1LA 1TEHA 5G0WA 1DHTA 2C2YA 3GVIA 1IL0A 1B8PA
chains in the Genus database with same CATH superfamily
2R751 5DF1A 2UZ1B 1JAYA 1OD6A 1E98A 2O7VA 3D8NA 5FBQB 4PHHA 2E48A 1OBFO 2PLRA 1V71A 3G5AA 4KSBA 3IT2A 4YQEA 3QX7A 4XGQA 5CFQA 3QWIA 5AVXA 2FEOA 5ENZA 1AUPA 4E46A 4M22A 3BC1A 4YCJA 3BVPA 5KYTA 1GTJ1 2XZTA 3ICWA 3W2HA 1LDNA 2GHIA 3WAGA 1KI4A 1U2DC 1W5EA 5BNZA 1YK0A 1IHDA 2NO1A 5H7XA 2AOTB 5REQB 2Q9AA 3MF4A 1LPSA 1Z73A 2AEFA 2NU7A 2CNBA 5IJ0A 2GTPA 4TYWA 2PMWB 2QMQA 4QL3A 1TVKB 2EF1A 4DZZA 4EUFA 3FVVA 4MWEA 5CT8A 4M8KA 4Q7MB 3FX2A 7REQA 4G0XA 1EQ2A 4Q16A 3E3OA 1XMIA 3A3PA 2VF7A 3P9SA 1JF8A 2Q2VA 3ZNNA 1NONA 3Q3IA 1X7DA 2ZBUA 2ECOA 4LJ7A 4MS4B 2X0KA 3RS2A 3URMA 4D9MA 1YZHA 4UQOA 1TQ6A 5JCOA 3EMBA 3N05A 4XJSA 5F23A 4N0MA 4Q3NA 1UMCA 4II2A 3WWEA 2GB4A 1VSTA 3JYNA 3L8MA 1EE9A 4ZCTA 1QF6A 3HKEA 4PLPA 2F6RA 2HA2A 3KEMA 5K0JA 3I3SR 4AY4A 1L4EA 2OAP1 1MABA 2P67A 3PD0A 4R40A 3GROA 5D3ZA 3TPFA 4EMTA 1J5EB 3QJGA 3T1OA 2HA0A 2P5TB 5LA6B 4HDNB 4HWTA 3A2NA 4HJXA 2O2SA 4PVDA 1JLHA 3BERA 3G49A 3E9QA 1JEYB 2YR0A 3F7MA 1INLA 2P91A 3HXLA 3KD3A 5D7BA 1QOZA 3FLEA 4OQDA 2XB4A 3RYTC 4C07A 3QVUA 2GTHA 2WJWA 3GLRA 1P77A 4JROA 5ECYA 4R1QA 5EQDA 3H17A 3SP1A 4KFTA 3BMCA 4D3SA 3PGJA 1BKDR 1L1FA 2FYTA 1KYVA 1C14A 3R0VA 2H1HA 4DIMA 5JG7A 4RVHA 4X44A 4ZAZA 1JR3E 2QU7A 1VKRA 1XZDA 3C7TA 4HB3A 4HEHA 2AW5A 3HXQA 1FU4A 2PH1A 1CEEA 1XJCA 5LYYA 3JWHA 3C8UA 5CW2A 4YJ2F 4LYYA 4ZGGA 4ZV4A 3L77A 2JAPA 3L8YA 5FQNA 4MUBA 2FLWA 4C3VA 2IHNA 3GPCA 3QXGA 4PXAA 3W3AH 1ZJYA 4ABYA 2CEKA 2EKZA 4NMHA 3TG8A 1ISSA 1QQ6A 2HK7A 2JJYA 2C2MA 2JKYA 4PG7A 3TNLA 4S35A 4EHAA 2ZYVX 3FNBA 2RJ3A 2AI2A 3TTSA 2DLNA 2FGJA 3I9V6 4D79A 5C37A 4FBLA 1TF7A 3L7NA 3I45A 3TPZA 3TZBA 4IUDS 3DM9B 3I2HA 4X90A 3K31A 4GVXA 5ITWA 5GGYA 2DWOA 1UBEA 5HM6A 5LOVB 3KR9A 2WB2A 4DA7A 1UFKA 1RXEA 1IM8A 1QO7A 2AE2A 4N5DA 1Y48E 3CT4A 2XT9A 1TAQA 2ANCA 1XBTA 2NO9A 4JYPA 3TLEA 4EATA 3BB3A 4FZ5A 3KJXA 3LY5A 1CX9B 5FFNA 2PRSA 1O95A 4GGOA 2O06A 4NXNB 5B58C 1MAUA 2ZP1A 3DEFA 1EP1B 4RESA 5CAEB 1P80A 2HBRA 3GG9A 5B53A 5I8WA 3TIXB 3D6VA 3KSUA 4LDPA 2OZLA 4CMJA 4GP9A 5BUQA 5AJVB 1NVEA 3E9NA 3AI1A 1HE1C 2G67A 3MCAA 3O31A 4OP1A 1W0KD 1ISIA 1NBMA 2I03A 3IVRA 3KQYA 4X1IA 2Q5FA 4V0QA 4CQMB 5IHPA 4IS2A 4RQBA 1EFVB 1H66A 4LZLA 4CM4B 5EMKA 3EPHA 2NVUB 2NQTA 3WP0A 5AJHA 2GH1A 4J75A 4H4CA 2ACWA 5F78A 1UR5A 3RHZA 5BR8B 1P61B 1YS7A 1KMNA 3RF7A 4G5HA 2VBCA 3I0ZA 4PRKA 4ITVA 1JEEA 4M0LA 2VOJA 1JEDA 2OUKA 5I47A 2ZT7A 4UZSA 5AYVA 1SD2A 4CQJA 4FKBA 2VHYA 3I9V1 3RREA 3TK1A 4D9NA 4EW1A 2OC4A 3M2TA 3S0JA 1X1AA 3M5WA 2WD7A 2B4YA 2QOEA 1MC5A 1ZUWA 2QSUA 5ALOA 3AF2A 4FVTA 4ARUA 4P8RA 4EMUA 4CLDA 3JZAA 1YQWA 3S1LA 2KMLA 1DQNA 3OF5A 4FC7A 4B2LA 3O2SB 3DZCA 1Z0ZA 3EEQA 4XIJA 4FMCF 3L92A 3E1KA 3K8QA 2MOKA 1Z28A 4J76A 2J8ZA 3WWCA 3H1EA 4WFIA 4LYEA 2H1IA 5BQPA 3RVPA 4CTMA 2VI5A 1Z4MA 2W48A 2OD9A 1Z39A 4Y6GB 4URVR 2JFXA 1RJEA 2PGXA 4I5IA 4BFTA 1H9CA 5JSUA 1GV1A 1GADO 2CL6X 2GVZC 2X0FA 4FYYA 1SHJA 2Y1LA 4NH4A 5CDSA 5JCOC 3T3PB 1QQTA 3PQCA 2C03A 1UINA 4KQMA 1XROA 5ESDA 3AYXB 1R37A 1FU7A 2D8AA 4J16A 2C5SA 3PNBA 3QFSA 4K26A 4OD0A 2QZ4A 1E3QA 3I4CA 5G41A 4D41A 4X97A 1VFNA 5FFMA 2QL7A 4BNDA 2PMCA 3AL2A 3DBRB 3EIUA 3CIFA 4QIHA 3ZYZA 2FK7A 4CMAA 2CE2X 4RTJA 5J1SB 3OSUA 4LX8A 1G8YA 3COSA 1U80A 4DM4A 1FS5A 5CFZA 1JYSA 4OQNA 3D0QA 2WWTA 1E60A 3NWPA 4Y2PA 5F3RA 4WNIA 3WL7A 1K3FA 3KHUA 4F8YA 3AVWA 2WLSA 4KRGA 2J0EA 2VCEA 1AUOA 1XTIA 2NUTB 3COYA 5AUQA 2CLCX 4K7JA 2RH8A 3ZI7A 3C6KA 1MUUA 1K2VN 2WMYA 3CIOA 4TXHA 4Q4CA 5IKXA 3FHTA 1A9TA 5KWSA 4DCJA 4H0FA 2QRZA 5TT1A 4TV8F 4Y18A 3WHPA 5EHGA 2ZRIA 2WIBA 4TX1A 3ET4A 3AH8A 3RBVA 4C20A 5IDQA 3GFFA 2R1UA 2QVCA 4YJ2A 5BQFA 2QG9A 2NOAA 4KO4S 2E9SA 4ECAA 3RFTA 4EQ6A 1QLHA 2PQMA 1D4FA 1N8SA 4UFNA 5AKHA 2XMCA 1XRRA 1U2RA 1F3OA 3F98A 3R3JA 1ZEJA 3UYLA 3RJZA 1K0FA 4TSFA 5DNCA 1F7VA 4AJIA 1NYQA 1ZZGA 3LCRA 2L42A 1E1RD 1VSUA 4LA4A 3QSYA 3ROGA 2YICA 4V0OA 1R6BX 4MR7A 1K7XB 1G20B 2QX8A 2QX7A 3QYPA 4J94A 4QPJC 4Y30A 1B0PA 3ZHRA 3T6KA 1W7AA 2CVQA 4BNWA 3EXG1 1BMFA 4L16A 4QYXA 2G4LA 4HN9A 1F6DA 4LGYA 5ELMA 4ZU1X 4AQDA 2YWGA 1IJKA 4WEOA 3ZKWB 5CEFA 1GPJA 1L4FA 2FE4A 2HNBA 4D0NA 4UAVA 3DE7X 2C5EA 3FNQA 2BFMA 2AJBA 1E2FA 3GN2A 3V5NA 2IQIA 2PCLA 3KL2A 4D0SA 3WRVA 3VRHA 4G1UC 4OXNA 1VE6A 1NBMD 3KKQA 2QN8A 3L1IA 1WOYA 5KWEA 4TTQA 5JS8A 2YFYA 4F2DA 4KREA 3AJRA 3MD9A 2Q0HA 4QTUB 3OOEA 4G9BA 1T9GS 1X7ZA 2HA7A 3G5LA 3R5TA 4GRIA 4M54A 5EE5B 3V8EA 1VQ1A 2QQ5A 4ZODA 5DISB 4JI4B 1T3ZA 1UDAA 3AWIA 5AJXA 1FXSA 1OBVA 2DUJA 3K1AB 3NJ8A 2PD3A 2H31A 3QU9A 4N6NA 4ZJYA 5HUQA 2GCIA 4L0CA 4WZAE 3SWWA 3LAWA 4RS3A 1LS6A 3O4IA 1I8TA 2V7QA 2F3PA 2O8FA 1T6NA 2UAGA 4QBGB 4YNBA 3EXIA 5DT2A 3V8RA 3SEZA 2JFZA 2BFFA 1DAPA 2A9OA 2RGUA 3C3WA 3CLHA 4RACA 3VGJA 3U4MA 1LV7A 4L08A 4I4IA 1XNJA 3MQ4A 2DOKA 4NCKA 5JSZA 3KHSA 4L3VA 2QTVB 3OIGA 3N8DA 3WL6A 1AC5A 4BC0A 3VC1A 4L5JA 5BNWA 4R6WA 1E5TA 3C8ZA 3OE5A 3QTLA 4PHGA 4UQPA 3NDBB 3U3OA 4WCFC 1UK7A 3SYKA 4CZ2A 3F90A 1K7FB 2DM6A 3EIXA 5DT9A 2MTBA 3RC2A 3ZJ4A 1SVUA 3KYIB 2H0QA 2WMDA 1YZUA 1C7IA 1F14A 1JLLB 1RPAA 2J3JA 4URUR 2NSLA 1ZM3A 5IARA 4OP3A 4CCAA 1QIJA 1HDGO 1KZ6A 2EFDB 3SFVA 2J3KA 3GCXA 421PA 2CLIB 1GZVA 2JCXA 3TQHA 1Z7WA 3ASUA 2XCTB 4GL2A 4EUNA 3KZKA 5IJZA 1KGSA 2BFFB 4DQKA 4MUEA 4D4KA 2H1RA 4CN8A 5TQ0B 1A88A 2BGGA 3FZYA 3B2NA 1CFJA 1T1RA 1X80A 3FOEC 5C1OA 1G7RA 3LKBA 4OA8A 3QELA 4EUEA 3OHSX 3DTNA 3DZHA 3B38A 4UVDA 3ROFA 2R68A 1ZLXA 3OPQA 4WZZA 4DLAA 1CC1S 2XHEA 3HCOA 4FKMA 3M2PA 4KI0A 1C1YA 3P45A 4TS9A 1KFCB 3IB3A 1JBKA 2WF8A 1R5OA 1LDBA 5HVNA 5A3SA 1ONSA 4UNPA 3HO6A 1FBTA 1WY7A 3HDVA 2RIPA 3R3YA 1IPHA 4JP8A 4BWVA 5IX8A 1YA4A 2E18A 2HHCA 4BIIA 5L3SB 1BMQA 1JEQA 1RP1A 3ANLA 4LPSA 1CSEE 1F2UA 3R44A 4NH0A 5DV9A 4PQEA 1KAOA 1TO2E 4DV7B 1E2GA 1AO0A 4DDUA 1UDRA 3PVZA 4RDHA 4WA8A 1BN7A 1VHLA 3QU5A 4WIAA 3SQNA 4W6QA 2ZTMA 5CBPB 5JRJA 3U3ZA 1JE1A 3OFJA 3AY7A 3DYVA 4UCQA 1Y1LA 2Z57A 5IT0A 3HUFA 4IFTA 5T8KA 4YIHA 1D4AA 4HNSA 3IBYA 1QFMA 4ZQBA 1ZR4A 4OL0A 1JHMA 1MX9A 1FRNA 1Y1TA 2I3AA 3E7WA 3PYLA 4ZALA 4FD2A 5CNKA 1QYRA 1N2BA 1B7GO 1SHUX 1RYEA 4XOUA 3GVHA 3HXMA 1SOMA 1TMOA 2QV7A 2IDMA 4TZTA 2I71A 4WNAA 5K3BA 4FDLA 3CISA 1TM4E 2XVZA 2I99A 4YK7A 2XSZA 3GBVA 3FRHA 1IBMB 2VUTA 4ZP1A 1H0KA 2ZYGA 2EDCA 5EJEA 1E63A 1DXHA 4JJ7A 2JI4A 2B30A 4FINA 4DG5A 1B23P 1NP6A 3C98A 4AK9A 5CBKA 2WUDA 5ITVA 4IHKA 3FYHA 2IPXA 2V7PA 3FDJA 4YRFA 2ZQ5A 3O92A 3R0QA 3KTOA 4KO3S 2ORED 4PZ0A 4B83A 3D43A 4CT5A 4LMAA 1KI6A 5C7IO 5IWAB 1RLUA 1BDBA 3H6HA 1JG2A 2C9MA 3LRXA 4L4UA 4MUIA 5JD4A 2X1HA 2IXGA 4EKGA 1XLWA 4GYYA 2MINA 1WE2A 4P7KA 4Q01A 5HFNA 3THXA 4TQAA 2B4KA 1KAGA 4J1QA 1AKTA 1PV1A 3P9KA 5C4IA 3O0TA 3UN1A 3OZFA 1NFFA 3QOFA 4HB0A 4P4LA 3VTAA 5IMBA 5HF5A 5M04A 5KQRA 5SYNA 1V8BA 5K0BA 5M34A 4GF5A 3A1NA 4MYSA 4FE4A 1U7HA 4YDSA 2GN0A 3P9YA 4NJOA 3UY4A 4YRZA 3VV2A 4ZI3A 3VH1A 1KYXA 3LHDA 4J0GA 4CM9D 2N47A 1VBKA 2REBA 3LX5A 1F51E 2O5EA 1R4MB 2H6EA 3TAHA 1RYMA 3OQOA 4NHEA 2Q29A 2QM7A 5LKAA 4MCHA 4DT1A 5E3IA 1A77A 3U40A 3NBUA 5KSOA 1PGPA 4GT1A 4F04A 1DBQA 2BTQB 3C87A 2QX4A 3QY9A 5DI9A 3DAOA 4GI5A 5BURA 2JLAA 1FPMA 4CDMA 2F48A 3ZNQA 3WYEA 3FNGA 1EVIA 4P7JA 2CYBA 1NMSA 1N92A 4O63O 1IM5A 2BJHA 2BMWA 1G8MA 2R48A 5T4FA 1H9AA 2ZXFA 3VZQA 4PSDA 4GR4A 5LBUA 3NBMA 1SUSA 5LQJA 5TIIA 3NEYA 3HP4A 3I5XA 3MQ2A 5FPPA 4CM6A 5K8TA 1CQZA 1P8JA 3LQ4A 4EJSB 1YR7A 3ITEA 5EMNA 2AW3A 1CZNA 1G16A 1RKXA 4K6HA 4AMVA 2XZLA 4JEIA 4E22A 3LQ1A 3AFMA 4M88A 1FJ2A 1ODSA 4FI3F 1DBIA 3AT1A 4CCWA 3I2YX 2WU3A 4GO1A 1NN0A 4OIMA 4ID9A 1BD4A 1NF2A 2BDEA 2Q5CA 2A9QA 2GCGA 1NI4B 1CIPA 2Y1FA 4I2NA 4AY2A 3KQQA 1PNVA 5IK2A 1JZTA 5EP1A 5FOTA 3V80A 5AUNB 3ZWYA 3U31A 4JMLA 2OZPA 4P33A 1Y8AA 2PL1A 2CXQA 2UV8A 2XA1A 2HBYA 3R09A 3IEPA 1M2OA 2O4CA 3DDNA 1Q21A 2G9QA 3IJ5A 4F45A 2DFTA 4DMKA 1BN6A 2XWQA 2HXGA 3NTXA 5KQPA 1WCIB 4RQTA 5TEVA 4BFYA 5T6BA 4KNWA 4O2BA 3GGGA 3EAFA 4DMGA 1CZOA 2O3JA 1X42A 2GJ4A 1BMTA 1OLXA 2H07A 3CU5A 2PPVA 3ZU6A 4XDGA 1MB4A 4KPGA 4BX8A 3VKHA 2FZKA 1EBUA 5ES4B 1GKYA 1P81A 4M9RA 1V9CA 2P2ZA 2AVNA 2WAMA 2DG2A 1ND5A 4F6CA 2B94A 1NZDA 3LW8A 3D6UA 3KVOA 4URFA 3RSHA 4CIAA 1NI5A 4JHLA 1N0IA 1U02A 3K1JA 1XNQB 3DUWA 4PC1A 1LRLA 1PNOA 1V6SA 4IR7A 4WUTA 4MOWA 3R5KA 3V8QA 2OGZA 4LF6B 1OFHA 2DWUA 1EP2B 1BEUB 3TDMA 1JHZA 1ZMXA 4C06A 1Y7PA 1RWPA 1T4BA 4BZQA 2NVOA 3L84A 4J0QA 1L5WA 3RS8A 5KO2A 3IP6A 2XADA 5DGHA 5LDHA 3I12A 1YNOA 3F5FA 2Z3ZA 1GPWB 4DIDA 4FEGA 4KDEA 4G6ZA 2ZRGA 2H4XA 2AZDA 1KO4A 3FRJA 3K30A 4H4DA 3E23A 3MOSA 4Q48A 3V7FA 4MR9B 2NSDA 4C5AA 1X14A 3QUSA 4GSYA 3TCKA 2B7BA 4CLHA 1MOQA 1EEXB 5G0UA 3RB8A 3S27A 1MDBA 1F0YA 3COVA 4M7PA 3EISA 1HZZC 4OKSA 5ALRA 4AVYA 1X1CA 4E70A 3K4PA 3TLMA 4L9RA 4AQ7A 4M0DA 1L5KA 5LBTA 3K0BA 4I3GA 4KXLA 3DAPA 4GWKA 4ZRDA 1XMXA 2FP4A 1DB3A 2X0NA 4CKBA 4D9EA 2ODBA 2WF5A 2ZJ4A 1IBCA 2V3WA 5K8LA 3EYAA 5LQNA 2O05A 1IXSB 1Z4KA 3PC8A 4MCIA 5AUOB 1CF4A 3QU2A 1IPEA 1UXIA 3HABA 5D5PA 2H4FA 5I7FA 3MGCA 1W59A 1LUAA 2EJTA 3PUHA 4R5MA 4UE3S 4EITA 2PUEA 1L2TA 2C61A 4YQZA 2JLZA 5D2CA 5IAEA 3LC1O 5ESXA 3THRA 3GDHA 1USUA 4GLFA 4YUAA 1RJ9A 4QG7A 4DMFA 3NYWA 4MR9A 5EQFA 1UC5B 5A05A 3S99A 4O0LA 4FCVA 4NBRA 1EM8B 2ZREA 4V2UA 3ZGOA 2ATXA 5AH0A 4EGSA 3UJPA 4PLGA 2X42A 1CUIA 2JLCA 1XKQA 2QA5A 5ALIA 3F97A 5KJ1A 1OGYA 3L18A 1VP9A 3IAUA 3WB1A 1R8JA 1J97A 4G5YA 3H4MA 3KU4A 2VYND 4B4KA 4JC4A 2EZ8A 3DXZA 5LUBA 2VP2A 3BWXA 2UYCA 2L2QA 4ODIA 2Q50A 5FOUA 3NU1A 4LBZA 4OA5A 2PNFA 5KNLA 4NPHA 5CRIA 1A97A 5EZYA 2RSLA 3FFTA 3W3AA 5C52B 1L8LA 3FW1A 3VC7A 3FSEA 1AA9A 2OT3B 1HFWA 4QELA 1E1CA 2P9HA 3X1KA 5DPMA 4GKKB 4QM6A 1A1SA 1PQUA 2CZCA 1PG0A 1PJ3A 2YJ6A 3ACCA 1T8TA 2VUUA 1GYPA 2FE1A 3HKCB 1N2ZA 3HYSA 3EVZA 4QFBA 2QMOA 3LGAA 1KC1A 4R69A 2B8TA 2H4HA 4W5RA 2PSFA 4FSDA 5TPWA 4DA9A 2G5TA 3LH5A 1U8UA 3EGXA 4RJJA 2SICE 3VM6A 2WILA 2ZKLA 3WB0A 1K92A 1YQ9A 3TL6A 2CBZA 1B14A 2H11A 1M10A 1JHXA 2Z98A 2ZSAA 4RAOA 2B5WA 1Y3DE 3KYBA 5KNCA 1AURA 2AF3C 2C0CA 2VJDA 5F1OA 1WP9A 1XVTA 4MGZR 4UUPA 2ID8A 3M5CA 2YTZA 2JK1A 3AFNA 1P44A 3KRTA 3WQSB 3B3AA 1IXKA 4HZGA 4Q18A 5MGBA 1FSZA 2ODQA 2XWBF 3F7OA 3IFSA 5I9BA 1QGUA 4K88A 4UC0A 1QH1A 1T2NA 2R65A 5JMOA 4E30A 1B2RA 1Q3TA 2C9ZA 2F4NA 3LWDA 3NDRA 2D59A 4PZDA 3TS1A 4DNQA 5BY2A 2W6ZA 4L22A 4AUEA 2JD0A 3PB3A 4ZI7F 5HQ3A 1E2DA 1OLOA 4QUJA 1OT3A 2WB4A 4NCXA 3CBGA 5EEHA 4DJJA 1IWPB 2RG7A 3B36A 3TVYA 5E3HA 1U6IA 5DGDA 3QI7A 2ERCA 3B6EA 3IVCA 2Q6OA 1C8BA 4JITA 5PNTA 1NQOA 3W6UA 5B3AA 4XQ0A 4EQZA 2QRUA 1JLLA 4TV9F 4CKCA 3IXQA 2VDQB 2ZRCA 3OPYI 1MX5A 5KIAA 4M6WA 4Z1OA 3OJLA 1CRQA 1VL8A 2IEDA 4GKVA 2V7WA 1A9XA 3LY7A 3I2KA 1EFKA 3O8OB 4PRYA 4HFMA 1UK9A 3DQZA 1M1XB 3RW9A 1YBVA 2EW1A 4LZJA 5C31A 5THKA 3GFQA 2F1IA 3ZWKA 1X9GA 4LJAA 2VDLB 1H42A 5DLYA 3IOMA 4EKDA 2OXFA 1XEWY 5IT5A 3UUEA 2HCFA 3DBLB 4PGAA 1ANKA 4FHGA 1UAGA 2QN3A 1RCTE 3IQFA 4IIBA 3U1VA 5K8CA 1ACJA 2QTRA 4XWAA 3EFBA 3S8YA 1QC5A 4FZJA 1YF3A 2E21A 1QPZA 2XE6A 1ZIYA 3IVXA 3EXIB 2HU2A 5J2TF 3KQNA 3NVKI 3KKEA 4BO6A 3ZV6A 1P19A 4TQ9A 3UTDA 3UKDA 4DSUA 3CG4A 2IPMA 4O4HA 1TD9A 3C5WP 1WDMA 3RD5A 4C5CA 1NLFA 4X8OA 4EG3A 3TEFA 1TJPB 3TSYA 5H0IA 1JNYA 3F6YA 4XQEA 4P38A 3U3XA 5IEJA 4GMHA 3JZDA 2H1SA 3EX7C 3OZTA 3PK0A 1VI6A 1J00A 3AJDA 3GLGE 1E96A 3CINA 4S12A 4AXBA 3OIWA 4F3NA 4Q00A 2EJVA 1FQJA 3F8SA 5AW8A 5IUNC 3G2PA 3TRIA 2NO0A 4L73A 3UQYS 4J0HA 3CCCA 3TKLA 4RGBA 1UCFA 5INTA 2YRFA 2VDJA 4MVJP 4XE5A 5C8VA 4P0TA 2DH5A 4TWAA 4ND3A 4O1IA 3QOWA 2GF2A 3H16A 4TTSA 3QXJA 3EVNA 4JUIA 3TXXA 1TYBE 5JI2E 3GZJA 1H1LA 1QNFA 4DBLE 5J5AA 2WHXA 1L7OA 1N3LA 2W2QA 1EWKA 3OO1A 4KFSA 5ABPA 3NC0C 1P7WA 4PGFA 1SC9A 4ALLA 3MJEA 4QVGA 4MAAA 5ALXA 2MINB 1B76A 3C3EA 4BNZA 3VZBA 2OVBA 4C3OB 3VR5A 3OQ1A 4DFDA 1XU9A 3K0FB 3QKRA 1JA9A 2YFQA 2GM4A 1WDKA 2NTEA 2AYXA 1GNTA 2V7VA 3FCCA 3QZUA 1IH8A 3IEMA 1QV6A 4KSYA 1YKSA 3CNHA 5L4NA 5IDYA 4P08A 4B3CA 2DBVO 1DJOA 2CUNA 2XQJA 3CE6A 2FDRA 3IAM6 4YV0A 2BGLA 4OYHA 2AJCA 2FPPA 4NYJQ 1YV9A 1D6JA 3LTEA 2WKPA 2MCFA 2M1ZA 3BFXA 3SM3A 2Z5VA 1PGJA 3DV9A 3PFGA 4KDRA 4XUCA 5BNIA 3BXZA 4CM7A 3FPEA 1GPMA 1EGMB 3G7SA 3T9CA 3QX9A 3RYFB 2XRFA 5FPKA 1RZRD 3MNFA 2Y3IA 3IB6A 1W8IA 1RWNA 1SZCA 1L8QA 2I1LA 1WULS 1ORDA 3IQIX 1G291 3JCZA 3P94A 2JCVA 3HKDB 4CMHA 3AIOA 3DEIA 5H1YA 1RLOA 3IP1A 2IHKA 1JMVA 2W6JA 2CN1A 4J0KA 5DW3A 4KXMA 5D1NA 2JKZA 3OF2A 1H4VB 2VATA 1P9LA 2JGRA 4EG5A 5I3CA 3R7FA 5AVZA 4WN9B 3U4QA 5EXEA 1C1DA 3CGWA 5E4YA 1EFLA 5I7EA 2Z2ZA 4EL0A 1RYNA 3D81A 1CQWA 5IM5A 2Z8YA 1GQSA 2FQ1A 3GUCA 3JD2A 3N3BC 1J33A 2VHUA 4K9NA 4LI0A 5F77A 4BVKA 5D5QA 1N34B 4GZ6A 1NM5C 4TRMA 4J4TA 5KOJB 3LVQE 5TVGA 1RHKA 4JWKA 1DCTA 1L5SA 1T13A 2RGNA 3NP9A 3OQPA 4V0KA 3UF0A 1NVFA 2IFTA 4E32A 2GK4A 5B1DA 3TR6A 2H2DA 2Z5FA 4MWCA 1TYZA 1AGPA 3Q0IA 2QAGC 3F74A 4PQRA 5JBIA 2X2OA 3F4KA 5DHPA 4D3FA 5CDYA 3CVVA 4HOYA 3D59A 1T1SA 1KNXA 4BBPA 3F6BX 3C41J 3PIDA 4U9HS 3CLSC 2YCBA 1XEXB 4Q4JB 1ELOA 3UHPA 5A4DA 2A0WA 2JFOA 2G72A 2QQ0A 4YAOA 3QMVA 1GAEO 2O8BA 2X86A 2XD4A 1OF1A 3QBEA 4N47A 2IS2A 4CKXA 2FEAA 4MPPA 4I50B 2IOYA 1CKEA 2QR2A 2QR5A 5K0ZA 1M7GA 5CVTA 4ZGWA 2VSQA 4OHPA 3E1SA 5A03A 3SYNA 3WLFA 3QE4A 3PQ2A 3OA0A 4JGBA 1XMSA 1OFVA 4L9SA 4LJ8A 4X1OA 2OYRA 3MHPA 4I1YA 3ZJYA 1UJBA 2CXXA 4BDTA 1CERA 1EFRD 1JJBA 1EWTA 2B2NA 3CF0A 3QXHA 1XD2B 3CW9A 1Q0RA 5A02A 4UU0A 2RHJA 1AUQA 5DCLA 2R47A 1NR1A 3N2NA 4YAUA 2Q3HA 4Q9IA 4S05A 2BE9A 2POCA 2HEGA 3DF7A 2C4VA 2LR0A 4N3AA 4R2LA 4XCVA 2Z2YA 4LJLA 3I37X 3VR3D 1GDHA 3IAM1 3M81A 4C7VA 2JIPA 5EG5A 4EVRA 2JHCA 3JU3A 3NBFA 1U28C 1XTQA 4M8NE 4CNQA 2ZBGA 4N3CA 5F35A 5ICGA 1Y7HA 3AIMA 4QE3A 1UEXC 5IH3A 1H8EA 3HBNA 1ORTA 2Z2JA 1Z6QA 3PGVA 2J48A 3CH4B 3NB0A 3K0CA 1RNLA 4UE2A 2G8LA 2X0JA 3QU4A 5PGMA 4Z7NB 1E5DA 4CETA 2BP7A 1EFUA 1REQB 4P83A 3RC1A 4QDTA 3TZLA 4I1SA 1UBRS 1MVLA 3CTPA 4UUNA 3ZWNA 3CKYA 2CJXA 4F91B 5HS4A 2O2CA 4RHFA 2DQYA 4CKBB 1ESNA 5JCZA 3EZ2A 4H17A 2P9CA 4IIGA 2P5UA 4HAOA 1FX0A 1H22A 4L72A 3PDIB 4OVKA 4DCMA 4X24A 4UOEA 5EHIA 1PL6A 2WFLB 2XIQA 4V1CI 3JQ8A 1SBZA 5KSZA 4TQUS 1G5FA 2IT1A 1DKRA 1Y5MA 1HA3A 3LNCA 4G81A 1T3LA 2D0PB 4GOND 4YC7A 3VYSB 4B8WA 3M33A 1FSGA 4Q4AA 3LLCA 3CTMA 3L6UA 3MUNA 1YR2A 2Q1WA 1NRWA 1SD1A 3Q87B 4EBFA 5DGCA 1ITZA 2D00A 2RAUA 2CUZA 2P6OA 2D5LA 1E9SA 3AILA 1NLZA 4IH4A 3W05A 1FYDA 1KEZA 5KAMA 4NQZA 1REQA 3ZI4A 3DVAA 1UBOS 2KB0A 3G2LA 3MCZA 4TRNA 4JI8B 1NIPA 4LDNA 2W43A 3L6BA 3LT0A 1WQ1R 3B70A 3ETLA 3NHMA 4BASA 1M1YE 4GUDA 2WUGA 2GCEA 4DADA 5GV8A 2QVYX 5I01A 3OFSA 5EUMA 3JVEA 3N5CA 2AR0A 2G6TA 5BOSA 3FCOA 2JVKA 2GD2A 3OX4A 5ED0A 5SICE 4U5XA 2M98A 1I2CA 2X9VA 1UQTA 2Q3LA 1FL9A 2ID9A 1BCRB 4HLDA 1KS9A 4GPZA 1QQ5A 3AFHA 3DHEA 3OC0A 4MQFB 4P4NA 3TTVA 1CJMA 4NNOA 1DBRA 1LGYA 5CA1B 4J29A 5F33A 1A8PA 2H5JA 1GIAA 3EF0A 3OQHA 3EWSA 1UADA 4BX9A 3FTEA 2W6NA 1TX4B 5F73A 3BSSA 4EW6A 3C3XA 1DWPA 2GJSA 3ZE0B 4X60A 3WLLA 4ROTA 4MLZA 1JXOA 521PA 1U2QA 4KCGA 4DUPA 3BQMB 3CZ5A 3Q6NA 1BWQA 3CR3C 2CT8A 2DGDA 1TIKA 2AT1A 2FSPA 1YIAA 4JQZA 3E2PA 4PCVA 1F6BA 1N4DA 2ZRAA 5AHOA 1BYIA 3BE8A 5JSFA 2UZ3A 3DQPA 3T4XA 4NAVA 2PZKA 3Q3VA 4BFWA 1KJYA 5I9SA 5BUCA 3H2HA 3OEYA 5AW4A 3HO1A 1A69A 4ARIA 1JG1A 4B46A 1NVGA 3DOOA 4PPGA 1VBMA 3GJXC 4B8YA 4QBHA 4G97A 4IHJF 3GCGA 3ZXUB 3GFSA 1EBFA 1RRGA 3AGPA 2VYFA 3ACDA 1Z13A 4O4IB 3ZK8A 1V5EA 1JG7A 3FKSA 4O1MA 1PJ4A 2A3RA 3RT9A 1QDEA 2Q2OA 3D2CA 3IQDB 3SLGA 2BMFA 4WNAB 4YP6A 5TQ2B 1LKZA 1JWBB 4MZXA 1R12A 3JTEA 5D85A 2QRGA 2GWHA 3IVMA 1SCKA 3MWFA 3B7PA 2VUHB 1Z5PA 3NCHA 4DC1A 4NABA 1EVJA 2HB6A 4WKBA 4DAEA 4MKHA 5ALTA 4WECA 2VBGA 3V4LA 4Q9NA 5JY1A 1U8ZA 1VRCA 2AOTA 4ACAA 3HU1A 4OQQA 4WKCA 5J4VA 4O0MA 2QMEA 3B6MA 4IWYA 4WK6A 4DWOA 1GUYA 1RACA 2Q27A 2ZDQA 5IJAA 5K0GA 3EFEA 3QXCA 4QO7A 1TYDE 3RHSA 3F6PA 4R2IA 2QT0A 1W1UA 1AS3A 1MJFA 2VAMA 4P2BA 5HA5A 2QPAA 2NVUA 3BB1A 1XR3A 3AVUA 2I3GA 1EXWA 2CJFA 2JLYA 1G8SA 2QUAA 4LE0A 1U98A 4AFNA 4G24A 2BFDA 3ZE6A 2YFKA 3Q98A 1Z2AA 3CCFA 1WBJB 3CZ9A 4ZEVA 4CIWA 2J0UA 1SIBE 2ZGVA 3RIHA 3ZOZA 3Q12A 3F2IA 5HX7A 3WFJA 3FOWA 4N7JA 4LRYA 4OQPA 3VDQA 4O2LA 3NPAA 3ZCPA 4PRLA 1V5IA 2ATIA 4Q3AA 5CLGA 1FDIA 3P19A 2FHPA 1MH9A 4R31A 3W5VA 4RKFA 4DBLC 1PT9A 3R24A 5I6DA 2A5LA 3GJ3A 5JIBA 3K9FC 3BRQA 3F4BA 7ABPA 1G8KA 4YRNA 3VHXA 1RRVA 3W2TA 4C6HA 2XMPA 3CVOA 2QTMA 4N12A 5EIAA 3RRFA 1PWXA 4QTTB 4PX5A 1YJ5A 1Z2CA 3UG6A 1RI4A 4EAAA 4CLEA 4MGHA 1ZGBA 3S2ZA 3WC4A 1R0CA 1Q1BA 3EFHA 3F9IA 3WGGA 2I9PA 2O8VA 5KYUB 3KZOA 1Y9ZA 3K0FA 2V5UA 3AF6A 2PMEA 3HNPA 1VJ0A 3ANNA 2ZAMA 5DBHX 2EDAA 2YUIA 2CJPA 3R0ZA 2PK3A 4OOFA 3VKFA 1F8FA 5EMLA 1V1MA 1SQ6A 3X1XA 2ZUSA 3RTDA 3ZJTA 4EYSA 4BJ3A 4QOFA 2HD4A 5KYVA 1ZRNA 1ZJJA 2GBCA 3Q3HA 4MGEA 4XVHA 2OFFA 3K0AB 4YROA 1MTZA 1QORA 2TMDA 2N3ZA 2O0KA 3AXTA 4XA8A 4DWWA 1N2CB 2YY6A 3KKLA 2CXOA 4MI1A 5F2NA 2VZ9A 5IUJC 5EP2A 1NPDA 4L57A 2DR0A 1I94B 4IEIA 3G89A 4IPTA 1VMIA 1U7UA 4LHSA 3JVUA 3MGGA 2R8BA 1JR2A 2Q99A 1DZ3A 2HN9A 4E08A 3WK6A 1YA6A 2EQ5A 4FGKA 1ABFA 1PDOA 5KYUA 3KDAA 4IX1A 1UEIA 1Z82A 3UCFA 1NNEA 4XRGA 3D7NA 4R8VA 3WHKA 1LBIA 1X1DA 2QF7A 3AXSA 3LMKA 4IO1A 1UBNA 3UAGA 1IXZA 3GJZA 4H0CA 1F1BA 2VA8A 4Z4HA 1BG6A 1Z9BA 5KZMB 1JLKA 3E7DA 1VLMA 1ESEA 3ICCA 4IVRA 1K98A 4ZT2A 4A0FA 2RC5A 3H19A 3BZWA 3PGLA 1JVSA 2VP5A 3HWWA 2NU8A 1LCIA 4MR7B 2DPXA 1G3MA 1KVTA 5KWIA 2IXFA 1ZM7A 2GQ0A 1CZRA 4N5HX 3STHA 3EQ2A 1ILEA 4MHOA 1MC4A 4R2JA 3WX0A 2V58A 4EHIA 2WT4A 2ERXA 4AN1A 3AETB 2BV3A 1PDWA 5TQVA 2PT7A 2H8GA 4KWIA 4ZGBA 3B6JA 3BD9A 5A3RA 4EENA 3PC4A 5DEIA 2CXRA 4QNRA 1B8OA 4PZAA 5BYAA 1N5LA 3OECA 4L75A 2PQ2A 2G80A 4NV0A 2Y67A 4S1TA 5TB5A 4PS1A 3SZGA 3ENQA 1UKEA 2YY7A 5KEIA 2I2WA 2ASEA 3IIEA 4U39A 1IVYA 1D7OA 1MDFA 3R0XA 4GXQA 1MNQA 4TRRA 1YUNA 4KB5A 4KR7A 1JL3A 3PJDA 3FTFA 1A5TA 1SBIA 4MH0R 5C2JB 3KXDA 3HL4A 1WCWA 1E2PA 1YDEA 5IAKA 2IPOA 3FI9A 1FC0A 3R5JA 5HZHA 3RK1A 3J7AC 1S2LA 4KP7A 5JJCA 5EC8A 3BXHA 1XP5A 2P2YA 2OILA 3NWJA 1VP3A 3OAAD 1XXHB 3A4LA 5FPSA 4ZYTA 1I2BA 3R6TA 5IYZA 1JXAA 3LPNA 4HL6A 4IG9A 1QOPB 1VB5A 3DMTC 1EP9A 2RKWA 3IT0A 4J0JA 3Q41A 1RHQA 2IHUA 4TN1A 4XZ3A 3KUCA 4NESA 4I6JA 5IVKA 2D7DA 1NKVA 1ZU4A 3SQLA 1LQTA 2VVTA 3V8VA 1O1YA 4ZOLB 4B2IA 3NKVA 2XXBA 5FB3A 2QBYA 5HGXA 2NX2A 3GEEA 4HS4A 1I7PA 3S68A 2D2IA 4WBNB 1D4OA 2FRDA 2WWWA 5AKYA 4FR0A 1L7DA 1ZC4A 2C88A 3BK1A 3LG2A 4X91A 5ERGB 5MN4A 2R66A 2HA3A 1KGDA 1YBMA 4Y2RA 2W8BA 3DPIA 1L1QA 2FN4A 3X1JA 3FF4A 1G21E 1WSDA 4N9QA 1DQZA 4W5HA 4XYMA 1CE8A 5B1HA 1DAHA 4BYGA 5IULC 1T34A 3GARA 3KLBA 4IDPA 1Z2OX 5HIIA 2L69A 1N8KA 4EB6B 1UIMA 1W0CA 1ZJZA 3LQYA 2GVNA 3M4JA 4YPFA 2BR4A 2P3LA 3CNQS 2H3HA 2H0RA 4HQRA 4LE1A 4DGSA 2XYVA 1KEVA 3N1UA 4RM3A 1NUAA 2MWMA 4RKRA 4WW0A 5EKXA 4JLOA 4QOGA 1B0ZA 3OZGA 4BY9E 4G8CA 1KAQA 4G1CA 4MVJH 3DBLA 3UMSA 2XUGA 4FOTA 4ZOLA 4E51A 3K32A 3AMVA 3IAXA 1R6DA 4XD7D 2CL5A 2HCJB 5CLHA 1ZKMA 2J0QA 3PIIA 2FFAA 1WW8A 2OPBA 1RRMA 1U2EA 5FYQA 4AKEA 4RABA 5FUMA 1NXSA 1HMPA 2PX2A 3FUWA 5DNDA 3SR3A 2XA9A 2DRIA 4DE5A 5AM3A 2M32A 1KMCA 4KXUA 1CRWG 4NCHA 2CVHA 3JY6A 1QFXA 1DO2A 1FRFS 2Z5LA 1ZXLA 4D8YA 4ZIRB 1L7BA 1Z8DA 1SVMA 2R25B 1GGFA 1VRWA 4Q5IA 4ZTBA 1DJNA 3UPDA 5B3KA 2BZ1A 2B7LA 1JHUA 8ABPA 1I1QB 4NDZA 3U4AA 4ZYYA 4PFQA 1VJRA 1Y8CA 2ZT8A 2CV2A 4HQ0A 1WTAA 2Q5IA 2YWCA 4E1AA 1FX0B 3ZE9A 3ET5A 3P9NA 2B82A 4NZYA 2WU0A 1YI1A 3I72A 2JD1A 2II6A 1BQ4A 1L7MA 3AIKA 3QF7A 5I8ZA 4IJVA 1T4MA 1SR8A 4GQAA 1R16A 2V6GA 3U7QB 1IULA 2Y68A 4UDOA 4ZVPA 4DCPA 5FOVA 3FPCA 3SJUA 5CLJA 4XSHA 1FFXA 1CQJA 3CLSD 2XWJI 4HDAA 4LUCA 4NOJA 4QJIA 4DY4A 1J0CA 2CDRA 3QMWA 1Y80A 2PGDA 2BMJA 2Z6VA 1HT2E 3FUCA 1CR2A 5EJ2A 3ZDFA 1PZGA 4MPJA 1GPUA 3NMUF 4HZUB 4NPAA 4DDVA 1HX7A 2W2VA 4A15A 2FOIA 4RVFA 1Z6PA 4GOLD 2X13A 5F98A 5LQDA 3AR9A 4WLNA 4G1FA 1QTRA 2CXSA