3E9FA

Crystal structure short-form (residue1-113) of eaf3 chromo domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
99
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNKEIKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Chromatin modification-related protein EAF3
total genus 19
structure length 99
sequence length 109
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9fA00
4E7IA 2BKDN 4IUUA 4IUQA 4A4GA 5IN1A 4B9XA 3OS1A 3LX7A 3OYDA 3L2WA 4E7JA 4E7KA 4C5EA 4GY5A 2O4XA 4C5IA 2L3RA 2LRQA 2DIQA 3CEYA 2VYTA 4QVZA 3FC3A 2X35A 5KE2A 3OYNA 3EAEA 5KCOA 4BE0A 2R57A 5IAYA 3MEVA 3BDLA 2IG0A 4Q5WA 3MEAA 4UC4A 3H6ZA 3DB3A 2RHIA 2EFIA 2RJDA 5KE3A 2RJEA 5FROA 2XK0A 2BIVA 3LH0A 2YRVA 3PNWC 3ZEHA 4A4EA 1RI0A 2M1HA 1MHNA 3S3NA 2GFAA 4PLLA 3E9GA 3S6WA 4FU6A 2X4WA 3OYJA 2QQSA 2DIGA 2RJCA 4EDUA 4E7LA 1OZ2A 2CKKA 4QQDA 2K3YA 2PQWA 5J39A 2RHUA 3OA6A 2XDPA 5D6YA 3F70A 3LGLA 3OQ5A 2EKOA 2NLUA 4L59A 3MO8A 3GOXA 4PL6A 3OS2A 3OS0A 3L2VA 2X4YA 2L89A 3S3MA 1WGSA 3P8HA 1OI1A 2RJFA 2RI3A 3OYKA 2D9TA 4PLIA 4IUPA 2QQRA 3O8VA 3UWNA 3LYIA 3OYCA 1OZ3A 3OB9A 2E6NA 4FL6A 4N4IA 2DAQA 2JTFA 3LLRA 3OYMA 4A4FA 5D6WA 3MP1A 2JZ2A 3DLMA 2RO0A 4BE2A 5FRNA 3C4SA 2L8DA 1OYXA 2EQKA 5C0MA 3QIIA 5M9OA 2RHYA 4QW2A 3QKJA 2MWPA 3META 3OMGA 2R5MA 2P0KA 5D6XA 3PMTA 3OYBA 3OYAA 1KHCA 3KUFA 2G3RA 2LCCA 3M9QA 3P8DA 4IURA 4Z02A 3SD4A 4NS5A 5CIUA 3PFSA 4CRIA 3OY9A 3OYIA 4BE1A 3MEUA 4OVAA 4A4HA 3PMIA 3UT1A 4C5GA 2B8AA 1WJSA 3H8ZA 2EQUA 2HQXA 3E9FA 3QJ6A 4B9WA 4BDYA 4QQGA 2LDMA 5J26A 4X34A 2WACA 3DB4A 2RI5A 3S3OA 3FLGA 2F5KA 2GFUA 2GF7A 4BD3A 4HCZA 4IKFA 2R58A 3NTKA 1XNIA 5KH6A 2RI2A 4IUVA 3L2RA 4BDZA 3NTIA 4E7HA 2LTOA 2RHXA 3MP6A 2BUDA 1N27A 2EQMA 3L42A 3MEWA 3L2UA 3FEOA 3OMCA 4LD6A 4QQ6A 1H3ZA 1WJRA 2K3XA 2EQJA 2X4XA 4N4GA 1G5VA 2FHDA 1WJQA 3L2QA 5FRMA 3OYFA 4ZTFA 3Q1JA 2HQEA 4II1A 2MWOA 5KCHA 3ASKA 3LGFA 3ME9A 4C5HA 3OYEA 2LVMA 3QBYA 3OYLA 5C6SA 4IUTA 2M16A 2O4XB 3NTHA 4RG2A 3MP8A 2E5QA 2RHZA 4ZTJA 3OYGA 3FDRA 2M0OA 2R5AA 1SSFA 4BACA 4N4HA 3OYHA
chains in the Genus database with same CATH superfamily
4E7IA 4IUQA 5FU7B 1SRMA 1WLPB 4C5EA 4Z89A 2CT4A 1VQ5Q 4M78D 5GAMg 3M0RA 5KE2A 4PNOA 4BE0A 2VV5A 2CH4W 2EIFA 3R6NA 3LW5E 1LCKA 1RAHB 2CSQA 2KXCA 5GANd 2A36A 2RJEA 5CKEA 3A5ZB 4A4EA 1RI0A 5I2SA 3CCJA 2X4WA 3M55A 1OZ2A 3IQLA 1Z9ZA 3RR6A 5GAOq 1UDLA 3OA6A 5D6YA 1VQ4T 1K9MR 1RACB 2G6FX 2DETA 4XTZA 2AZVA 3THKA 1YHQT 1H3HA 1X75C 2RI3A 3RMSA 1I5LA 4N4IA 2QYZA 3LLRA 3LWHA 2JZ2A 4BE2A 3RNJA 2ZZDA 2EQKA 4ATOA 2K5FA 5M9OA 1HYOA 2CZ7B 3OBYA 3QKJA 2OAWA 2ROTA 2RNAA 4FT2A 2DYBA 1KHCA 4EIKA 3PIOA 2IIMA 4NS5A 4JRQA 2DTHA 5CO7A 4KT0E 1R0CB 5CKFA 1I4K1 2HCKA 4QQGA 1TS9A 1TXQA 3JCMX 5J26A 4X34A 4C0DC 2RF0A 2MF2A 5CCAA 3RDVA 1QVFS 2O2OA 5KH6A 1M2VA 3NTIA 2E3HA 3NHNA 3HFOA 4M7DB 2FB7A 5CKHA 1GFDA 2VXEA 3OMCA 2QEXT 2C06A 2QDLA 3CCMT 1KQSA 1EX4A 1WJQA 3A8MB 5KCHA 2KNBB 3MP8A 2XG8D 2CREA 1SSFA 1R77A 1ZX6A 1RAFB 4TVRA 1W70A 1JRIA 1VYTA 3HSBA 4J7FA 3HPWA 1NJIU 2QTVA 3EAEA 4FYVB 4RTVA 3DB3A 2RHIA 2K4YA 3RUXA 2MPXC 3M54A 2RJDA 1UUEA 4KBMB 3REAB 2YUPA 1CKAA 1OPKA 5FROA 3I55A 1VQ4Q 4LDYA 2M02A 3EH2A 1JB0E 2JS0A 1PHTA 3CBMA 4J9CA 2O01E 2EKOA 2HBPA 3SB2A 2D9TA 2PTKA 4FW1A 2QQRA 4FW2A 1F1BB 2E6NA 4C8QD 1TUGB 2F2XA 4A4FA 2HAXA 1VQMA 1ZSZB 1W6XA 1ZQ1A 3M58A 8AT1B 2DF6A 1HJDA 5HK3A 4AFZC 1KQSS 3CPWA 2R5MA 4LDWA 2DRMA 3RKYA 3VYGA 4M78F 3J80E 1W4SA 1QQJA 4ZN3A 2LQKA 1YCYA 4M75G 1GXIE 4KRTA 1QVGS 3CMAQ 4IUVA 5GJVB 3CQTA 3H0FA 5I11A 1K8AR 1YBYA 1HK9A 2KRNA 3CCVQ 4OB1B 2BZYA 3QWYA 5GAN7 3GBQA 2QXFA 4M78G 3UA7A 3GLXA 3CCMA 2JJ9A 2K3BA 2QQAA 1RUWA 1O9SA 1H92A 2YUNA 2OJ2A 2KI7A 2JS2A 2FG0A 1JBMA 2EWNA 2QA4T 1IO6A 2LP5A 2QG9B 5IHKA 5GANg 2LJ3A 1VQKA 2XDBA 4E2FB 3H6ZA 3G4ST 3BY7A 3EFSA 2C0IA 2XK0A 4IIMA 1K8AC 2I0NA 3OW2P 2EGAA 2RB6A 4M78E 4E7LA 2IPOB 2DPPB 2CKKA 3L1AA 2DILA 1JJ2S 4AG1C 3CC7A 3G6EA 2DD4A 4AFUC 4LDXA 4F17A 1NBEB 2YHTA 1QW1A 3QJYA 2YXYA 3CCJT 1RAGB 1WI7A 4C8QA 1JQQA 4MDXA 2AKKA 1UG1A 2EGCA 2D8HA 1OZ3A 2DAQA 2RH2A 1M27C 5D6WA 1ZA2B 2RO0A 3FJPA 1ZUUA 4ZGDB 1M5Q1 1UGVA 2CS7A 5FWBA 5IXFA 6AT1B 3P8DA 1WIEA 3SD4A 4XU0A 1U06A 2SRCA 4HVUA 3M0TA 3PMIA 1YIJA 3G1JA 4M7DF 1Q81R 4EMKB 2XD0A 4O5VA 4KUIA 4HCZA 3G71Q 1YJWT 3GNFB 2JW4A 2KE9A 4HCCA 3FRNA 1VQ7A 3RKXA 3VKIA 4FCYA 3CCUA 1HXDA 1MMNA 1CKBA 4C8QC 3OYFA 3CCLA 4C92B 2LCLA 2KMTA 2ZCFB 5C6SA 4RG2A 3RKWA 5LJ5d 4KGXB 1KD1R 3CC4Q 4PFPA 4ME7A 1G3TA 3QYHB 4BACA 2DBKA 4C8QF 1Y96A 3E2UA 2CYZB 4MZMA 3V8JA 1YI2Q 1KIKA 2ESWA 1M9SA 5HKCA 3ZL7C 2ENMA 4NL2A 3PIPA 4J9EA 2CH4A 3JAME 2IG0A 2FYKA 5ECAA 3HTRA 1I0CA 3I5RA 3M5AA 4GLKA 2BIVA 4KGZB 1M90C 3CMAA 2KRSA 5GAOl 1NPRA 4FU6A 5AT1B 2PNIA 4AFSC 1RLPC 3M59A 1OX9A 2E5KA 2K3YA 3E19A 2H8HA 4C8QE 4PJOG 2LJ1A 4L59A 4XTYA 2KT8A 2LJ0A 1J3TA 3EG0A 3S3MA 3OYKA 4LNPA 3EHRA 1SG5A 2BTTA 2V8KA 4J5YA 1VQOT 2FL7A 1FWZA 2XI9A 4HXJA 4J9DA 1ZBJA 3PGGA 4JZ4A 4LXCA 2FVUA 2YLBA 5GAN8 5CAIA 1XQHA 3VRZA 5EG2A 3SHWA 3HKSA 3M9QA 1BB9A 1N9SA 4A53A 1A0NB 2HSEB 4B9WA 2DYIA 2VASA 3EFOB 2P0PA 4R56A 1NLPC 3FLGA 5I21A 1K9MC 2AHJB 1Q86U 1KFZA 2MCNA 3C94A 5GMKm 1BU1A 1PSFA 1PM3A 4WF2A 1V29B 3MEWA 2GTJA 1X01A 1VQLA 4Z8AA 5GANe 1WHJA 4M75F 1Q81U 4RTZA 2L3QA 2F2VA 1SPKA 2O4XB 2KYBA 4B6MA 1ZSZC 3EG9A 2P84A 1E7OA 3CCVT 5CR2A 4F04B 3JB9J 5LJ5j 1JJ2P 2JMCA 2K5LA 2Y4XA 1S72T 4C5IA 4AG2C 4D8KA 2DIQA 1M90R 1VQPA 1NYFA 1S72A 1TH7A 1FMWA 1AWXA 4DEXA 3CCQA 4ANJA 1FX7A 2NUTA 1BIBA 2K2MA 4JJDA 1I81A 1OV3A 2EFIA 2F2WA 4FYYB 1YJNA 2RD1A 3BDUA 4KULA 2DZCA 1VQNA 4LN2A 2CSIA 1XOVA 1UB4A 2EQIA 2JMAA 4OP0A 1M3AA 2XMFA 2KXDA 2EKHA 4PL6A 2V8IA 4FSSA 3GP8A 3J81E 1YITA 1M1KC 4MMKA 2AZSA 2RK1A 3NGPA 3REBB 5KYUA 5FRNA 3CCJQ 3JB9F 2HL3A 4C92A 1JO8A 1YWOA 2PZ1A 4DBRA 2F5TX 4IURA 1W2BA 4A54A 4AT1B 4RUGA 1IREB 2J05A 2W0ZA 4EPCA 4MZTA 2OX7A 2WSEE 3ZFJA 1YNZA 2DZ9A 2QEXQ 2M9UA 2GFUA 2JM9A 4N0AA 3CCRQ 4KGVB 4RTTA 4BD3A 3CCEQ 1CSKA 3L2RA 2FZGB 4RCCA 4LUDA 2DL3A 1G5VA 2QDYB 1YJWQ 3NMZC 4C92E 2EPDA 3JCMb 2QGGA 1QCFA 3J7AF 5LJ5g 1QVGA 2EVRA 2OTJA 2J6OA 1YCSB 2ZPIB 4IUTA 4R0KA 1UHCA 4ZNXA 1YITQ 2RHZA 1PG5B 1LOJA 1Q86R 2QQ9A 4N4HA 1PNJA 3OS1A 2LCSA 1FMKA 2ATCB 3X20B 1WDXA 1JU5C 2MIOA 2L3RA 3X24B 4PJOB 2DM1A 2VXFA 2CDTA 3FC3A 2FPFA 4JS5A 4YTLA 2ZPBB 2EBPA 2KT1A 2CP0A 1KC8U 3CCRA 5LJ3h 5IT9E 4M77C 4HVWA 3G6ET 1K9MU 4BI8B 2DJQA 2M1HA 3E9GA 2EYXA 4JZ3A 2PQWA 2DMOA 4OMQA 1AWJA 3CCST 3I56Q 1QCNA 2LX7A 1AWWA 1M90U 4D8DA 1VQ7T 1M3BA 1EZZB 5KYXB 1B34B 1KC8R 1B34A 3P8HA 3M0QA 4XTVA 2X3XD 4IUPA 3CC4A 1YJNQ 4ORZA 4F14A 2H3JA 3GNGA 3VYHB 1D3BB 1YHQQ 5KYYB 3CPFA 2L3PA 2V26A 5HK0A 4CC2A 3OYBA 1I5OB 1VQOQ 2LCCA 3CXCP 1PRMC 3INZA 4C5GA 4HT8A 1Q7YC 1Y07A 2PVDB 1M1KR 2DXTA 2A08A 4IKFA 4V2SA 3VS5A 5KYUB 4XTXA 5GMKe 4J9HA 4F7UF 1XJWB 2BUDA 1VQLQ 2E1HA 2CZ1B 3JCMJ 1X6GA 3CCUQ 4JJCA 1YITT 2M0YA 3VUBA 5GAMe 2AKLA 2HQEA 2YUQA 2A0FB 1M1KU 3NTHA 1EIFA 3MJXA 1NJIR 3UPUA 2GCXA 1B3QA 4PJNA 4PFOA 4A4GA 1VQKT 4E7JA 4GY5A 2KK4A 4XTWA 1M1FA 2E64A 1IB8A 5KYNA 3EFRA 2OI3A 1NYGA 2NUPB 2E3IA 2RM4A 1WX6A 2NUPA 3S6WA 3G4SQ 4M75E 4M77F 1ABOA 1ZA1B 1JEGA 4LD9K 1KJWA 2KBTA 3JB9I 2ABLA 1YJNT 2KRMA 2YRCA 4ELZC 4A63B 3GOXA 3OS5A 3CD6T 2DD5A 3A8HB 2DTOA 2Y90A 2DEUA 4M7AG 1K73C 1M8VA 4FSXA 3M0PA 3C4SA 4JRIA 1QLYA 4OMNA 3UF4A 1RADB 3TQ7P 3KUFA 2EYYA 4RCBA 1T3SA 1KQ2A 2EQUA 2LDMA 3RMQA 1VQLT 1ACMB 5A0GA 5LJ3f 1AVZC 2ZPFB 4JJNK 2YUOA 2JUFA 1KQSP 1VQPT 2HKNA 2LTOA 2X51A 1N27A 3QZ5B 1WHHA 1NLOC 2DL8A 2NWMA 2CZ0B 2DJZA 3V8LA 2COZA 2J06A 1PD1A 3CCET 1HSQA 2A28A 4ZTFA 1UJYA 2BE9B 1VIEA 2M16A 3CC7T 1ZUKA 2JTEA 2GQVA 1RAEB 4DOWA 3JRZA 4OB2B 4WTOB 2KROA 3M4YA 5GAN5 2DTIA 2M51A 4AFQC 3CEYA 5FU7C 2K9GA 4UC4A 3A98A 1Q7YU 3VS1A 1NE8A 1QWFA 2ECZA 1MHNA 5LJ3j 4AMCA 4RTWA 4EDUA 2GGRA 2YLCA 1VQ9Q 1TOVA 1B07A 3VS0A 1X6BA 1P92A 1MV0B 2ED1A 4FYWB 3L2VA 1BBZA 3H0HA 4PLIA 1ZHIA 3I56T 3TEEA 3CCSA 3OB9A 4FL6A 1I8FA 1ZSZA 2RQWA 4QVDA 2VUBA 2RN8A 1VQNQ 4PJOC 1IHWA 1T0JA 1M8MA 1PKTA 1GCQA 1OX8A 3EG3A 4ELYC 2YSQA 5GMKi 4J6YA 4MMLA 3WXMB 3OYIA 2GTOA 1QVFP 2A37A 4OMLA 3CPWP 1N9RA 1VQMT 2HSPA 4J9GA 3A1PA 4MDWA 3TSWA 1VQPQ 2LT4A 4F7UA 1VQ6T 1VYUA 2WACA 3T9NA 1N5ZA 1YJ9T 1WQWA 3FIFA 1XNIA 2DERA 3I35A 4E47A 4BDZA 1U5SA 2EQMA 1UEBA 2YT6A 4LD6A 3V7SA 4QQ6A 1G83A 4E6RA 3FB9A 1QP3A 1KD1U 2V8JA 2RQRA 4C0GA 1UE9A 3OYLA 1AZEA 5FU6C 4EMKA 3CCQQ 2QQBA 3TCJA 2QA4Q 2DKGA 4ZTJA 2DXCA 2LMJA 3MKDA 4PJMA 3OYGA 2O88A 3CCLT 1NM7A 1GL5A 2BKDN 4IUUA 2EJGA 1OEBA 2LRQA 3QSUA 1YJ9A 1YWPA 2VYTA 3CC4T 1NJIC 2HDAA 3H0IA 3X25B 4MZPA 2DO3A 2EYZA 3TVTA 2MK5A 4C92D 2VGMA 3ZEHA 2K7AA 5L23A 4JPBW 1KQ1A 2QAZA 1VIFA 5CKBA 4Y91A 2JT4A 3C95A 4GLMA 1K0XA 4VUBA 1ZLMA 3PVQA 3CCEA 2A7YA 1D0XA 2CT3A 5J39A 4RMOA 2E41A 2Z0WA 2EAYA 1UGPB 2JM8A 3OSVA 3VV0A 2O9SA 7AT1B 3GF5A 1WGSA 4C8QB 3EG9B 1Q7YR 3QUIA 2E12A 1W1FA 5DLQE 2QA4A 2EJ9A 3EG2A 2L8DA 5LL6S 4PJJA 3UA6A 5C0MA 1U1TA 3EHQA 3OMGA 4CRIA 1YJ9Q 4PJOE 5CIUA 2KGTA 2RQTA 1VYVA 1WJSA 1D0ZA 1RLQC 1TG0A 5HCKA 2MI6A 5DM7R 3SWNA 2CUBA 2ED0A 2LX9A 2L5QA 1R8OB 2RI5A 3CPWS 3SWNB 3SDZA 3HP9A 1NEBA 1YHQA 2XICA 1Y71A 3HRSA 1WZOA 2PUKB 2BZ8A 2DXBA 1VQ9A 5AYFA 1AWOA 4BI3A 3JCMg 4OGCA 4F7UG 3CCLQ 2O31A 2DVEA 1D09B 1MMAA 1YFNA 2DL7A 1YI2T 2KAFA 2HBWA 2DX1A 1VQ5T 2R5AA 3H41A 4JUVA 2P4RA 3SEMA 4M7AE 3LX7A 2OTLT 4RG8A 3V8KA 5KYWB 3GPLA 4LDUA 1RAIB 1ARKA 5GAOn 4QVZA 4RKUE 1WQ7A 5IXBA 4P5NA 1JXOA 3N5BB 1S72Q 1RAAB 2DVJA 3BFMA 5FLXE 3CCSQ 2D8JA 1BK2A 1C1AA 1VQ7Q 9ATCB 2GQIA 2ZAEA 3WVEB 5GANh 3TU4K 2H3EB 2RJCA 3CD6Q 4A4KA 4M77A 1NEGA 2WSFE 2C0TA 1W2BS 3G7ZA 2VVKA 3I55T 1BI1A 1MMDA 1PCXA 2K2VA 4J9BA 1Y96B 3JCMW 1IGQA 2F69A 3OS2A 2F1LA 3P8BB 5LJ3g 2ROLA 1C0MA 5LJ5e 1NZ9A 4XQ3A 3M4GA 2P4TA 3JSCA 2K57A 3JV3A 4OMMA 4M78B 3MP1A 1VQ6A 3CXCS 4JDSA 2HL5C 5CK9A 1QVFA 4HT9A 4RTXA 2KEAA 1SHGA 4C0DB 1TTHB 1VQ8Q 1WA7A 2C0OA 3I9QA 3PTAA 3ZBDA 3QYGB 2QGFB 5J3BA 3JB9H 4BY6C 2VGNA 1IZ6A 2VB6A 1ABQA 4EMKC 2KR3A 3FJ5A 3ULRB 2HMAA 2CZ6B 1VQ5A 4F7UE 3I5SA 1WJRA 1D1AA 4XTUA 4EMGA 3L2QA 1Y7XA 2D1XA 5LJ5h 1G8XA 1MV3A 4M7AF 1AHJB 4C5HA 3OYEA 2LVMA 1IRXA 3EFOA 2E4HA 4KH0B 1MNEA 4XU2A 2O9VA 4C92C 2LNHB 4XU3A 2HQHA 2MAMA 1IXDA 4B9XA 3CCQT 1BYMA 2O4XA 1ZUYA 2LQNA 5I2MA 3A8OB 1OULA 1ZSGA 4C92G 2X35A 5GAMj 2K6DA 1HD3A 1TU0B 5D7UA 1AOJA 4PJOA 4GBQA 3QWXX 5L8RE 3E1SA 5FWCA 3VS4A 3QHSA 2RQUA 4J7IA 3S3NA 2EGEA 3RBBB 2DIGA 1WNLA 3LH5A 4QQDA 2PU9B 4M75D 3V7CA 5EC7A 5CVIA 3OS0A 3VS3A 2XHCA 2RMOA 4M78C 1YIJQ 1M2VB 1U3OA 5IHNA 1UGSB 2L3SA 1OYXA 1VQ4A 1KG1A 3EGDB 2CP7A 5GAOp 2MWPA 1Y57A 3URGA 3OY9A 3MEUA 3CCRT 1VUBA 4BDYA 2KVQG 4XU1A 1MMGA 3DB4A 3QG1A 1GCQC 3NFCA 3X28B 4DBQA 8ATCB 1Q82C 3DLLA 1M1GA 2LNVA 3RERA 3CD6A 4FYXB 1AEYA 2KQWA 1SKUB 3JCMd 4X9DA 3L2UA 3MHXA 4CI0C 2XIDA 1H3ZA 2EQJA 4OMOA 2LQ8A 2FHDA 1FXXA 2GBQA 1AD5A 1QVPA 4M75A 3QBYA 3QXEB 2JVVA 1UGRB 1JJ2A 4OMFB 1JXMA 3DKMA 1EFNA 2SEMA 1KHIA 3OYHA 4OB0B 2DBMA 2KYMA 4Y92A 5IN1A 3OYDA 1QKWA 4OGEA 1BIAA 2XDDA 2MMPA 1VOMA 2EJFA 3VJPA 4HKEA 1VQ8A 2NYSA 2R57A 3MEAA 1VQKQ 3CCVA 2JOYA 4DQ2A 2J6KA 5A0LA 1N8RR 2ZPGB 3JB9D 3C0CA 3PNWC 1BCMA 2GFAA 4PLLA 3JCMP 5GAMh 3VUZA 1BKBA 3OBWA 3MCAB 5LJ3d 2X9HA 2HNIA 2XDPA 1QMCA 2MYSA 1I07A 3I56A 3KXTA 1QVGP 3QO3A 1WHLA 3M0UA 4X9CA 4BB7A 3CC2T 1PWTA 2LQWA 4N0AC 3LYIA 3UWNA 4PK4A 2OTJQ 1SSHA 3OYMA 1S1NA 2EW3A 4QKUA 3QIIA 5IHIA 2DE0X 3OW2A 2P0KA 3PMTA 1MGQA 3M0SA 3PFSA 3G71T 2WSCE 2B8AA 2JNGA 4M7DA 2COYA 3QJ6A 1GFCA 3MPUB 3EH1A 2JTMA 2QK0A 1OOTA 2FZKB 4M7AB 1X6OA 4DEYA 2LT1A 2DXUA 1TWBA 2FPEA 1VQ6Q 4J83A 2K3XA 4N4GA 2XKOC 1SHFA 5GAOm 4II1A 2MWOA 1U1SA 2QI2A 3U23A 3ME9A 4CC4B 2X4JA 3KFVA 2QEXA 1Y0MA 1KK7A 3JCMe 4Y28E 1FYNA 2RQVA 1ZBXA 1QKXA 3PT9A 1PRLC 3CBPA 1X2KA 1WYXA 4O6JA 1PC0A 4KH1B 5GANj 3LWIA 3OYNA 2ZPEB 1D1BA 1N8RC 2FEIA 1RI9A 1M30A 2VC8A 3PE0A 3A8GB 2K79A 4BUGA 2DLPA 3HRTA 2YRVA 4PJOD 1LPLA 3OYJA 4NL3A 2AIRB 3JCMh 3BW1A 2PUOB 1VQOA 1Q82U 3JCMQ 1VA7A 3LGLA 3OQ5A 2NLUA 1U8RA 5GMKl 2K5IA 1OI1A 2RJFA 2E70A 4HA8A 1N8RU 5FW9A 3C12A 3OYCA 2JTFA 1GRIA 3AT1B 1WFWA 3EGXB 1SEMA 1G3YA 2JXBA 1MUZA 4QW2A 1YIJT 1IHVA 1G3SA 5KYWA 4M7DD 3HRUA 4WCIA 3OYAA 1Q82R 4QVCA 4A4HA 2J7IA 2EYWA 1VQNT 3H8ZA 4OMPA 2HZYA 4HCKA 1NPPA 1TSFA 1FMVA 2EYQA 2AK5A 3M53A 2DA9A 2GF7A 3QDRB 3NTKA 1PD0A 1VQMQ 2E10A 2NUZA 2RHXA 4DOVA 4X1VA 2GNCA 3L42A 5DY9A 1WXTA 3FEOA 3JB9G 1H8KA 4C8QG 4M7DG 2X4XA 2J6FA 5FRMA 3EGXA 1TUCA 2CP5A 2D0QB 4M7DE 4RTYA 1M2OA 4Z88A 4ZN1A 2CGHA 1D0YA 1O75A 2BZXA 2XU8A 4M77D 2DFUA 3PVLA 1K8AU 1UHFA 1Z9QA 3EGUA 1WPYA 2FRYA 3CMET 1UGQB 5KYYA 1KD1C 3AHUA 1D3BA 4LE9A 5IAYA 3MEVA 3BDLA 3KBGA 4Q5WA 3CXCA 3UDCA 2OTLQ 2LC4A 3BE3A 1PKSA 1G3WA 2CP3A 5GAOr 1I1JA 4EMHA 2BE7D 2MOXA 2QQSA 1X2QA 4M7AA 3QPHA 1YI2A 2ZGWA 4PJLA 3NPFA 3MO8A 2L2PA 4D6WA 1GCPA 2KDSA 2L89A 2D6FA 2QTXA 2E65A 3QDFA 4JLGA 1AZGB 5GAN4 1UFFA 1XTDA 1PSEA 2YDLA 5FU6B 4FM4B 2X3WD 4C92F 1VQ8T 3CC2Q 1NG2A 2RHYA 4M75C 3GIBA 1K73U 2FO0A 4M77E 3CMAT 4R55A 3E9FA 3UATA 2F5KA 5GANf 1B7TA 4E7HA 1Q95G 3MP6A 1QWEA 5HY6A 1WXBA 1AT1B 1V1CA 3JCMf 1C6VX 1K76A 2E6ZA 4FIBA 2V1RA 4IIOA 4F7UB 2P0QA 1LJOA 2A3LA 2M0OA 1IGUA 4J9IA 3A8LB 1QCOA 2QASA 4J8OA 4E7KA 2RPNA 3CC7Q 3OW2S 3V7RA 3VS6A 4E7ZA 4M77B 4CC7A 2Y4YA 4RTUA 1M4ZA 5CKDA 2OAUA 5GAMd 1D1CA 1KSWA 5KE3A 3TSZA 4M7AC 1E6GA 1DJ7B 3LH0A 1MNDA 5GAN6 4NOYA 2DL5A 4ZGJB 2YWWA 2HD0A 3JCMc 1YN8A 5LJ5f 2HKQB 4FT4A 2DEQA 3F70A 2DL4A 4M7DC 3VS2A 2OTJT 2LZ6B 2X4YA 5GAN2 2ZPHB 5GJWB 2L0AA 1M3CA 3CBOA 4JRKA 1VQ9T 3O8VA 2DK3A 3QZ9B 3X26B 5GAN3 4CC3A 4M75B 2CP6A 3EG1A 1E6HA 5GMKh 2PVGB 1UECA 1X69A 2VKNA 3H9NA 5I22A 3META 1BI3A 5D6XA 4C0ZA 3L2ZA 4XK8E 2FZCB 3SFMA 1OQKA 4ESRA 2HQXA 4ZGEB 4J6WA 2VWFA 1KC8C 1Q81C 1BI0A 2R58A 1BCOA 3WVDB 2CUDA 1OU8A 3M56A 1GBRA 1WHKA 4JLIA 2B86A 1K73R 5CQXA 4M77G 2IVWA 4HVVA 3TREA 1YP5A 1WXUA 3G71A 1K4US 1UTIA 2KSSA 3JCMV 4JRPA 5KYXA 1GBQA 3VU3C 3G4SA 1W2BP 3RIRA 2RA2A 1K0SA 3L2WA 1H641 2NUTB 1Q86C 5GMKj 5IH2A 3M57A 5KCOA 4K11A 1WHMA 1OU9A 3CMEA 3D7SB 4LUEA 3I55Q 1X27A 4DBFA 1TUDA 4J9FA 2V1QA 1LNXA 1WHGA 1LVKA 4OF1A 4BY6B 1K1ZA 1G2BA 2RHUA 3G6EQ 2AT1B 1R0BG 4M7AD 1BI2A 1SF9A 4XAXB 2PVOB 3ER0A 2W10A 1QP2A 4M4ZA 3OYYA 2KY9A 3CC2A 4PKCC 4OB3B 1K9AA 2DNUA 3DLMA 4M78A 4DBHA 4PFZA 1RABB 2COWA 4C0FA 4L5GA 4BI4A 5A2QE 2D0NA 2G3RA 4Z02A 4BE1A 4E7SA 2OTLA 3VRYA 4OVAA 3UT1A 4L6V5 3R6OA 4QT7A 3HFNA 3HL8A 4PJOF 3EGDA 3O5ZA 3S3OA 1T0HA 5GAMf 2RK2A 5A0DA 1T3LA 2RI2A 4F16A 1SRLA 2I2LA 1V76A 3SWNC 4LDVA 3RESA 2FPDA 1X43A 2HEQA 3HHTB 1N6AA 3Q1JA 2YRDA 3ASKA 4DA4A 3LGFA 5CQYA 3VS7A 1YJWA 4KUDK 1UJ0A 1RL2A 3CCMQ 3CCUT 4J6XA 2E5QA 4JJBA 4HCBA 2DRKA 5LJ3e 3CMEQ 2JN0A 3FDRA 2FRWA 3OSSC 5DLOA 4JS4A 1OPLA 2CP2A
chains in the Genus database with same CATH topology
4E7IA 2BKDN 1ZBXA 4IUUA 5LJ5j 4IUQA 5FU7B 3PT9A 2K5LA 2EJGA 4C5EA 2Y4XA 3CBPA 1S72T 4C5IA 2LRQA 3QSUA 4O6JA 1YJ9A 2DIQA 4M78D 2VYTA 5GAMg 5GANj 3LWIA 5KE2A 3CC4T 1VQPA 3OYNA 1S72A 1TH7A 4PNOA 2ZPEB 2VV5A 3CCQA 4BE0A 1NJIC 1FX7A 1N8RC 2EIFA 3X25B 1BIBA 3LW5E 5GANd 1I81A 4MZPA 2DO3A 2EFIA 2VC8A 3A8GB 2RJEA 5CKEA 4BUGA 4C92D 3A5ZB 1YJNA 3HRTA 2YRVA 2VGMA 2RD1A 3ZEHA 4A4EA 4PJOD 1RI0A 3BDUA 4KULA 5I2SA 2DZCA 1VQNA 3CCJA 1KQ1A 3OYJA 2X4WA 1VIFA 5CKBA 4Y91A 4NL3A 3C95A 3JCMh 3BW1A 1UB4A 1OZ2A 1XOVA 3M55A 4VUBA 3CCEA 2A7YA 4OP0A 5J39A 4RMOA 5GAOq 2PUOB 3OA6A 2E41A 1VQOA 1Q82U 3JCMQ 2EAYA 5D6YA 1UGPB 1VQ4T 4XTZA 3LGLA 3OQ5A 2NLUA 1U8RA 3OSVA 3VV0A 4PL6A 2V8IA 3GP8A 3GF5A 1YHQT 3J81E 1YITA 1M1KC 1WGSA 2K5IA 1OI1A 1X75C 2RI3A 2RJFA 4MMKA 4C8QB 5GMKl 2RK1A 3RMSA 2E70A 4HA8A 1N8RU 1I5LA 3QUIA 3C12A 2E12A 3OYCA 4N4IA 5DLQE 2QA4A 2EJ9A 2JTFA 3LLRA 3LWHA 2JZ2A 4BE2A 5FRNA 2L8DA 3JB9F 2ZZDA 5LL6S 2EQKA 4C92A 4ATOA 2K5FA 5C0MA 5M9OA 2CZ7B 1G3YA 1U1TA 4QW2A 3OBYA 3QKJA 1YIJT 1G3SA 3OMGA 4M7DD 3HRUA 4FT2A 3OYAA 1KHCA 3PIOA 4CRIA 2F5TX 4IURA 1W2BA 4NS5A 5CIUA 4JRQA 4A54A 4PJOE 2DTHA 5CO7A 4QVCA 4A4HA 1IREB 4KT0E 4EPCA 1VQNT 1WJSA 3H8ZA 4MZTA 5CKFA 1I4K1 2WSEE 1NPPA 2MI6A 4QQGA 5DM7R 3JCMX 3ZFJA 3SWNA 5J26A 4X34A 4C0DC 2LX9A 2L5QA 2RI5A 1R8OB 2DZ9A 2EYQA 2MF2A 2M9UA 2GFUA 3M53A 3SDZA 3HP9A 3SWNB 2GF7A 4N0AA 3QDRB 4BD3A 1QVFS 3NTKA 5KH6A 2E10A 3L2RA 1YHQA 3NTIA 2XICA 2RHXA 1Y71A 4DOVA 3HRSA 2PUKB 3HFOA 2FB7A 4RCCA 5CKHA 3L42A 5DY9A 2VXEA 2DXBA 4M7DB 3FEOA 3OMCA 2QEXT 2C06A 1VQ9A 3JB9G 4C8QG 3AHUA 3CCMT 4M7DG 2X4XA 5AYFA 1KQSA 2QDYB 1G5VA 1WJQA 4C92E 5FRMA 2D0QB 3A8MB 3JCMg 4OGCA 4BI3A 4F7UG 3JCMb 4M7DE 3J7AF 5LJ5g 5KCHA 2DVEA 1QVGA 2OTJA 2ZPIB 4IUTA 2CGHA 4ZN1A 1YI2T 2KAFA 3MP8A 2XG8D 2RHZA 1VQ5T 1O75A 2XU8A 4M77D 1K8AU 2R5AA 1LOJA 1SSFA 2QQ9A 4JUVA 4N4HA 4M7AE 4TVRA 3OS1A 3LX7A 2OTLT 4RG8A 3V8KA 3X20B 3GPLA 1JRIA 3HSBA 4PJOB 3X24B 2L3RA 4LDUA 1WPYA 5GAOn 2VXFA 4QVZA 1UGQB 3HPWA 4J7FA 3FC3A 4RKUE 1WQ7A 3CMET 1NJIU 4JS5A 1D3BA 1KD1C 3EAEA 4YTLA 5IAYA 3MEVA 2ZPBB 3BDLA 3KBGA 4Q5WA 3CXCA 4P5NA 3UDCA 1KC8U 3DB3A 2RHIA 3N5BB 3CCRA 2K4YA 3RUXA 2LC4A 3M54A 5LJ3h 5IT9E 2RJDA 4KBMB 4M77C 3BFMA 1G3WA 5FLXE 5FROA 5GAOr 3G6ET 1K9MU 3I55A 4EMHA 4BI8B 2M1HA 3CPWS 4LDYA 3E9GA 1JB0E 3WVEB 5GANh 2QQSA 3TU4K 2RJCA 4M7AA 3QPHA 4A4KA 4M77A 2WSFE 3CBMA 2PQWA 1W2BS 1YI2A 3G7ZA 2O01E 2ZGWA 3I55T 1BI1A 3CCST 1M90U 3JCMW 2K2VA 1Y96B 2EKOA 1VQ7T 3MO8A 2HBPA 2F69A 4D6WA 3OS2A 3P8BB 5LJ3g 2KDSA 2L89A 5LJ5e 1B34B 2D6FA 2QTXA 1B34A 1NZ9A 3P8HA 4XTVA 3SB2A 4XQ3A 2D9TA 3M4GA 4IUPA 2P4TA 2QQRA 3JSCA 3CC4A 2E65A 2K57A 4JLGA 5GAN4 1XTDA 1PSEA 2E6NA 4C8QD 5CCAA 4M78B 2H3JA 4FM4B 5FU6B 3MP1A 3GNGA 3VYHB 4A4FA 1D3BB 2HAXA 1VQ6A 4C92F 3CXCS 4JDSA 1VQMA 1VQ8T 3CPFA 1ZQ1A 3M58A 2RHYA 5HK0A 4M75C 5HK3A 5CK9A 1QVFA 1KQSS 3CPWA 2R5MA 4LDWA 3OYBA 4HT9A 3GIBA 2LCCA 3INZA 1K73U 3RKYA 3VYGA 4C5GA 4M77E 4M78F 4C0DB 4HT8A 3CMAT 3PTAA 4R55A 3E9FA 3ZBDA 3QYGB 3J80E 1Q7YC 1Y07A 2PVDB 1W4SA 4ZN3A 2DXTA 2LQKA 1YCYA 5J3BA 4M75G 3JB9H 2F5KA 1GXIE 4BY6C 5GANf 2VGNA 4IKFA 1IZ6A 1QVGS 4V2SA 4EMKC 4XTXA 4IUVA 5GMKe 4E7HA 3MP6A 4F7UF 2BUDA 5HY6A 2E1HA 2CZ1B 3JCMJ 2CZ6B 1VQ5A 4F7UE 3JCMf 1WJRA 2E6ZA 4XTUA 4EMGA 4FIBA 1YITT 1YBYA 3L2QA 1Y7XA 1HK9A 5LJ5h 3VUBA 5GAMe 2HQEA 4M7AF 4OB1B 1AHJB 4C5HA 3OYEA 2LVMA 5GAN7 4F7UB 1M1KU 2QXFA 3NTHA 4M78G 3GLXA 1EIFA 4XU2A 3CCMA 2P0QA 1LJOA 4C92C 2QQAA 2A3LA 2M0OA 1O9SA 4XU3A 3UPUA 2GCXA 2MAMA 3A8LB 4A4GA 1VQKT 4B9XA 4J8OA 3CCQT 4E7JA 4E7KA 4GY5A 1BYMA 2O4XA 5I2MA 1JBMA 2EWNA 2KK4A 2QA4T 3A8OB 4XTWA 1M1FA 3OW2S 3V7RA 4C92G 2E64A 2X35A 5GAMj 5GANg 4M77B 1VQKA 2XDBA 2Y4YA 3EFRA 1M4ZA 3H6ZA 4PJOA 5CKDA 3G4ST 2OAUA 5GAMd 3BY7A 3EFSA 5KE3A 5L8RE 4M7AC 2RM4A 3E1SA 2XK0A 1DJ7B 3LH0A 5GAN6 3QHSA 1K8AC 4NOYA 4J7IA 3S3NA 2RB6A 4ZGJB 3S6WA 4M75E 4M78E 4M77F 2DIGA 1WNLA 4E7LA 2HD0A 2DPPB 2CKKA 3L1AA 1JJ2S 4QQDA 3CC7A 4LD9K 2PU9B 3JCMc 3JB9I 4M75D 5LJ5f 2DD4A 3V7CA 3G6EA 4FT4A 1YJNT 2DEQA 3F70A 4LDXA 4M7DC 5CVIA 4ELZC 2OTJT 2YHTA 1QW1A 3GOXA 3QJYA 3CCJT 3OS0A 2X4YA 3OS5A 2XHCA 5GAN2 2ZPHB 4C8QA 2DD5A 3CD6T 4MDXA 3A8HB 4M78C 1VQ9T 3CBOA 4JRKA 3O8VA 2DK3A 2DTOA 2Y90A 1OZ3A 3QZ9B 3X26B 5GAN3 2DAQA 2RH2A 4M75B 5D6WA 1K73C 1UGSB 4M7AG 2RO0A 3FJPA 4FSXA 1M8VA 3C4SA 1OYXA 5GMKh 4ZGDB 2PVGB 1M5Q1 1VQ4A 4JRIA 1KG1A 2CS7A 5GAOp 2MWPA 3META 1BI3A 5D6XA 4C0ZA 3L2ZA 3KUFA 3P8DA 3SD4A 4XU0A 4XK8E 3URGA 4RCBA 3OY9A 3MEUA 3CCRT 3SFMA 3PMIA 1YIJA 1VUBA 1KQ2A 2EQUA 2HQXA 4ZGEB 4M7DF 4BDYA 2LDMA 4J6WA 3RMQA 2KVQG 4XU1A 1KC8C 4EMKB 1Q81C 1VQLT 2XD0A 3DB4A 4O5VA 3QG1A 5A0GA 4KUIA 1BI0A 5LJ3f 3NFCA 4HCZA 2ZPFB 4JJNK 2R58A 1YJWT 3X28B 3GNFB 3WVDB 1Q82C 3DLLA 1M1GA 2JUFA 2LNVA 3FRNA 4HCCA 3M56A 1VQPT 2LTOA 4JLIA 3CD6A 3RERA 2KQWA 1N27A 3QZ5B 3JCMd 1VQ7A 4X9DA 3RKXA 3L2UA 3VKIA 3MHXA 4CI0C 2XIDA 3CCUA 1H3ZA 1HXDA 2CZ0B 2DJZA 2EQJA 3V8LA 2LQ8A 2FHDA 4C8QC 1FXXA 3CCET 5CQXA 4M77G 3OYFA 2IVWA 3TREA 4ZTFA 3CCLA 1QVPA 4M75A 4C92B 2LCLA 2KMTA 3QBYA 2ZCFB 3G71A 5C6SA 4RG2A 1VIEA 2M16A 3RKWA 3QXEB 2JVVA 3CC7T 2KSSA 3JCMV 5LJ5d 1UGRB 2GQVA 4JRPA 1JJ2A 4OMFB 3DKMA 4DOWA 4ME7A 1G3TA 3QYHB 3JRZA 3VU3C 4C8QF 1KHIA 3OYHA 3G4SA 4BACA 4OB0B 4OB2B 1Y96A 2RA2A 2CYZB 3RIRA 5IN1A 3OYDA 4OGEA 3M4YA 4MZMA 1BIAA 3V8JA 1H641 2DTIA 5GAN5 2MMPA 2XDDA 3L2WA 1M9SA 5HKCA 3CEYA 1Q86C 5FU7C 5GMKj 2EJFA 4NL2A 3VJPA 3PIPA 3M57A 4HKEA 5KCOA 3JAME 1VQ8A 2R57A 2IG0A 2FYKA 3MEAA 4UC4A 3CCVA 2JOYA 4DQ2A 3CMEA 1Q7YU 5A0LA 4GLKA 2ZPGB 3M5AA 3JB9D 1NE8A 2BIVA 3PNWC 1M90C 3CMAA 1MHNA 5GAOl 2GFAA 4PLLA 1LNXA 5LJ3j 1NPRA 4FU6A 4OF1A 5GAMh 3JCMP 4BY6B 4EDUA 3VUZA 1BKBA 3M59A 3OBWA 2K3YA 2YLCA 3MCAB 2RHUA 5LJ3d 2HNIA 3E19A 2XDPA 3I56A 4C8QE 1P92A 4PJOG 3KXTA 4M7AD 1BI2A 4L59A 3QO3A 4XTYA 4X9CA 3L2VA 4BB7A 3S3MA 4XAXB 3OYKA 3CC2T 2PVOB 4PLIA 3ER0A 1ZHIA 4N0AC 3LYIA 4J5YA 1QP2A 2V8KA 3TEEA 3UWNA 3OYYA 3I56T 3CCSA 2KY9A 3OB9A 4FL6A 1VQOT 2FL7A 4PKCC 4OB3B 1FWZA 1I8FA 3OYMA 3CC2A 3DLMA 2XI9A 4QVDA 2VUBA 4PJOC 3PGGA 4M78A 3QIIA 2FVUA 2YLBA 5GAN8 5CAIA 1XQHA 5EG2A 4ELYC 3OW2A 4C0FA 2P0KA 3HKSA 3PMTA 4L5GA 4BI4A 5GMKi 5A2QE 1MGQA 2G3RA 3M9QA 4J6YA 4MMLA 4Z02A 3WXMB 3OYIA 4BE1A 3PFSA 2OTLA 4OVAA 3G71T 2WSCE 3UT1A 1N9SA 2B8AA 2JNGA 4L6V5 4A53A 4M7DA 1N9RA 3R6OA 4B9WA 1VQMT 3QJ6A 4MDWA 3HFNA 3HL8A 2LT4A 4PJOF 4F7UA 1VQ6T 2P0PA 2WACA 3T9NA 4R56A 3S3OA 1YJ9T 3FLGA 2JTMA 1WQWA 5GAMf 3FIFA 2RK2A 5A0DA 5I21A 1XNIA 1K9MC 4E47A 4M7AB 2AHJB 1X6OA 2RI2A 1Q86U 2LT1A 4BDZA 2I2LA 3SWNC 2DXUA 3C94A 4LDVA 5GMKm 3RESA 1PSFA 4WF2A 1V29B 2EQMA 3MEWA 4J83A 1UEBA 4LD6A 3V7SA 4QQ6A 2K3XA 4N4GA 3HHTB 3FB9A 1X01A 1QP3A 1KD1U 1VQLA 2XKOC 2V8JA 5GAOm 1N6AA 4M75F 5GANe 3Q1JA 4II1A 2MWOA 1Q81U 1U1SA 3ASKA 2QI2A 3LGFA 5CQYA 4C0GA 4DA4A 3ME9A 1YJWA 4KUDK 3OYLA 5FU6C 4EMKA 2X4JA 1RL2A 2O4XB 3CCUT 4J6XA 2E5QA 2QQBA 3TCJA 2QEXA 2DKGA 4ZTJA 4HCBA 2DXCA 5LJ3e 3OYGA 2JN0A 3FDRA 3JCMe 3OSSC 5DLOA 4Y28E 3CCLT 4JS4A 3CCVT 5CR2A 3JB9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7I A;  2BKD N;  4IUU A;  4IUQ A;  4A4G A;  5IN1 A;  4B9X A;  3OS1 A;  3LX7 A;  3OYD A;  3L2W A;  4E7J A;  4E7K A;  4C5E A;  4GY5 A;  2O4X A;  4C5I A;  2L3R A;  2LRQ A;  2DIQ A;  3CEY A;  2VYT A;  4QVZ A;  3FC3 A;  2X35 A;  5KE2 A;  3OYN A;  3EAE A;  5KCO A;  4BE0 A;  2R57 A;  5IAY A;  3MEV A;  3BDL A;  2IG0 A;  4Q5W A;  3MEA A;  4UC4 A;  3H6Z A;  3DB3 A;  2RHI A;  2EFI A;  2RJD A;  5KE3 A;  2RJE A;  5FRO A;  2XK0 A;  2BIV A;  3LH0 A;  2YRV A;  3PNW C;  3ZEH A;  4A4E A;  1RI0 A;  2M1H A;  1MHN A;  3S3N A;  2GFA A;  4PLL A;  3E9G A;  3S6W A;  4FU6 A;  2X4W A;  3OYJ A;  2QQS A;  2DIG A;  2RJC A;  4EDU A;  4E7L A;  1OZ2 A;  2CKK A;  4QQD A;  2K3Y A;  2PQW A;  5J39 A;  2RHU A;  3OA6 A;  2XDP A;  5D6Y A;  3F70 A;  3LGL A;  3OQ5 A;  2EKO A;  2NLU A;  4L59 A;  3MO8 A;  3GOX A;  4PL6 A;  3OS2 A;  3OS0 A;  3L2V A;  2X4Y A;  2L89 A;  3S3M A;  1WGS A;  3P8H A;  1OI1 A;  2RJF A;  2RI3 A;  3OYK A;  2D9T A;  4PLI A;  4IUP A;  2QQR A;  3O8V A;  3UWN A;  3LYI A;  3OYC A;  1OZ3 A;  3OB9 A;  2E6N A;  4FL6 A;  4N4I A;  2DAQ A;  2JTF A;  3LLR A;  3OYM A;  4A4F A;  5D6W A;  3MP1 A;  2JZ2 A;  3DLM A;  2RO0 A;  4BE2 A;  5FRN A;  3C4S A;  2L8D A;  1OYX A;  2EQK A;  5C0M A;  3QII A;  5M9O A;  2RHY A;  4QW2 A;  3QKJ A;  2MWP A;  3MET A;  3OMG A;  2R5M A;  2P0K A;  5D6X A;  3PMT A;  3OYB A;  3OYA A;  1KHC A;  3KUF A;  2G3R A;  2LCC A;  3M9Q A;  3P8D A;  4IUR A;  4Z02 A;  3SD4 A;  4NS5 A;  5CIU A;  3PFS A;  4CRI A;  3OY9 A;  3OYI A;  4BE1 A;  3MEU A;  4OVA A;  4A4H A;  3PMI A;  3UT1 A;  4C5G A;  2B8A A;  1WJS A;  3H8Z A;  2EQU A;  2HQX A;  3E9F A;  3QJ6 A;  4B9W A;  4BDY A;  4QQG A;  2LDM A;  5J26 A;  4X34 A;  2WAC A;  3DB4 A;  2RI5 A;  3S3O A;  3FLG A;  2F5K A;  2GFU A;  2GF7 A;  4BD3 A;  4HCZ A;  4IKF A;  2R58 A;  3NTK A;  1XNI A;  5KH6 A;  2RI2 A;  4IUV A;  3L2R A;  4BDZ A;  3NTI A;  4E7H A;  2LTO A;  2RHX A;  3MP6 A;  2BUD A;  1N27 A;  2EQM A;  3L42 A;  3MEW A;  3L2U A;  3FEO A;  3OMC A;  4LD6 A;  4QQ6 A;  1H3Z A;  1WJR A;  2K3X A;  2EQJ A;  2X4X A;  4N4G A;  1G5V A;  2FHD A;  1WJQ A;  3L2Q A;  5FRM A;  3OYF A;  4ZTF A;  3Q1J A;  2HQE A;  4II1 A;  2MWO A;  5KCH A;  3ASK A;  3LGF A;  3ME9 A;  4C5H A;  3OYE A;  2LVM A;  3QBY A;  3OYL A;  5C6S A;  4IUT A;  2M16 A;  2O4X B;  3NTH A;  4RG2 A;  3MP8 A;  2E5Q A;  2RHZ A;  4ZTJ A;  3OYG A;  3FDR A;  2M0O A;  2R5A A;  1SSF A;  4BAC A;  4N4H A;  3OYH A; 
#chains in the Genus database with same CATH topology
 4E7I A;  4IUQ A;  5FU7 B;  1SRM A;  1WLP B;  4C5E A;  4Z89 A;  2CT4 A;  1VQ5 Q;  4M78 D;  5GAM g;  3M0R A;  5KE2 A;  4PNO A;  4BE0 A;  2VV5 A;  2CH4 W;  2EIF A;  3R6N A;  3LW5 E;  1LCK A;  1RAH B;  2CSQ A;  2KXC A;  5GAN d;  2A36 A;  2RJE A;  5CKE A;  3A5Z B;  4A4E A;  1RI0 A;  5I2S A;  3CCJ A;  2X4W A;  3M55 A;  1OZ2 A;  3IQL A;  1Z9Z A;  3RR6 A;  5GAO q;  1UDL A;  3OA6 A;  5D6Y A;  1VQ4 T;  1K9M R;  1RAC B;  2G6F X;  2DET A;  4XTZ A;  2AZV A;  3THK A;  1YHQ T;  1H3H A;  1X75 C;  2RI3 A;  3RMS A;  1I5L A;  4N4I A;  2QYZ A;  3LLR A;  3LWH A;  2JZ2 A;  4BE2 A;  3RNJ A;  2ZZD A;  2EQK A;  4ATO A;  2K5F A;  5M9O A;  1HYO A;  2CZ7 B;  3OBY A;  3QKJ A;  2OAW A;  2ROT A;  2RNA A;  4FT2 A;  2DYB A;  1KHC A;  4EIK A;  3PIO A;  2IIM A;  4NS5 A;  4JRQ A;  2DTH A;  5CO7 A;  4KT0 E;  1R0C B;  5CKF A;  1I4K 1;  2HCK A;  4QQG A;  1TS9 A;  1TXQ A;  3JCM X;  5J26 A;  4X34 A;  4C0D C;  2RF0 A;  2MF2 A;  5CCA A;  3RDV A;  1QVF S;  2O2O A;  5KH6 A;  1M2V A;  3NTI A;  2E3H A;  3NHN A;  3HFO A;  4M7D B;  2FB7 A;  5CKH A;  1GFD A;  2VXE A;  3OMC A;  2QEX T;  2C06 A;  2QDL A;  3CCM T;  1KQS A;  1EX4 A;  1WJQ A;  3A8M B;  5KCH A;  2KNB B;  3MP8 A;  2XG8 D;  2CRE A;  1SSF A;  1R77 A;  1ZX6 A;  1RAF B;  4TVR A;  1W70 A;  1JRI A;  1VYT A;  3HSB A;  4J7F A;  3HPW A;  1NJI U;  2QTV A;  3EAE A;  4FYV B;  4RTV A;  3DB3 A;  2RHI A;  2K4Y A;  3RUX A;  2MPX C;  3M54 A;  2RJD A;  1UUE A;  4KBM B;  3REA B;  2YUP A;  1CKA A;  1OPK A;  5FRO A;  3I55 A;  1VQ4 Q;  4LDY A;  2M02 A;  3EH2 A;  1JB0 E;  2JS0 A;  1PHT A;  3CBM A;  4J9C A;  2O01 E;  2EKO A;  2HBP A;  3SB2 A;  2D9T A;  2PTK A;  4FW1 A;  2QQR A;  4FW2 A;  1F1B B;  2E6N A;  4C8Q D;  1TUG B;  2F2X A;  4A4F A;  2HAX A;  1VQM A;  1ZSZ B;  1W6X A;  1ZQ1 A;  3M58 A;  8AT1 B;  2DF6 A;  1HJD A;  5HK3 A;  4AFZ C;  1KQS S;  3CPW A;  2R5M A;  4LDW A;  2DRM A;  3RKY A;  3VYG A;  4M78 F;  3J80 E;  1W4S A;  1QQJ A;  4ZN3 A;  2LQK A;  1YCY A;  4M75 G;  1GXI E;  4KRT A;  1QVG S;  3CMA Q;  4IUV A;  5GJV B;  3CQT A;  3H0F A;  5I11 A;  1K8A R;  1YBY A;  1HK9 A;  2KRN A;  3CCV Q;  4OB1 B;  2BZY A;  3QWY A;  5GAN 7;  3GBQ A;  2QXF A;  4M78 G;  3UA7 A;  3GLX A;  3CCM A;  2JJ9 A;  2K3B A;  2QQA A;  1RUW A;  1O9S A;  1H92 A;  2YUN A;  2OJ2 A;  2KI7 A;  2JS2 A;  2FG0 A;  1JBM A;  2EWN A;  2QA4 T;  1IO6 A;  2LP5 A;  2QG9 B;  5IHK A;  5GAN g;  2LJ3 A;  1VQK A;  2XDB A;  4E2F B;  3H6Z A;  3G4S T;  3BY7 A;  3EFS A;  2C0I A;  2XK0 A;  4IIM A;  1K8A C;  2I0N A;  3OW2 P;  2EGA A;  2RB6 A;  4M78 E;  4E7L A;  2IPO B;  2DPP B;  2CKK A;  3L1A A;  2DIL A;  1JJ2 S;  4AG1 C;  3CC7 A;  3G6E A;  2DD4 A;  4AFU C;  4LDX A;  4F17 A;  1NBE B;  2YHT A;  1QW1 A;  3QJY A;  2YXY A;  3CCJ T;  1RAG B;  1WI7 A;  4C8Q A;  1JQQ A;  4MDX A;  2AKK A;  1UG1 A;  2EGC A;  2D8H A;  1OZ3 A;  2DAQ A;  2RH2 A;  1M27 C;  5D6W A;  1ZA2 B;  2RO0 A;  3FJP A;  1ZUU A;  4ZGD B;  1M5Q 1;  1UGV A;  2CS7 A;  5FWB A;  5IXF A;  6AT1 B;  3P8D A;  1WIE A;  3SD4 A;  4XU0 A;  1U06 A;  2SRC A;  4HVU A;  3M0T A;  3PMI A;  1YIJ A;  3G1J A;  4M7D F;  1Q81 R;  4EMK B;  2XD0 A;  4O5V A;  4KUI A;  4HCZ A;  3G71 Q;  1YJW T;  3GNF B;  2JW4 A;  2KE9 A;  4HCC A;  3FRN A;  1VQ7 A;  3RKX A;  3VKI A;  4FCY A;  3CCU A;  1HXD A;  1MMN A;  1CKB A;  4C8Q C;  3OYF A;  3CCL A;  4C92 B;  2LCL A;  2KMT A;  2ZCF B;  5C6S A;  4RG2 A;  3RKW A;  5LJ5 d;  4KGX B;  1KD1 R;  3CC4 Q;  4PFP A;  4ME7 A;  1G3T A;  3QYH B;  4BAC A;  2DBK A;  4C8Q F;  1Y96 A;  3E2U A;  2CYZ B;  4MZM A;  3V8J A;  1YI2 Q;  1KIK A;  2ESW A;  1M9S A;  5HKC A;  3ZL7 C;  2ENM A;  4NL2 A;  3PIP A;  4J9E A;  2CH4 A;  3JAM E;  2IG0 A;  2FYK A;  5ECA A;  3HTR A;  1I0C A;  3I5R A;  3M5A A;  4GLK A;  2BIV A;  4KGZ B;  1M90 C;  3CMA A;  2KRS A;  5GAO l;  1NPR A;  4FU6 A;  5AT1 B;  2PNI A;  4AFS C;  1RLP C;  3M59 A;  1OX9 A;  2E5K A;  2K3Y A;  3E19 A;  2H8H A;  4C8Q E;  4PJO G;  2LJ1 A;  4L59 A;  4XTY A;  2KT8 A;  2LJ0 A;  1J3T A;  3EG0 A;  3S3M A;  3OYK A;  4LNP A;  3EHR A;  1SG5 A;  2BTT A;  2V8K A;  4J5Y A;  1VQO T;  2FL7 A;  1FWZ A;  2XI9 A;  4HXJ A;  4J9D A;  1ZBJ A;  3PGG A;  4JZ4 A;  4LXC A;  2FVU A;  2YLB A;  5GAN 8;  5CAI A;  1XQH A;  3VRZ A;  5EG2 A;  3SHW A;  3HKS A;  3M9Q A;  1BB9 A;  1N9S A;  4A53 A;  1A0N B;  2HSE B;  4B9W A;  2DYI A;  2VAS A;  3EFO B;  2P0P A;  4R56 A;  1NLP C;  3FLG A;  5I21 A;  1K9M C;  2AHJ B;  1Q86 U;  1KFZ A;  2MCN A;  3C94 A;  5GMK m;  1BU1 A;  1PSF A;  1PM3 A;  4WF2 A;  1V29 B;  3MEW A;  2GTJ A;  1X01 A;  1VQL A;  4Z8A A;  5GAN e;  1WHJ A;  4M75 F;  1Q81 U;  4RTZ A;  2L3Q A;  2F2V A;  1SPK A;  2O4X B;  2KYB A;  4B6M A;  1ZSZ C;  3EG9 A;  2P84 A;  1E7O A;  3CCV T;  5CR2 A;  4F04 B;  3JB9 J;  5LJ5 j;  1JJ2 P;  2JMC A;  2K5L A;  2Y4X A;  1S72 T;  4C5I A;  4AG2 C;  4D8K A;  2DIQ A;  1M90 R;  1VQP A;  1NYF A;  1S72 A;  1TH7 A;  1FMW A;  1AWX A;  4DEX A;  3CCQ A;  4ANJ A;  1FX7 A;  2NUT A;  1BIB A;  2K2M A;  4JJD A;  1I81 A;  1OV3 A;  2EFI A;  2F2W A;  4FYY B;  1YJN A;  2RD1 A;  3BDU A;  4KUL A;  2DZC A;  1VQN A;  4LN2 A;  2CSI A;  1XOV A;  1UB4 A;  2EQI A;  2JMA A;  4OP0 A;  1M3A A;  2XMF A;  2KXD A;  2EKH A;  4PL6 A;  2V8I A;  4FSS A;  3GP8 A;  3J81 E;  1YIT A;  1M1K C;  4MMK A;  2AZS A;  2RK1 A;  3NGP A;  3REB B;  5KYU A;  5FRN A;  3CCJ Q;  3JB9 F;  2HL3 A;  4C92 A;  1JO8 A;  1YWO A;  2PZ1 A;  4DBR A;  2F5T X;  4IUR A;  1W2B A;  4A54 A;  4AT1 B;  4RUG A;  1IRE B;  2J05 A;  2W0Z A;  4EPC A;  4MZT A;  2OX7 A;  2WSE E;  3ZFJ A;  1YNZ A;  2DZ9 A;  2QEX Q;  2M9U A;  2GFU A;  2JM9 A;  4N0A A;  3CCR Q;  4KGV B;  4RTT A;  4BD3 A;  3CCE Q;  1CSK A;  3L2R A;  2FZG B;  4RCC A;  4LUD A;  2DL3 A;  1G5V A;  2QDY B;  1YJW Q;  3NMZ C;  4C92 E;  2EPD A;  3JCM b;  2QGG A;  1QCF A;  3J7A F;  5LJ5 g;  1QVG A;  2EVR A;  2OTJ A;  2J6O A;  1YCS B;  2ZPI B;  4IUT A;  4R0K A;  1UHC A;  4ZNX A;  1YIT Q;  2RHZ A;  1PG5 B;  1LOJ A;  1Q86 R;  2QQ9 A;  4N4H A;  1PNJ A;  3OS1 A;  2LCS A;  1FMK A;  2ATC B;  3X20 B;  1WDX A;  1JU5 C;  2MIO A;  2L3R A;  3X24 B;  4PJO B;  2DM1 A;  2VXF A;  2CDT A;  3FC3 A;  2FPF A;  4JS5 A;  4YTL A;  2ZPB B;  2EBP A;  2KT1 A;  2CP0 A;  1KC8 U;  3CCR A;  5LJ3 h;  5IT9 E;  4M77 C;  4HVW A;  3G6E T;  1K9M U;  4BI8 B;  2DJQ A;  2M1H A;  3E9G A;  2EYX A;  4JZ3 A;  2PQW A;  2DMO A;  4OMQ A;  1AWJ A;  3CCS T;  3I56 Q;  1QCN A;  2LX7 A;  1AWW A;  1M90 U;  4D8D A;  1VQ7 T;  1M3B A;  1EZZ B;  5KYX B;  1B34 B;  1KC8 R;  1B34 A;  3P8H A;  3M0Q A;  4XTV A;  2X3X D;  4IUP A;  3CC4 A;  1YJN Q;  4ORZ A;  4F14 A;  2H3J A;  3GNG A;  3VYH B;  1D3B B;  1YHQ Q;  5KYY B;  3CPF A;  2L3P A;  2V26 A;  5HK0 A;  4CC2 A;  3OYB A;  1I5O B;  1VQO Q;  2LCC A;  3CXC P;  1PRM C;  3INZ A;  4C5G A;  4HT8 A;  1Q7Y C;  1Y07 A;  2PVD B;  1M1K R;  2DXT A;  2A08 A;  4IKF A;  4V2S A;  3VS5 A;  5KYU B;  4XTX A;  5GMK e;  4J9H A;  4F7U F;  1XJW B;  2BUD A;  1VQL Q;  2E1H A;  2CZ1 B;  3JCM J;  1X6G A;  3CCU Q;  4JJC A;  1YIT T;  2M0Y A;  3VUB A;  5GAM e;  2AKL A;  2HQE A;  2YUQ A;  2A0F B;  1M1K U;  3NTH A;  1EIF A;  3MJX A;  1NJI R;  3UPU A;  2GCX A;  1B3Q A;  4PJN A;  4PFO A;  4A4G A;  1VQK T;  4E7J A;  4GY5 A;  2KK4 A;  4XTW A;  1M1F A;  2E64 A;  1IB8 A;  5KYN A;  3EFR A;  2OI3 A;  1NYG A;  2NUP B;  2E3I A;  2RM4 A;  1WX6 A;  2NUP A;  3S6W A;  3G4S Q;  4M75 E;  4M77 F;  1ABO A;  1ZA1 B;  1JEG A;  4LD9 K;  1KJW A;  2KBT A;  3JB9 I;  2ABL A;  1YJN T;  2KRM A;  2YRC A;  4ELZ C;  4A63 B;  3GOX A;  3OS5 A;  3CD6 T;  2DD5 A;  3A8H B;  2DTO A;  2Y90 A;  2DEU A;  4M7A G;  1K73 C;  1M8V A;  4FSX A;  3M0P A;  3C4S A;  4JRI A;  1QLY A;  4OMN A;  3UF4 A;  1RAD B;  3TQ7 P;  3KUF A;  2EYY A;  4RCB A;  1T3S A;  1KQ2 A;  2EQU A;  2LDM A;  3RMQ A;  1VQL T;  1ACM B;  5A0G A;  5LJ3 f;  1AVZ C;  2ZPF B;  4JJN K;  2YUO A;  2JUF A;  1KQS P;  1VQP T;  2HKN A;  2LTO A;  2X51 A;  1N27 A;  3QZ5 B;  1WHH A;  1NLO C;  2DL8 A;  2NWM A;  2CZ0 B;  2DJZ A;  3V8L A;  2COZ A;  2J06 A;  1PD1 A;  3CCE T;  1HSQ A;  2A28 A;  4ZTF A;  1UJY A;  2BE9 B;  1VIE A;  2M16 A;  3CC7 T;  1ZUK A;  2JTE A;  2GQV A;  1RAE B;  4DOW A;  3JRZ A;  4OB2 B;  4WTO B;  2KRO A;  3M4Y A;  5GAN 5;  2DTI A;  2M51 A;  4AFQ C;  3CEY A;  5FU7 C;  2K9G A;  4UC4 A;  3A98 A;  1Q7Y U;  3VS1 A;  1NE8 A;  1QWF A;  2ECZ A;  1MHN A;  5LJ3 j;  4AMC A;  4RTW A;  4EDU A;  2GGR A;  2YLC A;  1VQ9 Q;  1TOV A;  1B07 A;  3VS0 A;  1X6B A;  1P92 A;  1MV0 B;  2ED1 A;  4FYW B;  3L2V A;  1BBZ A;  3H0H A;  4PLI A;  1ZHI A;  3I56 T;  3TEE A;  3CCS A;  3OB9 A;  4FL6 A;  1I8F A;  1ZSZ A;  2RQW A;  4QVD A;  2VUB A;  2RN8 A;  1VQN Q;  4PJO C;  1IHW A;  1T0J A;  1M8M A;  1PKT A;  1GCQ A;  1OX8 A;  3EG3 A;  4ELY C;  2YSQ A;  5GMK i;  4J6Y A;  4MML A;  3WXM B;  3OYI A;  2GTO A;  1QVF P;  2A37 A;  4OML A;  3CPW P;  1N9R A;  1VQM T;  2HSP A;  4J9G A;  3A1P A;  4MDW A;  3TSW A;  1VQP Q;  2LT4 A;  4F7U A;  1VQ6 T;  1VYU A;  2WAC A;  3T9N A;  1N5Z A;  1YJ9 T;  1WQW A;  3FIF A;  1XNI A;  2DER A;  3I35 A;  4E47 A;  4BDZ A;  1U5S A;  2EQM A;  1UEB A;  2YT6 A;  4LD6 A;  3V7S A;  4QQ6 A;  1G83 A;  4E6R A;  3FB9 A;  1QP3 A;  1KD1 U;  2V8J A;  2RQR A;  4C0G A;  1UE9 A;  3OYL A;  1AZE A;  5FU6 C;  4EMK A;  3CCQ Q;  2QQB A;  3TCJ A;  2QA4 Q;  2DKG A;  4ZTJ A;  2DXC A;  2LMJ A;  3MKD A;  4PJM A;  3OYG A;  2O88 A;  3CCL T;  1NM7 A;  1GL5 A;  2BKD N;  4IUU A;  2EJG A;  1OEB A;  2LRQ A;  3QSU A;  1YJ9 A;  1YWP A;  2VYT A;  3CC4 T;  1NJI C;  2HDA A;  3H0I A;  3X25 B;  4MZP A;  2DO3 A;  2EYZ A;  3TVT A;  2MK5 A;  4C92 D;  2VGM A;  3ZEH A;  2K7A A;  5L23 A;  4JPB W;  1KQ1 A;  2QAZ A;  1VIF A;  5CKB A;  4Y91 A;  2JT4 A;  3C95 A;  4GLM A;  1K0X A;  4VUB A;  1ZLM A;  3PVQ A;  3CCE A;  2A7Y A;  1D0X A;  2CT3 A;  5J39 A;  4RMO A;  2E41 A;  2Z0W A;  2EAY A;  1UGP B;  2JM8 A;  3OSV A;  3VV0 A;  2O9S A;  7AT1 B;  3GF5 A;  1WGS A;  4C8Q B;  3EG9 B;  1Q7Y R;  3QUI A;  2E12 A;  1W1F A;  5DLQ E;  2QA4 A;  2EJ9 A;  3EG2 A;  2L8D A;  5LL6 S;  4PJJ A;  3UA6 A;  5C0M A;  1U1T A;  3EHQ A;  3OMG A;  4CRI A;  1YJ9 Q;  4PJO E;  5CIU A;  2KGT A;  2RQT A;  1VYV A;  1WJS A;  1D0Z A;  1RLQ C;  1TG0 A;  5HCK A;  2MI6 A;  5DM7 R;  3SWN A;  2CUB A;  2ED0 A;  2LX9 A;  2L5Q A;  1R8O B;  2RI5 A;  3CPW S;  3SWN B;  3SDZ A;  3HP9 A;  1NEB A;  1YHQ A;  2XIC A;  1Y71 A;  3HRS A;  1WZO A;  2PUK B;  2BZ8 A;  2DXB A;  1VQ9 A;  5AYF A;  1AWO A;  4BI3 A;  3JCM g;  4OGC A;  4F7U G;  3CCL Q;  2O31 A;  2DVE A;  1D09 B;  1MMA A;  1YFN A;  2DL7 A;  1YI2 T;  2KAF A;  2HBW A;  2DX1 A;  1VQ5 T;  2R5A A;  3H41 A;  4JUV A;  2P4R A;  3SEM A;  4M7A E;  3LX7 A;  2OTL T;  4RG8 A;  3V8K A;  5KYW B;  3GPL A;  4LDU A;  1RAI B;  1ARK A;  5GAO n;  4QVZ A;  4RKU E;  1WQ7 A;  5IXB A;  4P5N A;  1JXO A;  3N5B B;  1S72 Q;  1RAA B;  2DVJ A;  3BFM A;  5FLX E;  3CCS Q;  2D8J A;  1BK2 A;  1C1A A;  1VQ7 Q;  9ATC B;  2GQI A;  2ZAE A;  3WVE B;  5GAN h;  3TU4 K;  2H3E B;  2RJC A;  3CD6 Q;  4A4K A;  4M77 A;  1NEG A;  2WSF E;  2C0T A;  1W2B S;  3G7Z A;  2VVK A;  3I55 T;  1BI1 A;  1MMD A;  1PCX A;  2K2V A;  4J9B A;  1Y96 B;  3JCM W;  1IGQ A;  2F69 A;  3OS2 A;  2F1L A;  3P8B B;  5LJ3 g;  2ROL A;  1C0M A;  5LJ5 e;  1NZ9 A;  4XQ3 A;  3M4G A;  2P4T A;  3JSC A;  2K57 A;  3JV3 A;  4OMM A;  4M78 B;  3MP1 A;  1VQ6 A;  3CXC S;  4JDS A;  2HL5 C;  5CK9 A;  1QVF A;  4HT9 A;  4RTX A;  2KEA A;  1SHG A;  4C0D B;  1TTH B;  1VQ8 Q;  1WA7 A;  2C0O A;  3I9Q A;  3PTA A;  3ZBD A;  3QYG B;  2QGF B;  5J3B A;  3JB9 H;  4BY6 C;  2VGN A;  1IZ6 A;  2VB6 A;  1ABQ A;  4EMK C;  2KR3 A;  3FJ5 A;  3ULR B;  2HMA A;  2CZ6 B;  1VQ5 A;  4F7U E;  3I5S A;  1WJR A;  1D1A A;  4XTU A;  4EMG A;  3L2Q A;  1Y7X A;  2D1X A;  5LJ5 h;  1G8X A;  1MV3 A;  4M7A F;  1AHJ B;  4C5H A;  3OYE A;  2LVM A;  1IRX A;  3EFO A;  2E4H A;  4KH0 B;  1MNE A;  4XU2 A;  2O9V A;  4C92 C;  2LNH B;  4XU3 A;  2HQH A;  2MAM A;  1IXD A;  4B9X A;  3CCQ T;  1BYM A;  2O4X A;  1ZUY A;  2LQN A;  5I2M A;  3A8O B;  1OUL A;  1ZSG A;  4C92 G;  2X35 A;  5GAM j;  2K6D A;  1HD3 A;  1TU0 B;  5D7U A;  1AOJ A;  4PJO A;  4GBQ A;  3QWX X;  5L8R E;  3E1S A;  5FWC A;  3VS4 A;  3QHS A;  2RQU A;  4J7I A;  3S3N A;  2EGE A;  3RBB B;  2DIG A;  1WNL A;  3LH5 A;  4QQD A;  2PU9 B;  4M75 D;  3V7C A;  5EC7 A;  5CVI A;  3OS0 A;  3VS3 A;  2XHC A;  2RMO A;  4M78 C;  1YIJ Q;  1M2V B;  1U3O A;  5IHN A;  1UGS B;  2L3S A;  1OYX A;  1VQ4 A;  1KG1 A;  3EGD B;  2CP7 A;  5GAO p;  2MWP A;  1Y57 A;  3URG A;  3OY9 A;  3MEU A;  3CCR T;  1VUB A;  4BDY A;  2KVQ G;  4XU1 A;  1MMG A;  3DB4 A;  3QG1 A;  1GCQ C;  3NFC A;  3X28 B;  4DBQ A;  8ATC B;  1Q82 C;  3DLL A;  1M1G A;  2LNV A;  3RER A;  3CD6 A;  4FYX B;  1AEY A;  2KQW A;  1SKU B;  3JCM d;  4X9D A;  3L2U A;  3MHX A;  4CI0 C;  2XID A;  1H3Z A;  2EQJ A;  4OMO A;  2LQ8 A;  2FHD A;  1FXX A;  2GBQ A;  1AD5 A;  1QVP A;  4M75 A;  3QBY A;  3QXE B;  2JVV A;  1UGR B;  1JJ2 A;  4OMF B;  1JXM A;  3DKM A;  1EFN A;  2SEM A;  1KHI A;  3OYH A;  4OB0 B;  2DBM A;  2KYM A;  4Y92 A;  5IN1 A;  3OYD A;  1QKW A;  4OGE A;  1BIA A;  2XDD A;  2MMP A;  1VOM A;  2EJF A;  3VJP A;  4HKE A;  1VQ8 A;  2NYS A;  2R57 A;  3MEA A;  1VQK Q;  3CCV A;  2JOY A;  4DQ2 A;  2J6K A;  5A0L A;  1N8R R;  2ZPG B;  3JB9 D;  3C0C A;  3PNW C;  1BCM A;  2GFA A;  4PLL A;  3JCM P;  5GAM h;  3VUZ A;  1BKB A;  3OBW A;  3MCA B;  5LJ3 d;  2X9H A;  2HNI A;  2XDP A;  1QMC A;  2MYS A;  1I07 A;  3I56 A;  3KXT A;  1QVG P;  3QO3 A;  1WHL A;  3M0U A;  4X9C A;  4BB7 A;  3CC2 T;  1PWT A;  2LQW A;  4N0A C;  3LYI A;  3UWN A;  4PK4 A;  2OTJ Q;  1SSH A;  3OYM A;  1S1N A;  2EW3 A;  4QKU A;  3QII A;  5IHI A;  2DE0 X;  3OW2 A;  2P0K A;  3PMT A;  1MGQ A;  3M0S A;  3PFS A;  3G71 T;  2WSC E;  2B8A A;  2JNG A;  4M7D A;  2COY A;  3QJ6 A;  1GFC A;  3MPU B;  3EH1 A;  2JTM A;  2QK0 A;  1OOT A;  2FZK B;  4M7A B;  1X6O A;  4DEY A;  2LT1 A;  2DXU A;  1TWB A;  2FPE A;  1VQ6 Q;  4J83 A;  2K3X A;  4N4G A;  2XKO C;  1SHF A;  5GAO m;  4II1 A;  2MWO A;  1U1S A;  2QI2 A;  3U23 A;  3ME9 A;  4CC4 B;  2X4J A;  3KFV A;  2QEX A;  1Y0M A;  1KK7 A;  3JCM e;  4Y28 E;  1FYN A;  2RQV A;  1ZBX A;  1QKX A;  3PT9 A;  1PRL C;  3CBP A;  1X2K A;  1WYX A;  4O6J A;  1PC0 A;  4KH1 B;  5GAN j;  3LWI A;  3OYN A;  2ZPE B;  1D1B A;  1N8R C;  2FEI A;  1RI9 A;  1M30 A;  2VC8 A;  3PE0 A;  3A8G B;  2K79 A;  4BUG A;  2DLP A;  3HRT A;  2YRV A;  4PJO D;  1LPL A;  3OYJ A;  4NL3 A;  2AIR B;  3JCM h;  3BW1 A;  2PUO B;  1VQO A;  1Q82 U;  3JCM Q;  1VA7 A;  3LGL A;  3OQ5 A;  2NLU A;  1U8R A;  5GMK l;  2K5I A;  1OI1 A;  2RJF A;  2E70 A;  4HA8 A;  1N8R U;  5FW9 A;  3C12 A;  3OYC A;  2JTF A;  1GRI A;  3AT1 B;  1WFW A;  3EGX B;  1SEM A;  1G3Y A;  2JXB A;  1MUZ A;  4QW2 A;  1YIJ T;  1IHV A;  1G3S A;  5KYW A;  4M7D D;  3HRU A;  4WCI A;  3OYA A;  1Q82 R;  4QVC A;  4A4H A;  2J7I A;  2EYW A;  1VQN T;  3H8Z A;  4OMP A;  2HZY A;  4HCK A;  1NPP A;  1TSF A;  1FMV A;  2EYQ A;  2AK5 A;  3M53 A;  2DA9 A;  2GF7 A;  3QDR B;  3NTK A;  1PD0 A;  1VQM Q;  2E10 A;  2NUZ A;  2RHX A;  4DOV A;  4X1V A;  2GNC A;  3L42 A;  5DY9 A;  1WXT A;  3FEO A;  3JB9 G;  1H8K A;  4C8Q G;  4M7D G;  2X4X A;  2J6F A;  5FRM A;  3EGX A;  1TUC A;  2CP5 A;  2D0Q B;  4M7D E;  4RTY A;  1M2O A;  4Z88 A;  4ZN1 A;  2CGH A;  1D0Y A;  1O75 A;  2BZX A;  2XU8 A;  4M77 D;  2DFU A;  3PVL A;  1K8A U;  1UHF A;  1Z9Q A;  3EGU A;  1WPY A;  2FRY A;  3CME T;  1UGQ B;  5KYY A;  1KD1 C;  3AHU A;  1D3B A;  4LE9 A;  5IAY A;  3MEV A;  3BDL A;  3KBG A;  4Q5W A;  3CXC A;  3UDC A;  2OTL Q;  2LC4 A;  3BE3 A;  1PKS A;  1G3W A;  2CP3 A;  5GAO r;  1I1J A;  4EMH A;  2BE7 D;  2MOX A;  2QQS A;  1X2Q A;  4M7A A;  3QPH A;  1YI2 A;  2ZGW A;  4PJL A;  3NPF A;  3MO8 A;  2L2P A;  4D6W A;  1GCP A;  2KDS A;  2L89 A;  2D6F A;  2QTX A;  2E65 A;  3QDF A;  4JLG A;  1AZG B;  5GAN 4;  1UFF A;  1XTD A;  1PSE A;  2YDL A;  5FU6 B;  4FM4 B;  2X3W D;  4C92 F;  1VQ8 T;  3CC2 Q;  1NG2 A;  2RHY A;  4M75 C;  3GIB A;  1K73 U;  2FO0 A;  4M77 E;  3CMA T;  4R55 A;  3E9F A;  3UAT A;  2F5K A;  5GAN f;  1B7T A;  4E7H A;  1Q95 G;  3MP6 A;  1QWE A;  5HY6 A;  1WXB A;  1AT1 B;  1V1C A;  3JCM f;  1C6V X;  1K76 A;  2E6Z A;  4FIB A;  2V1R A;  4IIO A;  4F7U B;  2P0Q A;  1LJO A;  2A3L A;  2M0O A;  1IGU A;  4J9I A;  3A8L B;  1QCO A;  2QAS A;  4J8O A;  4E7K A;  2RPN A;  3CC7 Q;  3OW2 S;  3V7R A;  3VS6 A;  4E7Z A;  4M77 B;  4CC7 A;  2Y4Y A;  4RTU A;  1M4Z A;  5CKD A;  2OAU A;  5GAM d;  1D1C A;  1KSW A;  5KE3 A;  3TSZ A;  4M7A C;  1E6G A;  1DJ7 B;  3LH0 A;  1MND A;  5GAN 6;  4NOY A;  2DL5 A;  4ZGJ B;  2YWW A;  2HD0 A;  3JCM c;  1YN8 A;  5LJ5 f;  2HKQ B;  4FT4 A;  2DEQ A;  3F70 A;  2DL4 A;  4M7D C;  3VS2 A;  2OTJ T;  2LZ6 B;  2X4Y A;  5GAN 2;  2ZPH B;  5GJW B;  2L0A A;  1M3C A;  3CBO A;  4JRK A;  1VQ9 T;  3O8V A;  2DK3 A;  3QZ9 B;  3X26 B;  5GAN 3;  4CC3 A;  4M75 B;  2CP6 A;  3EG1 A;  1E6H A;  5GMK h;  2PVG B;  1UEC A;  1X69 A;  2VKN A;  3H9N A;  5I22 A;  3MET A;  1BI3 A;  5D6X A;  4C0Z A;  3L2Z A;  4XK8 E;  2FZC B;  3SFM A;  1OQK A;  4ESR A;  2HQX A;  4ZGE B;  4J6W A;  2VWF A;  1KC8 C;  1Q81 C;  1BI0 A;  2R58 A;  1BCO A;  3WVD B;  2CUD A;  1OU8 A;  3M56 A;  1GBR A;  1WHK A;  4JLI A;  2B86 A;  1K73 R;  5CQX A;  4M77 G;  2IVW A;  4HVV A;  3TRE A;  1YP5 A;  1WXU A;  3G71 A;  1K4U S;  1UTI A;  2KSS A;  3JCM V;  4JRP A;  5KYX A;  1GBQ A;  3VU3 C;  3G4S A;  1W2B P;  3RIR A;  2RA2 A;  1K0S A;  3L2W A;  1H64 1;  2NUT B;  1Q86 C;  5GMK j;  5IH2 A;  3M57 A;  5KCO A;  4K11 A;  1WHM A;  1OU9 A;  3CME A;  3D7S B;  4LUE A;  3I55 Q;  1X27 A;  4DBF A;  1TUD A;  4J9F A;  2V1Q A;  1LNX A;  1WHG A;  1LVK A;  4OF1 A;  4BY6 B;  1K1Z A;  1G2B A;  2RHU A;  3G6E Q;  2AT1 B;  1R0B G;  4M7A D;  1BI2 A;  1SF9 A;  4XAX B;  2PVO B;  3ER0 A;  2W10 A;  1QP2 A;  4M4Z A;  3OYY A;  2KY9 A;  3CC2 A;  4PKC C;  4OB3 B;  1K9A A;  2DNU A;  3DLM A;  4M78 A;  4DBH A;  4PFZ A;  1RAB B;  2COW A;  4C0F A;  4L5G A;  4BI4 A;  5A2Q E;  2D0N A;  2G3R A;  4Z02 A;  4BE1 A;  4E7S A;  2OTL A;  3VRY A;  4OVA A;  3UT1 A;  4L6V 5;  3R6O A;  4QT7 A;  3HFN A;  3HL8 A;  4PJO F;  3EGD A;  3O5Z A;  3S3O A;  1T0H A;  5GAM f;  2RK2 A;  5A0D A;  1T3L A;  2RI2 A;  4F16 A;  1SRL A;  2I2L A;  1V76 A;  3SWN C;  4LDV A;  3RES A;  2FPD A;  1X43 A;  2HEQ A;  3HHT B;  1N6A A;  3Q1J A;  2YRD A;  3ASK A;  4DA4 A;  3LGF A;  5CQY A;  3VS7 A;  1YJW A;  4KUD K;  1UJ0 A;  1RL2 A;  3CCM Q;  3CCU T;  4J6X A;  2E5Q A;  4JJB A;  4HCB A;  2DRK A;  5LJ3 e;  3CME Q;  2JN0 A;  3FDR A;  2FRW A;  3OSS C;  5DLO A;  4JS4 A;  1OPL A;  2CP2 A; 
#chains in the Genus database with same CATH homology
 4E7I A;  2BKD N;  1ZBX A;  4IUU A;  5LJ5 j;  4IUQ A;  5FU7 B;  3PT9 A;  2K5L A;  2EJG A;  4C5E A;  2Y4X A;  3CBP A;  1S72 T;  4C5I A;  2LRQ A;  3QSU A;  4O6J A;  1YJ9 A;  2DIQ A;  4M78 D;  2VYT A;  5GAM g;  5GAN j;  3LWI A;  5KE2 A;  3CC4 T;  1VQP A;  3OYN A;  1S72 A;  1TH7 A;  4PNO A;  2ZPE B;  2VV5 A;  3CCQ A;  4BE0 A;  1NJI C;  1FX7 A;  1N8R C;  2EIF A;  3X25 B;  1BIB A;  3LW5 E;  5GAN d;  1I81 A;  4MZP A;  2DO3 A;  2EFI A;  2VC8 A;  3A8G B;  2RJE A;  5CKE A;  4BUG A;  4C92 D;  3A5Z B;  1YJN A;  3HRT A;  2YRV A;  2VGM A;  2RD1 A;  3ZEH A;  4A4E A;  4PJO D;  1RI0 A;  3BDU A;  4KUL A;  5I2S A;  2DZC A;  1VQN A;  3CCJ A;  1KQ1 A;  3OYJ A;  2X4W A;  1VIF A;  5CKB A;  4Y91 A;  4NL3 A;  3C95 A;  3JCM h;  3BW1 A;  1UB4 A;  1OZ2 A;  1XOV A;  3M55 A;  4VUB A;  3CCE A;  2A7Y A;  4OP0 A;  5J39 A;  4RMO A;  5GAO q;  2PUO B;  3OA6 A;  2E41 A;  1VQO A;  1Q82 U;  3JCM Q;  2EAY A;  5D6Y A;  1UGP B;  1VQ4 T;  4XTZ A;  3LGL A;  3OQ5 A;  2NLU A;  1U8R A;  3OSV A;  3VV0 A;  4PL6 A;  2V8I A;  3GP8 A;  3GF5 A;  1YHQ T;  3J81 E;  1YIT A;  1M1K C;  1WGS A;  2K5I A;  1OI1 A;  1X75 C;  2RI3 A;  2RJF A;  4MMK A;  4C8Q B;  5GMK l;  2RK1 A;  3RMS A;  2E70 A;  4HA8 A;  1N8R U;  1I5L A;  3QUI A;  3C12 A;  2E12 A;  3OYC A;  4N4I A;  5DLQ E;  2QA4 A;  2EJ9 A;  2JTF A;  3LLR A;  3LWH A;  2JZ2 A;  4BE2 A;  5FRN A;  2L8D A;  3JB9 F;  2ZZD A;  5LL6 S;  2EQK A;  4C92 A;  4ATO A;  2K5F A;  5C0M A;  5M9O A;  2CZ7 B;  1G3Y A;  1U1T A;  4QW2 A;  3OBY A;  3QKJ A;  1YIJ T;  1G3S A;  3OMG A;  4M7D D;  3HRU A;  4FT2 A;  3OYA A;  1KHC A;  3PIO A;  4CRI A;  2F5T X;  4IUR A;  1W2B A;  4NS5 A;  5CIU A;  4JRQ A;  4A54 A;  4PJO E;  2DTH A;  5CO7 A;  4QVC A;  4A4H A;  1IRE B;  4KT0 E;  4EPC A;  1VQN T;  1WJS A;  3H8Z A;  4MZT A;  5CKF A;  1I4K 1;  2WSE E;  1NPP A;  2MI6 A;  4QQG A;  5DM7 R;  3JCM X;  3ZFJ A;  3SWN A;  5J26 A;  4X34 A;  4C0D C;  2LX9 A;  2L5Q A;  2RI5 A;  1R8O B;  2DZ9 A;  2EYQ A;  2MF2 A;  2M9U A;  2GFU A;  3M53 A;  3SDZ A;  3HP9 A;  3SWN B;  2GF7 A;  4N0A A;  3QDR B;  4BD3 A;  1QVF S;  3NTK A;  5KH6 A;  2E10 A;  3L2R A;  1YHQ A;  3NTI A;  2XIC A;  2RHX A;  1Y71 A;  4DOV A;  3HRS A;  2PUK B;  3HFO A;  2FB7 A;  4RCC A;  5CKH A;  3L42 A;  5DY9 A;  2VXE A;  2DXB A;  4M7D B;  3FEO A;  3OMC A;  2QEX T;  2C06 A;  1VQ9 A;  3JB9 G;  4C8Q G;  3AHU A;  3CCM T;  4M7D G;  2X4X A;  5AYF A;  1KQS A;  2QDY B;  1G5V A;  1WJQ A;  4C92 E;  5FRM A;  2D0Q B;  3A8M B;  3JCM g;  4OGC A;  4BI3 A;  4F7U G;  3JCM b;  4M7D E;  3J7A F;  5LJ5 g;  5KCH A;  2DVE A;  1QVG A;  2OTJ A;  2ZPI B;  4IUT A;  2CGH A;  4ZN1 A;  1YI2 T;  2KAF A;  3MP8 A;  2XG8 D;  2RHZ A;  1VQ5 T;  1O75 A;  2XU8 A;  4M77 D;  1K8A U;  2R5A A;  1LOJ A;  1SSF A;  2QQ9 A;  4JUV A;  4N4H A;  4M7A E;  4TVR A;  3OS1 A;  3LX7 A;  2OTL T;  4RG8 A;  3V8K A;  3X20 B;  3GPL A;  1JRI A;  3HSB A;  4PJO B;  3X24 B;  2L3R A;  4LDU A;  1WPY A;  5GAO n;  2VXF A;  4QVZ A;  1UGQ B;  3HPW A;  4J7F A;  3FC3 A;  4RKU E;  1WQ7 A;  3CME T;  1NJI U;  4JS5 A;  1D3B A;  1KD1 C;  3EAE A;  4YTL A;  5IAY A;  3MEV A;  2ZPB B;  3BDL A;  3KBG A;  4Q5W A;  3CXC A;  4P5N A;  3UDC A;  1KC8 U;  3DB3 A;  2RHI A;  3N5B B;  3CCR A;  2K4Y A;  3RUX A;  2LC4 A;  3M54 A;  5LJ3 h;  5IT9 E;  2RJD A;  4KBM B;  4M77 C;  3BFM A;  1G3W A;  5FLX E;  5FRO A;  5GAO r;  3G6E T;  1K9M U;  3I55 A;  4EMH A;  4BI8 B;  2M1H A;  3CPW S;  4LDY A;  3E9G A;  1JB0 E;  3WVE B;  5GAN h;  2QQS A;  3TU4 K;  2RJC A;  4M7A A;  3QPH A;  4A4K A;  4M77 A;  2WSF E;  3CBM A;  2PQW A;  1W2B S;  1YI2 A;  3G7Z A;  2O01 E;  2ZGW A;  3I55 T;  1BI1 A;  3CCS T;  1M90 U;  3JCM W;  2K2V A;  1Y96 B;  2EKO A;  1VQ7 T;  3MO8 A;  2HBP A;  2F69 A;  4D6W A;  3OS2 A;  3P8B B;  5LJ3 g;  2KDS A;  2L89 A;  5LJ5 e;  1B34 B;  2D6F A;  2QTX A;  1B34 A;  1NZ9 A;  3P8H A;  4XTV A;  3SB2 A;  4XQ3 A;  2D9T A;  3M4G A;  4IUP A;  2P4T A;  2QQR A;  3JSC A;  3CC4 A;  2E65 A;  2K57 A;  4JLG A;  5GAN 4;  1XTD A;  1PSE A;  2E6N A;  4C8Q D;  5CCA A;  4M78 B;  2H3J A;  4FM4 B;  5FU6 B;  3MP1 A;  3GNG A;  3VYH B;  4A4F A;  1D3B B;  2HAX A;  1VQ6 A;  4C92 F;  3CXC S;  4JDS A;  1VQM A;  1VQ8 T;  3CPF A;  1ZQ1 A;  3M58 A;  2RHY A;  5HK0 A;  4M75 C;  5HK3 A;  5CK9 A;  1QVF A;  1KQS S;  3CPW A;  2R5M A;  4LDW A;  3OYB A;  4HT9 A;  3GIB A;  2LCC A;  3INZ A;  1K73 U;  3RKY A;  3VYG A;  4C5G A;  4M77 E;  4M78 F;  4C0D B;  4HT8 A;  3CMA T;  3PTA A;  4R55 A;  3E9F A;  3ZBD A;  3QYG B;  3J80 E;  1Q7Y C;  1Y07 A;  2PVD B;  1W4S A;  4ZN3 A;  2DXT A;  2LQK A;  1YCY A;  5J3B A;  4M75 G;  3JB9 H;  2F5K A;  1GXI E;  4BY6 C;  5GAN f;  2VGN A;  4IKF A;  1IZ6 A;  1QVG S;  4V2S A;  4EMK C;  4XTX A;  4IUV A;  5GMK e;  4E7H A;  3MP6 A;  4F7U F;  2BUD A;  5HY6 A;  2E1H A;  2CZ1 B;  3JCM J;  2CZ6 B;  1VQ5 A;  4F7U E;  3JCM f;  1WJR A;  2E6Z A;  4XTU A;  4EMG A;  4FIB A;  1YIT T;  1YBY A;  3L2Q A;  1Y7X A;  1HK9 A;  5LJ5 h;  3VUB A;  5GAM e;  2HQE A;  4M7A F;  4OB1 B;  1AHJ B;  4C5H A;  3OYE A;  2LVM A;  5GAN 7;  4F7U B;  1M1K U;  2QXF A;  3NTH A;  4M78 G;  3GLX A;  1EIF A;  4XU2 A;  3CCM A;  2P0Q A;  1LJO A;  4C92 C;  2QQA A;  2A3L A;  2M0O A;  1O9S A;  4XU3 A;  3UPU A;  2GCX A;  2MAM A;  3A8L B;  4A4G A;  1VQK T;  4B9X A;  4J8O A;  3CCQ T;  4E7J A;  4E7K A;  4GY5 A;  1BYM A;  2O4X A;  5I2M A;  1JBM A;  2EWN A;  2KK4 A;  2QA4 T;  3A8O B;  4XTW A;  1M1F A;  3OW2 S;  3V7R A;  4C92 G;  2E64 A;  2X35 A;  5GAM j;  5GAN g;  4M77 B;  1VQK A;  2XDB A;  2Y4Y A;  3EFR A;  1M4Z A;  3H6Z A;  4PJO A;  5CKD A;  3G4S T;  2OAU A;  5GAM d;  3BY7 A;  3EFS A;  5KE3 A;  5L8R E;  4M7A C;  2RM4 A;  3E1S A;  2XK0 A;  1DJ7 B;  3LH0 A;  5GAN 6;  3QHS A;  1K8A C;  4NOY A;  4J7I A;  3S3N A;  2RB6 A;  4ZGJ B;  3S6W A;  4M75 E;  4M78 E;  4M77 F;  2DIG A;  1WNL A;  4E7L A;  2HD0 A;  2DPP B;  2CKK A;  3L1A A;  1JJ2 S;  4QQD A;  3CC7 A;  4LD9 K;  2PU9 B;  3JCM c;  3JB9 I;  4M75 D;  5LJ5 f;  2DD4 A;  3V7C A;  3G6E A;  4FT4 A;  1YJN T;  2DEQ A;  3F70 A;  4LDX A;  4M7D C;  5CVI A;  4ELZ C;  2OTJ T;  2YHT A;  1QW1 A;  3GOX A;  3QJY A;  3CCJ T;  3OS0 A;  2X4Y A;  3OS5 A;  2XHC A;  5GAN 2;  2ZPH B;  4C8Q A;  2DD5 A;  3CD6 T;  4MDX A;  3A8H B;  4M78 C;  1VQ9 T;  3CBO A;  4JRK A;  3O8V A;  2DK3 A;  2DTO A;  2Y90 A;  1OZ3 A;  3QZ9 B;  3X26 B;  5GAN 3;  2DAQ A;  2RH2 A;  4M75 B;  5D6W A;  1K73 C;  1UGS B;  4M7A G;  2RO0 A;  3FJP A;  4FSX A;  1M8V A;  3C4S A;  1OYX A;  5GMK h;  4ZGD B;  2PVG B;  1M5Q 1;  1VQ4 A;  4JRI A;  1KG1 A;  2CS7 A;  5GAO p;  2MWP A;  3MET A;  1BI3 A;  5D6X A;  4C0Z A;  3L2Z A;  3KUF A;  3P8D A;  3SD4 A;  4XU0 A;  4XK8 E;  3URG A;  4RCB A;  3OY9 A;  3MEU A;  3CCR T;  3SFM A;  3PMI A;  1YIJ A;  1VUB A;  1KQ2 A;  2EQU A;  2HQX A;  4ZGE B;  4M7D F;  4BDY A;  2LDM A;  4J6W A;  3RMQ A;  2KVQ G;  4XU1 A;  1KC8 C;  4EMK B;  1Q81 C;  1VQL T;  2XD0 A;  3DB4 A;  4O5V A;  3QG1 A;  5A0G A;  4KUI A;  1BI0 A;  5LJ3 f;  3NFC A;  4HCZ A;  2ZPF B;  4JJN K;  2R58 A;  1YJW T;  3X28 B;  3GNF B;  3WVD B;  1Q82 C;  3DLL A;  1M1G A;  2JUF A;  2LNV A;  3FRN A;  4HCC A;  3M56 A;  1VQP T;  2LTO A;  4JLI A;  3CD6 A;  3RER A;  2KQW A;  1N27 A;  3QZ5 B;  3JCM d;  1VQ7 A;  4X9D A;  3RKX A;  3L2U A;  3VKI A;  3MHX A;  4CI0 C;  2XID A;  3CCU A;  1H3Z A;  1HXD A;  2CZ0 B;  2DJZ A;  2EQJ A;  3V8L A;  2LQ8 A;  2FHD A;  4C8Q C;  1FXX A;  3CCE T;  5CQX A;  4M77 G;  3OYF A;  2IVW A;  3TRE A;  4ZTF A;  3CCL A;  1QVP A;  4M75 A;  4C92 B;  2LCL A;  2KMT A;  3QBY A;  2ZCF B;  3G71 A;  5C6S A;  4RG2 A;  1VIE A;  2M16 A;  3RKW A;  3QXE B;  2JVV A;  3CC7 T;  2KSS A;  3JCM V;  5LJ5 d;  1UGR B;  2GQV A;  4JRP A;  1JJ2 A;  4OMF B;  3DKM A;  4DOW A;  4ME7 A;  1G3T A;  3QYH B;  3JRZ A;  3VU3 C;  4C8Q F;  1KHI A;  3OYH A;  3G4S A;  4BAC A;  4OB0 B;  4OB2 B;  1Y96 A;  2RA2 A;  2CYZ B;  3RIR A;  5IN1 A;  3OYD A;  4OGE A;  3M4Y A;  4MZM A;  1BIA A;  3V8J A;  1H64 1;  2DTI A;  5GAN 5;  2MMP A;  2XDD A;  3L2W A;  1M9S A;  5HKC A;  3CEY A;  1Q86 C;  5FU7 C;  5GMK j;  2EJF A;  4NL2 A;  3VJP A;  3PIP A;  3M57 A;  4HKE A;  5KCO A;  3JAM E;  1VQ8 A;  2R57 A;  2IG0 A;  2FYK A;  3MEA A;  4UC4 A;  3CCV A;  2JOY A;  4DQ2 A;  3CME A;  1Q7Y U;  5A0L A;  4GLK A;  2ZPG B;  3M5A A;  3JB9 D;  1NE8 A;  2BIV A;  3PNW C;  1M90 C;  3CMA A;  1MHN A;  5GAO l;  2GFA A;  4PLL A;  1LNX A;  5LJ3 j;  1NPR A;  4FU6 A;  4OF1 A;  5GAM h;  3JCM P;  4BY6 B;  4EDU A;  3VUZ A;  1BKB A;  3M59 A;  3OBW A;  2K3Y A;  2YLC A;  3MCA B;  2RHU A;  5LJ3 d;  2HNI A;  3E19 A;  2XDP A;  3I56 A;  4C8Q E;  1P92 A;  4PJO G;  3KXT A;  4M7A D;  1BI2 A;  4L59 A;  3QO3 A;  4XTY A;  4X9C A;  3L2V A;  4BB7 A;  3S3M A;  4XAX B;  3OYK A;  3CC2 T;  2PVO B;  4PLI A;  3ER0 A;  1ZHI A;  4N0A C;  3LYI A;  4J5Y A;  1QP2 A;  2V8K A;  3TEE A;  3UWN A;  3OYY A;  3I56 T;  3CCS A;  2KY9 A;  3OB9 A;  4FL6 A;  1VQO T;  2FL7 A;  4PKC C;  4OB3 B;  1FWZ A;  1I8F A;  3OYM A;  3CC2 A;  3DLM A;  2XI9 A;  4QVD A;  2VUB A;  4PJO C;  3PGG A;  4M78 A;  3QII A;  2FVU A;  2YLB A;  5GAN 8;  5CAI A;  1XQH A;  5EG2 A;  4ELY C;  3OW2 A;  4C0F A;  2P0K A;  3HKS A;  3PMT A;  4L5G A;  4BI4 A;  5GMK i;  5A2Q E;  1MGQ A;  2G3R A;  3M9Q A;  4J6Y A;  4MML A;  4Z02 A;  3WXM B;  3OYI A;  4BE1 A;  3PFS A;  2OTL A;  4OVA A;  3G71 T;  2WSC E;  3UT1 A;  1N9S A;  2B8A A;  2JNG A;  4L6V 5;  4A53 A;  4M7D A;  1N9R A;  3R6O A;  4B9W A;  1VQM T;  3QJ6 A;  4MDW A;  3HFN A;  3HL8 A;  2LT4 A;  4PJO F;  4F7U A;  1VQ6 T;  2P0P A;  2WAC A;  3T9N A;  4R56 A;  3S3O A;  1YJ9 T;  3FLG A;  2JTM A;  1WQW A;  5GAM f;  3FIF A;  2RK2 A;  5A0D A;  5I21 A;  1XNI A;  1K9M C;  4E47 A;  4M7A B;  2AHJ B;  1X6O A;  2RI2 A;  1Q86 U;  2LT1 A;  4BDZ A;  2I2L A;  3SWN C;  2DXU A;  3C94 A;  4LDV A;  5GMK m;  3RES A;  1PSF A;  4WF2 A;  1V29 B;  2EQM A;  3MEW A;  4J83 A;  1UEB A;  4LD6 A;  3V7S A;  4QQ6 A;  2K3X A;  4N4G A;  3HHT B;  3FB9 A;  1X01 A;  1QP3 A;  1KD1 U;  1VQL A;  2XKO C;  2V8J A;  5GAO m;  1N6A A;  4M75 F;  5GAN e;  3Q1J A;  4II1 A;  2MWO A;  1Q81 U;  1U1S A;  3ASK A;  2QI2 A;  3LGF A;  5CQY A;  4C0G A;  4DA4 A;  3ME9 A;  1YJW A;  4KUD K;  3OYL A;  5FU6 C;  4EMK A;  2X4J A;  1RL2 A;  2O4X B;  3CCU T;  4J6X A;  2E5Q A;  2QQB A;  3TCJ A;  2QEX A;  2DKG A;  4ZTJ A;  4HCB A;  2DXC A;  5LJ3 e;  3OYG A;  2JN0 A;  3FDR A;  3JCM e;  3OSS C;  5DLO A;  4Y28 E;  3CCL T;  4JS4 A;  3CCV T;  5CR2 A;  3JB9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...