3E8XA

Putative nad-dependent epimerase/dehydratase from bacillus halodurans.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
GMRVLVVGANGKVARYLLSELKNKGHEPVAMVRNEEQGPELRERGASDIVVANLEEDFSHAFASIDAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFIMVSSVGTVDPDQGPMNMRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVTVSPHFSEITRSITRHDVAKVIAELVDQQHTIGKTFEVLNGDTPIAKVVEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative NAD-dependent epimerase/dehydratase from Bacillus halodurans.
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords Putative NAD-dependent epimerase/dehydratase
total genus 72
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e8xA00
2F1KA 1PR3A 4YJGA 1PGJA 3VPGA 5BNFA 1C0IA 2Y68A 3JQ9A 4HWKA 4M87A 1KERA 4Z0TA 1GQYA 5CFZA 4IZIA 4NMHA 3G1UA 1DRUA 1YWGO 2PKQP 1ZIDA 3ANNA 2OBNA 3JQAB 3TQHA 5A9SB 5ITWA 3WIDA 1ZBQA 4HFRA 2D4AA 2AEJA 1LNQA 2C29D 2XOXA 4II3A 4TRNA 1JDJA 1NQTA 4FC6A 3WQRA 3S2GA 3HG7A 1E7MA 4KTVE 1YJ8A 4DC1A 1M66A 1DIHA 2VWGA 1IPEA 2X6TA 1EVIA 3FHLA 3LC7O 5G0VA 1R4MA 2NVUB 2NU8A 4XGKA 4I9HA 4PLYA 4IDFA 4W99A 3IDSA 3S2IA 4BB5A 4CMJA 3AUTA 5THQA 3AW9A 3WJ7A 3ZWXA 4FOSA 3A4VA 4TVBA 3VKVA 2CVOA 2GN8A 3F3SA 4FFPA 3OP4A 5FI3A 3WSWA 1UP4A 3FD8A 5ILOA 1E7WA 5JCJA 4J43A 5B4TA 2V6GA 2C07A 5IDQA 4BO3A 3K2BA 2Y0EA 2BLLA 2PLAA 2R6JA 4O59O 5EQDA 3BMOA 2CF6A 2EGHA 3RWBA 2HO5A 4OO3A 2PR2A 3ZNPA 5IXYA 2PFGA 3E9QA 4WASA 1ZK1A 3IIEA 3WR5A 4I8XA 2GLXA 2VRCA 3PQFA 1HYEA 3AY7A 1E6UA 1R16A 4PFJA 2BELA 3BIOA 4PG6A 3TRIA 3ZCXA 4NK4A 2O4UX 1UP7A 1F8GA 3D4NA 5ILGA 4E5KA 2AE2A 3I9NA 1X1EA 4JCOA 2ZB8A 3RBZA 1DDOA 1KEWA 4F3YA 1HDCA 1E6WA 4LRSB 4XIJA 2NM0A 1E92A 2X8LA 3GPIA 4F6LA 4YXFA 5C7LO 2D5CA 3QLJA 2EF1A 3JQDA 3GPDG 1HZZA 3FR7A 3WWZA 2IXAA 3GLQA 3DAGA 5KVSA 3NDJA 3ZHZA 2X9GA 1AGNA 1Q7BA 2VZ8A 4RLHA 4MOWA 4B4VA 1E3EA 3DBHB 5I9NA 3PJFA 3GEDA 1YB4A 2VHYA 5T8KA 3FN4A 1C1DB 3DDNA 4AFNA 1ZO8A 1PGNA 3KLPX 1YKFA 4XRRA 5CDYA 3KV3O 5EN4A 4CLEA 3E18A 2BRUA 4B3HA 3AUSA 2PZLA 1IPFA 3IJRA 3RUEA 1BWSA 2JD0A 1M67A 2CUKA 2FMUA 2I66A 4JXKA 1ZSVA 3H2SA 4YPOA 3C7CB 1PTJA 4ZVVA 3D5QA 1NFQA 3NGXA 4CMAA 1QKIA 1A4IA 4MVJH 1FDTA 4FFLA 4YRDA 3WXBA 2VOJA 4DUPA 4Y98A 3KETA 4JROA 4EUHA 2PH5A 1JKFA 1X14A 2BFMA 2J3JA 4FFOA 1IOLA 1YDEA 4TQGA 3ZNOA 4P4LA 4FN4A 4NBUA 4Q3AA 4AJPA 3JYOA 4XDYA 1I3LA 4BL5A 2OZPA 3AY6A 3PTZA 3WNVA 2Y1OA 3SLKA 5IZ4A 2AQKA 1P1RA 2ZTMA 5AYVA 5B1YA 3AWDA 3VAZA 5KVCA 4BNXA 1Q2XA 5BSHA 3DO5A 1P9LA 4XGIA 3GVHA 5DN9A 1B0AA 4M1QA 5GY7A 1XQ1A 1XELA 1ML3A 1K0UA 2Q2VA 4IUYA 5KNLA 1DSSG 5KJ6A 3IMFA 3VC7A 4OOFA 2HDHA 4GBJA 4RPLA 2C0CA 4L4XA 4A26A 4BO0A 3Q0EA 5JAMA 1X1TA 1Y9AA 4EI2A 3DEYX 5JAIA 2J5QA 3C85A 1LEHA 2J5RA 4ZICA 2HKIA 3UH1A 4Z9YA 1A5ZA 2W8ZA 5HM8A 3GMDA 2QYTA 1T2AA 3KYCB 4RCVA 2G76A 4UVIA 2AHRA 1GAEO 1E1MA 3ZU2A 2X23A 4BKQA 2DU8A 3DHNA 3ENNA 4TRRA 1I5RA 4I5FA 3DMTC 1ZJZA 3DAFA 4BMVA 2ZJ0A 5EERA 4DMMA 4LSWA 1E5QA 1JU9A 1LX6A 1DRVA 4RPKA 3GN2A 4GLOA 1N1GA 4GX5A 1DEHA 3GR6A 4CQMD 1R0LA 2C59A 3CPSA 4QO7A 2NU6A 4CPDA 2XAAA 4O6VA 3NDIA 3OBBA 3PRJA 4I5GA 4JJGA 1Y9EA 4R01A 4TZTA 1TT5A 1KIFA 4BHTA 3FPLA 3QY9A 5JPIA 3OECA 2ZCUA 2EJWA 3ST7A 1PIWA 2Q3EA 2WD7A 3RI3A 3V1TC 4H3VA 2I65A 4YT4A 1AHHA 1YB5A 1FDSA 1NX6A 3HWRA 4CLDA 4U6QA 1C1DA 3PJGA 3Q9NA 4W9NC 4J2HA 3ZWVA 1B3BA 2YDXA 1LLDA 1UXKA 1ZNQO 3BTUA 4NR0A 2UUPA 3KB6A 3KBOA 4IJWA 4BO2A 4GL4A 3FSRA 1CERA 4HX5A 1WZIA 1ZUD1 4DRYA 3GUYA 2X1HA 2O3SA 2JFFA 2PA3A 3NT4A 2EWMA 4D79A 4ROSA 1VC2A 2SCUA 1EBFA 1LDYA 1HYGA 4MKZA 4LCJA 1KY5A 4QECA 4UVDA 2DM6A 4XKJA 4AL4A 2Q1UA 4NJMB 3VDQA 2FOIA 2X5OA 4WEOA 4M8SA 2ZTLA 1LUAA 4N5LA 4LRTB 1E77A 2DLDA 1DXYA 4ZD6A 1EMDA 3DHEA 3K31A 4OXKA 4EBFA 3DFZA 3AJRA 1IHXA 3UAGA 1QMGA 4CV3A 1XLTA 1O0SA 2UYYA 3DOJA 3RUAA 4FFMA 3TN7A 1VL8A 3U9LA 5C37A 4FQ8A 4MIOA 1NQ5A 3ZWWA 3VH2A 1T24A 1ZK4A 3ETEA 3ZHYA 4IIVA 3OA2A 4MINA 5ES3A 1A71A 2J3KA 4Q9NA 2VUUA 3V8BA 5EMHA 5DBGA 3TDKA 3KYCA 2OUIA 1YJQA 3E48A 1D8AA 1X7HA 2HSDA 5K6AC 4LVUA 3BMNA 3UCEA 3JQ6A 5A06A 4PLCA 1PJCA 4QQRA 1NASA 1GL3A 1I33A 1PWXA 3V2GA 4CM8A 4K28A 3EDMA 4CR7A 1R37A 3Q1LA 4XR4A 2A9FA 4CMIB 1LXCA 1QV6A 1QYWA 3GA0A 3ENKA 4Y6PA 3VH3A 3E9MA 5A03A 4RVDA 5BR7A 3GNTA 2VQ3A 4BNZA 3AY3A 1JA9A 4NBRA 1SOVA 1BW9A 3UW3A 4ALLA 1H94A 2NVBA 3QE3A 4KUEA 3GNQA 3ZU3A 5CG2A 3HDYA 2BGKA 2VNSA 2X22A 1MGOA 1HETA 1PS0A 4HKTA 1WP4A 3LT2A 4OL9A 2HMVA 1U5AA 8ADHA 3Q2KA 1SO8A 1FK8A 2JFHA 3PFWO 4FB5A 4MO2A 4PG7A 1PJLA 4J1QA 2CMDA 1ZZEA 1YS4A 3ZW8A 1O5IA 4JIGA 1Z6ZA 3W8DA 1ZSYA 4ND3A 4R1NA 3S1LA 4RORA 3WTCA 3UFXA 1ENYA 3WG9A 4HBGA 4PGFA 3GDGA 3UVEA 4GGPA 1A72A 1C0KA 5BT9A 3BTVA 3WWYA 3ZU4A 3P7MA 2XXJA 1C0LA 1UZMA 3COSA 4L0QA 1VM6A 4UEJA 3BTOA 1ZFNA 1G0OA 1U4OA 4N7RA 1VKOA 1HLDA 1HSZA 1C14A 2JJYA 4P4GA 3OJEA 3PHIA 2JCXA 2DBRA 3EHEA 3SBOA 1PS9A 4A10A 5TGDA 1GYRA 5T6BA 2VWPA 3QV1A 3A9WA 3FBGA 5TSDA 5JAZA 1YRLA 5DZSA 2OHXA 4WNIA 2Q50A 2EV9A 5TT0A 2NUAA 4CLXA 4YR9A 3LZ6A 2HMTA 3CEAA 2EKPA 4YYZA 1LI4A 1E3WA 2GN6A 2EG9A 1DLIA 3K5PA 5B4UA 1MUUA 3Q6IA 2EP7A 5JYDA 1P0FA 2PD3A 4OJNA 2AG5A 4YT8A 5JCXA 4UUPA 2DPHA 5EL0A 3GN1A 3QVSA 1E0DA 5TJHA 3DOOA 1NPDA 2DTDA 2GERA 1XU9A 1MFZA 4Z3DA 2X0IA 4YEDA 2H63A 2P4QA 1XIVA 2QW8A 5IDYA 1DC4A 3RFXA 1EK5A 3U4IA 3FCOA 3HDQA 5TLSA 7MDHA 2D0IA 4ND4A 2W2KA 4D42A 3U09A 2C54A 1HRDA 2FR8A 4GWKA 1DOHA 4P22A 4AJ1A 2X0JA 3JD4A 4Y67A 1EEHA 1NBOA 3D3WA 3PLNA 3WNQA 1P1FA 3HN2A 1XU7A 2OXIA 3DTYA 4BO8A 1D1TA 1U3TA 2I3GA 5AOVA 5HRUA 3B6ZA 2J3IA 1YQXA 2DVMA 3RD5A 1SC6A 2E37A 1N1EA 1U5CA 3VTZA 3ANLA 3CUKA 3NGLA 3MEQA 2VRCD 2W98A 1EQ2A 3C8MA 5JDCA 1MV8A 4IXTA 4J0FA 4MIYA 3RC7A 3AU9A 3KSDO 3GGPA 2CDBA 2WE7A 4JBHA 4FD3A 3FR8A 2H6EA 5A3VA 4JJFA 1P45A 1WMAA 3HJAA 4BB6A 1E3IA 5L7TA 4PRKA 1ADBA 4W82A 5ENVA 3WYBA 2D8AA 1YH3A 4ZQBA 1U8FO 3R3JA 4KQXA 4OAQA 3UCXA 5CEEA 1PL7A 3IKTA 1KS9A 3C7AA 3CZMA 4RF3A 1MB4A 1D4FA 1SB8A 4GKVA 2O50A 3ASUA 2RHRA 1G6KA 3WMWA 4QFCA 2EIHA 2B5WA 3KLMX 3M2PA 4NI5A 4E4YA 4E32A 3DZIA 4ZHSA 4D0SA 3RIHA 1JTVA 2D5AA 1A9ZA 3AOEA 4FCCA 1FDUA 5DT9A 3H6KA 3I6QA 4R5MA 3UGKA 2O2YA 1MC4A 1P1HA 3O8QB 5I9MA 1EBUA 2ILTA 2RAFA 1TB4A 5A05A 5T57A 5BSEA 1UAGA 2YZ7A 5CPBA 4YT2A 3QWFA 3GEMA 4NJMA 4YAJA 3NTRA 3TPCA 3AOEC 3ZH2A 4GMFA 2FP4A 4YJGB 1CQIA 5TC4A 5K6AA 3H65A 1D3AA 4ND2A 4M86A 4R69A 3ONDA 2JL1A 3HB4X 5CAEA 3KSUA 1HTBA 4J2OA 5CPFA 1E7RA 4G2NA 1PGQA 1LLQA 1XGKA 3TFOA 5JE8A 1NXQA 2ZYAA 2VTEA 1CIVA 4A27A 4L8VA 4HNGA 2PZMA 5I8ZA 4TROA 2WD7B 3KUXA 1CYDA 4D41A 2IRWA 4EUEA 3GZNA 5JMPA 2Q2WA 1ISJA 1IUKA 1ARZA 1JQBA 4OMUA 2R00C 3ADOA 2GZ1A 3DXFA 4R1SA 2B5VA 3BMOB 3GHYA 2IZ0A 3JQ7A 3AUUA 1UXHA 5B37A 4CV2A 2JD1A 3X2EA 2YFQA 4HUJA 2PD4A 1PU2A 2HK9A 4XQEA 3RC1A 4UEOA 3AI2A 5A4DA 1B2LA 5JW6A 4CMKA 1Z74A 4W7IA 4CODB 3NV9A 4WLVA 1YXMA 1SBYA 1F8FA 3HHPA 4L74A 4Q3DA 3INTA 5A5EA 1W8DA 2JAPA 4R51A 2Z5LA 5COQA 3ANMA 1T25A 3WGHA 4BV9A 3RU7A 1ZMTA 2NQ8A 4BV8A 3H5AA 2BGLA 4ILKA 4J91A 4YJFB 3T7CA 5JC1A 1PZEA 3TZHA 5AXAA 5I7EA 4RL6A 3JTMA 3DQPA 1MXHA 3WYCA 2FHSA 4PCVA 5CDUA 4BNMA 4UUMA 3GVXA 4O5OA 5CP8A 4BGIA 1L7DA 1DFHA 1YOVA 4U7WA 1P1JA 3ZV5A 4FW8A 5JS6A 2AEFA 3GOHA 4YAGA 2AMFA 4FPXA 3O8QA 3V1YA 5FF9A 2D2IA 2HK7A 3I9OA 3UCFA 1LSSA 5BSFA 2I76A 2D1YA 3DBLA 3JV7A 4GVLA 4HY3A 4PVDA 1TI7A 4A7PA 1T2CA 3PHHA 4CV0A 4NJOA 4MP6A 2Y1EA 4FSHA 3GZNB 3M1AA 4KUHA 5A9RA 1UXGA 4BKRA 1ISIA 1HLPA 3B70A 4MVJF 4XB1A 3NYWA 3MJTA 4IQ8A 2X9VA 3W6ZA 4L4SA 2GCGA 3LC2O 1LBEA 5T67A 3ZWYA 3ZDFA 2FR1A 2O2SA 2JAHA 1H6AA 2CDAA 4XJSA 4F46A 1BXGB 1Y8QA 1DIGA 3MOGA 1TLTA 2VWQA 4DQVA 1NPYA 4DMLA 3KEOA 5ADHA 4E30A 4RLSA 3VPFA 2FWMX 6LDHA 3I4CA 1C1XA 3AM5A 4OQZA 5DOZA 2IXBA 4I9UA 5JYEA 1RJWA 3K2EA 4HFJA 1WLYA 2C2XA 4HV4A 1PX0A 2GDZA 1X7GA 3PLRA 1QG6A 2CY0A 2O48X 2PWZA 2PY6A 1LDEA 1SZJG 3KRTA 4GPD1 2DC1A 5TNXA 2FPGA 1KC3A 2ZB4A 3CMCO 3VTFA 3CIFA 4JBGA 3SLGA 4MVJG 2PGDA 1DRWA 3DONA 3DFUA 4D7AA 4NBWA 1XG5A 1LDGA 4AICA 3LT1A 5BQFA 5JO0A 1OOEA 3E9NA 1CJCA 4BKPA 3FI9A 2WJPA 2ZJ1A 3MTJA 4PG8A 4YJHA 2NU7A 4Y6RA 5JDIC 1DFIA 1BTOA 1MX3A 3E6AA 2O7QA 3UOGA 2HRBA 5LDHA 2P2SA 4XQGA 1HDZA 1B3RA 1SEPA 3GY0A 4H15A 5FWNA 4ZA2A 4RPGA 4NG5A 4CL8A 3PPIA 3AK4A 1WXDA 2VNAA 1QP8A 3L6DA 4OH1A 1CETA 3INRA 1VI2A 4MVJA 2B4TO 3PDJA 4U5QA 2X9NA 1I32A 3U4DA 3DL2A 5EINA 4D0RA 1IZ9A 3IC5A 1GCUA 1F17A 5A5FA 5IN4A 1U28A 4ALJA 3A06A 3SJUA 4CM5A 3H4VA 3OMLA 1EUDA 3B1JA 4DLLA 1GYPA 4BGEA 1NVTA 2G17A 5I7VA 2ET6A 2EERA 3VZRA 5THKA 1O94A 4Y6SA 3WYEA 2O23A 2GO1A 4YB8A 3I1JA 3I3OA 2JHFA 5JBIA 1SB9A 1EVZA 1B16A 1R0SA 3D3WB 3QIVA 1V8BA 1HSOA 3D5TA 4CJXA 3LU1A 3K96A 3GRPA 3UUWA 3GVCA 5TX7A 3JCZA 2DT5A 2H5LA 1JW9B 4U8GA 4NU5A 5HBRA 3N7UA 3T4XA 4BKUA 2HJSA 1NVGA 1DAPA 3GG9A 2QG4A 1O95A 3GGOA 3U49A 3W8FA 4BKOA 1YO6A 3WFIA 1MG5A 3D1LA 3MJVA 1GD1O 2NTVA 4EUFA 3VPHA 1YGYA 4FGWA 2BFPA 4KWHA 4R9RA 1OI7A 4B7UA 2WD8A 1IL0A 4WLEA 3SC4A 1IULA 3EZLA 4D46A 2QHXA 3VH1A 3B1FA 3AOGA 3PZRA 3OJOA 4OSPA 2PH3A 1LDMA 3ON5A 1LLUA 2A4KA 1PQUA 3O26A 5C5IA 3BA1A 4MP8A 4IMRA 3P19A 5B12A 1JVBA 4RVGA 3DZKA 1GEEA 4DTIA 3W4IA 4MIEA 4EEZA 3OJ0A 1O89A 3L6EA 1GFSA 1HKUA 1PS8A 1P3DA 2QRJA 1HEUA 4XR9A 2Z95A 3FWZA 4L76A 3ZWBA 4EEXA 2CD9A 1C0PA 2D3TA 4ESOA 2OFPA 1A9YA 3DB2A 4OM8A 5IF3A 3NX4A 4IDDA 4DA9A 3LLVA 1BGVA 1JKJA 1E1LA 4MDHA 3T4EA 4IS3A 1U7HA 4WK6A 4RDHA 1EVYA 4ZRMA 3TFQA 1PZGA 4AJHA 4BO5A 2X7HA 1DPGA 1KYQA 3CH6A 2JD2A 2VWHA 3FPCA 4DQUA 3L0DA 2GYYA 2HAEA 4CQMB 3HUDA 4B4UA 3O9ZA 5K0ZA 3H5RA 3JQ8A 3OQ1A 3GT0A 4BNTA 1H5QA 3BMQA 5L53A 4XJTA 2WYVA 3WQQA 4RPJA 1T1SA 4UREA 4J7UA 4B8WA 4M49A 4EYEA 3PEFA 3HDJA 3KYDA 2A92A 1N9GB 5COAA 4HNHA 5EQFA 1P0CA 1Y8RA 3KM0A 1JKIA 1T2DA 3LDHA 2RBEA 4TSKA 3JYLA 4LSMA 4GLLA 3TNLA 3PWKA 2Y1DA 3PFFA 2GR9A 2OGUA 3P5SA 2EEZA 4GQAA 2VHVA 1BRMA 1NQOA 5L40A 5A3JA 3PI7A 2YY7A 1DIRA 1FDWA 1DFGA 2PZKA 3IUSA 3CXRA 5G0SA 2E48A 3WJAA 1RM4A 3R1IA 4D44A 4TVOA 2R2GA 3PYLA 4RZIA 4PLTA 5FFFA 3E5RA 5LCXA 2FR0A 2VHXA 4ZU3A 4CMCA 1AN9A 5HWSA 2LDXA 3KYBA 1LDBA 4R5HA 4XYMA 1IB6A 4Z0PA 4TZKA 1NNUA 1R0KA 1GUYA 4MVJI 3D0OA 2GZ2A 3RSHA 4XCVA 4A0SA 3U4CA 3WSVA 5I8WA 3HADA 3WGIA 3IKVA 3MJCA 2DTXA 4NK5A 5KKAA 1MFPA 4JP3A 1BHSA 3GDFA 1N7GA 3WBBA 1RPNA 2J5KA 1GZ6A 2YUTA 4MPDA 4XRGA 2GNAA 3W8EA 1ONOA 4I08A 1J49A 1GYQA 4BGVA 2FN7A 4BNWA 3U4HA 4L75A 4BOYA 3F1LA 5EIOA 3OQ6A 2OBYA 2VHWA 4E21A 3JQBC 4JN6B 1W73A 1ZXBA 1LA2A 1GV0A 2QRLA 4BNUA 3HNPA 3ZI0A 1E7SA 1P33A 2IE0A 3MCVA 2YV1A 1LU9A 3OFSA 4NFYA 4II2A 3NT2A 4XB2A 2RIRA 1NFFA 4IDGA 1R6DA 4NZ9A 3OHSX 1MXFA 3HFGA 1YDWA 2BHLA 3F5QA 4YRBA 3FTPA 5HA5A 2FSSA 4AG3A 3RFTA 4PLZA 1XQ6A 2QX7A 2PD6A 3GAFA 1Q0LA 4HFMA 1Y6JA 2YW9A 4XYGA 4YRAA 4LMPA 4IQGA 2YJZA 2DPGA 1KEUA 4N5MA 1NAHA 1R4NB 5MDHA 1P44A 3MJEA 2X58A 1E3JA 2NQTA 1X7DA 3TOXA 1H6DA 4J90A 3KSZO 4H7PA 4ALNA 2NLOA 2VYVA 3EMKA 3EC7A 2V6FA 1EE9A 1NR7A 2X5JO 5AQ1A 3ULKA 1I36A 3DBRA 3QVOA 2I9PA 1PJQA 3RROA 3WICA 4OXYA 5B4VA 2PK3A 3NAQA 1NVMB 5A9TA 2IYOA 2VUTA 3KEQA 3DBVO 3BAZA 1MLDA 1W4ZA 4CM1A 4FGSA 1HE5A 3IP3A 3B20A 5F1KA 3JD1A 4R1UA 5KJCA 3DZJA 2GN4A 3OEYA 4RQUA 1EDOA 4ZRNA 1HZJA 4OKIA 5IN5A 2Y0DA 4GAEA 3RC9A 1LSOA 3VH4A 1PZFA 4QUKA 1LSJA 2YHIA 3PYXA 4Z3KA 2Q46A 2O3TA 3DZHA 4CMIA 2C7VA 1UP6A 2Y0CA 3GDOA 3A1NA 1GZ3A 2QZZA 2O3UA 3LF2A 2HMSA 2W2KB 1Z73A 4BS9A 1K6JA 5L4LA 3EW7A 1ADGA 1BDMA 2EJVA 1H6BA 1N8KA 1BW9B 1Y5RA 3CE6A 1V0JA 4I5DA 4BQPA 2DUWA 4IIUA 2J8ZA 4KDEA 5F5NA 3WB9A 5GZ3A 4U0JA 1Y8RB 3AM4A 3AI1A 3OIGA 4R68A 4WCFA 4ZQFA 1GPDG 1NQAO 2X4GA 2O4CA 1DC3A 2VYND 3AU8A 5DCYA 2NU9A 2JCVA 3GH3A 1PJBA 3PGXA 3OQBA 3RVDA 3IS3A 2FZWA 2HUNA 3C7DB 3PWZA 1LSUA 4E5PA 3RFVA 4CLOB 4YAIA 3GAZA 4PLGA 4ALKA 1I24A 5COBA 4YAKA 2GGSA 5JMWA 3TJRA 3QQPA 4WJZA 3WLFA 4UVHA 3RUDA 1Y7TA 4FJ2A 3TZKA 2W2LD 3NTQA 3ROQA 2BGMA 1LJ8A 3OA0A 1SCUA 5JNLA 4BNFA 5BNIA 3I5MA 4MVJE 3VVBA 1Y5MA 3FTNA 4BQRA 5IDWA 2DFVA 4J3FA 4PG4A 1PQWA 2YHIB 1EE2A 1HE2A 1K6XA 3PWSA 4XQCA 4TMFA 5I7SA 1KVRA 2B0JA 1Q0HA 3OH8A 2OL4A 3F47A 1HF3A 4FS3A 2HMUA 2H9IA 1ISHA 4DREA 2FZEA 1YQDA 4M55A 4WECA 2VT3A 1E5LA 3BMCB 1QLHA 4E2WA 5A9SA 3V5NA 4J4TA 1WAMA 2NWQA 5BNTA 1ADCA 4WCFB 4L73A 1V3TA 3K6JA 5JC8A 3QWHA 5J23A 5DBIA 3ROMA 2PV7A 5L7WA 4ID9A 4K9DA 1HDXA 3GK3A 1P77A 5GZ6A 3G17A 4J1SA 1KEVA 1QORA 2HCTA 3AFNA 4DPKA 5EJ2A 3D4PA 1EFLA 1KY4A 2YYYA 2FY8A 3G1TA 1T4DA 3L9XA 4GI2A 4IDAA 1YONA 5EESA 3OF2A 4GSLA 3HDHA 1SMKA 1OC2A 4IQ0A 4UUOA 2E49A 4R3NA 1VL0A 1BDBA 2B4QA 3SX2A 5KCZA 4OSOA 1PGPA 1QXSA 3EAGA 1UXJA 4CLRA 1GTMA 1TA4A 5IDXA 4URFA 1E1NA 3JQ7B 1X13A 2O3RA 1N5DA 3AM3A 3FBTA 2P91A 5L3ZA 2ZTVA 4JX8A 3M6IA 2H1SA 4I5EA 2OP1A 4R3WA 5KVVA 3IUPA 2VYNA 3WTBA 5F1OA 1B8VA 4IBOA 2VRBA 5A02A 1EDZA 1XR3A 4CL3A 1HE3A 1RM5A 3DBLB 4XA8A 1GQQA 4A73A 2GUGA 2UDPA 1ZMOA 1WDLA 4J7XA 2IYPA 1SPXA 2YV2A 2CSUA 1V35A 4MKRA 1OAAA 3BYZA 2RH4A 1EUZA 1GUFA 3NJ4A 1YL6A 4KP7A 5TF4A 3UF0A 4DQXA 1DIBA 4P38A 2B83A 4NFHA 3S2EA 5IZCC 2X86A 2YV3A 1VKNA 4WGGA 9LDBA 4BMNA 4XZ3A 3H9GA 4MKXA 1YBVA 3QVWA 4WCDA 1TT5B 4E31A 2VZ9A 4Y8VA 1OFGA 3G49A 3UHAA 1BG6A 4B4WA 3ABIA 1YB1A 2DBZA 4YQYA 4WPGA 3TF5A 1J0XO 4K26A 3N74A 3H9UA 4NFSA 4J4HA 3KYDB 3UICA 3RASA 1GV1A 1ID1A 3MTGA 3K9QO 4J6FA 1A27A 4PIVA 3U62A 1M75A 1WNTA 2YHUA 4Z9FA 4R9SA 5F1PA 4PLPA 3JQ9C 4IJVA 4L9RA 3QVTA 4W4TA 2O3JA 1HDRA 3UXYA 3GUCA 4LCEA 2BH9A 1FF9A 3F4BA 4RF5A 2EKQA 1I2CA 4IJKA 4E5YA 1B15A 2Y66A 5U1PA 3I9LA 3OETA 3VPSA 4IZHA 1QR6A 2IEDA 3G79A 3QWAA 4S1VA 3VZPA 3K8ZA 4J16A 3RJ5A 3WGGA 2Q4BA 2HRZA 4GWGA 4IS2A 1GUZA 2WSBA 3LK7A 5ER6A 5DF1A 1OZAA 2VUSA 3D7LA 3KHUA 1TEHA 4NH4A 1ZK0A 4W7HA 3LC1O 3ZGYA 4RV9A 3LT0A 2RCYA 2OOSA 3OSUA 4CMBA 2EKLA 5JO9A 1BMDA 4YVFA 4LISA 3ICPA 1G1AA 1ENPA 2IZ1A 1A4UA 4MVJP 4AJNA 3E82A 1UXIA 1WDMA 3ITDA 4DIBA 1T4BA 3E8XA 3TOZA 3RUHA 3KOUA 1YBAA 1EK6A 1P1KA 3LYLA 1EFKA 2DQ4A 2RHCA 4U6SA 4ZQEA 4EITA 4ZQGA 3WS7A 5KKCA 4KDFA 3L4BA 4WLNA 4H16A 4YACA 1J4AA 3HZZA 3KO8A 4RPHA 2DUUA 3O4RA 3MWEB 2CVQA 2WMDA 4OHUA 2VZ0A 4Q39A 3GQVA 3QWBA 2I6TA 4CR8A 2Y1FA 4J49A 1EZ4A 2G82A 1U7TA 2QYSA 3Q9UA 1CWUA 2B35A 3V1UA 4RVUA 1I0ZA 3DTTA 3LSYA 4W9NA 1H2HA 2Q4EA 3MJSA 1L7EA 4AJJA 3BMQB 1VJ1A 3RUCA 5T8KC 3ROKA 1U4SA 4I9NA 2I99A 5ITVA 4RF2A 4BO4A 2ZYDA 5KVQA 4BNIA 3WOHA 1GU7A 4O1MA 4BO6A 1QV7A 3HB5X 5DBFA 3WFJA 1PEDA 4Q3CA 5F5LA 4PLFA 3GZ4A 3JYQA 2UAGA 4BGUA 4DL9A 3I52A 4NIMA 2BFOA 1GCOA 4LN1A 5IZCA 2ZQZA 5T5QA 3VZSA 3W4JA 3FNEA 2UUOA 3ZNQA 1H6CA 3TZ6A 2BI7A 4YWJA 1LQUA 1ENZA 1CQJA 1IYZA 1GPJA 4J9VA 4BVAA 1PJSA 4Y9DA 2TMGA 3S55A 2B69A 2X0RA 3GFBA 4EJ6A 1K5HA 2R00A 3D4OA 4ZN6A 4J7CA 1QYXA 2RH8A 4TRMA 4FC7A 2WTBA 3W6UA 2Y1GA 4JP2A 4U0KA 4CLOA 2EHDA 2WWRA 1UR5A 2G1UA 1ZW1A 3JQGA 5G2OA 1GQ2A 5JCJD 5G0TA 4WEQA 4DWVA 1H2BA 4CM6A 2QZ9A 2BMAA 1KOLA 5HS4A 1AXEA 4FIZA 1RM0A 2JCYA 3VZQA 4CMGA 5C3MA 4KOAA 1ZKMA 4AJEA 3GGGA 1ZXLA 2EW8A 4B7CA 1TXGA 3NKLA 4PLVA 1XYGA 3IL2A 4J4BA 4AJIA 2FRDA 4J9UE 1JAXA 3ZWMA 4LGVA 5F3RA 3G3EA 7ADHA 1Q0QA 1U3WA 2JKVA 4J0EA 1IZ0A 5A04A 1OC4A 3IOYA 5TS3A 1I2BA 2D59A 5JLAA 4JJIA 5L4SA 1GADO 3C1OA 3C1AA 4BNKA 2ZTUA 1JWBB 4BNLA 1M2WA 4CMEC 4C7JA 4G5HA 2W4QA 5AVOA 2V6BA 3JD3A 3OIDA 3H9EO 2EGGA 3JQ8B 3EVTA 1PGOA 3EVNA 3PYMA 2AQHA 3DAPA 1AUPA 2ZCVA 2CF5A 1Y81A 1NP3A 4CM3A 2TMDA 2EW2A 4R4JA 3JQBA 1Q7CA 1IY8A 2Y1CA 3LQFA 4Z6KA 1ULUA 3H2ZA 1PWZA 1LDNA 3L4BC 1NFRA 1AE1A 1Y1PA 3TSCA 3MWDB 3LLSA 1KVSA 1XEAA 4Q3EA 1N92A 4GVXA 2P4HX 2ZB7A 5G4KB 4DVJA 4OQYA 4RZHA 3JQAD 3F46A 3JQEA 3QJ5A 3RAJA 3LF1A 2J3HA 5JY1A 5CHEA 1RYDA 4B3IA 2FPIA 3OEWA 4DBVO 4OKNA 4M54A 5KJ1A 3NT5A 4PZDA 2P68A 4PG5A 4S3MA 4BNHA 1HWYA 2DBQA 2F00A 4N18A 5LDGA 2POQX 4JLWA 1Q7GA 3I9JA 2CZCA 3Q3CA 1GZ4A 1BSVA 2HMWA 3ORFA 3ITKA 3H3FA 5G4LA 2E82A 3I6IA 4JGBA 2I67A 2BKAA 4HP8A 4GMGA 3IP1A 4LVCA 1NHGA 1ZK3A 4XYBA 5DP1A 3NEPX 1XDWA 3WBFA 2NNLD 4D3DA 2UV8A 1E3LA 2Q99A 4YCAA 5LC1A 2A94A 5U9CA 1CDOA 1X0XA 1YVEI 4KQWA 3VOSA 3PDUA 3GRKA 3JD2A 4CV1A 1ONNA 3DWFA 4E2YA 4ITUA 2C7GA 1GDHA 1QSGA 2OO5A 5H83A 2B4RO 1YL5A 3KVOA 2I3AA 4PLWA 2P9GA 3WGYA 1P74A 1UJMA 2OORA 4KMSA 5GZ1A 5KIAA 1H0KA 4JQCA 4E12A 2IODA 3NJ8A 5L45A 4D45A 2FSVA 5FYDA 3EUWA 4WKGA 4OXNA 4O63O 1UDBA 1SNYA 5TJ9A 1TVEA 4Q3BA 4NHEA 3U3XA 3SXPA 4IGFA 3BHJA 3PJEA 1PR9A 4YTEA 5DOVA 4D43A 3R0IA 1H9AA 1I30A 3ZHBA 4IY1A 1ZK2A 3PHLA 4IXWA 5JDIA 3OIFA 2BI8A 4DIOA 1JVSA 1B8PA 1PSDA 4LMRA 2V7PA 3DC2A 4YJDA 1AHIA 1KETA 3ZU5A 2ZK7A 3I9MA 2AW5A 1S7CA 2C5EA 4J1TA 1RKXA 1SOWA 3ZV4A 3GFGA 4CMHA 1U2GA 4W6ZA 4CQLA 2A35A 2HU2A 4KUGA 3NTOA 4L4RA 4GX2A 4YJFA 1T2FA 1JWAB 2B36A 3L6OO 3R3SA 4NNJA 1EVJA 4BUCA 2W90A 3RJ9A 2WDZA 1SEVA 2Q49A 2NACA 4Z9XA 3X2FA 3P2YA 1W0CA 1HYHA 1UZNA 4LW8A 1ENOA 4WUVA 4KWIA 1I2ZA 3KXDA 1P31A 3OJFA 4EJ0A 2EXXA 4K6CA 1WMBA 3BMCA 4OGWA 2AXQA 4QEDA 4IJUA 3W1VA 5BSGA 1UH5A 3H9QA 4PVCA 4Q3NA 4ND5A 2XF8A 1U2DA 4ALIA 3DHYA 2BF7A 3ZWAA 1CRWG 3FNGA 2AG8A 2NV6A 5JXWA 3QW2A 4AVYA 2CNBA 1E7QA 3F6YA 1ZCJA 2JHGA 3GMSA 4ZGWA 2YQ4A 3L4SO 4R1TA 4RF4A 1VJ0A 3PXXA 2ZATA 1DO8A 3PP8A 5TT1A 2BD0A 2NTNA 4BIIA 3PVZA 3RUFA 1YOVB 4DLBA 3WQSB 2DAPA 3DMTA 5ENDA 1LQTA 3WGTA 3QVXA 1WZEA 2P9EA 4EGFA 1RM3A 1P1IA 3ONFA 1UDCA 3CTMA 4JNKA 3PJDA 1KEPA 4QT0A 1AXGA 1IHYA 3D3EA 4MP3A 3RCBA 4IM7A 3CKYA 5AXDA 4OIMA 4FJ0A 3S2FA 5DCUA 4A03A 4E2XA 4XYLA 2C5AA 1T26A 3E5MA 3CSDA 3ZV6A 1A7AA 4MJLA 4UEKA 2GF2A 3V2UA 4CM8B 3W4KA 4QXMA 2E6UX 4A5OA 4CR6A 3RC2A 3MZ0A 4CM9A 5JY6A 3JD0A 3JQFC 4N5NA 4FJ1A 1QYCA 2PTGA 5L51A 3AUAA 3STHA 3WLEA 4CM7A 4CUJA 3A28A 9LDTA 2O3QA 4WLFA 1XSEA 4E0BA 4DPMA 3ZWNA 1Y8QB 3ETDA 2GRAA 1F06A 2P5YA 4CUZA 3DMYA 4RO0A 1U3VA 3ZWOA 5JDCC 1R15A 3OJLA 3DZGA 3GC6A 4G81A 4EZBA 1PL6A 3HQ4O 2WYUA 2YDYA 2UVDA 5JFOA 1VL6A 1KVQA 2VTDA 5HS6A 1D7OA 3ZWPA 2O7SA 4X54A 4DIFA 4WE3A 5DDIP 5CEFA 4HXYA 5CDGA 2ZB3A 2X0NA 3PGJA 1WVGA 2CFCA 1V9LA 1DAOA 1V3UA 3PIDA 3E03A 3QWIA 3BMNB 5AXBA 1I3KA 3EYWA 4UULA 1LC0A 4R16A 2AE1A 3WGQA 5C7OO 3FNHA 3QHAA 3DBRB 4NDNE 3SJ7A 3RU9A 1MC5A 5C7IO 4GKBA 4OOEA 5G0WA 2Y05A 4O0LA 3U5TA 5G4KA 2HQ1A 3K73O 2CVZA 2PKRA 4RVFA 1DLJA 2Q1SA 5AXCA 2C82A 4AJ2A 2ZKLA 1B14A 1GR0A 1VJTA 4J1NA 2AA3A 1J6UA 1YL7A 2VCYA 3B1KA 5L4NA 1UUFA 3H3JA 1DIAA 2Q1TA 3MOIA 4IINA 1NAIA 1PZHA 3EY4A 5CDTA 2X5KO 3VDRA 1MP0A 1QYDA 3RQSA 3VVCA 1FMCA 5IJZA 3WMXA 1Z7BA 1N9GA 1Z82A 3G0OA 3ZHXA 4DC0A 3K30A 4IDEA 1T2EA 1FXSA 4PZCA 1HL3A 2Q2QA 3SEFA 2VOEA 3KTDA 4M89A 1NM5A 4AJKA 4BMSA 2P5UA 3ZN2A 4FBGA 4QO8A 4TKLA 2DTEA 1ZJYA 4K6FA 1QLJA 3N58A 2P9CA 4BNNA 1H93A 4XEHA 1VPDA 3QP9A 1E3WB 2NVWA 3ZZNA 5MGBA 4CLHA 2ZIZA 3JYNA 4ZJUA 1A7KA 1GEGA 3RBVA 2YQ5A 3CZRA 2Y99A 3AI3A 1KVUA 1LRJA 1WW8A 4HADA 1V6AA 4INAA 2IDZA 3HFSA 1C3VA 1U1IA 3U0BA 4F45A 1VLLA 2V65A 5GMOA 4XX0A 3FF4A 3M1LA 3WX0A 1B7GO 1M6WA 2AQIA 2JFGA 4B79A 2NSDA 2W2LA 4CQMA 2XPCA 1K89A 4JK3A 2NVUA 4BNYA 3I83A 1CEQA 1E1KA 1F14A 1E7YA 1I01A 4RDIA 3WIEA 2ZQYA 4UAGA 5KWEA 4TRJA 4D3FA 2G5CA 3NUGA 1DC5A 1K6IA 3H5NA 4B8ZA 1NHWA 2OP0A 3ADPA 3K92A 3Q11A 1WPQA 3M2TA 2WE8A 1M6HA 1R12A 3GHHA 5CG1A 4YBZA 4AJOA 6ADHA 1KC1A 3C3XA 4RJTA 2PNFA 1UDAA 4DYDA 5DNAA 4CMEA 5KOIA 3WGZA 1I10A 3HE3A 3FWNA 4E13A 1V3VA 3UKOA 4TWRA 2DFDA 1YQGA 1XKQA 4KTTE 1T1RA 1K2WA 1DJQA 3FNFA 3ICCA 1C1XB 3PIIA 5HTOA 1W6UA 2PGLA 1BXKA 4GGOA 4IDCA 1ZEMA 4DLAA 4EJMA 5L95A 4FDAA 2Q1WA 2VT2A 2Y93A 4MVJD 2AQ8A 5FI5A 3TZQA 1ZVMA 1VSUA 3ASVA 4PZEA 4RQTA 4IMPA 4C7KA 4YAEA 4YDRA 3MJ4A 3S8MA 3PQDA 1LRLA 4XYEA 3NRCA 3BHIA 3ONEA 3C1TA 3JQAA 1ADFA 1JAYA 1FJHA 4F6CA 3DZFA 4BNJA 1HDOA 5U4QA 1F12A 2PGJA 4GX1A 4BO9A 3RBXA 5DP2A 2Z1NA 1XWFA 3JSAA 3Q2IA 1M76A 1CF2O 1ONPA 3ZNNA 3ZW9A 5ER9A 3DOCA 2Q45A 1OMOA 4BO7A 4CM4A 4YT5A 4XIYA 1S6YA 5TRTA 5K9ZA 4BNVA 1Q1NA 1O8CA 1ISMA 4NBVA 1YBMA 2B37A 1L1FA 1FDVA 4R54A 2Y67A 5H82A 4CLRB 2IZZA 3TL2A 3BZUA 5TQVA 4EDFA 5KJFA 2OMEA 1Z7EA 1YE3A 2QQ5A 1PJTA 3PK0A 5I9LA 1Z75A 3RUIA 4XQ9A 1N7HA 2PKQO 3A14A 1R4NA 2WYWA 1U3UA 2WEKA 4PRLA 3V2HA 3CINA 5JAQA 5L7YA 4YJHB 1N2SA 5F21A 3F9IA 4E6PA 3ETGA 1SAYA 3RKRA 5L9AA 3I4FA 4UVEA 1JLLA 1PL8A 4WLOA 1PJ3A 3R6DA 4E5MA 4K1LA 3PZBA 3C24A 4XWYA 1O6ZA 1ISFA 1QYVA 5CDSA 1I3NA 3BHMA 2VN8A 3TWOA 3P2OA 4DBZA 1NTOA 3PHGA 1RYEA 4BO1A 1XCBA 4DYVA 4AJLA 1KBZA 1X15A 3TL3A 3UN1A 5ICSA 2HJRA 4ZQHA 3CMMA 2DKNA 4OYRA 4TKMA 1J5PA 1HDYA 4IGEA 3GNSA 2LDBA 2NTJA 2V6MA 4KZPA 5IXSA 4E2ZA 3BTSA 3VPXA 4N54A 2VHZA 3F1KA 4NQZA 4NU6A 4BNGA 1B8UA 1DBVO 3WDSA 4B7XA 1B26A 1I8TA 3PQEA 5I7FA 4P8RA 3EK2A 3VHRA 4C4OA 4GH5A 2C20A 3ROPA 3O03A 4RVHA 1XHLA 1E6EA 4HFNA 1HXHA 3I23A 2HK8A 4P4NA 3IAHA 4JBIA 1HE4A 3GEGA 1ULSA 5ICMA 2XXBA 4E33A 1DHTA 3JQCA 3F4LA 3GF4A 1K3TA 1GY8A 3JQGB 1D1SA 4CM4B 2G0TA 1RWBA 2E4AA 3SVTA 3SC6A 1HT0A 2J6IA 1O9BA 1EUCA 3QRWA 1LRKA 2QIOA 4UVGA 2BFAA 3TZCA 4XGNA 2VYVD 1ISGA 4WLUA 1DC6A 2Z1MA 1NPTO 4FFRA 5IG2A 5H81A 4IDBA 1HDGO 1WDKA 2GZ3A 1NR1A 3DZBA 3L07A 4XDZA 3VKUA 5DULA 1TT7A 1DJNA 1R4MB 2GASA 5IAAA 4Z0HO 1I3MA 4B3JA 5T64A 1EQUA 4GX0A 3PHJA 4LK3A 4I1IA 5DCWA 3T7EA 4QX6A 2GSDA 1VE9A 1DHRA 3BXXA 1H9BA 3FRJA 3QA9A 1G0NA 3L77A 2ZYGA 2PZJA 1R66A 3LT4A 4R41A 2IEBA 4YA6A 5EPOA 2QRKA 1X0VA 3LVFO 3QSGA 5FEUA 5CEJA 3INGA 4PN3A 3OICA 1VRWA 1NWHA 2HLPA 1LLCA 4D3SA 1DB3A 1E3SA 1IE3A 3NDRA 4ND1A 3F5SA 4RGBA 3E1KA 4IPTA 2AEMA 4AJ4A 2YFHA 4QFDA 2GPTA 3ZWCA 1XA0A 1ZH8A 4G65A 5JSFA 1JN0A 1MA0A 1WWKA 4GSKA 4CQLB 1Z45A 3H7AA 4E3ZA 1ORRA 5G0UA 1NWCA 1U8XX 4FR5A 2NADA 4WNCA 8LDHA 1ZSNA 4UUNA 2C2YA 2CDCA 3AFMA 4CM9D 2I5PO 3HN7A 1BVRA 4YQZA 2GD1O 1U9JA 4NPCA 4PLHA 4FOOA 2GN9A 3D64A 4MVJM 1QRRA 1MG0A 4A2CA 3OM9A 1LC3A 4NBTA 4QTZA 2DBVO 3I9KA 4DXHA 1BVUA 4ONEA 3IQDB 3GVPA 1VSVA 5KTKA 1OBFO 4CUKA 1NYTA 3IJPA 1ZEJA 4E5NA 4EW6A 5A1TA 4XD2A 3DR3A 3EGOA 1BXGA 4RVSA 2EP5A 4WOJA 3L9WA 4WOKA 2WM3A 5KJEA 1BXZA 1UZLA 3H8VA 1LTHR 3JQFA 5IFLA 4DPLA 3O38A 3ZV3A 1PQPA 2FPPA 3H9JA 3GVIA 5TIIA 3WGOA 4WCFC 4B4OA 1PJ2A 1F0YA 3RKUA 1KVTA 3DBHA 4FFNA 3KZVA 3JYPA 3GG2A 3EZYA 1PJ4A 4ALMA 4QSMA 4DGSA 3HSKA 1UAYA
chains in the Genus database with same CATH superfamily
4FMDF 3F5MA 3ZGXA 2WF7A 1CR6A 1TYAE 1C0IA 2Y68A 2IEYA 3C70A 3JQ9A 3JPYA 4NPHA 1KERA 4Z0TA 1GQYA 1NE2A 3AUJB 4IZIA 4NMHA 3G1UA 3Q12A 1H2YA 3G2PA 1ZPDA 2QUBA 2HA3A 3N6VA 1V96A 2A57A 1B6TA 1NJFA 1VI5A 1OPXA 1A8QA 1ZD3A 4PAOA 3D5EA 4AP6A 1Z5PA 1OWLA 4TRNA 3EH1A 5EKSA 2WVHA 4MGIR 3DR5A 2EFEB 3GNLA 4A23A 3U61B 4DLSA 5ERYA 3UWKA 2P3LA 2FDXA 1RZ3A 4X3PA 4AF6A 1XDSA 1M66A 1DIHA 1Z15A 1ZRSA 2R8YA 4MR7A 1IPEA 2WIDA 3C6QA 4UUQA 3LC7O 2NVUB 3NRBA 5JS1A 2NU8A 4MQEB 4HDMA 2JGFA 3TTXA 3UG6A 3I76A 4NFLA 4OXQA 1OX5A 3A4VA 1T2VA 1AU9A 1XMQB 2C96A 1VECA 2AFIB 2BGNA 2CVOA 2NXNA 2QX8A 2GN8A 5HZGA 5FI3A 3OP4A 4C0KA 3WSWA 1OH8A 3WKEA 1L4GA 5JCJA 5C52B 1JIXA 1B2RA 4J43A 4RMIA 2C07A 2GEVA 3GJSA 4M98A 1YE5A 3L01A 3WGVA 3ZLTA 2WR8A 3VU0A 1M8JA 2F1OA 2C9ZA 2XGGA 1PNVA 3OX4A 2CF6A 4O59O 1AD2A 2HO5A 2PMFA 4O25A 5KCMA 4WFQA 3RWBA 2PDAA 2VBFA 5CVVA 1RYZA 2J07A 2FXVA 3Q72A 4CQNA 4HGZA 4QGAA 4PC6A 4WI1A 4YFYA 3E9ZA 4M8KA 4ZMBA 1L5SA 1QIGA 4RC9A 2BELA 1C3OB 4KMRA 4PG6A 2BZ1A 1Z17A 2P3OA 4TLAA 2YX1A 1F8GA 2IPXA 1EGAA 3SHOA 4FYHA 1AZLA 2A5FA 1U0RA 3M89A 4KGDA 5FXMA 4DWJA 2ZB8A 5DNDA 1HDCA 3SDSA 1HE1C 1YQQA 4RLQA 2W6MA 1E6WA 3O84A 4TTQA 1P4JA 2NM0A 3BSSA 4QHTA 2GJ8A 5CNMA 2P4UA 3DEFA 4YXFA 4KLRA 1RTKA 3ZV7A 4KR2A 2IW3A 3O4GA 4B32A 3SC2A 3QFHA 2VZ8A 1P2DA 4H60A 2ZSUA 4R0NA 4B4VA 4G8BA 2WP8J 4OGLA 1G8YA 3PJFA 2CGEA 4Q01A 1P62B 4U4AA 4UFNA 3GLIE 3DDNA 3LX5A 3NVDA 4G4SO 5H02A 1U04A 1XZGA 1ZO8A 3QG1A 4NVRA 2XZTA 5TPWA 1YKFA 4PPFA 4A9AA 2Y3IA 3TTUA 1J06A 2D4HA 2WJAA 3K1TA 3KV3O 4BYGA 5AUOB 3AV0B 1BDJA 3AUSA 2LIPA 1E2QA 4FOLA 4WBSA 2R8XA 4ZPXA 1KMNA 2ECQA 2VDUE 3VVLA 2FMUA 4HRXA 2Q28A 2I66A 3U7EB 3AX6A 1XZAA 1VIDA 4P3XA 3EIEA 4EOGA 4ZYXA 1NFQA 2I29A 2QL5A 4DCGA 1T9GS 5SZIA 1FNCA 4LY6A 3FNBA 3F2VA 5DXFA 1WBJB 3WXBA 1NOKA 2QXUA 2XYQA 2X5XA 3GJYA 2VCHA 3NZEA 4IUDS 4EUHA 5K3FA 1X14A 1UBFA 3RIMA 4BQEA 1DQZA 4PHHA 3LUFA 2ICAA 5I3ZA 2HLNA 3ETLA 4DY6A 4QGHA 3T1OA 4KN9S 1C7ZA 5B55A 2IY8A 2AI2A 4KV9A 2AFIE 2PO5A 1DKQA 4KQEA 5CX1A 4ENSA 2HSGA 4TQGA 4ABYA 1U2SA 1KZYC 3GLIA 4Q3AA 4YALA 5LMZA 3GDWA 4BL5A 3B38A 4BDSA 3SM3A 2FR8C 2CLFB 3FNIA 5AP9A 4ZCMA 2ZTMA 1Z26A 1XZQA 1SCNE 2CHQA 5KSWB 1XRSB 5KVCA 4KBFA 4BNXA 3E4DA 1Q2XA 2HWKA 3N2ZB 2ZRCA 3DO5A 3FETA 1P5RA 3VR4H 4LK2A 1MABA 2WU8A 2JA2A 2Q0QA 2LCQA 4C0WA 5BMVA 5B2EA 1ML3A 1RWKA 5JZVA 3DKRA 2G07A 3UA3A 5ILQA 1JIUA 1RAFA 2GFQA 4Z8YA 3T41A 3CG4A 3QBTA 2X14A 1KWKA 2BR3A 1G8PA 3BCHA 3M3DA 1ESEA 1QH1B 2YWRA 4OOFA 1L0BA 5K8LA 5KYXA 4F06A 5EFZA 4EWLA 2GJSA 3FZYA 1P7CA 2AVDA 3A0UA 3ZHQA 5IKEA 4BO0A 1KHTA 5JR3A 3QX8A 1GWNA 1TF2A 1KZGB 1WG8A 3C85A 1R74A 1ZKDA 3LQRA 1LEHA 2J5RA 2W2OA 3P4XA 4JLPA 2HKIA 4Z2YA 1AKRA 5LQRA 3FJ1A 5KTOA 3HK2A 1IWOA 2W8ZA 3IAM1 1RQXA 5F7OA 1AKQA 1T2AA 4BX8A 1Q7TA 4IRMA 4RCVA 1TF7A 1U2GC 1FE8A 2LKDA 3AIOA 2GBGA 3F0TA 2AHRA 5GM2A 4H4DA 4TS4A 1EESA 2DQYA 4BKQA 4FEEA 3DHNA 1X8KA 1Q0SA 1LD3A 1YT5A 4I5FA 1BU5A 1TW3A 2A3NA 3DAFA 1CUSA 4JV5B 4DMMA 4L8FA 5E38A 3CRVA 1WSAA 1TL7C 1TUBB 2C2BA 3GN2A 4GLOA 1N1GA 2Z1DA 4RKWA 2ODQA 3DFFA 1DEHA 3GR6A 1KBOA 2C59A 4QO7A 5J43A 3F5DA 3QX7A 3NDIA 4I5GA 5LYYA 5AVZA 2O8EB 4G4JA 4KDRA 5E1BA 1SQSA 2UU9B 1XEWY 2FTKE 3FPLA 4I36A 3FFWA 3QY9A 4MI9A 1RI1A 3L43A 3LKZA 5JPIA 3OECA 5LWHA 3JQQA 1UEXC 2TSYB 2RI1A 2AOXA 3M5WA 4DXAA 1PIWA 2ZSJA 3RI3A 4RGVA 5C4GB 1DI0A 3KOYA 2I65A 4FT2A 4QT4A 2C5BA 4WTOA 2B1IA 1NX6A 1UBNA 2OORC 3GCWA 4OM7A 5LJIA 4LV6A 3CR7A 4CFZA 1D9ZA 3D8RA 1Y1SA 1XC7A 3HCNA 2FJPA 3WLIA 4DMCA 1B3BA 3E0QA 4BX0A 1KJZA 3DEAA 3KB6A 3KBOA 2Q1XA 3PI6A 1I4OA 2UUBB 1QVAA 1M6EX 5A7HA 4MGYR 5CA0F 2P6RA 1ZUD1 2TMYA 2JIMA 1UFVA 2H1WA 2KYRA 2XCQA 2DUNA 3PVSA 4DRYA 1GPYA 2IGBA 2X1HA 2O3SA 3L41A 3NT4A 2EWMA 2IIVA 4JJAA 5A4MS 4IOLA 2VXCA 4ROSA 3RREA 4RKRA 3DBIA 5D86A 1AUVA 1HYGA 2PZBA 3AF4A 3QBVA 1KY5A 4N9WA 3LLMA 2DM6A 3NBXX 3PB3A 4HGNA 4NMMA 2I3DA 4NJMB 4XKJA 5CHYA 1DQRA 1G291 4PONA 1KAOA 5EHNA 4QXRA 2Y92A 5CX4A 4KOEC 2RHHA 3QG5A 4B48A 5SICE 1HDIA 1EMDA 3V32A 3K31A 3TGPA 4YRGA 4HWTA 4XOUA 3OE7D 1YKSA 3DFZA 1T1IA 3PQCA 3UAGA 3BGIA 4I6GA 4OBBA 1PR5A 3EWAA 4Q4CA 4PYQA 4FFMA 4D0GA 3U9LA 5CT4A 4FWBA 4FQ8A 3S1AA 3VH2A 3UB4A 1UBRS 1H4QA 4E88A 3CN7A 4TXNA 4B6OA 2NMVA 3A6JA 3SKVA 1M83A 2FWIA 4RHUA 4TL6A 2VLIA 3SSMA 3W2FA 2VUUA 3ISVA 5B2FA 5FWXB 3V8BA 3QNMA 3MC1A 4TS3A 4B9EA 4CBVA 1MH1A 2H8GA 2QYOA 3IV7A 4NXNB 1YJQA 3LBIA 3NPMA 2AMJA 1OXMA 3E48A 5JD3A 3NIWA 5KNDD 2XT9A 2OA0A 1ZVJA 2HSDA 3NAZA 4A0HA 5K6AC 4IJMA 3WA7A 3BMNA 3BXGA 2VUIB 5JTUA 2QGNA 5B53A 4QQRA 1I33A 3P9IA 5HTKA 1YJXA 4V0NA 1P8JA 1U1GA 3AR7A 4XR4A 3IBSA 3C8UA 2A9FA 2QLBA 4CMIB 4W1SA 1NBME 2RHOA 3BJEA 2PNJA 4DGQA 3ENKA 4Y6PA 3BD6A 1YZ3A 1Z0DA 1KEKA 1NURA 3OOJA 3URMA 4E09A 3K6SB 4FOPA 1EGQA 1W85A 4WZAB 1U9IC 3BEOA 2ZRJA 1JA9A 2FUG1 4K7JA 4NBRA 3VMFA 2J3MA 2PU5A 4HB3A 4ALLA 1Z0IA 2GHTA 4EB3A 1EWYA 2NVBA 2GM4A 4N48A 1OGIA 1IY2A 1Z6PA 3TIXB 3NOOA 2OLEA 3NONA 3ZU3A 3IAS1 1YVPA 5CG2A 5JJKA 5ELXA 1QIFA 5LQDA 1ZCFA 5JBNA 1E8MA 3QH4A 2XMZA 3IE1A 2ODWA 3B53X 1YZVA 1SO8A 2JFHA 2QL7A 3PFWO 2CV2A 3ILXA 1PJLA 3K8OE 2EAUA 1FXWF 3TK1A 1M1YE 5C8YA 3H11A 2CXQA 1FSGA 1ZZEA 2C1XA 3MFYA 3Q10A 4H1VA 1YS4A 4B0PA 1S1MA 2EJBA 4C03A 1ZSYA 3S1LA 4DHWA 4Y9UA 3C74A 3WTCA 1S9HA 3UFXA 3FKSA 2XIJA 4PGFA 3A6DA 1XHEA 3GDGA 3KUCA 3LKVA 4P4UA 4Q93A 2WIBA 3V2IA 3W5DA 5BT9A 5GINE 3ZU4A 3FAZA 2PWYA 3MSCA 4PPYA 2G40A 3LPNA 5E3IA 4EO4A 1MRNA 1VM6A 3ABRB 3IIIA 3BTOA 3LHDA 4IUCS 4UEJA 3AXTA 4YC7A 5P21A 3VR6A 1COWD 2QWXA 3FVQA 4N7RA 3HLKA 3LHFA 1JJFA 4KLAA 1DOAA 1VKOA 5AK5A 1PR2A 2JJYA 3HBAA 4GOKA 1FNMA 3CRZA 5I7RA 3SYMA 1A7JA 4BVHA 4A10A 3I1YA 4PBTA 4RULA 3QV2A 4KNYA 2GHQA 2OC9A 1K6EA 3A9WA 3FBGA 1IN5A 2FFAA 3CR3C 1YRLA 3UAZA 5JAZA 2OHXA 3SZUA 3VR5D 2EV9A 3DOFA 2ID9A 3EBPA 3R5XA 4HGOA 5TT0A 1J8FA 4YR9A 4RTNA 2JCSA 2NSLA 3CEAA 2O06A 1MNAA 2EKPA 1J7JA 4YYZA 4HH4A 4NCIA 4QUHA 3UW1A 2A88A 2H5IA 2QXYA 1JHRA 4KWEA 2O2XA 3M6UA 1GUAA 4K88A 4AUMA 5JXIA 3Q6IA 5GJWC 2ADMA 1SUFA 2GTPA 2PD3A 3IPXA 1CG6A 2G5TA 3Q3JB 4OJNA 3Q5GA 4UUPA 5FPSA 4GOJA 5J63A 3GN1A 5SZJA 3DNMA 2B82A 2YRXA 2ZULA 2QQEA 1E2EA 4F4UA 2YY5A 5DEOA 2VAWA 3KFVA 4P54A 5JARA 1D4ZA 2C94A 3H6HA 2H63A 1Z4OA 2W71A 1JIJA 2RKBA 3KYJB 1FMFA 2DWPA 1GNTA 1LJUA 5IDYA 3HU2A 3KOXA 4PIPA 1N3BA 5ALJA 1EK5A 2QD4A 2YVAA 5TQJA 1V16A 3RFXA 4DJEC 2A33A 2VRNA 2HC9A 4Z3OA 2YVLA 1YHNA 2DP4E 3EG5A 3Q8KA 1T15A 2FEPA 4BFSA 1II9A 2OFXA 2WW8A 1CJUC 1G3MA 3PNMA 4HEA1 2JLBA 4Y67A 2IYVA 4C0SA 3PLNA 1W36D 4P82A 1OLSB 4JUIA 4RK6A 1OT3A 5CFPA 2OY0A 5HOEA 1XU7A 1QK3A 1U3TA 2OKGA 2I3GA 2CW5A 1POXA 2PH1A 3A1FA 3D7NA 1XJQA 1E9FA 3DLCA 2DVMA 4X85A 3ZQ4A 3Q15C 2G70A 3PSAA 4FGJA 1GTVA 4XPZA 5C0OE 3K9BA 2OCDA 3G2JA 3MEQA 1X2EA 4PBRA 2VRCD 1KAHA 1EQ2A 1FFEA 2W98A 1G6Q1 3C8MA 5BMVB 4XWKA 5JISA 4MIYA 5I4CA 1SCQA 1N5OX 1SU8A 3AFGA 2DOKA 4YRJA 2XDYA 2FP4B 3GCXA 2VXOA 3K70D 4FD3A 2JLSA 4N0MA 2H6EA 1DKMA 2ZSDA 2JFYA 2QN6A 3PDCA 3ZZ0A 1GFZA 2V9ZA 3QIAA 1TQ6A 2CE2X 3DO6A 4F3KA 1BDIA 1W1IA 2GM9A 5L7TA 3RTAA 1ZJWA 3WYBA 1JJIA 5ENVA 1GQRA 2RG7A 3M4ZA 2GT1A 1TAUA 3UMGA 1VRCA 4OXXA 1PL7A 2G9NA 1KS9A 5DYIA 1L7AA 3FI0A 3BKWA 4ZCLA 4GKVA 3ZK9A 2VUHB 3OLCX 5G3YA 4I46A 3WY9A 4LTNA 4F4IA 1G6KA 3IOCA 1CUWA 2EIHA 1NSFA 2B5WA 4MITA 4PX3A 3WQRA 3T5TA 3EZGA 4E32A 4BB9A 4ZHSA 4ZMRA 5KS2A 3M6VA 3UJAA 3H0CA 5AIBA 1ZRMA 4AX4A 2XTJA 4FGZA 3GCZA 3LK6A 1KQGA 3QTTA 4U9HS 1G60A 5HUHA 3F2IA 5E9QA 4FCCA 4MS4B 2C7OA 1B76A 3I6QA 4D82A 2YJ6A 2Z4TA 2OE2A 2CKMA 5I9MA 2ILTA 2RAFA 3H5TA 5A05A 5T57A 1YD7A 2CEKA 3PC7A 2FSIA 3AIMA 4G5QA 4RH3A 3W8RA 5CPBA 1R0ZA 2QQGA 3T5GA 4YT2A 3GEMA 4NJMA 3DLIA 3NTRA 1PWEA 2JBWA 4MIKA 3V7FA 3STWA 1WKBA 1P4RA 3RYFA 3Q7EA 5MN6A 5FPTA 2FP4A 5CLJA 4CKEB 2O8BA 3S28A 2FNAA 3GFTA 2N46A 4XI9A 5JFGA 1GGHA 1D3AA 4DDKA 2EC5A 4ARIA 4C5CA 3ONDA 1TKBA 2CHFA 2H59A 3H04A 2GA9A 4LDJA 4QUEA 3GRUA 4FEAA 1I7PA 3Q3GE 4Q4JB 3NHSA 3K0KA 5CPFA 1LK5A 4MDFA 4PN7A 4G2NA 2QPOA 1R0WA 4KYTA 1JEJA 3DE4X 1XZLA 5FUBA 3FOFC 1DG1G 3W2EA 5JE8A 3ZLVA 4QREA 1HORA 4WN9A 3A6GA 4OHOA 1MA3A 4YCNA 3EY9A 1QNLA 1RDFA 3R7LA 4HNGA 3HBMA 4AN1A 2QPLA 1NRIA 1FVHA 1ZI9A 2OHGA 4TROA 5E3HA 4EECA 3A11A 4RXTA 1MQ9A 1UANA 1YR8A 1WX1A 1G2IA 3O91A 4CKZA 1E0AA 5JATA 2F1JA 4RD0A 3PGKA 1SJ9A 4IL5A 3MQ4A 2QTHA 1G63A 1TIPA 2A1UA 2Q2WA 1ISJA 3HSYA 5IC5A 3TIFA 4D9MA 1IUKA 1JQBA 1E3TA 1NQVA 3UPDA 1QIMA 1ZGCA 5EJGA 2PGNA 1Z5OA 2B5VA 1E4EB 3BMOB 3GHYA 3NEYA 4Z3KA 4EJFA 5A6SA 2P2NA 3AUUA 4HR7A 3HO1A 3NCTA 3R7DA 3QNUA 1VRVA 1W30A 3LBYA 3ZLUA 4R8RA 1X7WB 2JD1A 4C0BA 5LDDC 2YFQA 4HUJA 4Z86A 4XQEA 2JFOA 3RC1A 1TCBA 4UEOA 3VHXB 4E1VA 1IOZA 3KT0A 1SOUA 2GK3A 5ALGA 5JW6A 3CX4A 5BW5A 5F2KA 1X7YB 1HG0A 1Q1ZA 2VHEA 2IH4A 4GUAA 5FP0A 3SXJA 2JAPA 1CK4A 5FR2A 4UE3S 4IJ5A 3SSNA 2P2LA 2HBZA 4H1HA 4M8IA 1C9MA 4AS2A 4JX9A 3FE2A 5AW0A 3T3PB 4FZJA 4ZJYA 3F9CA 5HJ5A 5GAJA 1GNVA 4GU5A 1ZMTA 2NQ8A 4BV8A 4D5EA 5TMPA 4V0LA 3A04A 5JCZA 3W06A 1BVHA 3GJXC 2X2FA 3QU2A 4ILKA 2QTFA 1T13A 2Q2OA 1A1VA 3FYHA 4RL6A 4QFMA 1K63A 1MXHA 4PCVA 4BNMA 2ONYA 3GVXA 3DULA 1AGXA 2OB2A 1DFHA 1NBMD 1YOVA 4KU4A 2HZ7A 1K75A 1MPTA 1R9NA 2ETVA 2QG9A 3T7KA 2HA6A 5JS6A 3DDZX 2VJOA 3GOHA 5I9IA 1R18A 4RV4A 4S2EA 3IQHX 2ZUFA 4MCIA 2AKAB 2ZUDA 1HX7A 1QRSA 4WZBB 1KY3A 3R7FA 4GVLA 3IUJA 2LW7A 4PVDA 5F3DA 4A7PA 1SD1A 2C98A 5KX5A 1XQVA 2IHBA 2YYAA 4EH1A 2CBZA 3OTHA 4X20A 5KSPA 5CXSA 4HQNA 4IV0A 1H4SA 5A9RA 4L6IA 3AZPA 1UXGA 1ZUNA 4N01A 1MDFA 4JVMA 4BKRA 3F7TA 3B70A 4MVJF 4XB1A 2CLSA 3NYWA 5HE9A 5CX1B 3MJTA 4H7KA 2X9VA 3UK1A 3TNDA 1Q5PA 1PUIA 3S70A 2I54A 4MV6A 2GCGA 3ET5A 1LBEA 4DCPA 2ZUWA 5T67A 4LNAA 3ZPXA 2FR1A 5GJBA 5T7BA 1J70A 2JAHA 5EZ5A 2X40A 3L0YA 5FPPA 3CZ5A 1WSWA 1J42A 1HOTA 2QLTA 3FHOA 1KPHA 3T3DA 4BATA 3UBTA 1MORA 3K9WA 3EVAA 2HDWA 3IDOA 3KEOA 4BBJA 4EKIA 4X24A 1FYVA 3I4CA 4DEVA 2ZSAA 5JALA 5DOZA 4BQFA 1W0KA 3PUKA 3TW8B 1Y8ZA 1N5KA 1OV4A 1YVUA 4A4DA 5C8YF 3K2EA 4HFJA 4B3MB 3OFVA 4BZWA 4QU5A 4HV4A 1PX0A 3G6WA 2HMYB 2MCFA 4EW3A 4F3CA 5TNXA 4GPD1 4WNAA 1HK7A 2FPGA 3CMCO 1GZ5A 4TMXA 4UZFA 2V97A 4JBGA 3VYVA 4ER5A 3SLGA 1DUIA 4LJ6A 2PGDA 1HV8A 3DONA 4CKBB 1SBCA 3H9BA 4ETMA 2WUDA 1LDGA 1VJGA 1O6FA 1OOEA 4IOJA 3E9NA 4FHCA 3FI9A 4EY5A 2ZJ1A 1KIAA 1TYDE 5D3KA 1E60A 1WP9A 4F56A 4KYVA 2FW1A 2NU7A 4Y6RA 3VU9B 1LPSA 3AF1A 4DE5A 5JDIC 5M7EA 2RGNC 1ZM3A 2O7QA 3ZQ6A 4IYJA 3UOGA 2HRBA 4YR7A 4DUGD 5LDHA 2P2SA 4G0MA 4XQGA 2PKCA 1M74A 4U6NA 3GY0A 2F3PA 4H15A 3K6KA 2NUTA 4ZA2A 3HPQA 4DQKA 2VP4A 1RXIA 2A67A 3CLTC 2QKYA 1QP8A 3R6TA 4OH1A 1ZAYA 2G0NA 2Q5OA 1N4AA 2Z43A 3STXA 4L22A 3PDJA 5E6RB 2XT0A 4U5QA 4CYMA 2IYLD 1G21E 3DL2A 2P65A 4MR7B 4JB0A 4BJHB 1XNGA 1TVMA 1QGUB 4R40A 1IM5A 4ZOLF 2PZFA 3CA8A 2YMMA 1P6QA 4KQJA 1H69A 3E05A 5SYNA 2NU9B 2Q6IA 3B1JA 3R6LA 4JA0A 4DLLA 3NHAA 4FT4A 4BGEA 1WUJS 1QGAA 1NV9A 4O8ZA 2G17A 2OZKA 4Q7QA 1G8HA 1A95A 5DHAA 1O94A 5THKA 1FSZA 1GGVA 1QHXA 5AI0A 4LF9B 4M38A 5CUQA 2FGJA 2HJWA 1NMSA 3OZVA 5JD6A 3EXFB 4WKPA 3SZMA 1T2UA 3F5FA 2O19A 5IASA 5EE5B 1B16A 1YAJA 1SC9A 5C3UA 1RWQA 1M3SA 3QIVA 1V8BA 4MV0A 1C7RA 4BP8A 4CJXA 3K96A 4DR2B 4P7KA 4R2WA 1LFDB 1GT91 1ZIYA 3COZA 3IHKA 2V4UA 3N86A 4J8PA 2Z8ZA 5DX1A 1RBQA 5IW8A 3JCZA 2F3TA 5TY0A 1E8DA 2FW8A 1K8RA 3T4XA 3GWZA 5HBRA 1N6PA 4JOCA 3IJ5A 1OX4B 3W5IA 3EPRA 4TTAA 1NVGA 1DAPA 4NYIR 2PUWA 1O95A 2QG4A 4AI6A 5IKXA 3DGEC 3CB2A 5EPUA 1FYFA 2C4HA 1G19A 2ZBRA 3Q2OA 2WIFA 4OGGA 2H0RA 1QVZA 2VHJA 1VI6A 1SQFA 1YGYA 3HJTA 3ZGVA 3L5KA 4DT1A 4R9RA 4DR3B 4EENA 3C6XA 4GEKA 1IL0A 4WLEA 5AUQA 3KHKA 2VK8A 1TVCA 1IULA 3GV0A 1UPTA 3NC0C 4RY2A 5K8CA 4PS0A 3S2YA 2QN1A 3I04M 3G2IA 3ZJ5A 4L5BA 3I8OA 1O95D 2C77A 1CEXA 1JLKA 5EIAA 2I7CA 1O97D 4AO7A 4N8SA 2BE9A 1N5IA 3W5AA 4ZOCA 2A4KA 4JYBA 1P61B 2WIGA 3M6MD 1FW6A 5LOVF 1P5JA 4K05A 1PNRA 1A97A 4NOKA 2JF0A 3PR3A 4U9IS 5B12A 2B7BA 1JVBA 4FEYA 3WGGA 1OAKA 3ZK7A 1P7PA 1TO1E 2I78A 4QJ5A 1Z0UA 2NUPB 4HZUB 2WSYB 2YC4C 3OJ0A 3REOA 4BE7B 2W42A 2XQVA 3GYGA 4NNOA 1P3DA 2QRJA 1HEUA 3IX7A 4M0DA 3EVDA 3KOWA 4H7HA 5EG5A 4EEXA 2CD9A 2IY7A 3R7SA 2D3TA 821PA 2QM3A 4N6NA 1I13A 3DB2A 1GA1A 2B4AA 2OXRA 1WXGA 1KK3A 1X7ZB 3H87A 3MM4A 1S2DA 1GZSA 1DL5A 2XX3A 4NAUA 1U7HA 2W43A 1EVYA 4MPRA 1U0JA 2FPWA 3IB6A 3ZW7A 4ARCA 3FZEA 4A91A 3A70A 1GVHA 1ZJ5A 3ZWKA 5IKMA 3T9BA 1MX1A 2JD2A 1EPUA 3FPCA 4JENA 4XVUA 4QZVA 1HE8B 2GYYA 2HAEA 3HUDA 3ZE6A 2WD9A 3ZXUB 1F7VA 3H5RA 4KRGA 1FFHA 2RJNA 4WZAA 2NVOA 3IT2A 4DA8A 3H4MA 1QVWA 3J7AC 1O5OA 4QLAA 1FRZA 2C0QA 5IULC 4UREA 1BHJA 4H2DA 4B6JA 1KTIA 4BLVA 1W4CA 5KYWA 2X8WA 3PEFA 4KQ9A 3HDJA 4DF3A 2IK8A 1V4BA 1QANA 5EMKA 4GP6A 4LWPA 4OPMA 1FFXB 3GRAA 4PPNA 2Q3BA 4IMIB 1Y8RA 3KM0A 4RWEA 2VJNA 1XCJA 3FGOA 3OZXA 4QQFA 5JS7A 1YUMA 4DZRA 4U3JB 1OXXK 1N9ZA 1T91A 1J0BA 1XEFA 3O3CA 2QN3A 4A6DA 4GLLA 1XTIA 4HB4A 3TLXA 3I12A 3RNLA 2OUKA 2Y1DA 2OGUA 3P5SA 3F6SA 4GQAA 2VHVA 4UAVA 1MH9A 1NJSA 5H59A 4DJTA 4L1KA 1AO3A 5TPZD 1J25A 2H2FA 1I7LA 3PI7A 3PX7A 3JZFA 4GI1A 1J21A 4LDQA 3HJGA 4GBMA 4KO4S 3IUSA 4PYRA 3R1IA 4D44A 5AR1A 2XD9A 2O8NA 4LY3A 5D7NA 5FFFA 1Z0SA 3WWEA 4AF8A 5LCXA 1IATA 1QYIA 2FR0A 4ZU3A 3TPFA 3L7CA 1FFDA 1U1CA 1LDBA 5CCDA 1NJ2A 4LRQA 1EG7A 4GRAA 2RGRA 4LHEA 5EHXA 1GUYA 3WSVA 4B31A 2AC7A 1IMJA 3HV0A 3OHMA 2HOQA 4YQEA 1Z88A 4UM9B 4KC0A 5A4AA 4HYYA 1P7ZA 3JAKA 3N8IA 4X00A 1I2AA 2F4NA 2CLHB 3W2HA 2YHAA 4IIJA 3RAGA 4GYWA 1JG2A 2WJYA 1A8PA 1J9GA 1PJ8A 2VPIA 4PRZA 4PXYA 4BGVA 4Z1MD 1JHPA 3W2IA 1R9GA 1DBRA 4BOYA 3DDWA 5CYGA 2WJZB 2VDOB 4PGGA 3NR2A 1LA2A 3WIBA 2CXNA 2QRLA 3SQXA 1DBIA 3FMIA 4BNUA 1CR1A 3MCVA 3ZI0A 2JEOA 1D4OA 2P6UA 3BWCA 4YJ3B 3N6XA 1LU9A 3OFSA 3UT5B 4F4JA 2FH5B 4QUAA 4CKWA 2B9VA 3NT2A 2HHAA 4KV7A 1KQOA 1R6DA 4HBZA 4ENWA 2LUOA 3IQWA 1OYOA 1XTUA 2WQZA 3ZDBA 3R9WA 1PT5A 3MELA 3RRNA 1YA8A 5E7JA 1I4DD 2ID7A 1HMPA 3Q8LA 4JI1B 4Y3UA 2FEMA 2QD2A 3FTPA 3LYHA 1SHZA 2FSSA 2IZOA 3PDWA 4LA4A 4PLZA 1GLNA 1LB1B 1FQOA 1BFUA 4V0OA 3VDMA 2XEDA 4GKJB 1E5VA 1RABA 4P2GA 1DCFA 4AB1A 1F38A 3G0IA 1KIMA 4OFWA 3DC7A 2YJZA 3TZEA 4CKYA 3HMKA 1NAHA 1QHNA 4U00A 1GPLA 3CZ9A 4RD4A 2IC5A 1E3JA 1CZLA 4HRVA 1IJBA 1Z28A 2P4SA 3TOXA 3U48A 2XUJA 2CDRA 1RWXA 1VE1A 1Q3KA 1LBQA 3AR4A 3GLGE 4IEEA 2VYVA 4TLEA 2WWXA 2ZIXA 3WNCA 3KQWA 4JCCA 2E6KA 1NR7A 2ZSFA 3BRQA 4MMXB 4A1OA 3BS4A 5JYCA 1L2TA 3PQ7A 1NVMB 3INYA 1KZ7B 4PAMA 1OREA 1KFKB 4NKRA 2H2HA 3BAZA 4FGSA 3TLJA 1RZVA 1HE5A 1ZGAA 2Z6UA 1XK6A 3EF1A 4TUYF 4ZO8A 3AG5A 3AERA 1KKUA 4R1UA 5F1KA 5KJCA 3OFNA 3PX2A 4WOBA 1O03A 4IFBA 1Q44A 3THSA 2CNWA 1BA3A 4FYJA 4ZRNA 2XB2A 1SXHA 2WOOA 1EI9A 2A9RA 1JSLA 2Y0DA 3AR2A 3OZ7A 4Q48A 1PZFA 4TKUB 4X91A 4YGXB 1XXHE 1QRTA 3H1GA 4JS0A 2BEUB 2JLQA 1R0CA 1PYGA 2NYVA 2WWFA 4PC7A 4IR7A 3USZA 2OXTA 2HLHA 4DLZA 5FWDA 1ZVVA 4PE5B 3DWGA 2FWJA 2R5FA 4CL0A 1PFVA 1RLIA 3GDOA 3AJ9A 3RU2A 2QZZA 3AR3A 3TLGB 1I1OA 2GKSA 5JZBA 3DYVA 1Z73A 1FRQA 3AJ8A 2AFHE 2EZ8A 2BFNA 4YO7A 3EW7A 3U7RA 1TQ8A 4PYJA 2EARA 1SXGA 3K5WA 1L7MA 1BDMA 2EJVA 3HKDB 4GF5A 5AHKA 3DEZA 5CCEA 1N8KA 3ND8A 1BW9B 5DRYA 1V0JA 1O58A 1P0QA 3DXZA 2ODPA 1EHIA 5JSKA 2J8ZA 2HU5A 1UBHS 1Y3IA 3BGOS 3IYLW 5F5NA 3U26A 1PUJA 1AQ6A 1HT1E 3AM4A 4WCFA 1EDEA 5AK0A 4TN5A 4ZQFA 3FX2A 1N2CE 1TU3A 1B4DA 4UD2A 3X1KA 5LQKA 5K3FB 3VNBA 2JGDB 3DE1X 2YVKA 3JVUA 5L3QA 3HEBA 2RGGA 5HK8A 2NU9A 1C0EA 2QTAA 2WYHA 3GH3A 1C80A 4ZWNA 4YCLA 2C8VA 1IUPA 2H4FA 1PAUA 1TVKB 3BFXA 1ZG3A 3UO8B 2HUNA 3PWZA 1LSUA 2PGIA 1E1RA 4R2LA 4RJJA 4ZAGA 4HAZA 3UZUA 1KSHA 3GP8A 1ZW6A 4LXHA 4US1R 2XTMA 3ED1A 3GAZA 2OVFA 1JDSA 2JJ2A 3HCAA 5JBQA 5JMWA 4B3CA 4WJZA 2W5UA 3DF7A 1UFRA 1WM1A 3DPUA 1G20A 4FJ2A 4NY1A 5TPWB 2K7ZA 3NTQA 4BFYA 2BGMA 3BE6A 2W6OA 5BNIA 3FWYA 4I4NA 1JPUA 2PS1A 3VR0A 1M1YA 2DFVA 1N3IA 3ET4A 3ZU6A 3GPBA 4ETWA 3S81A 4JLOA 3CUSA 1UEIA 3GJ3A 2CL0X 1L6RA 3I45A 4PSKA 2NXJA 1PHPA 3I04A 3PWSA 4XQCA 2FKNA 3G5MA 1N0VC 4BP3A 5FT9A 4HDQB 4TMFA 1XNRB 4FYMA 16PKA 2KS6A 2N75A 4URZR 4M8LA 4R2HA 1KO1A 3EG9A 2OL4A 3F47A 5J2UF 4FS3A 3A2NA 4ZVUA 3RAFC 2X4DA 2WTAA 2WHQA 2H9IA 1C9JA 3WBJA 4UHCA 3FZQA 1QP4A 1OLXB 3AVWA 5CNJA 1PT9A 2Q5CA 2R8BA 2V7QD 5DHSA 2XZPA 5A9SA 2QNBA 5LZ8A 1KE1A 2BGTA 2NWQA 2UYGA 1WKVA 2B2CA 2FLWA 2DH5A 1ADCA 1YZLA 2XW6A 2ZE6A 3GGSA 1O97C 2PXXA 1Q17A 1E2FA 4U7FA 2J0QA 2P62A 2BWJA 3MRTA 3H84A 3PENA 3QWHA 4MB6A 2D0OB 4HJXA 1U7DA 2V45A 5GGXA 1FFCA 5GIPE 4YRLA 3CUUA 4MKGA 3WKDA 2CDNA 2CNWD 1DINA 3GK3A 1PJRA 1KZ1A 1FRNA 1L3CA 2H2GA 3AFNA 3RG8A 3SR0A 1WDTA 1EFLA 1XYYA 1GPKA 1KY4A 2YYYA 3EE6A 4JXJA 4L0DA 2X41A 1DO0A 2D8MA 2QR5A 4V3CA 3KJZA 1YONA 4JODA 3UJ7A 3IMGA 4URHA 1WHSB 3OF2A 4GSLA 5EESA 5ICCA 1OC2A 3JALB 4X7RA 3OPXA 1AQIA 1QIJA 4HAOA 5EY5B 1KMQA 1UQUA 2X7XA 3G0CA 3KOMA 3VDNB 1UQRA 1N6RA 1OAOC 1J99A 4OI4A 3UAYA 4HWGA 2BMJA 3X43A 2V1UA 4H6PA 3BAFA 4MWCA 4KSBA 5FJJA 4OSOA 1HT3A 2RK3A 3C48A 4CIWA 4DG8A 1NTRA 2G9QA 1WIWA 2QLLA 3NALA 4CLRA 1GTMA 4R8SA 5G02A 3V8MA 3BDVA 4MQFA 3W3AD 4F11A 1WPXA 3ZZ1A 1E1NA 3A1TA 1I4LD 3JQ7B 2O3RA 4Q1EA 1AJEA 1Q92A 3AM3A 1BEZA 2J6CA 4X20B 2VH1A 1WB6A 1FSFA 1YZNA 2HSZA 1PSWA 5BSTA 3M6IA 1TFRA 4URVR 3IUPA 3HCDA 2KLHA 2VYNA 4X90A 4DG5A 2WJGA 2AUNA 3WC4A 2J3QA 1OXVA 1X8JA 3OPVA 1JIVA 2NPIA 5B30A 3LXMA 4UJ3A 2UDPA 1ZMOA 4DQLA 1WDLA 3G82C 2D1QA 3AL2A 4RGQA 5ANRB 2ORIA 2IYPA 5E6UA 1OIVA 2CSUA 1H2WA 2X3FA 3BYZA 1BHQ1 2X0DA 5HZHA 2ZBGA 3E9DA 4M22A 1U1FA 1Z4PX 4RYLA 1C9EA 4OHYA 4P5PA 1VKNA 3DPSA 1UJ4A 1EFCA 3OUZA 1VLJA 3MRSA 3PQ5A 1S02A 4NBKA 1IM2A 4MKXA 3BJZA 3QVWA 4UU0A 4OI1A 2GXQA 3A3YA 4E31A 4Y8VA 1OFGA 3TQSA 2Z08A 1KOFA 3B82A 3PNKA 5J59A 1E2MA 4WPGA 2JZNA 3ILHA 2JI7A 4K26A 1WXFA 4J4HA 4QC2A 4B80A 5ED4A 5C1IA 1II8A 2QIPA 1TZMA 3RASA 4CKBA 1DO2A 1CPYA 2XLBA 5AQEA 2GWRA 2P1RA 4PLPA 1T8WA 1GNRA 5JNLA 5CT5A 1G9SA 4YCMA 4I55B 3R9IA 3TCKA 1W25A 3GUCA 3ORYA 5F7ZA 1L5HA 4C0XA 3ER9A 1FF9A 2ZPUA 3F4BA 2YJNA 2AK2A 2EBUA 3HKBB 4XLZA 2EKQA 5BWCA 2BKLA 1RVDA 3FH0A 3UA4A 1DBWA 5U1PA 4LF4B 3VPSA 1UOPA 4IIJF 4S1VA 3L3BA 2IHZA 2PO7A 5J9FA 2H2IA 2WAMA 2HRZA 4E11A 3VZCA 3UC5A 5DF1A 1XMOB 1TM4E 1LK7A 3D7LA 4YRCA 3EIWA 4N0EA 2GEKA 2IP2A 1L4BA 3FGNA 1TEHA 3KHUA 1GT6A 2QPTA 4NH4A 3D8HA 1TD9A 3LC1O 3W79A 4GC5A 3N0TA 1HQDA 1Z38A 1XZEA 3F6CA 3OSUA 3IESA 4CMBA 1QVVA 4EJSC 1N1DA 1R9MA 3P2EA 1RXYA 4IQFA 4S1OA 3NBQA 3RSQA 3VU9A 4OUDA 3DVRX 1M5RA 1NW4A 2OV2A 4I6JA 5KQPA 2IZ1A 4MVJP 1VFNA 1JQKA 2OOKA 1JH8A 1UXIA 1A8HA 3ITDA 1JG6A 1T4BA 2FPXA 2YOFA 3RUHA 2J7PA 2INGX 4DJDC 4MXDA 2Q3CA 2IBMA 2VHQA 3IBFA 3OLZA 1F3OA 4NE2A 4U6SA 4FSDA 2ZIXB 4EITA 3ESXA 3GLRA 2YYSA 5T6MA 4XVRA 2H1IA 4ZVKA 1KAEA 3BFPA 3DWEX 2YZKA 4M46A 1J4AA 1M1NA 2I22A 3HZZA 4RPHA 4ZCSA 3O4RA 5AW7A 3MWEB 2Q3LA 2CVQA 3IPLA 3O9MA 2JLYA 4CR8A 1VHDA 3PX3A 2AXNA 3SKYA 4XQ0A 4ARAA 2QYSA 4EFKA 3Q9UA 2KLBA 4RVUA 4YBRA 1I0ZA 2PH7A 3DTTA 2WZCA 3DLHA 2G5PA 2Q4EA 2X3UA 4LXTA 1U0GA 1KMMA 1Z36A 4RMHA 3USES 1KI6A 3ILVA 2CNLA 5HKLA 1RPAA 5HFJA 3RNOA 3EXEA 1K5PA 5FQOA 5HKAA 1JKMA 1RADA 5KAMA 4ZHQA 2P67A 5CLFA 1PV4A 3WOHA 3U60B 1GU7A 4O1MA 3BE4A 1LV7A 1DELA 5ENZA 5DHUA 2KMLA 5I7HA 2A0UA 2O52A 2RAPA 3H8SA 3G8YA 3JYQA 3EBLA 4D9CA 3GOQA 2G1AA 3OEHA 3M6FA 3TVYA 3AB3A 5EE3A 4PGAA 4GL2A 5IKOA 2PA0A 4AKTA 2HH9A 2AOUA 5DYNA 5T5QA 3VZSA 1PVVA 2P9YA 3Q0IA 3U4AA 2QN8A 4NPAA 3U9SA 1RWPA 3WJ2A 3WK7A 4CHGA 4NZZA 3A4TA 4YWJA 1R6AA 2BN4A 4X1IB 1SG9A 2YICA 1CC1S 2IITA 1IAQA 4ENPA 1CY0A 3K0SA 3R74A 2V0GA 2X0RA 1BCSB 1AGPA 1LI7A 2V74B 3EXHB 3IR5A 3VSBA 3KQLA 4J7CA 4E4RA 4HQKA 4UHDA 1E79A 3VI3B 2WTBA 2VT6A 1H0HA 4U0KA 2JATA 1UR5A 4NG4A 1B6SA 1ZW1A 1R5OA 3QOWA 4RD1A 1PLKA 3JQGA 5T41A 2BEKA 5G0TA 3SFZA 1BAPA 3DE6X 3UPUA 1Z12A 3O1JC 1M8GA 3P2MA 5NULA 1RM0A 4NLLA 1DRJA