3E9FA

Crystal structure short-form (residue1-113) of eaf3 chromo domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
99
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNKEIKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin modification-related protein EAF3
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 99
sequence length 109
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9fA00
2G3RA 5FRNA 3OYAA 1WJRA 2YRVA 3FEOA 4N4HA 2FHDA 3EAEA 2WACA 2EQJA 2X4WA 4C5GA 3L2UA 4BE1A 4Z02A 3MEAA 2RI2A 3QJ6A 4HCZA 2E5QA 2M1HA 3OQ5A 2RJDA 3PMTA 4A4GA 3L2RA 3ASKA 3DB4A 4OVAA 4C5EA 3C4SA 5CIUA 2L89A 3OYBA 3OYDA 1XNIA 3OYJA 2JZ2A 5C6SA 2X4XA 2JTFA 2EKOA 3OMGA 5IN1A 4BDYA 4C5IA 5D6YA 3OYIA 2LRQA 3LX7A 3QKJA 2K3YA 4PLLA 2VYTA 2X35A 4LD6A 3NTIA 2EQKA 4UC4A 2QQSA 4B9WA 5KCHA 5KE3A 4IKFA 2D9TA 3L2WA 1WJQA 3DLMA 3P8DA 2DIQA 3E9FA 3L42A 2LCCA 5C0MA 3OS0A 4EDUA 2EQMA 5M9OA 3E9GA 4II1A 2GFUA 4X34A 2IG0A 3OYNA 3FDRA 3L2VA 3OY9A 3SD4A 1SSFA 2GFAA 2HQXA 3P8HA 2BUDA 5D6WA 4QQDA 3OB9A 3MP6A 5KCOA 4QQGA 5KH6A 4BE2A 2RJCA 3FLGA 2RHYA 2O4XA 2QQRA 2M0OA 3LH0A 4FU6A 4E7HA 3OS2A 1WGSA 2LDMA 4ZTFA 2L3RA 5FRMA 4IUTA 2LTOA 2P0KA 3MEVA 4IUUA 4RG2A 2EQUA 3GOXA 2L8DA 5FROA 3MO8A 5IAYA 3NTKA 3UWNA 3F70A 2BKDN 4A4EA 3S3OA 1RI0A 2EFIA 3KUFA 3O8VA 4GY5A 4QW2A 4BDZA 1H3ZA 2R57A 3LGLA 5J26A 3NTHA 4PLIA 4A4FA 1OI1A 2O4XB 2RO0A 4A4HA 4CRIA 3MEWA 4QVZA 3MEUA 2RHZA 4BE0A 2R5AA 2R58A 5J39A 3OYGA 3OYCA 3Q1JA 4N4GA 3S6WA 3M9QA 1OYXA 4IUPA 3OYEA 4E7LA 1OZ2A 4PL6A 2NLUA 2MWOA 3H8ZA 4QQ6A 4L59A 2F5KA 2DAQA 2PQWA 3ZEHA 2BIVA 3QBYA 4BACA 2HQEA 2XK0A 4IURA 1WJSA 1MHNA 4Q5WA 1KHCA 3LYIA 2RJEA 3S3MA 4BD3A 4NS5A 4C5HA 2GF7A 3MP8A 3ME9A 2R5MA 4E7KA 3OYFA 4E7IA 5D6XA 3PNWC 1G5VA 3OYHA 3UT1A 3LLRA 3PMIA 2K3XA 2RI5A 2XDPA 3CEYA 2E6NA 4ZTJA 2RJFA 3LGFA 2DIGA 3OYKA 3S3NA 3H6ZA 4FL6A 4IUQA 4N4IA 2B8AA 3MP1A 3OS1A 3OA6A 5KE2A 2LVMA 2CKKA 3DB3A 4IUVA 3OMCA 3OYLA 1N27A 2MWPA 3OYMA 2X4YA 3BDLA 2RHUA 2M16A 2RHIA 2RHXA 3PFSA 3L2QA 3META 4B9XA 3QIIA 4E7JA 2RI3A 3FC3A 1OZ3A
chains in the Genus database with same CATH superfamily
2L3SA 2FHDA 3OBWA 5GAN6 2WACA 3KFVA 1K4US 4M75G 3QJ6A 1BBZA 1UGPB 2RJDA 4A4GA 5D7UA 3JCMJ 2LT1A 2L2PA 2X3WD 2O31A 3VU3C 1QP2A 5CQYA 2FYKA 4FM4B 3OMGA 5IN1A 1I5LA 2DF6A 2DVEA 3VS6A 3X25B 1W70A 2EKHA 2DL8A 2DEUA 3EH2A 1E7OA 2VXEA 4MZTA 4RTUA 5C0MA 3FJ5A 2AZSA 3CCST 5GAMh 3OY9A 1N6AA 3SD4A 4JJCA 2RMOA 3G4ST 4BE2A 5EG2A 3G6ET 2AT1B 4E7HA 2CDTA 2EW3A 1Q95G 4IUTA 1K8AR 3VS1A 3GOXA 2KAFA 2DTOA 3O8VA 4FYWB 4LDXA 2O4XB 1X75C 2LZ6B 1O9SA 1LVKA 1SRMA 5FWBA 5GAMf 2NUZA 3Q1JA 4OB1B 3ZL7C 1RAGB 3CC4Q 1LNXA 1T3SA 3N5BB 2XDBA 5LJ3g 4AFZC 2YUQA 3V8JA 5LJ5h 3JCMe 3SWNA 4CC3A 2GNCA 2CSQA 1VQ6A 2EWNA 2EAYA 4MDXA 1K9MU 3G71T 4M78C 1EIFA 1VQPT 3QYGB 1GBQA 2RH2A 2BZXA 1JEGA 3MP1A 5ECAA 5AYFA 4JLGA 2I2LA 3G71Q 5GMKh 1CKAA 3PFSA 4CI0C 2O88A 5GAN4 1K9AA 4HCCA 1I0CA 4EMKC 4RG8A 2NUPB 3PGGA 3VYGA 3QWXX 2M1HA 3L2RA 3M59A 2EPDA 1O75A 2MK5A 1XNIA 2JVVA 5IXBA 3EGXA 2JM9A 2O9SA 1M3BA 5A0GA 3JRZA 5GAOq 2DIQA 4JRQA 4FW1A 2GGRA 1KD1C 1VQOA 2OJ2A 1OX9A 4JUVA 4X1VA 3M0RA 4C8QF 1Y7XA 1N9SA 1N5ZA 3TEEA 1VQKA 5I22A 1QQJA 1W2BP 4M7DA 5CR2A 4M75F 2CREA 2ED0A 4C92C 1D1BA 1WXBA 2D0QB 4QT7A 1K8AC 2K57A 4PLIA 3BW1A 2EJGA 3CD6T 4J6XA 4XTUA 4C0DC 4OP0A 1Y71A 4M7DG 4E6RA 3OS5A 4DBQA 2AKKA 1PNJA 3GIBA 3DKMA 2RJEA 2DZCA 3CCRA 1NJIU 1M90U 3HTRA 1WIEA 2CS7A 1D3BB 3LLRA 1NEGA 5CKBA 1QCOA 2DIGA 3CMEA 3VS3A 1VYUA 2J6OA 3I35A 4AMCA 3FIFA 3BDLA 2CH4A 2RHIA 4B9XA 3UATA 4J5YA 1KQSS 5LJ5j 3VRYA 1KQ2A 1D09B 4FSXA 3I56A 1OOTA 3EGDA 1YN8A 3VS4A 4J9IA 5HK3A 3MKDA 3VUBA 4RKUE 4C5EA 3BDUA 1SHGA 2CYZB 4XAXB 3OYDA 5A2QE 2F2VA 2QEXQ 1HK9A 3CCUT 1TUCA 2ECZA 1BIAA 4PLLA 1FXXA 3P8DA 2FVUA 2JS2A 4MZPA 1GCQA 2VASA 2DL3A 4DOWA 1K73R 4M7AA 1PRLC 2LJ1A 3VV0A 3HRTA 4FU6A 3JB9D 3OS2A 1M3CA 1ZSZB 1TWBA 3AHUA 4JJBA 4MMLA 2LQKA 1TUGB 1KSWA 2CP7A 2L8DA 4QW2A 2KBTA 2KNBB 1IGQA 1UE9A 4M7AG 3EFOB 5CK9A 2JTEA 3M0QA 3RIRA 2AIRB 2QGGA 5J39A 2DRMA 2PUOB 2RF0A 1I8FA 1YJNT 1ZA2B 3V8LA 1HD3A 3CCJT 3L2ZA 5KYWB 4LDUA 1PSEA 1VQ9Q 4IURA 1U5SA 1YJNQ 1V29B 2LNHB 2HMAA 1NYGA 3BY7A 2HEQA 3OYFA 2DXTA 4QKUA 2IIMA 3PMIA 1T0JA 3JCMW 1Z9QA 2EJFA 4FL6A 5GAN5 4C8QB 2M0YA 2PVGB 1M1FA 1Y07A 2DO3A 1QVPA 3JCMh 1NZ9A 1M9SA 5CQXA 5KYXA 1X27A 1QVFP 3NGPA 4F7UA 4M75B 3J80E 3VYHB 4J9GA 3E19A 1WFWA 2MPXC 4JJNK 1KFZA 1IGUA 1PCXA 2MIOA 2RI2A 3EGUA 1VQ7Q 3CC2A 4M7DF 1D0XA 1HXDA 3UF4A 3HFOA 2JM8A 3RMSA 5C6SA 5D6YA 1ZX6A 5DM7R 1Y57A 4RMOA 2HSEB 4LD6A 4F7UG 1VQ8A 4ME7A 1GFCA 2V8IA 3CCQA 3OW2P 2JMCA 3JCMf 2Y4XA 2V1RA 4X34A 4E7SA 2JUFA 1NBEB 3MP6A 1GFDA 2RHYA 4C8QE 4LD9K 2J06A 5DY9A 3PIOA 4BY6C 3NTKA 5EC7A 4GY5A 4BDZA 3V7CA 1OI1A 1YCYA 4M75E 5GANe 5GAN8 1V76A 3REAB 1WQWA 4DBFA 3OYGA 2CP0A 1OYXA 1TXQA 1YBYA 2NLUA 2RQRA 1MNDA 4J9EA 4LDVA 2JJ9A 3URGA 1ABOA 4AFQC 3A5ZB 2BIVA 2RPNA 4O5VA 1UGVA 2JS0A 2YLCA 4BD3A 2HZYA 2YLBA 2O2OA 2FB7A 3GNFB 1VIFA 1G83A 4ZGEB 1G5VA 4DBHA 3EG3A 1YCSB 4JJDA 2RQUA 4KUIA 1VOMA 2EYXA 3H6ZA 1U8RA 3SWNB 4J8OA 4GLMA 2W10A 2RB6A 4PJJA 4M7AF 1YITA 3H41A 3UDCA 1KIKA 2DZ9A 5GANd 5FRNA 3BE3A 3CCMA 1BI0A 2E1HA 2ZPFB 4C5GA 1C0MA 3RNJA 3L2UA 1EFNA 3JV3A 1VQ5T 2KR3A 1ZBJA 5DLQE 1ARKA 3ASKA 1R0BG 3OYBA 5LJ5g 4F04B 5GMKm 3CCLT 1TTHB 1VQ5Q 3QG1A 2K3YA 4LUDA 1ZBXA 2MOXA 5KCHA 2QQSA 4R0KA 3CCLQ 5M9OA 1Y96A 1WHMA 2EQIA 3H9NA 3T9NA 2GFAA 2D8JA 2LQNA 2QK0A 3CCVT 3HKSA 2I0NA 3A8GB 2DERA 4EMHA 3GNGA 2CT4A 5FRMA 1BIBA 2DJZA 4JZ3A 3FB9A 1YHQA 4ATOA 4KULA 2NYSA 2RNAA 2K7AA 4LE9A 1WXTA 3RKXA 4A4FA 4XK8E 3JB9G 3NHNA 3MEWA 3CCET 4KGVB 2R5AA 1MMAA 1D1AA 3I55Q 1X43A 4Z89A 4M7DB 2Z0WA 4F7UF 4E7LA 1PKTA 2F69A 4Z88A 3FJPA 2PTKA 2HNIA 1M8MA 2LP5A 3ME9A 5GMKi 4OB3B 3PNWC 4M77C 2RI5A 1X2KA 2P0PA 8AT1B 4KGXB 4J9DA 1D0YA 1I81A 2DXUA 2M16A 1Q7YR 4A53A 2RI3A 3VRZA 4PK4A 1PKSA 3HHTB 4IIOA 1Q82C 5IHKA 2LJ0A 3REBB 1K73U 2E41A 4LDWA 2X4WA 1YI2T 2FPEA 4BUGA 2VWFA 2JXBA 1WI7A 2GCXA 2DM1A 2LJ3A 4J9BA 3RBBB 1G2BA 1M27C 4M77E 1YI2Q 4M7DE 2DBMA 5FU7B 2F2WA 2F2XA 3TCJA 3EGDB 4XU0A 1UECA 3NTIA 2EQKA 2MMPA 3NPFA 1VQ4T 3OS0A 2K79A 3RKYA 1YIJT 2IG0A 3HL8A 2F1LA 2H8HA 1LJOA 2BUDA 4C0FA 5KH6A 1UUEA 2EYYA 1ZQ1A 2C0IA 1TOVA 4HT9A 1EZZB 4M7AB 5CCAA 1KD1R 1YJWT 4A4EA 3JCMc 4CC4B 3RERA 4CC2A 3NTHA 1F1BB 2YXYA 3EFRA 4QVZA 1YJWQ 3OYCA 2J7IA 2COZA 4M7AD 3CCSQ 3CMAT 7AT1B 2X51A 1OU8A 1V1CA 3G4SQ 3CC4A 4C0ZA 1WNLA 5LL6S 3G6EQ 3CMAQ 4LUEA 1QVGA 1RUWA 3MCAB 3OYHA 5GAN3 3CEYA 2DL5A 3EHRA 3CXCP 2H3JA 4IUVA 3TSZA 2FG0A 1N27A 2V8JA 1IREB 2RHUA 4OMNA 4AG1C 2PUKB 3JB9F 4J9FA 1VQLT 1IZ6A 2XD0A 2KT1A 2YSQA 1LCKA 4ESRA 4N4HA 1Q7YC 4M7AE 4E47A 4Z8AA 3G71A 3EAEA 2CP3A 1QKWA 1UDLA 1NLPC 1VQLQ 4FSSA 1PC0A 5GANf 4PJOA 1UFFA 5KYXB 5GAOm 4F7UB 2EYZA 1RL2A 1VQPQ 1QVFS 2KXCA 1IXDA 4M78D 5LJ3d 2EYWA 4PKCC 3HRSA 5FLXE 5FU6B 4WCIA 1VQ6T 3E9GA 2JT4A 3OYNA 1WZOA 4PJOG 2MI6A 2E3IA 2HAXA 1X69A 3JCMg 2YUPA 2DEQA 1WA7A 1T0HA 4DQ2A 1PD0A 2V8KA 1M8VA 1G3WA 2A3LA 1N8RR 4OMFB 4LXCA 3MEVA 5AT1B 4IUUA 3OW2S 4N0AC 4XU2A 3UPUA 2QG9B 2R57A 1SPKA 4CRIA 2ROTA 1B34A 2FZGB 2GQIA 2QDLA 2IVWA 2ED1A 2NWMA 2W0ZA 1BKBA 2F5KA 2PQWA 1YFNA 1Q81R 4F7UE 2DNUA 3J81E 2YDLA 4NS5A 3JAME 1U3OA 3M57A 1W1FA 2R5MA 1VQNT 1AZGB 1VQOT 4DEXA 5GAMj 1K0XA 3QZ5B 2E5KA 2A08A 2C0OA 1VQNQ 2X4YA 1VQKT 1P92A 1M4ZA 3CD6Q 1RAIB 4RTYA 3INZA 3OYAA 4OMPA 3H0IA 4HCZA 1AHJB 1IRXA 1C1AA 3M53A 4JLIA 3DB4A 3QO3A 2KI7A 2X4XA 4JRIA 4QVCA 2LMJA 4BI8B 2E12A 1WHLA 3THKA 2LNVA 3EHQA 3C94A 1W4SA 3QZ9B 3CCRT 2M9UA 4ELYC 4K11A 2QEXA 2GFUA 3M4GA 4AG2C 5D6WA 2K9GA 2RM4A 1UJ0A 3QHSA 1RAHB 1OEBA 1WGSA 3M54A 5GMKj 1Y96B 2P0KA 2J05A 5J3BA 2NUTB 1VQMT 1MNEA 1N8RC 3A8HB 1U1SA 1GBRA 3I56T 1ZLMA 2DRKA 3LGLA 4XTZA 2DKGA 5IT9E 2RN8A 3LWIA 3CCUQ 3OSSC 1OQKA 1VQMQ 1M1KC 1TG0A 1RABB 2D6FA 1KC8R 2HL3A 5IXFA 3M9QA 2RA2A 5I2MA 5KYNA 2DMOA 2FRWA 1S1NA 1ZUUA 2DAQA 1ACMB 2FPFA 5CAIA 1KHCA 3LYIA 2G6FX 1YWPA 4PFPA 4PJOF 1N9RA 1Q81C 3X26B 2PVDB 1I4K1 5CKFA 2DPPB 2YWWA 1ABQA 1VQ9A 2KE9A 1VYTA 1BI1A 1YJNA 4N4IA 1MMNA 2QA4T 1IHVA 1ZSZC 4D6WA 1ZSGA 1PRMC 2GBQA 4D8DA 3QIIA 2CZ0B 1OU9A 4FW2A 4OMOA 3QYHB 2PVOB 2G3RA 4LDYA 1WHKA 2RK2A 3FEOA 2QA4Q 3CBOA 4FCYA 2BTTA 5KYUA 3RKWA 3VJPA 4LN2A 5A0DA 3CCJQ 5CKHA 3I5RA 1RLPC 1UEBA 3PMTA 2KYBA 2GTOA 1KG1A 1YJ9A 9ATCB 4M78A 1JB0E 1JXOA 2HCKA 1VQ7A 1KD1U 3WXMB 2X35A 2RQVA 1MV0B 2VUBA 1KQSA 4J9HA 4F17A 4EDUA 4DOVA 5FWCA 5CKDA 1JJ2A 3X28B 2DXBA 1IHWA 4JS4A 5KCOA 4M78G 4EMKA 2RJCA 5L8RE 4C8QC 4WF2A 3A1PA 2M0OA 3RESA 2KGTA 2CUBA 1UGRB 2EIFA 1K8AU 4FT2A 2GQVA 2EGEA 4RTVA 3JB9I 1NLOC 4FYXB 2BKDN 3S3OA 4DA4A 3KUFA 2ENMA 4M75C 2HL5C 1YP5A 2K5IA 4OMLA 1Q86C 3EG2A 3O5ZA 4FYYB 2LC4A 3HSBA 3CC2T 2V1QA 4RUGA 4OMQA 1JBMA 2L0AA 1M5Q1 4R56A 3GF5A 2OTLT 2MWOA 4B6MA 5I11A 1KC8C 2COWA 5HY6A 3ZEHA 4NL3A 4J7FA 4XQ3A 5I21A 1MHNA 1VQ8T 4XTWA 2EYQA 2OTLQ 2X9HA 2FL7A 3VS2A 4AFSC 4AFUC 4AT1B 4C92A 1NM7A 3OS1A 2X4JA 4GBQA 4RTTA 3OMCA 3OYMA 1VIEA 1R8OB 1E6HA 2LX9A 3FC3A 5GAMg 2F5TX 2QQAA 1WJRA 1D0ZA 6AT1B 4KUDK 2LX7A 4MZMA 2C0TA 1EX4A 1WDXA 2EBPA 4C92G 3CXCS 3JB9H 4P5NA 1ZA1B 1K76A 1KHIA 3VS0A 2L89A 2XI9A 3M0PA 3PVLA 2WSCE 3KXTA 4HVVA 1XQHA 1Q82R 2C06A 2LCSA 1FMWA 4C5IA 3OYIA 1RLQC 5LJ5e 2QGFB 5GAMd 1VYVA 1QWEA 2BE7D 3L42A 1PM3A 4PJOB 3JSCA 2OX7A 2V26A 3QPHA 4JDSA 1VQ5A 1SSFA 2A37A 3SWNC 3CCLA 4Y28E 2KYMA 2KRMA 4XTVA 2L3RA 3LW5E 1YITT 4PJOD 2P0QA 5IAYA 2KMTA 1IB8A 3CPFA 1B7TA 2L3QA 3CCMT 5J26A 2QQBA 4OF1A 3G1JA 3WVEB 2OTJT 1H92A 4ANJA 4MMKA 2MYSA 4HXJA 1CSKA 2R58A 3QJYA 4ORZA 3EGXB 1G3TA 2EVRA 3AT1B 2E65A 2OTJQ 5CKEA 5LJ5d 4L59A 1SSHA 3ZBDA 2A0FB 2XICA 3C0CA 2YRCA 2KVQG 3I55A 1B34B 3CCVQ 4D8KA 3PT9A 1YWOA 2CGHA 3OYYA 4C5HA 4M78F 1B07A 3SB2A 4E7IA 3JCMb 4RCCA 2ZPIB 2XDPA 4BI4A 4E2FB 2K2VA 2DA9A 2PNIA 4RTWA 5KE2A 1K9MC 3DB3A 1XOVA 3QUIA 3CCEQ 2ZPHB 2CP6A 2CZ6B 2CT3A 2QTXA 3DLLA 1JO8A 1OZ3A 1I5OB 1ZSZA 1RAFB 2HBPA 4X9DA 3GP8A 2LQ8A 1HYOA 3HP9A 3UA7A 2DK3A 4M7DC 2ZPEB 2H3EB 3C4SA 3CC7T 3I9QA 1W6XA 3M58A 1K0SA 2DETA 1PD1A 3ULRB 2LRQA 3R6NA 1GCPA 5I2SA 4UC4A 1BI3A 3CC7Q 1OX8A 1K1ZA 1M2VA 2LCCA 5KYWA 1YI2A 3CPWA 1UGQB 1RADB 2KXDA 1ZUYA 4R55A 4A63B 4J6WA 2SEMA 4QQGA 3JB9J 1FMVA 3VS7A 3X20B 3R6OA 4RTZA 2LDMA 2K6DA 2LTOA 3OSVA 4A4KA 3C12A 4C8QA 2DE0X 4C92F 3SFMA 2AKLA 1RI0A 2EFIA 1AD5A 1I07A 4PJMA 3VS5A 4PNOA 3V7SA 2ESWA 1SRLA 3D7SB 2JN0A 1QLYA 2DD4A 3MPUB 3ER0A 2XDDA 4N4GA 1S72T 2KEAA 5KYYA 2A36A 1VQ4Q 3TQ7P 2MCNA 1YIJQ 3H8ZA 5FU7C 2OI3A 3M0TA 1FX7A 4BACA 1YJWA 1S72Q 3CQTA 4X9CA 4Q5WA 3JCMX 1PSFA 3EG1A 4E7ZA 2XIDA 3PTAA 4YTLA 3CCSA 1WHJA 1FYNA 2KT8A 4OB0B 2ZPGB 2DTIA 3G4SA 1NJIC 1M90C 2B8AA 3M5AA 3G6EA 3CMAA 2CP5A 2QXFA 1GCQC 1W2BA 2RHXA 2E64A 4M7AC 2DYIA 2DXCA 2K4YA 1JU5C 1BI2A 4JRKA 2KRSA 1CKBA 1TU0B 5LJ3e 5GAOr 5GANh 2OAUA 1RACB 2E5QA 3GPLA 2CUDA 4XTXA 2JOYA 4ZN1A 1HSQA 3MHXA 4BDYA 5KYUB 3QKJA 2YUOA 1VQLA 3ZFJA 4J6YA 2Y4YA 1MV3A 4WTOB 3CC4T 2P84A 1QP3A 1GRIA 3A8OB 1AEYA 2JW4A 4J83A 4M78B 1VQPA 3JCMP 3EG0A 3P8HA 3OB9A 2E3HA 4XTYA 2ZPBB 4ZTFA 1NEBA 4PFZA 4KGZB 4EIKA 4C0GA 1MMGA 1RAEB 3VUZA 2WSEE 3EFSA 4EMKB 3M55A 3CPWP 2A28A 2RO0A 2XG8D 5GAN2 2FZCB 4FYVB 4BE0A 1AOJA 2KROA 1X6GA 2FO0A 2SRCA 1VQ6Q 4NOYA 3QXEB 1WHGA 1NG2A 3FRNA 4OGCA 3JCMV 2AHJB 1M1KR 5IHNA 5GAOl 5FU6C 2GF7A 3MP8A 5LJ5f 4A54A 1ZHIA 1RAAB 2JTMA 3U23A 5GAOp 1SHFA 4M78E 3EG9A 1UG1A 3JCMd 1Q82U 4OB2B 2MWPA 1SF9A 2QDYB 4JS5A 2D1XA 1SKUB 1X2QA 3PVQA 1M2OA 2ABLA 3TSWA 1TSFA 2YRVA 4Y92A 4C92B 1VQNA 2HQHA 1I1JA 2DL7A 2EGCA 3E2UA 3RDVA 2EQJA 1JXMA 2EGAA 1DJ7B 3CD6A 3J7AF 2DBKA 2XHCA 4KT0E 2COYA 2KRNA 4C0DB 1YNZA 4BB7A 3OYJA 5CVIA 1T3LA 1VQOQ 4C92D 4M77A 2VGMA 1X6BA 2CZ1B 1R77A 3TREA 2VYTA 4B9WA 2VKNA 3GBQA 2L3PA 2QTVA 4NL2A 2BE9B 4KH0B 2LT4A 2ROLA 2YUNA 1VQKQ 3C95A 1G3YA 1QVGP 1AWOA 3FDRA 5GANj 2MAMA 1X6OA 3QWYA 3RR6A 2CZ7B 2IPOB 3NMZC 2X3XD 4M4ZA 1NYFA 2WSFE 4M77G 2E4HA 2FPDA 2ZGWA 2DVJA 1QCFA 2EQUA 1QVFA 3UWNA 3OBYA 4GLKA 4V2SA 4L6V5 4C92E 2QI2A 1PHTA 1KQ1A 3RMQA 2K2MA 3NFCA 3P8BB 1AT1B 3CCRQ 1X01A 3CMET 1GXIE 3CCUA 1QWFA 1VQMA 3PE0A 5HKCA 3M56A 3QBYA 2XK0A 3HFNA 2VGNA 1Q86R 3OW2A 3CMEQ 1JJ2S 4CC7A 2M02A 1M30A 2QEXT 4TVRA 4J9CA 5D6XA 2LQWA 2FEIA 2VV5A 2E6NA 1LOJA 3S3NA 1XTDA 1M1GA 2ATCB 3I56Q 2KK4A 2PU9B 1Q7YU 3X24B 3SHWA 3META 5FW9A 2HKQB 1AWWA 4JRPA 4PJNA 3BFMA 1Z9ZA 4BE1A 3MEAA 1J3TA 2EJ9A 3OQ5A 4KH1B 1FMKA 3H0HA 2RQWA 2D0NA 5CIUA 2QA4A 2JZ2A 1BCOA 2JTFA 2EKOA 3CCJA 2E10A 3LX7A 1QKXA 2PZ1A 1H3HA 1U1TA 3E9FA 1MUZA 5LJ3h 2DJQA 3L2VA 1VQ9T 3KBGA 4ZGDB 2O4XA 2KDSA 2QQRA 1M2VB 2E70A 4ELZC 5DLOA 2CSIA 3MO8A 1SG5A 1FWZA 4XU1A 4PFOA 1LPLA 2ZZDA 1PG5B 4RCBA 1H3ZA 2P4TA 4A4HA 5A0LA 1QCNA 2RHZA 5GJWB 2LCLA 4EMGA 5LJ3f 1AVZC 4XU3A 2XU8A 5L23A 5IHIA 1YJ9T 4IUPA 1OZ2A 4PL6A 2K5FA 1BCMA 3A8MB 5GJVB 1UB4A 1VA7A 1AWXA 2DL4A 3H0FA 1VQ7T 2HQEA 1KJWA 1WJSA 4DBRA 1KK7A 1YJ9Q 4J7IA 2D8HA 1TS9A 2VB6A 4Y91A 3CBMA 1JQQA 1UHFA 1WX6A 2KSSA 4OMMA 5KYYB 2K5LA 4E7KA 4C8QD 4HVUA 4M77F 1R0CB 2P4RA 3V8KA 4N0AA 3LGFA 1UTIA 2OTLA 1G3SA 1OV3A 4VUBA 2NUPA 4M75D 2HBWA 1MGQA 4MDWA 3CC2Q 3WVDB 4BY6B 3CCQT 3HRUA 2KQWA 2QYZA 4Z02A 5GAMe 1VQ8Q 1H641 1K9MR 2DD5A 3QSUA 4OVAA 4EPCA 3CCQQ 1K73C 4IIMA 2O01E 1BYMA 1RI9A 2JNGA 3V7RA 4ZN3A 5KE3A 3L2WA 1UHCA 2HSPA 2EQMA 2RQTA 5GAN7 4OGEA 4II1A 1IO6A 3EH1A 2HDAA 2DILA 1AWJA 2L5QA 3A8LB 4QQDA 2QASA 2QQ9A 3FLGA 3M4YA 4F16A 1N8RU 3LH0A 2ZAEA 2HKNA 1TUDA 2AZVA 1BK2A 1JRIA 4ZNXA 4KBMB 3RUXA 5GANg 1M1KU 5FROA 3F70A 2Y90A 3LWHA 1C6VX 3L1AA 5LJ3j 1BU1A 1WQ7A 1WYXA 2YRDA 4HCKA 3LH5A 1E6GA 1NPRA 1AZEA 3PIPA 3S6WA 3A98A 3SEMA 1G8XA 1D3BA 3GLXA 1GL5A 1Q81U 5GMKe 2BZ8A 1WLPB 1WPYA 2K3BA 3S3MA 3CPWS 4PJLA 1KQSP 4PJOC 2OTJA 1NE8A 2MF2A 1YITQ 1JJ2P 2A7YA 1XJWB 1NPPA 2DFUA 4HVWA 3UT1A 4ZGJB 2ZCFB 4HT8A 3M0SA 2FZKB 2RJFA 2VXFA 3VKIA 3OYKA 3CCVA 1D1CA 4DEYA 2QAZA 3OA6A 3CCMQ 2LVMA 3OYLA 5IH2A 1M3AA 2DX1A 2JMAA 1OULA 2CP2A 4L5GA 4JPBW 4FIBA 3SDZA 5HK0A 1QMCA 5GMKl 2NUTA 3CCEA 3EG9B 1NJIR 1M90R 2BZYA 3I5SA 4PJOE 1MMDA 4BI3A 1UGSB 1VUBA 2KY9A 2YHTA 3G7ZA 1OPKA 3CBPA 2RK1A 8ATCB 4IKFA 2VVKA 3I55T 2D9TA 4JZ4A 1WJQA 3DLMA 1A0NB 1ZUKA 1YHQT 3UA6A 2XKOC 4FT4A 3HPWA 3CXCA 4M77B 2HQXA 1WHHA 1Y0MA 3CC7A 4KRTA 2B86A 1YHQQ 3EFOA 1U06A 2M51A 1W2BS 3E1SA 2FRYA 2DTHA 3M0UA 1WXUA 4QVDA 1B3QA 5CO7A 1Q86U 4O6JA 1SEMA 4M77D 3IQLA 4M7DD 1QVGS 2RD1A 2OAWA 1TH7A 2E6ZA 3MJXA 4HKEA 2J6FA 3MEUA 3TVTA 1KC8U 1QW1A 1H8KA 3OYEA 2XMFA 4QQ6A 4HCBA 2VC8A 5HCKA 3JCMQ 4LNPA 3TU4K 2DLPA 2DYBA 3QDRB 5GAOn 4F14A 1OPLA 1VQ4A 4RTXA 1YIJA 2YT6A 3QDFA 2HD0A 1PWTA 2K3XA 1S72A 4ZTJA 2J6KA 4M75A 4IUQA 2O9VA 2CKKA 1BB9A 1UJYA 1HJDA 3L2QA 4C8QG 2GTJA 4E7JA 2CH4W 2AK5A 4HA8A 4RG2A
chains in the Genus database with same CATH topology
2G3RA 4LDYA 2DZ9A 5GANd 2RK2A 2YRVA 3FEOA 4C92B 5FRNA 3CBOA 3CCMA 2FHDA 3OBWA 1VQNA 1BI0A 2E1HA 3RKWA 3VJPA 5GAN6 5A0DA 2ZPFB 2WACA 2EQJA 4C5GA 5CKHA 3L2UA 4M75G 1DJ7B 3QJ6A 3CD6A 3OW2S 3J7AF 1UEBA 3PMTA 1VQ5T 1UGPB 2RJDA 5DLQE 4A4GA 3JCMJ 2LT1A 3ASKA 1KG1A 3OYBA 1YJ9A 2XHCA 4KT0E 4C0DB 5LJ5g 4BB7A 3VU3C 3OYJA 5CVIA 1QP2A 5CQYA 2FYKA 4FM4B 4M78A 4C92D 3OMGA 5IN1A 5GMKm 4M77A 2VGMA 3CCLT 1I5LA 1JB0E 2CZ1B 2DVEA 3X25B 1VQ7A 3QG1A 2K3YA 1KD1U 3WXMB 3TREA 2VYTA 2X35A 1ZBXA 5KCHA 4B9WA 2QQSA 2VUBA 1KQSA 4NL2A 2VXEA 4MZTA 5C0MA 4EDUA 2LT4A 4DOVA 3CCST 5CKDA 5M9OA 1JJ2A 1Y96A 3C95A 5GAMh 1G3YA 3FDRA 5GANj 2MAMA 1N6AA 1X6OA 3SD4A 3T9NA 2GFAA 3X28B 3OY9A 2CZ7B 2DXBA 4JS4A 5KCOA 3HKSA 4M78G 4EMKA 3G4ST 2RJCA 4M77G 2WSFE 3A8GB 4WF2A 5L8RE 4C8QC 2ZGWA 4EMHA 5EG2A 3G6ET 2M0OA 3GNGA 4E7HA 3RESA 1YIJA 1UGRB 2EIFA 1K8AU 4FT2A 5FRMA 2GQVA 4IUTA 2EQUA 1BIBA 1QVFA 3JB9I 3GOXA 2DJZA 2KAFA 2DTOA 3FB9A 3OBYA 2BKDN 3UWNA 3S3OA 4DA4A 1YHQA 3KUFA 4KULA 3O8VA 4M75C 4ATOA 4GLKA 2K5IA 4V2SA 4L6V5 4LDXA 3RKXA 1Q86C 4A4FA 2O4XB 4XK8E 1X75C 4C92E 1O9SA 3MEWA 3JB9G 3CCET 2LC4A 3HSBA 2QI2A 2R5AA 3CC2T 1KQ1A 4M7DB 3RMQA 5GAMf 3Q1JA 3NFCA 3P8BB 4OB1B 4F7UF 4E7LA 1JBMA 1M5Q1 2F69A 4R56A 1X01A 3CMET 3GF5A 1GXIE 2OTLT 1LNXA 2MWOA 3CCUA 1VQMA 1KC8C 5HY6A 3FJPA 3N5BB 2XDBA 3ZEHA 5LJ3g 5HKCA 3M56A 3QBYA 4NL3A 2XK0A 4J7FA 4XQ3A 3V8JA 1MHNA 5I21A 3HFNA 5LJ5h 2HNIA 2VGNA 3JCMe 3SWNA 3OW2A 4XTWA 2EYQA 1JJ2S 5LJ5f 1M8VA 2FL7A 3ME9A 1VQ6A 5GMKi 2QEXT 2EWNA 2EAYA 4TVRA 4OB3B 5D6XA 4MDXA 1K9MU 3PNWC 3G71T 4M78C 4M77C 1EIFA 1VQPT 3QYGB 2RI5A 2RH2A 2VV5A 2E6NA 1LOJA 4C92A 3S3NA 1XTDA 2P0PA 1M1GA 3OS1A 3MP1A 2X4JA 2KK4A 5AYFA 1I81A 3OMCA 4JLGA 2I2LA 2PU9B 3OYMA 1VIEA 2DXUA 5GMKh 2M16A 3PFSA 3X24B 4CI0C 1Q7YU 1R8OB 3META 4A53A 2LX9A 2RI3A 5GAN4 3FC3A 5GAMg 4HCCA 2F5TX 3HHTB 1Q82C 2QQAA 4JRPA 1WJRA 3BFMA 1N8RU 4EMKC 4MZMA 4KUDK 1K73U 2E41A 4LDWA 2X4WA 1YI2T 4RG8A 4BUGA 4C92G 3CXCS 4BE1A 3MEAA 3JB9H 2EJ9A 3PGGA 4P5NA 3VYGA 2M1HA 3OQ5A 3L2RA 2GCXA 1KHIA 3M59A 2L89A 5CIUA 2XI9A 1O75A 2QA4A 2WSCE 4M77E 1XNIA 3KXTA 4M7DE 2JZ2A 2JTFA 2EKOA 3CCJA 1XQHA 2JVVA 5FU7B 2C06A 2E10A 4C5IA 3OYIA 3LX7A 3TCJA 4XU0A 3NTIA 2EQKA 5A0GA 5LJ5e 5GAMd 2MMPA 3JRZA 5GAOq 2DIQA 4JRQA 1U1TA 3E9FA 3L42A 3OS0A 1VQ4T 4PJOB 3JSCA 3RKYA 1YIJT 1KD1C 1VQOA 5LJ3h 3QPHA 2IG0A 4JUVA 3HL8A 4JDSA 1VQ5A 3L2VA 1SSFA 1VQ9T 1LJOA 2BUDA 4C8QF 1Y7XA 4C0FA 5KH6A 3KBGA 3SWNC 4ZGDB 1N9SA 2O4XA 2KDSA 2QQRA 1ZQ1A 3TEEA 3CCLA 2E70A 4Y28E 4XTVA 1VQKA 2L3RA 4ELZC 3LW5E 4HT9A 1YITT 4PJOD 4RG2A 4M7DA 5DLOA 5CR2A 2P0QA 4M7AB 5CCAA 5IAYA 3MO8A 4M75F 1FWZA 4XU1A 4A4EA 1YJWT 2KMTA 4RCBA 2ZZDA 3JCMc 4C92C 3RERA 1H3ZA 3CPFA 2D0QB 1K8AC 3CCMT 2K57A 5J26A 3NTHA 2P4TA 2QQBA 3EFRA 4OF1A 4PLIA 3WVEB 2OTJT 4A4HA 5A0LA 3BW1A 4QVZA 4MMKA 2EJGA 2RHZA 2LCLA 3CD6T 4J6XA 2R58A 3QJYA 4EMGA 4XTUA 5LJ3f 3OYCA 1G3TA 4XU3A 2XU8A 4C0DC 1YJ9T 4M7AD 4IUPA 2E65A 4OP0A 1OZ2A 1Y71A 4PL6A 5CKEA 2K5FA 5LJ5d 4M7DG 3OS5A 4L59A 3A8MB 3CMAT 1UB4A 3ZBDA 2XICA 3GIBA 2KVQG 1VQ7T 2HQEA 1WJSA 3DKMA 3I55A 1B34B 4J7IA 2RJEA 2DZCA 4Y91A 3PT9A 3CC4A 3CBMA 4C0ZA 2KSSA 3CCRA 1WNLA 2CGHA 3OYYA 5LL6S 4C5HA 1QVGA 2K5LA 1NJIU 4E7KA 4C8QD 1M90U 4M78F 4M77F 3SB2A 4E7IA 3MCAB 2CS7A 3JCMb 4RCCA 2ZPIB 1D3BB 3OYHA 5GAN3 3LLRA 5CKBA 4N0AA 3V8KA 2XDPA 3CEYA 4BI4A 2K2VA 3LGFA 2DIGA 2H3JA 3CMEA 2OTLA 1G3SA 5KE2A 4IUVA 3DB3A 1K9MC 4VUBA 1N27A 2V8JA 1XOVA 1IREB 3QUIA 3FIFA 3BDLA 2RHUA 1MGQA 2RHIA 2ZPHB 4M75D 2CZ6B 2QTXA 4B9XA 3DLLA 4MDWA 3WVDB 4J5YA 1KQSS 4BY6B 2PUKB 3JB9F 5LJ5j 1IZ6A 1OZ3A 1VQLT 1KQ2A 2XD0A 4FSXA 3I56A 4N4HA 3CCQT 1Q7YC 4M7AE 3HRUA 4E47A 2KQWA 3G71A 2HBPA 3EAEA 4X9DA 2LQ8A 3GP8A 4Z02A 5GAMe 3HP9A 5HK3A 1H641 2DD5A 2DK3A 3QSUA 2ZPEB 4M7DC 1Q81C 4OVAA 4EPCA 3VUBA 4RKUE 5GANf 4C5EA 3C4SA 1K73C 3BDUA 3CC7T 2CYZB 4PJOA 2O01E 4XAXB 3OYDA 1BYMA 5A2QE 3M58A 5GAOm 4F7UB 1HK9A 2JNGA 3CCUT 1RL2A 3V7RA 1BIAA 4ZN3A 2LRQA 4PLLA 1QVFS 5I2SA 4UC4A 4M78D 1BI3A 5KE3A 5LJ3d 1FXXA 3L2WA 3P8DA 4PKCC 3HRSA 5FLXE 2FVUA 2LCCA 4MZPA 5FU6B 1YI2A 2EQMA 5GAN7 3CPWA 1UGQB 3E9GA 4OGEA 4II1A 1VQ6T 3OYNA 4DOWA 4M7AA 4R55A 4PJOG 4J6WA 2MI6A 2L5QA 3A8LB 4QQDA 2HAXA 3JCMg 4QQGA 2DEQA 2QQ9A 3FLGA 3M4YA 3VV0A 4DQ2A 3JB9J 3HRTA 2V8KA 3LH0A 4FU6A 3R6OA 3X20B 3OS2A 3JB9D 2LDMA 1G3WA 2A3LA 4OMFB 3AHUA 2LTOA 3MEVA 4MMLA 4IUUA 3OSVA 1JRIA 4A4KA 2LQKA 3C12A 4KBMB 3RUXA 4C8QA 4C92F 2L8DA 3SFMA 5FROA 4N0AC 5GANg 1M1KU 3F70A 2Y90A 1RI0A 2EFIA 4QW2A 3LWHA 4XU2A 3UPUA 4M7AG 2R57A 3CCVT 5CK9A 4PNOA 3V7SA 3RIRA 3L1AA 5LJ3j 4CRIA 1WQ7A 2JN0A 2DD4A 1B34A 5J39A 2PUOB 3ER0A 1NPRA 2XDDA 4N4GA 1S72T 3PIPA 3S6WA 2IVWA 1I8FA 1YJNT 3H8ZA 1D3BA 3V8LA 3GLXA 1BKBA 2F5KA 5FU7C 3CCJT 2PQWA 5GMKe 3L2ZA 1FX7A 1Q81U 4LDUA 1PSEA 4BACA 4F7UE 4IURA 1YJWA 1WPYA 4X9CA 4Q5WA 3JCMX 3S3MA 3J81E 1PSFA 3CPWS 4NS5A 1V29B 3JAME 2XIDA 3M57A 3PTAA 4YTLA 3CCSA 4PJOC 2OTJA 1NE8A 2R5MA 1VQNT 3BY7A 3OYFA 1VQOT 2MF2A 2DXTA 4OB0B 5GAMj 2A7YA 1NPPA 3UT1A 4ZGJB 4HT8A 3PMIA 2ZCFB 3JCMW 2ZPGB 2RJFA 2EJFA 2DTIA 2VXFA 3QZ5B 3VKIA 3OYKA 3G4SA 3CCVA 1NJIC 4FL6A 1M90C 2B8AA 5GAN5 4C8QB 3OA6A 3M5AA 2LVMA 2PVGB 1M1FA 3G6EA 1Y07A 3OYLA 3CMAA 2X4YA 2QXFA 1W2BA 1VQKT 2RHXA 2DO3A 1P92A 1M4ZA 2E64A 1QVPA 4M7AC 3JCMh 4L5GA 1NZ9A 1M9SA 5CQXA 2DXCA 2K4YA 4FIBA 3INZA 1BI2A 3OYAA 3SDZA 4F7UA 4M75B 5HK0A 3VYHB 3J80E 4JRKA 3E19A 5GMKl 3CCEA 4JJNK 5LJ3e 5GAOr 5GANh 2OAUA 2RI2A 4M7DF 4HCZA 3CC2A 2E5QA 3GPLA 4PJOE 1AHJB 4BI3A 3M53A 4JLIA 4XTXA 1UGSB 3DB4A 1HXDA 1VUBA 2KY9A 2JOYA 3HFOA 3RMSA 2YHTA 3QO3A 2X4XA 4ZN1A 5C6SA 3G7ZA 4JRIA 4QVCA 3MHXA 4BDYA 4BI8B 2E12A 5D6YA 3CBPA 5DM7R 3QKJA 4RMOA 2RK1A 1VQLA 4LD6A 3ZFJA 4F7UG 4ME7A 1VQ8A 4IKFA 2V8IA 2Y4YA 4J6YA 2D9TA 3I55T 1WJQA 2LNVA 3DLMA 3CCQA 3C94A 3CC4T 1W4SA 3QZ9B 1YHQT 3CCRT 2M9UA 3JCMf 4ELYC 1QP3A 2QEXA 2Y4XA 2GFUA 2XKOC 3A8OB 4X34A 4FT4A 3M4GA 4J83A 3HPWA 4M78B 1VQPA 3CXCA 4M77B 3JCMP 2HQXA 2JUFA 3P8HA 5D6WA 3CC7A 2RM4A 3OB9A 3MP6A 3QHSA 1W2BS 2RHYA 3E1SA 4XTYA 2DTHA 1WGSA 2ZPBB 4ZTFA 3M54A 4C8QE 4QVDA 4LD9K 5GMKj 1Y96B 2P0KA 5CO7A 4O6JA 5DY9A 5J3BA 3PIOA 1VQMT 1Q86U 4BY6C 3NTKA 4C0GA 1N8RC 4M77D 3A8HB 1U1SA 3VUZA 2WSEE 2RD1A 4GY5A 3V7CA 4BDZA 3EFSA 3I56T 1QVGS 4M7DD 3LGLA 4XTZA 4EMKB 2DKGA 3M55A 1TH7A 3LWIA 2E6ZA 3OSSC 4HKEA 1OI1A 5IT9E 2RO0A 1YCYA 2XG8D 1M1KC 4M75E 5GANe 5GAN2 3MEUA 5GAN8 4BE0A 1WQWA 1KC8U 3OYGA 2D6FA 1QW1A 3M9QA 1OYXA 3OYEA 2RA2A 1YBYA 2NLUA 4QQ6A 4NOYA 5I2MA 4HCBA 2VC8A 4LDVA 2DAQA 3JCMQ 3URGA 3TU4K 3QXEB 3A5ZB 3FRNA 2BIVA 4OGCA 3JCMV 2AHJB 4O5VA 5CAIA 1KHCA 3LYIA 2YLCA 3QDRB 4BD3A 5GAOn 4PJOF 1VQ4A 1N9RA 2YLBA 5GAOl 5FU6C 2FB7A 2GF7A 3GNFB 3MP8A 1VIFA 2PVDB 3X26B 1I4K1 5CKFA 4A54A 1ZHIA 2DPPB 2HD0A 4ZGEB 2JTMA 5GAOp 1G5VA 1VQ9A 2K3XA 1S72A 4ZTJA 1BI1A 4KUIA 4M75A 1YJNA 4M78E 3H6ZA 4IUQA 4N4IA 1U8RA 3SWNB 4J8OA 2CKKA 3JCMd 4BE2A 1Q82U 4OB2B 2QA4T 2MWPA 1VQ8T 2QDYB 2RB6A 4D6WA 3L2QA 4C8QG 4M7AF 1YITA 4JS5A 3QIIA 2CZ0B 4E7JA 4HA8A 3QYHB 3UDCA 2PVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3R A;  5FRN A;  3OYA A;  1WJR A;  2YRV A;  3FEO A;  4N4H A;  2FHD A;  3EAE A;  2WAC A;  2EQJ A;  2X4W A;  4C5G A;  3L2U A;  4BE1 A;  4Z02 A;  3MEA A;  2RI2 A;  3QJ6 A;  4HCZ A;  2E5Q A;  2M1H A;  3OQ5 A;  2RJD A;  3PMT A;  4A4G A;  3L2R A;  3ASK A;  3DB4 A;  4OVA A;  4C5E A;  3C4S A;  5CIU A;  2L89 A;  3OYB A;  3OYD A;  1XNI A;  3OYJ A;  2JZ2 A;  5C6S A;  2X4X A;  2JTF A;  2EKO A;  3OMG A;  5IN1 A;  4BDY A;  4C5I A;  5D6Y A;  3OYI A;  2LRQ A;  3LX7 A;  3QKJ A;  2K3Y A;  4PLL A;  2VYT A;  2X35 A;  4LD6 A;  3NTI A;  2EQK A;  4UC4 A;  2QQS A;  4B9W A;  5KCH A;  5KE3 A;  4IKF A;  2D9T A;  3L2W A;  1WJQ A;  3DLM A;  3P8D A;  2DIQ A;  3E9F A;  3L42 A;  2LCC A;  5C0M A;  3OS0 A;  4EDU A;  2EQM A;  5M9O A;  3E9G A;  4II1 A;  2GFU A;  4X34 A;  2IG0 A;  3OYN A;  3FDR A;  3L2V A;  3OY9 A;  3SD4 A;  1SSF A;  2GFA A;  2HQX A;  3P8H A;  2BUD A;  5D6W A;  4QQD A;  3OB9 A;  3MP6 A;  5KCO A;  4QQG A;  5KH6 A;  4BE2 A;  2RJC A;  3FLG A;  2RHY A;  2O4X A;  2QQR A;  2M0O A;  3LH0 A;  4FU6 A;  4E7H A;  3OS2 A;  1WGS A;  2LDM A;  4ZTF A;  2L3R A;  5FRM A;  4IUT A;  2LTO A;  2P0K A;  3MEV A;  4IUU A;  4RG2 A;  2EQU A;  3GOX A;  2L8D A;  5FRO A;  3MO8 A;  5IAY A;  3NTK A;  3UWN A;  3F70 A;  2BKD N;  4A4E A;  3S3O A;  1RI0 A;  2EFI A;  3KUF A;  3O8V A;  4GY5 A;  4QW2 A;  4BDZ A;  1H3Z A;  2R57 A;  3LGL A;  5J26 A;  3NTH A;  4PLI A;  4A4F A;  1OI1 A;  2O4X B;  2RO0 A;  4A4H A;  4CRI A;  3MEW A;  4QVZ A;  3MEU A;  2RHZ A;  4BE0 A;  2R5A A;  2R58 A;  5J39 A;  3OYG A;  3OYC A;  3Q1J A;  4N4G A;  3S6W A;  3M9Q A;  1OYX A;  4IUP A;  3OYE A;  4E7L A;  1OZ2 A;  4PL6 A;  2NLU A;  2MWO A;  3H8Z A;  4QQ6 A;  4L59 A;  2F5K A;  2DAQ A;  2PQW A;  3ZEH A;  2BIV A;  3QBY A;  4BAC A;  2HQE A;  2XK0 A;  4IUR A;  1WJS A;  1MHN A;  4Q5W A;  1KHC A;  3LYI A;  2RJE A;  3S3M A;  4BD3 A;  4NS5 A;  4C5H A;  2GF7 A;  3MP8 A;  3ME9 A;  2R5M A;  4E7K A;  3OYF A;  4E7I A;  5D6X A;  3PNW C;  1G5V A;  3OYH A;  3UT1 A;  3LLR A;  3PMI A;  2K3X A;  2RI5 A;  2XDP A;  3CEY A;  2E6N A;  4ZTJ A;  2RJF A;  3LGF A;  2DIG A;  3OYK A;  3S3N A;  3H6Z A;  4FL6 A;  4IUQ A;  4N4I A;  2B8A A;  3MP1 A;  3OS1 A;  3OA6 A;  5KE2 A;  2LVM A;  2CKK A;  3DB3 A;  4IUV A;  3OMC A;  3OYL A;  1N27 A;  2MWP A;  3OYM A;  2X4Y A;  3BDL A;  2RHU A;  2M16 A;  2RHI A;  2RHX A;  3PFS A;  3L2Q A;  3MET A;  4B9X A;  3QII A;  4E7J A;  2RI3 A;  3FC3 A;  1OZ3 A; 
#chains in the Genus database with same CATH topology
 2L3S A;  2FHD A;  3OBW A;  5GAN 6;  2WAC A;  3KFV A;  1K4U S;  4M75 G;  3QJ6 A;  1BBZ A;  1UGP B;  2RJD A;  4A4G A;  5D7U A;  3JCM J;  2LT1 A;  2L2P A;  2X3W D;  2O31 A;  3VU3 C;  1QP2 A;  5CQY A;  2FYK A;  4FM4 B;  3OMG A;  5IN1 A;  1I5L A;  2DF6 A;  2DVE A;  3VS6 A;  3X25 B;  1W70 A;  2EKH A;  2DL8 A;  2DEU A;  3EH2 A;  1E7O A;  2VXE A;  4MZT A;  4RTU A;  5C0M A;  3FJ5 A;  2AZS A;  3CCS T;  5GAM h;  3OY9 A;  1N6A A;  3SD4 A;  4JJC A;  2RMO A;  3G4S T;  4BE2 A;  5EG2 A;  3G6E T;  2AT1 B;  4E7H A;  2CDT A;  2EW3 A;  1Q95 G;  4IUT A;  1K8A R;  3VS1 A;  3GOX A;  2KAF A;  2DTO A;  3O8V A;  4FYW B;  4LDX A;  2O4X B;  1X75 C;  2LZ6 B;  1O9S A;  1LVK A;  1SRM A;  5FWB A;  5GAM f;  2NUZ A;  3Q1J A;  4OB1 B;  3ZL7 C;  1RAG B;  3CC4 Q;  1LNX A;  1T3S A;  3N5B B;  2XDB A;  5LJ3 g;  4AFZ C;  2YUQ A;  3V8J A;  5LJ5 h;  3JCM e;  3SWN A;  4CC3 A;  2GNC A;  2CSQ A;  1VQ6 A;  2EWN A;  2EAY A;  4MDX A;  1K9M U;  3G71 T;  4M78 C;  1EIF A;  1VQP T;  3QYG B;  1GBQ A;  2RH2 A;  2BZX A;  1JEG A;  3MP1 A;  5ECA A;  5AYF A;  4JLG A;  2I2L A;  3G71 Q;  5GMK h;  1CKA A;  3PFS A;  4CI0 C;  2O88 A;  5GAN 4;  1K9A A;  4HCC A;  1I0C A;  4EMK C;  4RG8 A;  2NUP B;  3PGG A;  3VYG A;  3QWX X;  2M1H A;  3L2R A;  3M59 A;  2EPD A;  1O75 A;  2MK5 A;  1XNI A;  2JVV A;  5IXB A;  3EGX A;  2JM9 A;  2O9S A;  1M3B A;  5A0G A;  3JRZ A;  5GAO q;  2DIQ A;  4JRQ A;  4FW1 A;  2GGR A;  1KD1 C;  1VQO A;  2OJ2 A;  1OX9 A;  4JUV A;  4X1V A;  3M0R A;  4C8Q F;  1Y7X A;  1N9S A;  1N5Z A;  3TEE A;  1VQK A;  5I22 A;  1QQJ A;  1W2B P;  4M7D A;  5CR2 A;  4M75 F;  2CRE A;  2ED0 A;  4C92 C;  1D1B A;  1WXB A;  2D0Q B;  4QT7 A;  1K8A C;  2K57 A;  4PLI A;  3BW1 A;  2EJG A;  3CD6 T;  4J6X A;  4XTU A;  4C0D C;  4OP0 A;  1Y71 A;  4M7D G;  4E6R A;  3OS5 A;  4DBQ A;  2AKK A;  1PNJ A;  3GIB A;  3DKM A;  2RJE A;  2DZC A;  3CCR A;  1NJI U;  1M90 U;  3HTR A;  1WIE A;  2CS7 A;  1D3B B;  3LLR A;  1NEG A;  5CKB A;  1QCO A;  2DIG A;  3CME A;  3VS3 A;  1VYU A;  2J6O A;  3I35 A;  4AMC A;  3FIF A;  3BDL A;  2CH4 A;  2RHI A;  4B9X A;  3UAT A;  4J5Y A;  1KQS S;  5LJ5 j;  3VRY A;  1KQ2 A;  1D09 B;  4FSX A;  3I56 A;  1OOT A;  3EGD A;  1YN8 A;  3VS4 A;  4J9I A;  5HK3 A;  3MKD A;  3VUB A;  4RKU E;  4C5E A;  3BDU A;  1SHG A;  2CYZ B;  4XAX B;  3OYD A;  5A2Q E;  2F2V A;  2QEX Q;  1HK9 A;  3CCU T;  1TUC A;  2ECZ A;  1BIA A;  4PLL A;  1FXX A;  3P8D A;  2FVU A;  2JS2 A;  4MZP A;  1GCQ A;  2VAS A;  2DL3 A;  4DOW A;  1K73 R;  4M7A A;  1PRL C;  2LJ1 A;  3VV0 A;  3HRT A;  4FU6 A;  3JB9 D;  3OS2 A;  1M3C A;  1ZSZ B;  1TWB A;  3AHU A;  4JJB A;  4MML A;  2LQK A;  1TUG B;  1KSW A;  2CP7 A;  2L8D A;  4QW2 A;  2KBT A;  2KNB B;  1IGQ A;  1UE9 A;  4M7A G;  3EFO B;  5CK9 A;  2JTE A;  3M0Q A;  3RIR A;  2AIR B;  2QGG A;  5J39 A;  2DRM A;  2PUO B;  2RF0 A;  1I8F A;  1YJN T;  1ZA2 B;  3V8L A;  1HD3 A;  3CCJ T;  3L2Z A;  5KYW B;  4LDU A;  1PSE A;  1VQ9 Q;  4IUR A;  1U5S A;  1YJN Q;  1V29 B;  2LNH B;  2HMA A;  1NYG A;  3BY7 A;  2HEQ A;  3OYF A;  2DXT A;  4QKU A;  2IIM A;  3PMI A;  1T0J A;  3JCM W;  1Z9Q A;  2EJF A;  4FL6 A;  5GAN 5;  4C8Q B;  2M0Y A;  2PVG B;  1M1F A;  1Y07 A;  2DO3 A;  1QVP A;  3JCM h;  1NZ9 A;  1M9S A;  5CQX A;  5KYX A;  1X27 A;  1QVF P;  3NGP A;  4F7U A;  4M75 B;  3J80 E;  3VYH B;  4J9G A;  3E19 A;  1WFW A;  2MPX C;  4JJN K;  1KFZ A;  1IGU A;  1PCX A;  2MIO A;  2RI2 A;  3EGU A;  1VQ7 Q;  3CC2 A;  4M7D F;  1D0X A;  1HXD A;  3UF4 A;  3HFO A;  2JM8 A;  3RMS A;  5C6S A;  5D6Y A;  1ZX6 A;  5DM7 R;  1Y57 A;  4RMO A;  2HSE B;  4LD6 A;  4F7U G;  1VQ8 A;  4ME7 A;  1GFC A;  2V8I A;  3CCQ A;  3OW2 P;  2JMC A;  3JCM f;  2Y4X A;  2V1R A;  4X34 A;  4E7S A;  2JUF A;  1NBE B;  3MP6 A;  1GFD A;  2RHY A;  4C8Q E;  4LD9 K;  2J06 A;  5DY9 A;  3PIO A;  4BY6 C;  3NTK A;  5EC7 A;  4GY5 A;  4BDZ A;  3V7C A;  1OI1 A;  1YCY A;  4M75 E;  5GAN e;  5GAN 8;  1V76 A;  3REA B;  1WQW A;  4DBF A;  3OYG A;  2CP0 A;  1OYX A;  1TXQ A;  1YBY A;  2NLU A;  2RQR A;  1MND A;  4J9E A;  4LDV A;  2JJ9 A;  3URG A;  1ABO A;  4AFQ C;  3A5Z B;  2BIV A;  2RPN A;  4O5V A;  1UGV A;  2JS0 A;  2YLC A;  4BD3 A;  2HZY A;  2YLB A;  2O2O A;  2FB7 A;  3GNF B;  1VIF A;  1G83 A;  4ZGE B;  1G5V A;  4DBH A;  3EG3 A;  1YCS B;  4JJD A;  2RQU A;  4KUI A;  1VOM A;  2EYX A;  3H6Z A;  1U8R A;  3SWN B;  4J8O A;  4GLM A;  2W10 A;  2RB6 A;  4PJJ A;  4M7A F;  1YIT A;  3H41 A;  3UDC A;  1KIK A;  2DZ9 A;  5GAN d;  5FRN A;  3BE3 A;  3CCM A;  1BI0 A;  2E1H A;  2ZPF B;  4C5G A;  1C0M A;  3RNJ A;  3L2U A;  1EFN A;  3JV3 A;  1VQ5 T;  2KR3 A;  1ZBJ A;  5DLQ E;  1ARK A;  3ASK A;  1R0B G;  3OYB A;  5LJ5 g;  4F04 B;  5GMK m;  3CCL T;  1TTH B;  1VQ5 Q;  3QG1 A;  2K3Y A;  4LUD A;  1ZBX A;  2MOX A;  5KCH A;  2QQS A;  4R0K A;  3CCL Q;  5M9O A;  1Y96 A;  1WHM A;  2EQI A;  3H9N A;  3T9N A;  2GFA A;  2D8J A;  2LQN A;  2QK0 A;  3CCV T;  3HKS A;  2I0N A;  3A8G B;  2DER A;  4EMH A;  3GNG A;  2CT4 A;  5FRM A;  1BIB A;  2DJZ A;  4JZ3 A;  3FB9 A;  1YHQ A;  4ATO A;  4KUL A;  2NYS A;  2RNA A;  2K7A A;  4LE9 A;  1WXT A;  3RKX A;  4A4F A;  4XK8 E;  3JB9 G;  3NHN A;  3MEW A;  3CCE T;  4KGV B;  2R5A A;  1MMA A;  1D1A A;  3I55 Q;  1X43 A;  4Z89 A;  4M7D B;  2Z0W A;  4F7U F;  4E7L A;  1PKT A;  2F69 A;  4Z88 A;  3FJP A;  2PTK A;  2HNI A;  1M8M A;  2LP5 A;  3ME9 A;  5GMK i;  4OB3 B;  3PNW C;  4M77 C;  2RI5 A;  1X2K A;  2P0P A;  8AT1 B;  4KGX B;  4J9D A;  1D0Y A;  1I81 A;  2DXU A;  2M16 A;  1Q7Y R;  4A53 A;  2RI3 A;  3VRZ A;  4PK4 A;  1PKS A;  3HHT B;  4IIO A;  1Q82 C;  5IHK A;  2LJ0 A;  3REB B;  1K73 U;  2E41 A;  4LDW A;  2X4W A;  1YI2 T;  2FPE A;  4BUG A;  2VWF A;  2JXB A;  1WI7 A;  2GCX A;  2DM1 A;  2LJ3 A;  4J9B A;  3RBB B;  1G2B A;  1M27 C;  4M77 E;  1YI2 Q;  4M7D E;  2DBM A;  5FU7 B;  2F2W A;  2F2X A;  3TCJ A;  3EGD B;  4XU0 A;  1UEC A;  3NTI A;  2EQK A;  2MMP A;  3NPF A;  1VQ4 T;  3OS0 A;  2K79 A;  3RKY A;  1YIJ T;  2IG0 A;  3HL8 A;  2F1L A;  2H8H A;  1LJO A;  2BUD A;  4C0F A;  5KH6 A;  1UUE A;  2EYY A;  1ZQ1 A;  2C0I A;  1TOV A;  4HT9 A;  1EZZ B;  4M7A B;  5CCA A;  1KD1 R;  1YJW T;  4A4E A;  3JCM c;  4CC4 B;  3RER A;  4CC2 A;  3NTH A;  1F1B B;  2YXY A;  3EFR A;  4QVZ A;  1YJW Q;  3OYC A;  2J7I A;  2COZ A;  4M7A D;  3CCS Q;  3CMA T;  7AT1 B;  2X51 A;  1OU8 A;  1V1C A;  3G4S Q;  3CC4 A;  4C0Z A;  1WNL A;  5LL6 S;  3G6E Q;  3CMA Q;  4LUE A;  1QVG A;  1RUW A;  3MCA B;  3OYH A;  5GAN 3;  3CEY A;  2DL5 A;  3EHR A;  3CXC P;  2H3J A;  4IUV A;  3TSZ A;  2FG0 A;  1N27 A;  2V8J A;  1IRE B;  2RHU A;  4OMN A;  4AG1 C;  2PUK B;  3JB9 F;  4J9F A;  1VQL T;  1IZ6 A;  2XD0 A;  2KT1 A;  2YSQ A;  1LCK A;  4ESR A;  4N4H A;  1Q7Y C;  4M7A E;  4E47 A;  4Z8A A;  3G71 A;  3EAE A;  2CP3 A;  1QKW A;  1UDL A;  1NLP C;  1VQL Q;  4FSS A;  1PC0 A;  5GAN f;  4PJO A;  1UFF A;  5KYX B;  5GAO m;  4F7U B;  2EYZ A;  1RL2 A;  1VQP Q;  1QVF S;  2KXC A;  1IXD A;  4M78 D;  5LJ3 d;  2EYW A;  4PKC C;  3HRS A;  5FLX E;  5FU6 B;  4WCI A;  1VQ6 T;  3E9G A;  2JT4 A;  3OYN A;  1WZO A;  4PJO G;  2MI6 A;  2E3I A;  2HAX A;  1X69 A;  3JCM g;  2YUP A;  2DEQ A;  1WA7 A;  1T0H A;  4DQ2 A;  1PD0 A;  2V8K A;  1M8V A;  1G3W A;  2A3L A;  1N8R R;  4OMF B;  4LXC A;  3MEV A;  5AT1 B;  4IUU A;  3OW2 S;  4N0A C;  4XU2 A;  3UPU A;  2QG9 B;  2R57 A;  1SPK A;  4CRI A;  2ROT A;  1B34 A;  2FZG B;  2GQI A;  2QDL A;  2IVW A;  2ED1 A;  2NWM A;  2W0Z A;  1BKB A;  2F5K A;  2PQW A;  1YFN A;  1Q81 R;  4F7U E;  2DNU A;  3J81 E;  2YDL A;  4NS5 A;  3JAM E;  1U3O A;  3M57 A;  1W1F A;  2R5M A;  1VQN T;  1AZG B;  1VQO T;  4DEX A;  5GAM j;  1K0X A;  3QZ5 B;  2E5K A;  2A08 A;  2C0O A;  1VQN Q;  2X4Y A;  1VQK T;  1P92 A;  1M4Z A;  3CD6 Q;  1RAI B;  4RTY A;  3INZ A;  3OYA A;  4OMP A;  3H0I A;  4HCZ A;  1AHJ B;  1IRX A;  1C1A A;  3M53 A;  4JLI A;  3DB4 A;  3QO3 A;  2KI7 A;  2X4X A;  4JRI A;  4QVC A;  2LMJ A;  4BI8 B;  2E12 A;  1WHL A;  3THK A;  2LNV A;  3EHQ A;  3C94 A;  1W4S A;  3QZ9 B;  3CCR T;  2M9U A;  4ELY C;  4K11 A;  2QEX A;  2GFU A;  3M4G A;  4AG2 C;  5D6W A;  2K9G A;  2RM4 A;  1UJ0 A;  3QHS A;  1RAH B;  1OEB A;  1WGS A;  3M54 A;  5GMK j;  1Y96 B;  2P0K A;  2J05 A;  5J3B A;  2NUT B;  1VQM T;  1MNE A;  1N8R C;  3A8H B;  1U1S A;  1GBR A;  3I56 T;  1ZLM A;  2DRK A;  3LGL A;  4XTZ A;  2DKG A;  5IT9 E;  2RN8 A;  3LWI A;  3CCU Q;  3OSS C;  1OQK A;  1VQM Q;  1M1K C;  1TG0 A;  1RAB B;  2D6F A;  1KC8 R;  2HL3 A;  5IXF A;  3M9Q A;  2RA2 A;  5I2M A;  5KYN A;  2DMO A;  2FRW A;  1S1N A;  1ZUU A;  2DAQ A;  1ACM B;  2FPF A;  5CAI A;  1KHC A;  3LYI A;  2G6F X;  1YWP A;  4PFP A;  4PJO F;  1N9R A;  1Q81 C;  3X26 B;  2PVD B;  1I4K 1;  5CKF A;  2DPP B;  2YWW A;  1ABQ A;  1VQ9 A;  2KE9 A;  1VYT A;  1BI1 A;  1YJN A;  4N4I A;  1MMN A;  2QA4 T;  1IHV A;  1ZSZ C;  4D6W A;  1ZSG A;  1PRM C;  2GBQ A;  4D8D A;  3QII A;  2CZ0 B;  1OU9 A;  4FW2 A;  4OMO A;  3QYH B;  2PVO B;  2G3R A;  4LDY A;  1WHK A;  2RK2 A;  3FEO A;  2QA4 Q;  3CBO A;  4FCY A;  2BTT A;  5KYU A;  3RKW A;  3VJP A;  4LN2 A;  5A0D A;  3CCJ Q;  5CKH A;  3I5R A;  1RLP C;  1UEB A;  3PMT A;  2KYB A;  2GTO A;  1KG1 A;  1YJ9 A;  9ATC B;  4M78 A;  1JB0 E;  1JXO A;  2HCK A;  1VQ7 A;  1KD1 U;  3WXM B;  2X35 A;  2RQV A;  1MV0 B;  2VUB A;  1KQS A;  4J9H A;  4F17 A;  4EDU A;  4DOV A;  5FWC A;  5CKD A;  1JJ2 A;  3X28 B;  2DXB A;  1IHW A;  4JS4 A;  5KCO A;  4M78 G;  4EMK A;  2RJC A;  5L8R E;  4C8Q C;  4WF2 A;  3A1P A;  2M0O A;  3RES A;  2KGT A;  2CUB A;  1UGR B;  2EIF A;  1K8A U;  4FT2 A;  2GQV A;  2EGE A;  4RTV A;  3JB9 I;  1NLO C;  4FYX B;  2BKD N;  3S3O A;  4DA4 A;  3KUF A;  2ENM A;  4M75 C;  2HL5 C;  1YP5 A;  2K5I A;  4OML A;  1Q86 C;  3EG2 A;  3O5Z A;  4FYY B;  2LC4 A;  3HSB A;  3CC2 T;  2V1Q A;  4RUG A;  4OMQ A;  1JBM A;  2L0A A;  1M5Q 1;  4R56 A;  3GF5 A;  2OTL T;  2MWO A;  4B6M A;  5I11 A;  1KC8 C;  2COW A;  5HY6 A;  3ZEH A;  4NL3 A;  4J7F A;  4XQ3 A;  5I21 A;  1MHN A;  1VQ8 T;  4XTW A;  2EYQ A;  2OTL Q;  2X9H A;  2FL7 A;  3VS2 A;  4AFS C;  4AFU C;  4AT1 B;  4C92 A;  1NM7 A;  3OS1 A;  2X4J A;  4GBQ A;  4RTT A;  3OMC A;  3OYM A;  1VIE A;  1R8O B;  1E6H A;  2LX9 A;  3FC3 A;  5GAM g;  2F5T X;  2QQA A;  1WJR A;  1D0Z A;  6AT1 B;  4KUD K;  2LX7 A;  4MZM A;  2C0T A;  1EX4 A;  1WDX A;  2EBP A;  4C92 G;  3CXC S;  3JB9 H;  4P5N A;  1ZA1 B;  1K76 A;  1KHI A;  3VS0 A;  2L89 A;  2XI9 A;  3M0P A;  3PVL A;  2WSC E;  3KXT A;  4HVV A;  1XQH A;  1Q82 R;  2C06 A;  2LCS A;  1FMW A;  4C5I A;  3OYI A;  1RLQ C;  5LJ5 e;  2QGF B;  5GAM d;  1VYV A;  1QWE A;  2BE7 D;  3L42 A;  1PM3 A;  4PJO B;  3JSC A;  2OX7 A;  2V26 A;  3QPH A;  4JDS A;  1VQ5 A;  1SSF A;  2A37 A;  3SWN C;  3CCL A;  4Y28 E;  2KYM A;  2KRM A;  4XTV A;  2L3R A;  3LW5 E;  1YIT T;  4PJO D;  2P0Q A;  5IAY A;  2KMT A;  1IB8 A;  3CPF A;  1B7T A;  2L3Q A;  3CCM T;  5J26 A;  2QQB A;  4OF1 A;  3G1J A;  3WVE B;  2OTJ T;  1H92 A;  4ANJ A;  4MMK A;  2MYS A;  4HXJ A;  1CSK A;  2R58 A;  3QJY A;  4ORZ A;  3EGX B;  1G3T A;  2EVR A;  3AT1 B;  2E65 A;  2OTJ Q;  5CKE A;  5LJ5 d;  4L59 A;  1SSH A;  3ZBD A;  2A0F B;  2XIC A;  3C0C A;  2YRC A;  2KVQ G;  3I55 A;  1B34 B;  3CCV Q;  4D8K A;  3PT9 A;  1YWO A;  2CGH A;  3OYY A;  4C5H A;  4M78 F;  1B07 A;  3SB2 A;  4E7I A;  3JCM b;  4RCC A;  2ZPI B;  2XDP A;  4BI4 A;  4E2F B;  2K2V A;  2DA9 A;  2PNI A;  4RTW A;  5KE2 A;  1K9M C;  3DB3 A;  1XOV A;  3QUI A;  3CCE Q;  2ZPH B;  2CP6 A;  2CZ6 B;  2CT3 A;  2QTX A;  3DLL A;  1JO8 A;  1OZ3 A;  1I5O B;  1ZSZ A;  1RAF B;  2HBP A;  4X9D A;  3GP8 A;  2LQ8 A;  1HYO A;  3HP9 A;  3UA7 A;  2DK3 A;  4M7D C;  2ZPE B;  2H3E B;  3C4S A;  3CC7 T;  3I9Q A;  1W6X A;  3M58 A;  1K0S A;  2DET A;  1PD1 A;  3ULR B;  2LRQ A;  3R6N A;  1GCP A;  5I2S A;  4UC4 A;  1BI3 A;  3CC7 Q;  1OX8 A;  1K1Z A;  1M2V A;  2LCC A;  5KYW A;  1YI2 A;  3CPW A;  1UGQ B;  1RAD B;  2KXD A;  1ZUY A;  4R55 A;  4A63 B;  4J6W A;  2SEM A;  4QQG A;  3JB9 J;  1FMV A;  3VS7 A;  3X20 B;  3R6O A;  4RTZ A;  2LDM A;  2K6D A;  2LTO A;  3OSV A;  4A4K A;  3C12 A;  4C8Q A;  2DE0 X;  4C92 F;  3SFM A;  2AKL A;  1RI0 A;  2EFI A;  1AD5 A;  1I07 A;  4PJM A;  3VS5 A;  4PNO A;  3V7S A;  2ESW A;  1SRL A;  3D7S B;  2JN0 A;  1QLY A;  2DD4 A;  3MPU B;  3ER0 A;  2XDD A;  4N4G A;  1S72 T;  2KEA A;  5KYY A;  2A36 A;  1VQ4 Q;  3TQ7 P;  2MCN A;  1YIJ Q;  3H8Z A;  5FU7 C;  2OI3 A;  3M0T A;  1FX7 A;  4BAC A;  1YJW A;  1S72 Q;  3CQT A;  4X9C A;  4Q5W A;  3JCM X;  1PSF A;  3EG1 A;  4E7Z A;  2XID A;  3PTA A;  4YTL A;  3CCS A;  1WHJ A;  1FYN A;  2KT8 A;  4OB0 B;  2ZPG B;  2DTI A;  3G4S A;  1NJI C;  1M90 C;  2B8A A;  3M5A A;  3G6E A;  3CMA A;  2CP5 A;  2QXF A;  1GCQ C;  1W2B A;  2RHX A;  2E64 A;  4M7A C;  2DYI A;  2DXC A;  2K4Y A;  1JU5 C;  1BI2 A;  4JRK A;  2KRS A;  1CKB A;  1TU0 B;  5LJ3 e;  5GAO r;  5GAN h;  2OAU A;  1RAC B;  2E5Q A;  3GPL A;  2CUD A;  4XTX A;  2JOY A;  4ZN1 A;  1HSQ A;  3MHX A;  4BDY A;  5KYU B;  3QKJ A;  2YUO A;  1VQL A;  3ZFJ A;  4J6Y A;  2Y4Y A;  1MV3 A;  4WTO B;  3CC4 T;  2P84 A;  1QP3 A;  1GRI A;  3A8O B;  1AEY A;  2JW4 A;  4J83 A;  4M78 B;  1VQP A;  3JCM P;  3EG0 A;  3P8H A;  3OB9 A;  2E3H A;  4XTY A;  2ZPB B;  4ZTF A;  1NEB A;  4PFZ A;  4KGZ B;  4EIK A;  4C0G A;  1MMG A;  1RAE B;  3VUZ A;  2WSE E;  3EFS A;  4EMK B;  3M55 A;  3CPW P;  2A28 A;  2RO0 A;  2XG8 D;  5GAN 2;  2FZC B;  4FYV B;  4BE0 A;  1AOJ A;  2KRO A;  1X6G A;  2FO0 A;  2SRC A;  1VQ6 Q;  4NOY A;  3QXE B;  1WHG A;  1NG2 A;  3FRN A;  4OGC A;  3JCM V;  2AHJ B;  1M1K R;  5IHN A;  5GAO l;  5FU6 C;  2GF7 A;  3MP8 A;  5LJ5 f;  4A54 A;  1ZHI A;  1RAA B;  2JTM A;  3U23 A;  5GAO p;  1SHF A;  4M78 E;  3EG9 A;  1UG1 A;  3JCM d;  1Q82 U;  4OB2 B;  2MWP A;  1SF9 A;  2QDY B;  4JS5 A;  2D1X A;  1SKU B;  1X2Q A;  3PVQ A;  1M2O A;  2ABL A;  3TSW A;  1TSF A;  2YRV A;  4Y92 A;  4C92 B;  1VQN A;  2HQH A;  1I1J A;  2DL7 A;  2EGC A;  3E2U A;  3RDV A;  2EQJ A;  1JXM A;  2EGA A;  1DJ7 B;  3CD6 A;  3J7A F;  2DBK A;  2XHC A;  4KT0 E;  2COY A;  2KRN A;  4C0D B;  1YNZ A;  4BB7 A;  3OYJ A;  5CVI A;  1T3L A;  1VQO Q;  4C92 D;  4M77 A;  2VGM A;  1X6B A;  2CZ1 B;  1R77 A;  3TRE A;  2VYT A;  4B9W A;  2VKN A;  3GBQ A;  2L3P A;  2QTV A;  4NL2 A;  2BE9 B;  4KH0 B;  2LT4 A;  2ROL A;  2YUN A;  1VQK Q;  3C95 A;  1G3Y A;  1QVG P;  1AWO A;  3FDR A;  5GAN j;  2MAM A;  1X6O A;  3QWY A;  3RR6 A;  2CZ7 B;  2IPO B;  3NMZ C;  2X3X D;  4M4Z A;  1NYF A;  2WSF E;  4M77 G;  2E4H A;  2FPD A;  2ZGW A;  2DVJ A;  1QCF A;  2EQU A;  1QVF A;  3UWN A;  3OBY A;  4GLK A;  4V2S A;  4L6V 5;  4C92 E;  2QI2 A;  1PHT A;  1KQ1 A;  3RMQ A;  2K2M A;  3NFC A;  3P8B B;  1AT1 B;  3CCR Q;  1X01 A;  3CME T;  1GXI E;  3CCU A;  1QWF A;  1VQM A;  3PE0 A;  5HKC A;  3M56 A;  3QBY A;  2XK0 A;  3HFN A;  2VGN A;  1Q86 R;  3OW2 A;  3CME Q;  1JJ2 S;  4CC7 A;  2M02 A;  1M30 A;  2QEX T;  4TVR A;  4J9C A;  5D6X A;  2LQW A;  2FEI A;  2VV5 A;  2E6N A;  1LOJ A;  3S3N A;  1XTD A;  1M1G A;  2ATC B;  3I56 Q;  2KK4 A;  2PU9 B;  1Q7Y U;  3X24 B;  3SHW A;  3MET A;  5FW9 A;  2HKQ B;  1AWW A;  4JRP A;  4PJN A;  3BFM A;  1Z9Z A;  4BE1 A;  3MEA A;  1J3T A;  2EJ9 A;  3OQ5 A;  4KH1 B;  1FMK A;  3H0H A;  2RQW A;  2D0N A;  5CIU A;  2QA4 A;  2JZ2 A;  1BCO A;  2JTF A;  2EKO A;  3CCJ A;  2E10 A;  3LX7 A;  1QKX A;  2PZ1 A;  1H3H A;  1U1T A;  3E9F A;  1MUZ A;  5LJ3 h;  2DJQ A;  3L2V A;  1VQ9 T;  3KBG A;  4ZGD B;  2O4X A;  2KDS A;  2QQR A;  1M2V B;  2E70 A;  4ELZ C;  5DLO A;  2CSI A;  3MO8 A;  1SG5 A;  1FWZ A;  4XU1 A;  4PFO A;  1LPL A;  2ZZD A;  1PG5 B;  4RCB A;  1H3Z A;  2P4T A;  4A4H A;  5A0L A;  1QCN A;  2RHZ A;  5GJW B;  2LCL A;  4EMG A;  5LJ3 f;  1AVZ C;  4XU3 A;  2XU8 A;  5L23 A;  5IHI A;  1YJ9 T;  4IUP A;  1OZ2 A;  4PL6 A;  2K5F A;  1BCM A;  3A8M B;  5GJV B;  1UB4 A;  1VA7 A;  1AWX A;  2DL4 A;  3H0F A;  1VQ7 T;  2HQE A;  1KJW A;  1WJS A;  4DBR A;  1KK7 A;  1YJ9 Q;  4J7I A;  2D8H A;  1TS9 A;  2VB6 A;  4Y91 A;  3CBM A;  1JQQ A;  1UHF A;  1WX6 A;  2KSS A;  4OMM A;  5KYY B;  2K5L A;  4E7K A;  4C8Q D;  4HVU A;  4M77 F;  1R0C B;  2P4R A;  3V8K A;  4N0A A;  3LGF A;  1UTI A;  2OTL A;  1G3S A;  1OV3 A;  4VUB A;  2NUP A;  4M75 D;  2HBW A;  1MGQ A;  4MDW A;  3CC2 Q;  3WVD B;  4BY6 B;  3CCQ T;  3HRU A;  2KQW A;  2QYZ A;  4Z02 A;  5GAM e;  1VQ8 Q;  1H64 1;  1K9M R;  2DD5 A;  3QSU A;  4OVA A;  4EPC A;  3CCQ Q;  1K73 C;  4IIM A;  2O01 E;  1BYM A;  1RI9 A;  2JNG A;  3V7R A;  4ZN3 A;  5KE3 A;  3L2W A;  1UHC A;  2HSP A;  2EQM A;  2RQT A;  5GAN 7;  4OGE A;  4II1 A;  1IO6 A;  3EH1 A;  2HDA A;  2DIL A;  1AWJ A;  2L5Q A;  3A8L B;  4QQD A;  2QAS A;  2QQ9 A;  3FLG A;  3M4Y A;  4F16 A;  1N8R U;  3LH0 A;  2ZAE A;  2HKN A;  1TUD A;  2AZV A;  1BK2 A;  1JRI A;  4ZNX A;  4KBM B;  3RUX A;  5GAN g;  1M1K U;  5FRO A;  3F70 A;  2Y90 A;  3LWH A;  1C6V X;  3L1A A;  5LJ3 j;  1BU1 A;  1WQ7 A;  1WYX A;  2YRD A;  4HCK A;  3LH5 A;  1E6G A;  1NPR A;  1AZE A;  3PIP A;  3S6W A;  3A98 A;  3SEM A;  1G8X A;  1D3B A;  3GLX A;  1GL5 A;  1Q81 U;  5GMK e;  2BZ8 A;  1WLP B;  1WPY A;  2K3B A;  3S3M A;  3CPW S;  4PJL A;  1KQS P;  4PJO C;  2OTJ A;  1NE8 A;  2MF2 A;  1YIT Q;  1JJ2 P;  2A7Y A;  1XJW B;  1NPP A;  2DFU A;  4HVW A;  3UT1 A;  4ZGJ B;  2ZCF B;  4HT8 A;  3M0S A;  2FZK B;  2RJF A;  2VXF A;  3VKI A;  3OYK A;  3CCV A;  1D1C A;  4DEY A;  2QAZ A;  3OA6 A;  3CCM Q;  2LVM A;  3OYL A;  5IH2 A;  1M3A A;  2DX1 A;  2JMA A;  1OUL A;  2CP2 A;  4L5G A;  4JPB W;  4FIB A;  3SDZ A;  5HK0 A;  1QMC A;  5GMK l;  2NUT A;  3CCE A;  3EG9 B;  1NJI R;  1M90 R;  2BZY A;  3I5S A;  4PJO E;  1MMD A;  4BI3 A;  1UGS B;  1VUB A;  2KY9 A;  2YHT A;  3G7Z A;  1OPK A;  3CBP A;  2RK1 A;  8ATC B;  4IKF A;  2VVK A;  3I55 T;  2D9T A;  4JZ4 A;  1WJQ A;  3DLM A;  1A0N B;  1ZUK A;  1YHQ T;  3UA6 A;  2XKO C;  4FT4 A;  3HPW A;  3CXC A;  4M77 B;  2HQX A;  1WHH A;  1Y0M A;  3CC7 A;  4KRT A;  2B86 A;  1YHQ Q;  3EFO A;  1U06 A;  2M51 A;  1W2B S;  3E1S A;  2FRY A;  2DTH A;  3M0U A;  1WXU A;  4QVD A;  1B3Q A;  5CO7 A;  1Q86 U;  4O6J A;  1SEM A;  4M77 D;  3IQL A;  4M7D D;  1QVG S;  2RD1 A;  2OAW A;  1TH7 A;  2E6Z A;  3MJX A;  4HKE A;  2J6F A;  3MEU A;  3TVT A;  1KC8 U;  1QW1 A;  1H8K A;  3OYE A;  2XMF A;  4QQ6 A;  4HCB A;  2VC8 A;  5HCK A;  3JCM Q;  4LNP A;  3TU4 K;  2DLP A;  2DYB A;  3QDR B;  5GAO n;  4F14 A;  1OPL A;  1VQ4 A;  4RTX A;  1YIJ A;  2YT6 A;  3QDF A;  2HD0 A;  1PWT A;  2K3X A;  1S72 A;  4ZTJ A;  2J6K A;  4M75 A;  4IUQ A;  2O9V A;  2CKK A;  1BB9 A;  1UJY A;  1HJD A;  3L2Q A;  4C8Q G;  2GTJ A;  4E7J A;  2CH4 W;  2AK5 A;  4HA8 A;  4RG2 A; 
#chains in the Genus database with same CATH homology
 2G3R A;  4LDY A;  2DZ9 A;  5GAN d;  2RK2 A;  2YRV A;  3FEO A;  4C92 B;  5FRN A;  3CBO A;  3CCM A;  2FHD A;  3OBW A;  1VQN A;  1BI0 A;  2E1H A;  3RKW A;  3VJP A;  5GAN 6;  5A0D A;  2ZPF B;  2WAC A;  2EQJ A;  4C5G A;  5CKH A;  3L2U A;  4M75 G;  1DJ7 B;  3QJ6 A;  3CD6 A;  3OW2 S;  3J7A F;  1UEB A;  3PMT A;  1VQ5 T;  1UGP B;  2RJD A;  5DLQ E;  4A4G A;  3JCM J;  2LT1 A;  3ASK A;  1KG1 A;  3OYB A;  1YJ9 A;  2XHC A;  4KT0 E;  4C0D B;  5LJ5 g;  4BB7 A;  3VU3 C;  3OYJ A;  5CVI A;  1QP2 A;  5CQY A;  2FYK A;  4FM4 B;  4M78 A;  4C92 D;  3OMG A;  5IN1 A;  5GMK m;  4M77 A;  2VGM A;  3CCL T;  1I5L A;  1JB0 E;  2CZ1 B;  2DVE A;  3X25 B;  1VQ7 A;  3QG1 A;  2K3Y A;  1KD1 U;  3WXM B;  3TRE A;  2VYT A;  2X35 A;  1ZBX A;  5KCH A;  4B9W A;  2QQS A;  2VUB A;  1KQS A;  4NL2 A;  2VXE A;  4MZT A;  5C0M A;  4EDU A;  2LT4 A;  4DOV A;  3CCS T;  5CKD A;  5M9O A;  1JJ2 A;  1Y96 A;  3C95 A;  5GAM h;  1G3Y A;  3FDR A;  5GAN j;  2MAM A;  1N6A A;  1X6O A;  3SD4 A;  3T9N A;  2GFA A;  3X28 B;  3OY9 A;  2CZ7 B;  2DXB A;  4JS4 A;  5KCO A;  3HKS A;  4M78 G;  4EMK A;  3G4S T;  2RJC A;  4M77 G;  2WSF E;  3A8G B;  4WF2 A;  5L8R E;  4C8Q C;  2ZGW A;  4EMH A;  5EG2 A;  3G6E T;  2M0O A;  3GNG A;  4E7H A;  3RES A;  1YIJ A;  1UGR B;  2EIF A;  1K8A U;  4FT2 A;  5FRM A;  2GQV A;  4IUT A;  2EQU A;  1BIB A;  1QVF A;  3JB9 I;  3GOX A;  2DJZ A;  2KAF A;  2DTO A;  3FB9 A;  3OBY A;  2BKD N;  3UWN A;  3S3O A;  4DA4 A;  1YHQ A;  3KUF A;  4KUL A;  3O8V A;  4M75 C;  4ATO A;  4GLK A;  2K5I A;  4V2S A;  4L6V 5;  4LDX A;  3RKX A;  1Q86 C;  4A4F A;  2O4X B;  4XK8 E;  1X75 C;  4C92 E;  1O9S A;  3MEW A;  3JB9 G;  3CCE T;  2LC4 A;  3HSB A;  2QI2 A;  2R5A A;  3CC2 T;  1KQ1 A;  4M7D B;  3RMQ A;  5GAM f;  3Q1J A;  3NFC A;  3P8B B;  4OB1 B;  4F7U F;  4E7L A;  1JBM A;  1M5Q 1;  2F69 A;  4R56 A;  1X01 A;  3CME T;  3GF5 A;  1GXI E;  2OTL T;  1LNX A;  2MWO A;  3CCU A;  1VQM A;  1KC8 C;  5HY6 A;  3FJP A;  3N5B B;  2XDB A;  3ZEH A;  5LJ3 g;  5HKC A;  3M56 A;  3QBY A;  4NL3 A;  2XK0 A;  4J7F A;  4XQ3 A;  3V8J A;  1MHN A;  5I21 A;  3HFN A;  5LJ5 h;  2HNI A;  2VGN A;  3JCM e;  3SWN A;  3OW2 A;  4XTW A;  2EYQ A;  1JJ2 S;  5LJ5 f;  1M8V A;  2FL7 A;  3ME9 A;  1VQ6 A;  5GMK i;  2QEX T;  2EWN A;  2EAY A;  4TVR A;  4OB3 B;  5D6X A;  4MDX A;  1K9M U;  3PNW C;  3G71 T;  4M78 C;  4M77 C;  1EIF A;  1VQP T;  3QYG B;  2RI5 A;  2RH2 A;  2VV5 A;  2E6N A;  1LOJ A;  4C92 A;  3S3N A;  1XTD A;  2P0P A;  1M1G A;  3OS1 A;  3MP1 A;  2X4J A;  2KK4 A;  5AYF A;  1I81 A;  3OMC A;  4JLG A;  2I2L A;  2PU9 B;  3OYM A;  1VIE A;  2DXU A;  5GMK h;  2M16 A;  3PFS A;  3X24 B;  4CI0 C;  1Q7Y U;  1R8O B;  3MET A;  4A53 A;  2LX9 A;  2RI3 A;  5GAN 4;  3FC3 A;  5GAM g;  4HCC A;  2F5T X;  3HHT B;  1Q82 C;  2QQA A;  4JRP A;  1WJR A;  3BFM A;  1N8R U;  4EMK C;  4MZM A;  4KUD K;  1K73 U;  2E41 A;  4LDW A;  2X4W A;  1YI2 T;  4RG8 A;  4BUG A;  4C92 G;  3CXC S;  4BE1 A;  3MEA A;  3JB9 H;  2EJ9 A;  3PGG A;  4P5N A;  3VYG A;  2M1H A;  3OQ5 A;  3L2R A;  2GCX A;  1KHI A;  3M59 A;  2L89 A;  5CIU A;  2XI9 A;  1O75 A;  2QA4 A;  2WSC E;  4M77 E;  1XNI A;  3KXT A;  4M7D E;  2JZ2 A;  2JTF A;  2EKO A;  3CCJ A;  1XQH A;  2JVV A;  5FU7 B;  2C06 A;  2E10 A;  4C5I A;  3OYI A;  3LX7 A;  3TCJ A;  4XU0 A;  3NTI A;  2EQK A;  5A0G A;  5LJ5 e;  5GAM d;  2MMP A;  3JRZ A;  5GAO q;  2DIQ A;  4JRQ A;  1U1T A;  3E9F A;  3L42 A;  3OS0 A;  1VQ4 T;  4PJO B;  3JSC A;  3RKY A;  1YIJ T;  1KD1 C;  1VQO A;  5LJ3 h;  3QPH A;  2IG0 A;  4JUV A;  3HL8 A;  4JDS A;  1VQ5 A;  3L2V A;  1SSF A;  1VQ9 T;  1LJO A;  2BUD A;  4C8Q F;  1Y7X A;  4C0F A;  5KH6 A;  3KBG A;  3SWN C;  4ZGD B;  1N9S A;  2O4X A;  2KDS A;  2QQR A;  1ZQ1 A;  3TEE A;  3CCL A;  2E70 A;  4Y28 E;  4XTV A;  1VQK A;  2L3R A;  4ELZ C;  3LW5 E;  4HT9 A;  1YIT T;  4PJO D;  4RG2 A;  4M7D A;  5DLO A;  5CR2 A;  2P0Q A;  4M7A B;  5CCA A;  5IAY A;  3MO8 A;  4M75 F;  1FWZ A;  4XU1 A;  4A4E A;  1YJW T;  2KMT A;  4RCB A;  2ZZD A;  3JCM c;  4C92 C;  3RER A;  1H3Z A;  3CPF A;  2D0Q B;  1K8A C;  3CCM T;  2K57 A;  5J26 A;  3NTH A;  2P4T A;  2QQB A;  3EFR A;  4OF1 A;  4PLI A;  3WVE B;  2OTJ T;  4A4H A;  5A0L A;  3BW1 A;  4QVZ A;  4MMK A;  2EJG A;  2RHZ A;  2LCL A;  3CD6 T;  4J6X A;  2R58 A;  3QJY A;  4EMG A;  4XTU A;  5LJ3 f;  3OYC A;  1G3T A;  4XU3 A;  2XU8 A;  4C0D C;  1YJ9 T;  4M7A D;  4IUP A;  2E65 A;  4OP0 A;  1OZ2 A;  1Y71 A;  4PL6 A;  5CKE A;  2K5F A;  5LJ5 d;  4M7D G;  3OS5 A;  4L59 A;  3A8M B;  3CMA T;  1UB4 A;  3ZBD A;  2XIC A;  3GIB A;  2KVQ G;  1VQ7 T;  2HQE A;  1WJS A;  3DKM A;  3I55 A;  1B34 B;  4J7I A;  2RJE A;  2DZC A;  4Y91 A;  3PT9 A;  3CC4 A;  3CBM A;  4C0Z A;  2KSS A;  3CCR A;  1WNL A;  2CGH A;  3OYY A;  5LL6 S;  4C5H A;  1QVG A;  2K5L A;  1NJI U;  4E7K A;  4C8Q D;  1M90 U;  4M78 F;  4M77 F;  3SB2 A;  4E7I A;  3MCA B;  2CS7 A;  3JCM b;  4RCC A;  2ZPI B;  1D3B B;  3OYH A;  5GAN 3;  3LLR A;  5CKB A;  4N0A A;  3V8K A;  2XDP A;  3CEY A;  4BI4 A;  2K2V A;  3LGF A;  2DIG A;  2H3J A;  3CME A;  2OTL A;  1G3S A;  5KE2 A;  4IUV A;  3DB3 A;  1K9M C;  4VUB A;  1N27 A;  2V8J A;  1XOV A;  1IRE B;  3QUI A;  3FIF A;  3BDL A;  2RHU A;  1MGQ A;  2RHI A;  2ZPH B;  4M75 D;  2CZ6 B;  2QTX A;  4B9X A;  3DLL A;  4MDW A;  3WVD B;  4J5Y A;  1KQS S;  4BY6 B;  2PUK B;  3JB9 F;  5LJ5 j;  1IZ6 A;  1OZ3 A;  1VQL T;  1KQ2 A;  2XD0 A;  4FSX A;  3I56 A;  4N4H A;  3CCQ T;  1Q7Y C;  4M7A E;  3HRU A;  4E47 A;  2KQW A;  3G71 A;  2HBP A;  3EAE A;  4X9D A;  2LQ8 A;  3GP8 A;  4Z02 A;  5GAM e;  3HP9 A;  5HK3 A;  1H64 1;  2DD5 A;  2DK3 A;  3QSU A;  2ZPE B;  4M7D C;  1Q81 C;  4OVA A;  4EPC A;  3VUB A;  4RKU E;  5GAN f;  4C5E A;  3C4S A;  1K73 C;  3BDU A;  3CC7 T;  2CYZ B;  4PJO A;  2O01 E;  4XAX B;  3OYD A;  1BYM A;  5A2Q E;  3M58 A;  5GAO m;  4F7U B;  1HK9 A;  2JNG A;  3CCU T;  1RL2 A;  3V7R A;  1BIA A;  4ZN3 A;  2LRQ A;  4PLL A;  1QVF S;  5I2S A;  4UC4 A;  4M78 D;  1BI3 A;  5KE3 A;  5LJ3 d;  1FXX A;  3L2W A;  3P8D A;  4PKC C;  3HRS A;  5FLX E;  2FVU A;  2LCC A;  4MZP A;  5FU6 B;  1YI2 A;  2EQM A;  5GAN 7;  3CPW A;  1UGQ B;  3E9G A;  4OGE A;  4II1 A;  1VQ6 T;  3OYN A;  4DOW A;  4M7A A;  4R55 A;  4PJO G;  4J6W A;  2MI6 A;  2L5Q A;  3A8L B;  4QQD A;  2HAX A;  3JCM g;  4QQG A;  2DEQ A;  2QQ9 A;  3FLG A;  3M4Y A;  3VV0 A;  4DQ2 A;  3JB9 J;  3HRT A;  2V8K A;  3LH0 A;  4FU6 A;  3R6O A;  3X20 B;  3OS2 A;  3JB9 D;  2LDM A;  1G3W A;  2A3L A;  4OMF B;  3AHU A;  2LTO A;  3MEV A;  4MML A;  4IUU A;  3OSV A;  1JRI A;  4A4K A;  2LQK A;  3C12 A;  4KBM B;  3RUX A;  4C8Q A;  4C92 F;  2L8D A;  3SFM A;  5FRO A;  4N0A C;  5GAN g;  1M1K U;  3F70 A;  2Y90 A;  1RI0 A;  2EFI A;  4QW2 A;  3LWH A;  4XU2 A;  3UPU A;  4M7A G;  2R57 A;  3CCV T;  5CK9 A;  4PNO A;  3V7S A;  3RIR A;  3L1A A;  5LJ3 j;  4CRI A;  1WQ7 A;  2JN0 A;  2DD4 A;  1B34 A;  5J39 A;  2PUO B;  3ER0 A;  1NPR A;  2XDD A;  4N4G A;  1S72 T;  3PIP A;  3S6W A;  2IVW A;  1I8F A;  1YJN T;  3H8Z A;  1D3B A;  3V8L A;  3GLX A;  1BKB A;  2F5K A;  5FU7 C;  3CCJ T;  2PQW A;  5GMK e;  3L2Z A;  1FX7 A;  1Q81 U;  4LDU A;  1PSE A;  4BAC A;  4F7U E;  4IUR A;  1YJW A;  1WPY A;  4X9C A;  4Q5W A;  3JCM X;  3S3M A;  3J81 E;  1PSF A;  3CPW S;  4NS5 A;  1V29 B;  3JAM E;  2XID A;  3M57 A;  3PTA A;  4YTL A;  3CCS A;  4PJO C;  2OTJ A;  1NE8 A;  2R5M A;  1VQN T;  3BY7 A;  3OYF A;  1VQO T;  2MF2 A;  2DXT A;  4OB0 B;  5GAM j;  2A7Y A;  1NPP A;  3UT1 A;  4ZGJ B;  4HT8 A;  3PMI A;  2ZCF B;  3JCM W;  2ZPG B;  2RJF A;  2EJF A;  2DTI A;  2VXF A;  3QZ5 B;  3VKI A;  3OYK A;  3G4S A;  3CCV A;  1NJI C;  4FL6 A;  1M90 C;  2B8A A;  5GAN 5;  4C8Q B;  3OA6 A;  3M5A A;  2LVM A;  2PVG B;  1M1F A;  3G6E A;  1Y07 A;  3OYL A;  3CMA A;  2X4Y A;  2QXF A;  1W2B A;  1VQK T;  2RHX A;  2DO3 A;  1P92 A;  1M4Z A;  2E64 A;  1QVP A;  4M7A C;  3JCM h;  4L5G A;  1NZ9 A;  1M9S A;  5CQX A;  2DXC A;  2K4Y A;  4FIB A;  3INZ A;  1BI2 A;  3OYA A;  3SDZ A;  4F7U A;  4M75 B;  5HK0 A;  3VYH B;  3J80 E;  4JRK A;  3E19 A;  5GMK l;  3CCE A;  4JJN K;  5LJ3 e;  5GAO r;  5GAN h;  2OAU A;  2RI2 A;  4M7D F;  4HCZ A;  3CC2 A;  2E5Q A;  3GPL A;  4PJO E;  1AHJ B;  4BI3 A;  3M53 A;  4JLI A;  4XTX A;  1UGS B;  3DB4 A;  1HXD A;  1VUB A;  2KY9 A;  2JOY A;  3HFO A;  3RMS A;  2YHT A;  3QO3 A;  2X4X A;  4ZN1 A;  5C6S A;  3G7Z A;  4JRI A;  4QVC A;  3MHX A;  4BDY A;  4BI8 B;  2E12 A;  5D6Y A;  3CBP A;  5DM7 R;  3QKJ A;  4RMO A;  2RK1 A;  1VQL A;  4LD6 A;  3ZFJ A;  4F7U G;  4ME7 A;  1VQ8 A;  4IKF A;  2V8I A;  2Y4Y A;  4J6Y A;  2D9T A;  3I55 T;  1WJQ A;  2LNV A;  3DLM A;  3CCQ A;  3C94 A;  3CC4 T;  1W4S A;  3QZ9 B;  1YHQ T;  3CCR T;  2M9U A;  3JCM f;  4ELY C;  1QP3 A;  2QEX A;  2Y4X A;  2GFU A;  2XKO C;  3A8O B;  4X34 A;  4FT4 A;  3M4G A;  4J83 A;  3HPW A;  4M78 B;  1VQP A;  3CXC A;  4M77 B;  3JCM P;  2HQX A;  2JUF A;  3P8H A;  5D6W A;  3CC7 A;  2RM4 A;  3OB9 A;  3MP6 A;  3QHS A;  1W2B S;  2RHY A;  3E1S A;  4XTY A;  2DTH A;  1WGS A;  2ZPB B;  4ZTF A;  3M54 A;  4C8Q E;  4QVD A;  4LD9 K;  5GMK j;  1Y96 B;  2P0K A;  5CO7 A;  4O6J A;  5DY9 A;  5J3B A;  3PIO A;  1VQM T;  1Q86 U;  4BY6 C;  3NTK A;  4C0G A;  1N8R C;  4M77 D;  3A8H B;  1U1S A;  3VUZ A;  2WSE E;  2RD1 A;  4GY5 A;  3V7C A;  4BDZ A;  3EFS A;  3I56 T;  1QVG S;  4M7D D;  3LGL A;  4XTZ A;  4EMK B;  2DKG A;  3M55 A;  1TH7 A;  3LWI A;  2E6Z A;  3OSS C;  4HKE A;  1OI1 A;  5IT9 E;  2RO0 A;  1YCY A;  2XG8 D;  1M1K C;  4M75 E;  5GAN e;  5GAN 2;  3MEU A;  5GAN 8;  4BE0 A;  1WQW A;  1KC8 U;  3OYG A;  2D6F A;  1QW1 A;  3M9Q A;  1OYX A;  3OYE A;  2RA2 A;  1YBY A;  2NLU A;  4QQ6 A;  4NOY A;  5I2M A;  4HCB A;  2VC8 A;  4LDV A;  2DAQ A;  3JCM Q;  3URG A;  3TU4 K;  3QXE B;  3A5Z B;  3FRN A;  2BIV A;  4OGC A;  3JCM V;  2AHJ B;  4O5V A;  5CAI A;  1KHC A;  3LYI A;  2YLC A;  3QDR B;  4BD3 A;  5GAO n;  4PJO F;  1VQ4 A;  1N9R A;  2YLB A;  5GAO l;  5FU6 C;  2FB7 A;  2GF7 A;  3GNF B;  3MP8 A;  1VIF A;  2PVD B;  3X26 B;  1I4K 1;  5CKF A;  4A54 A;  1ZHI A;  2DPP B;  2HD0 A;  4ZGE B;  2JTM A;  5GAO p;  1G5V A;  1VQ9 A;  2K3X A;  1S72 A;  4ZTJ A;  1BI1 A;  4KUI A;  4M75 A;  1YJN A;  4M78 E;  3H6Z A;  4IUQ A;  4N4I A;  1U8R A;  3SWN B;  4J8O A;  2CKK A;  3JCM d;  4BE2 A;  1Q82 U;  4OB2 B;  2QA4 T;  2MWP A;  1VQ8 T;  2QDY B;  2RB6 A;  4D6W A;  3L2Q A;  4C8Q G;  4M7A F;  1YIT A;  4JS5 A;  3QII A;  2CZ0 B;  4E7J A;  4HA8 A;  3QYH B;  3UDC A;  2PVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...