3E9LA

Crystal structure of human prp8, residues 1755-2016
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
b'EPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title Structure and function of an RNase H domain at the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, splicing
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12134 PRP8_domainIV PRP8 domain IV core
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3e9lA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3e9lA01
4JK9A 4JKFA 4ILHA 4JKGB 3E9PA 3SBGA 3E9OA 4JKAA 4JKDA 3ENBA 4JKEA 4JKGA 4JKCA 3SBTA 4JK7A 3E9LA 4ILJA 4JKHA 3E66A 4JK8A 4JKBA 4ILGB
chains in the Genus database with same CATH superfamily
1BO5O 4ISEA 2OZSA 2VQFK 2YHAA 3A5NC 2E2PA 1VSIA 2NRWA 5HLFA 1RT1A 5LJWA 2PYLA 4CIEA 3PVLA 1YVNA 4C8OA 3JXUA 4RW4A 3ZSYA 3ALYA 5FPDA 4IXCA 3LZJA 3W0LA 2X6SA 3J7AP 1JL1A 3VOVA 1KC7A 3LZIA 2KLAA 4Q0BA 3VEWA 2J4RA 2HNDA 2B4JA 3HVTA 2EMSA 4CZKA 2VWJA 3E9OA 4JI6K 4AQYK 2QK9A 1VSHA 4WE1A 4KFBA 2BANA 4B9LA 3R8EA 3QFUA 4CF2A 2O8BA 3M8RA 4DF4A 2QWNA 1QZ6A 4JKBA 3SCXA 1CZ9A 4BRMA 1O13A 4DV4K 1TK8A 1RILA 4AM6A 2A41A 3MXMA 3WNGA 3WXKA 3A2FA 4FWSA 1VBGA 2COPA 4O5BA 1C1CA 3C65A 1HYVA 1RT7A 4CVNE 3C6UA 3KLGA 1VSEA 5EOYA 5LMNK 1WSIA 4HUEA 2P1JA 1NGEA 4BE0A 4DV0K 1D9FA 4AHRA 1J54A 1XC3A 3G6EN 1KFDA 2R82A 2P9NB 4FWRA 4FJ5A 3BINA 3CIPA 4CEQA 4RWTA 4TSXA 5FPEA 3NE6A 4EHUA 3AVCA 2KZMA 4FJHA 2RKIA 4H5NA 3C7NA 3QERA 3J80O 4DQSA 5T7BA 4FJJA 4DU1A 4H5TA 2JLEA 2RN2A 2ZF5O 3BP8A 3SJHA 2FF6A 5KQ8A 2KZZA 2OA8A 3TABA 3V1QA 5FLXO 3IMXA 5TKWA 4BC2A 1J5OA 2ASOA 2I1JA 4K25A 2WC9A 5AQMA 3DRPA 3QB0A 1KAXA 1S6QA 1SV5A 3VGMA 5F1XA 3PIOL 2O8FA 4QS7A 1X3NA 3F9KA 4CBUA 1YJNN 3ZSZA 2P9PA 2F8SA 3R3LA 4B8AB 4E7LA 4B1ZA 4OGCA 1NVLA 4BDPA 1QE1A 4DTMA 3L6QA 3H3OB 4ICLA 1DEJA 3DWLA 5SWMA 3NVKA 4WYBA 2FSKA 1L3SA 2VYPA 2WFBA 1CXQA 2A3ZA 3VGKA 3VA3A 3AY9A 2AP1A 3K5OA 4ISFA 4FJ7A 3H46O 4DR5K 1WAJA 2D0CA 5HRRA 1Q18A 5B8HA 1XWLA 1IJJA 2B6AA 3V6DA 3NGYA 2UU9K 4FJMA 4IOAL 4ELTA 5KI6A 2O4IA 5KPZA 1W2BM 2RQ1A 4OLBA 1S6PA 4BE1A 4Z4IA 3VA0A 4A61A 4AH9A 1XI1A 1Y19B 4FYDA 1YIJN 2P9IA 3P4IA 1VQ4N 4K41A 3AVJA 1QZ5A 3CQYA 4MFBA 5GADP 3V4IA 3OBYA 2BDPA 4C8MA 3QEXA 1ATNA 2W6LA 4FZXC 4DR4K 4DSKA 4OPKA 3CC4N 3VQPA 3K2PA 1G15A 3U6FA 4Z4CA 4B1WB 1HKCA 4IFYA 4KREA 3RWUA 4X62K 4LFCK 3LP3A 3ZEUB 1D4XA 3TTFA 3TAEA 4E1JA 1JXBA 3KK1A 1VRUA 1TAQA 3I33A 4QCLA 4CFDA 4BR0A 4E1MA 3WEEA 3FFKB 1CZAN 4DTSA 1C0UA 4CZGA 4CJTA 2Q0UA 1RDAA 3M8QA 3IG1A 4Z4FA 3LAMA 2ZWHA 1RBSA 1HKBA 4GV9A 1NM1A 2HHUA 3KKRA 3CCUN 4BE2A 1LW0A 4O44A 1TVRA 3RR7A 1Z26A 4CHQA 4H4OA 3KK7A 1NJWA 3U8XA 3M6GA 3TANA 3S3MA 2I5JA 3CYMA 5C0YA 5AQGA 1LCUA 4PWDA 2Z1IA 1GLEG 1SAZA 2P9SB 2KTQA 1VSKA 4IDKA 1JJ2M 4CF1A 2E8AA 4BRAA 3K58A 4CHZA 3O9SA 3LPUA 4O55A 4MDBA 2CH5A 2X74A 3EO3A 1MIXA 2WONA 4H8KA 2ETJA 1TKDA 2V7YA 1JL2A 2X78A 3WXIA 2A1RA 2O8DB 4PKHA 2P9UA 3TARA 3KLFA 1GLFO 4F2SA 4WCEL 4M3UA 3AGKA 5HBMA 4ILJA 4B3MK 1XMOK 2HMPA 1Y64A 1Q9XA 3AVMA 1MK9B 1BHLA 3VQQA 3EKSA 1T7PA 1HMVA 1GG3A 1E4FT 2NZTA 4JKGA 4C8NA 1S72N 1CZBA 4BRGA 1Z05A 2J0KA 2E88A 2DFHA 1LW2A 1GOCA 4CGFA 4MO5A 2OCEA 3LDOA 3L2RA 3CCSN 3CC2N 1VSLA 3V9SA 3CD6N 3AO2A 1QTMA 1TK0A 3BF3A 1VRTA 3TR8A 4N41A 5AR0A 2KW4A 3NF9A 4I6MA 3L0QA 2VG6A 2LSNA 5BR8K 5E84A 2O4GA 5LL6Z 3ZX2A 3HP9A 1O1WA 4CHNA 1OH7A 1VQKN 1W9HA 1L3TA 3K0SA 5C10A 3J7ZO 4KB0A 5BREA 1NGHA 4FLUA 1HNVA 4ILHA 3VEOA 1OKJA 3HPOA 3CERA 3AA4A 2P9LA 4BR4A 3QLHA 3UKRA 4BR9A 5AZJA 5GAEP 2Z1HA 1B92A 3V1OA 2VQEK 3VERA 2HBJA 2D4WA 1EXQA 5AQXA 4E7JA 3A8YA 5CHIA 3O3FA 4DLGA 1FJGK 3SI6A 1XHZA 1C6VA 1KBLA 4DLEA 4B3SK 2O8EB 3KLIA 2O8CB 4PL8A 1X1PA 3HL8A 4ILGB 2FBVA 3NMUA 1FW6A 3ZLJA 1ASVA 1U2VA 5FRMA 1HRHA 3VTHA 3T19A 3U8ZA 4LF5K 5AQOA 3JYTA 1P8ZA 4IG3A 3DXKA 3VQEA 3AVBA 1RCHA 4N47A 1FK9A 2FSNA 3L2QA 4JRPA 1SZ2A 2OTJN 5EVZA 4OO1J 1NG9A 3O1WA 2JWLA 1OVQA 2Z1JA 5LY3A 1NK7A 1UOCA 2A1SA 5HP1A 1GLDG 3CETA 3HPGA 4FJXA 3SZ2A 1Q86O 2FF3B 4FJ8A 2A40A 3K59A 3T1HK 1HBKA 4I2QA 3VQDA 2QWLA 4FVMA 5KRTA 3OHRA 5AQQA 1S1XA 4H0YB 4CJRA 3RMCA 4DS4A 1IKXA 3ZT3A 2D0BA 2J0MA 4EFHA 1BI4B 4BGBA 3NF8A 3N4QA 3AAQA 4FWLA 1S1VA 4FLZA 2HNZA 5LMUK 2BE2A 3AARA 3NBPA 5AQVA 3AVAA 2YHXA 2G8UA 5E41A 4CHOA 3QO9A 4ELVA 3CCRN 1K6YA 2E2OA 2KHOA 2HRJA 1UA1A 3NH2A 4B9MA 1MWKA 3RSEA 3G10A 4KPYA 5EXWA 1Q81O 2NRTA 1EWQA 3SYZA 3D2FB 2OPQA 1NKEA 3O1BA 4RCHA 2IVNA 4J2EA 4JD2B 4WF9L 4YORA 3WQTA 4M7XA 3VQCA 4F4KA 4R5PA 1J53A 3P31A 4DFJA 4LH5A 1VQPN 3DOKA 2NNWA 5AQYA 4JKHA 3E66A 1DGKN 2F4VK 1VHXA 1HPZA 3ZETB 3I55N 3OTOK 1HNWK 3WXJA 4NB4A 2YX6A 1NGBA 3VQ4A 4CZEA 3CCVN 1MU2A 2QW9A 3DJCA 4KAZA 4PL7A 4O0JA 1JDEA 3H1QA 4CBWA 1GLBG 3HVRA 3K9JA 1NI2A 3EZ5A 4FJNA 3KLEA 4CJ3A 3OJUA 3KK2A 1YUWA 1RTHA 2RPIA 4LF9K 1Z6RA 3AU4A 3C6HA 4Z0UA 1T44A 2YJFA 3G25A 5C42A 1IBMK 3UKUA 3SUOA 1N5YA 3VQ9A 1NWKA 1NGGA 1VSDA 2JGUA 4FOIA 4JYAK 3DXMB 3LDLA 4PY5A 5JS1A 2E5LK 3O6WA 1FKPA 4DR6K 4E7HA 4BRKA 3PLAA 4H0XB 2WTUA 4JK8A 1REVA 4LC9B 4RW7A 4KHNA 4KBOA 3G4SN 3QBWA 3PX4A 3HYFA 1TKZA 3THXA 2ZJPL 2FBXA 2IIRA 4BRNA 3DI6A 2VGMA 4CEDA 3AO3A 1EWRA 4IDHA 1T3VA 4DQQA 4DS5A 4Z4GA 3LWLA 4CJLA 3F9MA 1GOAA 3CXCM 1GLLO 3G9WA 1XQSC 4BDZA 2VWKA 2HHVA 3TWHA 3VQ5A 1YTUA 1HR0K 1NK4A 4L8RB 1U04A 3THWA 4A57A 2D5RA 1LAVA 2GELA 3AA3A 3ENOA 1EF1A 4AHCA 4BQZA 5HOOA 1TKTA 4KI4A 2XO7A 4BWJA 3PY8A 4W5NA 2Y1JA 1RTIA 1NGAA 4IJAA 1RT3A 4CZJA 1XNRK 1N36K 3E1YA 4NYNA 1YAGA 2EHGA 2BH1A 3TI0A 4CEBA 3PO4A 2E1ZA 4JI7K 1RT2A 4HTUA 4ZTJA 5FPMA 3ZT4A 5J2NA 3SQ1A 3M8PA 1HUXA 4FJGA 3CJAA 4Z4HA 4F3TA 3L3VA 2QWRA 3OY9A 2P9KB 5HL7L 3M8SA 4YOYA 5CY4A 4RG8A 3BF1A 5FROA 2HMIA 1VAZA 3CHWA 2ITGA 2FDQA 2ZE2A 3SAGA 2E2QA 3TAPA 4PKIA 4R79A 3DM2A 3KD1E 1QQNA 2HB5A 5I3UA 4U7BA 1WNSA 1BWFO 3L2WA 3LM9A 4NYFA 2GTDA 3MN6A 4OJRA 2HVHA 2FBTA 1DLOA 5FPNA 3C95A 1KRPA 3SQ4A 4DB3A 4LF8K 2EX3A 4FLVA 2FC0A 3KVGA 4CE9A 2HOEA 3ULDA 4BROA 2XRIA 1JCFA 1BQNA 4FPAA 3G71N 4H0PA 3GG4A 2P9NA 4W5QA 1RNHA 4LFBK 3ZSRA 4CD3A 4BACA 3EKUA 4G9ZA 4HDOA 1VSJA 4J2BA 1C1BA 5JVGL 4CJPA 3V81A 4CJVA 3OYFA 3CC7N 2PFUA 3MXIA 3H1VX 3EE8A 4K42A 3BZCA 3J81O 2HVIA 4GKJK 3F5TA 1JLGA 3ZYYX 4B3RK 1KVBA 5KTQA 2YNGA 3MEGA 3QESA 4M3XA 1Z25A 3HTVA 4E19A 4B08A 2HHSA 1QS4A 2JWKA 4JK7A 1WN7A 3AVHA 3SAFA 3H6EA 3NHGA 3WT0A 4CESA 5DM7L 1GGOA 4MDAA 4Y1DA 4YOVA 4OPJA 3O80A 3EL2A 3C6TA 2GWKA 2Q97A 4NO7A 2G8HA 5AQKA 5AQSA 4AHTA 3VQ8A 4KKOA 1U48A 3NH0A 3QICA 4FJKA 3D45A 1NK6A 1C1AA 3FE1A 1NK9A 4PA1A 3OYKA 4JAXA 2CQUA 4O8KA 2NUBA 1KQSM 3DLGA 4FOEA 4OLAA 1LOTB 2PBDA 4YOXA 1LWCA 4IZ9A 1TV6A 1I39A 5C2FA 3WQUA 4IFVA 1V4SA 2IOCA 1JCGA 3O9QA 3MK6A 1VQNN 3D2EB 4NXMK 1J5EK 3HOSA 4DTOA 4PQUA 2XY7A 1ASWA 5MLCQ 2X0SA 2B5JA 1U6ZA 3OYAA 5H1SQ 4ISGA 3OYNA 1T6CA 3O4WA 4YL8A 4FPBA 4LF6K 4OPHA 3SUNA 2G8FA 3OYGA 3AA5X 3VQ6A 4M41A 4FVUA 4FM2A 3BY5A 3UE5A 3ZEUA 2NRXA 3MX2A 4CD1A 1C0FA 3RRHA 2G8WA 1SUQA 3QETA 1DKGD 3SV4A 3SPYA 2LBBA 4C1NI 4DUYK 3BEXA 2F7TA 1HYSA 1RT5A 4H0VB 4JEPA 1NLVA 5AQIA 2OYQA 5AFUH 4M3RA 2Q2RA 2HHHK 5AQZA 3DLHA 5DM6L 1Q9YA 1MIZB 1HPMA 1IO2A 1QSLA 5EY4A 5C25A 1VQ6N 4MLHA 2Q3SA 1X9WA 2Z1GA 3EE9A 4FWQA 4DSEA 4IFEA 3MDQA 5JVHL 1J19A 4I9QA 1KVCA 4EZ6A 4JRQA 3FP5A 2P9SA 3PX0A 3K5MA 1TK5A 4FM1A 3CCLN 2YKNA 2GWJA 4F8RA 1I3AA 3PUFA 5AFUA 4JKCA 3Q7CA 4FWPA 4KTQA 3TAFA 4CHPA 2D2QA 3ASMA 4BRLA 4M3YA 2E20A 4ELUA 1B9FA 1KLNA 1HLUA 1ZBSA 1RDDA 4BR5A 2O8DA 4H5RA 4BC5A 4M7YA 3LAKA 5AQLA 4QS9A 1QVGM 3O4QA 1SL2A 3I0SA 4K8ZA 3CPWM 3AO1A 3ATVA 3LDQA 1T6DA 5KRSA 5C15A 3C0BA 1ZBLA 4A62A 4GKKK 1VQON 3BGRA 5GINA 1B9DA 3IAYA 1RT6A 3F2KA 3VN5A 4LD0A 2R7YA 1XC9A 4DFKA 2VGNA 4Z4EA 1FXXA 4HWIA 3ULEB 3DYAA 3O9UA 4CCHA 2FLOA 4E7IA 2P5GA 3U4LA 3P83D 1K9MO 3HO1A 4KRFA 2HNYA 2QM1A 2E4LA 3QEPA 3CQXA 1KSPA 2QWQA 3OJSA 3ID8A 3LDNA 1EO1A 2KFNA 3ZSQA 4BDYA 4CYEA 4O5FA 3DAWA 3SNNA 2UUBK 5KGWA 3HRGA 3I56N 4HHTA 3S3OA 5ADXH 2F9WA 3ITHA 4A2BA 3GL1A 2KQ2A 4IOCL 1Q7YO 4BY9C 3ID6A 4GY2B 3HT3A 4K8XA 3WUHA 1JLFA 4W5OA 4DTUA 1ILYA 1SS6A 2D0PA 4JI4K 3U3GA 1H1VA 4CZFA 3T7ZA 4V19S 3K5NA 4M3WA 1NU0A 2AJQA 1A5XA 5GAHP 2J0JA 4BREA 4GXBA 2CGJA 4A2AA 4MO4A 1K8KB 4DQRA 4BGAA 4JK9A 3EEQA 4DHYA 2RHKA 1NOZA 2QXFA 3DLKA 4FWOA 2ASMA 3U9ZA 4DG1A 2Q31A 3VEYA 2O8CA 1TL3A 4BRDA 3KIOA 2P5OA 3QIOA 4DSJA 1IH7A 5EU7A 3LALA 4OPAA 3S41A 4YOWA 3CCQN 4GVEA 5BN9A 4CGHA 1BCMA 1S22A 1GLCG 4IJNA 1KAYA 3VQ7A 4CFCA 3QFPA 4CF0A 3OYMA 2IC3A 2QI2A 4CJKA 3THYB 1R0AA 4DCHA 4B9QA 4DTRA 3RRGA 4GV6A 3RR8A 5IWAK 3AVFA 2F96A 3EYZA 4HCCA 3I8DA 1Y97A 5M1KA 4CJ4A 1SL1A 1K8AO 4IEIA 1GLAG 3FLVA 1XMQK 4CECA 5HRNA 4FL9A 1E4GT 4CZIA 4FLXA 1WBDA 1HX1A 2X6NA 4BVPA 3O4NA 3NH1A 5CYMA 4E89A 4HUGA 4KHUA 2UXCK 3FFIA 1TL1A 2CB8A 3PSIA 3OS2A 2NLXA 3WNEA 1BI4A 3O3GA 1R59O 3D6RA 4N76A 5C2DA 3BZKA 3KWGA 3MXJA 4M63C 4BR7A 4DQIA 4DTNA 3ENBA 4RTFD 4CFBA 1T8EA 5J2PA 1ISNA 2QXLA 3K5LA 4BC3A 4ZHRA 1WSJA 4JHDB 3OYIA 3VF2A 5IJMA 3L3UA 4B3TK 1JKHA 3CJBA 5F2RA 5BRDA 3PV8A 4CGIA 1RDCA 3CJ1A 1WSGA 1ZC6A 3VEZA 1BQMA 1BISA 1EX4A 1ZXOA 4CK1A 4CERA 4IO8A 3D2FA 2A5XA 1VK0A 2D0OA 3TTDA 1EP4A 3NGIA 4JKAA 3EN9A 1QQMA 3AU5A 4E3SA 3RMDA 4CGJA 4JD2A 4OKEA 3TAGA 3ZX3A 2HW3A 2NRHA 4YOTA 4DQPA 2RE2A 2A42A 4B3OA 1DTQA 5BPMA 1ZBUA 2FBYA 1IBLK 1ZBIA 5KGXA 3UB5A 3VESA 3MCPA 1JLAA 2HHTA 1BL3A 1VBHA 3ZETA 1E5WA 2IAJA 3VGLA 3PO5A 4LF4K 3T1YK 4JV5K 4CJUA 2DIKA 5AQPA 3PSFA 3ZSOA 1VQ7N 4X65K 1HNIA 4CW7B 3QBXA 4CEEA 3NDKA 2UXBK 4ZRIA 3DMJA 3IFRA 1NGFA 3DRRA 4GVMA 3DLRA 4JKFA 3AVIA 1YJWN 2D1KA 3OYJA 1L3UA 2NRVA 3LDSA 3OYEA 1OH5A 1TYQB 1RDBA 4DSIA 1MK7B 4K43A 1NOYA 2DFFA 4JI1K 4DU3A 3E9LA 3VMFB 2I7NA 3I0RA 3P1GA 3OA9A 1RDWX 4CEAA 4DTXA 3DXMA 3MEEA 4CEOA 4CI6A 4Y1CA 2KKZA 2ZD1A 4DFMA 1K73O 3GOIA 3UIQA 3ZCMA 2E1YA 3IDHA 4L3QA 1WBBA 1LWEA 2OPRA 2ZM6K 5BR9A 1VQ5N 4CF8A 3WNFA 3AA2A 3KK3A 1S1UA 1YF5L 1ZBHA 4G1QA 4X64K 1HB6A 4BRFA 4JI2K 4YFUA 4B9UA 2DFEA 2PZSA 3VQBA 1D8YA 3OYHA 4KB1A 3E9PA 1LWFA 1NK5A 3TAQA 3MCAB 3O9RA 2V51B 3AV9A 3A5MC 4FWNA 4C23A 2DPNA 4B9TA 4XH4A 4Z94A 5J2QA 1N6QA 4KHWA 3CI5A 2G8VA 2KFZA 1XNQK 1M90O 4JLHA 2GX9A 4FM0A 5HROA 3HXMA 4I7FA 3AVLA 4KHPK 1DT9A 1WSFA 5SZTA 1KLMA 3LP2A 2HBMA 1RTDA 1YVUA 2GV9A 4F9OA 4E1NA 3FGUA 4FW1A 4C8KA 4GW6A 4P7IA 4XEIA 5AQRA 1OH8A 1S9GA 1YT3A 4CGDA 3AVKA 4DTPA 5CR4A 2G8IA 2VCPA 3A0IX 4KTZA 1GC7A 2P9KA 1WOQA 1J6ZA 4YDUA 3KLHA 3OYCA 1YXQA 2QWMA 1HJOA 4MLEA 5BPNA 3KTQA 1IV0A 2D10A 5EX5A 4CBXA 5GAGP 5FRNA 2FXUA 2ZPYA 4DTJA 1XUPO 5JVLA 1SQKA 1L5UA 3C94A 3L2UA 4EZ9A 5CYQA 5KQDA 3AO4A 5AZIB 2FJ9A 1YTAA 3X23A 1TAUA 4BVOA 3O5BA 4JNEA 1NTIA 1QQCA 1RBVA 1NNEA 3T3FA 4PHTX 2GUIA 1S5JA 4IWVA 3CCJN 1ACAA 3D7EO 2QKBA 4H0OA 5AQHA 2CGLA 3VENA 2Q36A 3DLEA 4JKEA 4NLCA 1D9DA 4OGEA 5AQNA 1JLQA 1U49A 4WFNL 2YHBA 3M1FA 1T03A 2BTFA 3IRXA 4CJEA 4NCGA 4JI5K 1NBWA 4DR1K 4KTWA 4N5SA 4M42A 4CGGA 5GIOA 4CJSA 3CF5L 4BG9A 3QINA 1N8RO 1YITN 3GDQA 2Q1NA 5AQUA 2RF2A 2GBZA 3P38A 4DU4A 4FSVA 3MN5A 2IS3A 5AQWA 4NXNK 5A2QO 2AA4A 2YKMA 2Y1IA 5F0XA 3JAMO 2WUSA 4B1XB 1QHTA 3ZSVA 3NFAA 1VQLN 2I7PA 4IKFA 3SJJA 3SMPA 3IS9A 4XH5A 1N34K 4CJFA 4UQGA 2HHWA 4CJ7A 1X9MA 3EZWA 4BRPA 4FJIA 3ZSWA 2ZGZA 5JS2A 4FLWA 1DTTA 3RMBA 2O8BB 2NRZA 3H45C 3MAQA 3G0ZA 3IKMA 4FLYA 4Y0WA 5GIPA 1KC8O 2QTDA 3SK3A 1VSMA 3OBWA 4PUOA 3GBTA 3SQ2A 2HSTA 2F8TA 4YHHK 1E3MA 1WUAA 3O3HA 4FZYA 1GC6A 3CFRA 2YHWA 3L4IA 1SGHA 4O8UA 3QDKA 4CIFA 3MEDA 4A59A 4FK2A 2UUAK 1A5VA 4BG8A 4KHQA 4ZRKA 3HPHA 3SBTA 2AEHA 5AQFA 3SV3A 3D2EA 2ZQBA 4WQ5A 2E6MA 2QA4N 4CJWA 1MA9B 1QSSA 2QKKA 3V9XA 3TSQA 3SAHA 3LP1A 4A5BA 1M1KO 4F3OA 1IG9A 3P5JA 4BR2A 3NCIA 3KD5E 1WSEA 5IT9O 2PY5A 3C7NB 1IG8A 4FJ9A 1KXPA 4FO0A 4B1UB 4KH6A 1KAZA 2HF3A 3O08A 3NAEA 1IKYA 1ESVA 1W97L 4CEZA 4CZHA 4DSFA 4JI8K 3FZFA 2NRRA 5CE3A 4H5VA 1NK8A 2VG7A 4NCBA 4CFAA 4KO0A 4DF8A 1L3VA 1QVFM 3WA0A 4X66K 4E7KA 1S1TA 3MWPA 3I8BA 4J2AA 4AHSA 4LF7K 3CJ7A 1TUYA 2PYJA 1ITGA 2O8FB 3CM6A 3JSMA 3KKSA 2P9PB 3IUCA 1D5AA 5ELZA 1IKVA 3O9TA 3QEVA 4KHYA 5CZ2A 3T1AA 2BGGA 5J2MA 3QIJA 4EAHD 4KHSA 2V7ZA 4WQ4A 1BG3A 1NGCA 3SPZA 1C0MA 3LDPA 3O8MA 4FK4A 1NGIA 1BGXT 1JCEA 3B6PA 3QNNA 2OTLN 4DV6K 4M3TA 4CK2A 2VWBA 4BC4A 1JLEA 5TKYA 3CFPA 3DOLA 2HBKA 4H5WA 4EP4A 1YJ9N 2IVOA 1QQOA 3LM2A 2G8KA 4ZRJA 2IGIA 3AO5A 2F9TA 1F21A 2W42A 5K14A 4M45A 1QHAA 2P9IB 4CK3A 4BRIA 2UUCK 3B8AX 3CJ9A 1GLJO 4FK0A 1HB8A 1BA1A 2EMTA 4QAGA 3ZSXA 1YHQN 3MN9A 4OX9K 5BPLA 2ABDA 3P39A 2HHXA 2H3GX 4IG0A 4W5RA 3VEVA 1HYZA 3VEXA 2EWSA 3CG7A 2E6LA 4OKJA 5BRFA 3QEIA 3SLCA 3LWMA 1U47A 4FXDA 4PKGA 3EPYA 3WEEB 4HTLA 3ZX0A 4B9VA 4H0TB 3D0PA 2W6KA 3VF4A 1BDGA 4K0KK 3AVGA 1W0HA 3ULEA 5C24A 2HBLA 2UYTA 3NF6A 4AHUA 3CFOA 3N4PA 3LANA 1WAFA 4FZZA 1Q82O 3PIPL 4FCYA 2D0AA 3NF7A 1WB9A 1NKCA 1S3XA 3OYLA 4C1NK 2PAVA 4HCBA 4FLTA 1NGJA 3T69A 1U4BA 3AGRA 3KWIA 4ID5A 4DV5K 1H4RA 1EQYA 2A6AA 5M1OA 1QSYA 1CXUA 2QWPA 3HI0A 2QEXN 2DY4A 3TSUA 1Q8IA 1W7AA 2ZJRL 1I94K 1BIUA 2XY5A 1UAXA 3V9UA 4DQ8A 2VG5A 3H08A 4KH5A 4C8LA 2OPPA 1NMDA 4GV3A 3M5RA 3W3DA 4E0DA 3OYDA 1BUPA 3QNOA 4FWMA 2Q0RA 1K8KA 4DMNA 1X9SA 2P9UB 5FDLA 4RW9A 3VPZA 4LFAK 2IVPA 3SMSA 4ZTFA 2YNIA 3VTIA 3ENHA 3HM8A 1NJIO 4CF9A 2QWOA 3M3ZA 1WLJA 2WOMA 3AAPA 3VF6A 3FR0A 4DR7K 4CJ5A 4EHTA 3CCEN 1JLBA 4DWIA 2O8EA 1NJXA 4JKGB 2GUPA 4WFAL 3TTCA 1NJYA 2ZJQL 3THVA 3HOTA 1LAWA 4CEFA 3THYA 5ADXA 2ITMA 2YV0X 3BDPA 3OYBA 4LY7A 3OS1A 4KI6A 4FW2A 4AF1A 4ID1A 3GE1A 5JMVA 3MECA 3TPQA 4DV3K 3ZT1A 2V52B 2CH6A 3QEWA 3K9KA 1HQUA 2ZGYA 2ATQA 4YDUC 4B9NA 1BU6O 3TU5A 1RBRA 4W5TA 4B1YB 5LJVA 4LSNA 4I6MB 3DLLL 3R1XA 1N33K 3TAMA 3WXMB 1BCOA 4RW6A 1N32K 3LP0A 3MWTA 4DKWA 3DLBA 4DV7K 1RT4A 4NLBA 1SL0A 1RTJA 4FWKA 1MDUB 3DRSA 5AQJA 2HF4A 2YCHA 4BRCA 1J9AA 4JHDA 3K57A 4OKKA 4IEEA 1KD1O 3MN7A 2W40A 2E2NA 2ASPA 3C6AA 2P9LB 4F2RA 3UKRB 5AZJB 5KPRA 1X9JA 5M1FA 4M3ZA 3SBGA 1DIKA 1P90A 4CZMA 3A5LC 5AJ3K 2OPSA 1ZYQA 3ATUA 1WSHA 3PX6A 3HSCA 4IOXA 2HE7A 3HZ6A 1EETA 1FKOA 4KV8A 2UXDK 4J8FA 1U2VB 1KTQA 1S9EA 1BA0A 3WXLA 4AM7A 3CM5A 4I2PA 1IBKK 1S1WA 2YNHA 4OVLA 3KJVA 1IKWA 5I9EB 4CIGA 4BQLA 1BIZA 4DV2K 1C0TA 2XY6A 3DXKB 3JS6A 1X3MA 5M1PA 4N56A 3NGZA 3F73A 4WFBL 4B9SA 3OVNA 3MMVA 5BN8A 1OVYA 2CGKA 3B6OA 4UY8O 2YHYA 4FJLA 2YJEA 3FZHA 4EP5A 3OW2M 1UA0A 5D3GA 1CLQA 4J2DA 4O4GA 1EKEA 1TKXA 3VQAA 4NCAA 1KCFA 4QS8A 2XHBA 3HM9A 3ZDTA 4YNQA 4AILC 4XIUA 4A5AA 3RMAA 1TUUA 3V1RA 4TKNA 3BUZB 5JLHA 3HP6A 3RVCA 1TYQA 3ZT0A 3PZDA 4BRHA 2YI1A 3ISNC 1SKWA 1ATSA 2IDOA 3S3NA 1HNXK 4HDQA 3LPTA 3FZKA 1UWBA 1JLCA 3HK2A 3KZBA 1NK0A 4DR3K 3MX5A 3RSEB 5HRSA 4WQ5C 4DUZK 1HJRA 3ZT2A 5JICA 3OS0A 3FLCO 1G99A 3R6MA 5J1EA 1ASUA 3LL3A 4IBNA 4YY3K 1MWMA 5E26A 4DR2K 4I9LA 1VQ8N 1ST7A 3U9DA 4NY0A 1HNZK 3IVFA 3U3YA 3L4QA 3CMEN 5AQTA 4BRQA 2OZMA 1VSFA 1SKSA 1V4TA 4JN4A 3VETA 3RTVA 4QOZB 4BWMA 2YVCA 3J8AA 5JLFA 3J7YP 4IO9L 1RGIA 4H4MA 4JI0K 3CMAN 4CJQA 1NKBA 1GOBA 5DK5A 4LH4A 1RBUA 3CQ8A 2W41A 3E01A 2P51A 5C12A 5M1NA 2OANA 1XHXA 4YOUA 1VQMN 4GNIA 4HVJA 4JKDA 4DV1K 1ZBFA 4WQ4C 2D11A 1HKGA 3SQ0A 1RBTA 1A5WA 2WH5A 3CJCA 4DFPA 1RFQA 4EKUA 3U7DA 3L8BA 3EY1A 4HUFA 1LV5A 2BUPA 3UKUB 1VQ9N 1KFSA 3SUQA 5CZ1A 4B1VA 1C0GA 4Q5VA 1RDUA 3KHYA 3V9ZA 4GMJB 1YI2N 1T05A 3HJFA 3CPEA 4CZLA 3V9WA 2HHQA 1U45A 3L2VA 3AVNA 2AL6A 5BRHA 3CCMN 1NJZA 1OH6A 3HSTB 3QIPA 5DMRA 4JS5A 2XY8A 4EIAA 1BOTO 1NGDA 2YNFA 5M1QA 3TSPA 4O0IA 2I1KA 3THXB 2WBNA 3HBTA 3Q7BA 1NMNA 1JXEA 2DTUA 4DXAB 3R9PA 1SKRA 4B8CA 4MQ3A 4DSLA 5HRPA 2FSJA 3NVMA 5AZIA 4JI3K 5KPTA 3WNHA 4KH4A 4CHYA 3A5OC 4AHVA 3S9HA 3SUPA 4U67L 1KVAA 3H3NO 4LSLA 4F7GA 4RW8A 4JS4A 2GEMA 1ATRA 3FZMA 5I42A 1TGOA 3FZLA 4H03B 3THWB 3QMLA 4XH1A 1HQEA
chains in the Genus database with same CATH topology
3CJ7A 1TUYA 1BO5O 4ISEA 4RCHA 3WUHA 2IVNA 4JD2B 4WF9L 4YORA 2P9PB 3A5NC 3IUCA 1SS6A 4M7XA 5ELZA 3WQTA 1ILYA 2D0PA 2E2PA 3O9TA 1H1VA 3P31A 4CZFA 3T7ZA 2NRWA 1VQPN 3QIJA 4EAHD 5LJWA 3PVLA 1YVNA 5GAHP 2V7ZA 4WQ4A 2J0JA 1BG3A 1NGCA 4BREA 2NNWA 3JXUA 3LDPA 3O8MA 4GXBA 4JKHA 2CGJA 5AQYA 5FPDA 3E66A 1DGKN 4IXCA 1NGIA 3W0LA 1JCEA 4A2AA 4MO4A 1K8KB 3VOVA 2OTLN 3ZETB 1KC7A 4BGAA 3I55N 2KLAA 4JK9A 4DHYA 2RHKA 3WXJA 3VEWA 3U9ZA 4NB4A 2J4RA 2ASMA 2VWBA 2YX6A 1NGBA 2Q31A 4FWOA 4BC4A 3VEYA 4CZEA 2EMSA 5TKYA 4CZKA 3CCVN 4BRDA 3E9OA 2HBKA 2QW9A 3DJCA 4H5WA 4PL7A 1YJ9N 2IVOA 1JDEA 3H1QA 1QQOA 4OPAA 4CBWA 1GLBG 3S41A 4YOWA 3K9JA 3LM2A 1NI2A 3R8EA 3CCQN 4ZRJA 3QFUA 4GVEA 5BN9A 1S22A 1YUWA 1GLCG 2F9TA 2QWNA 4IJNA 1KAYA 1QZ6A 1QHAA 1Z6RA 2P9IB 3QFPA 4BRIA 3AU4A 4JKBA 3C6HA 4BRMA 3B8AX 1O13A 2QI2A 3CJ9A 1GLJO 1T44A 2YJFA 3G25A 1HB8A 1BA1A 4B9QA 4DCHA 2EMTA 4AM6A 4GV6A 2A41A 3UKUA 3WXKA 4FWSA 1VBGA 2COPA 1YHQN 3MN9A 5BPLA 3C65A 1NWKA 5M1KA 2ABDA 1K8AO 3P39A 1NGGA 2H3GX 4FOIA 4IEIA 3VEVA 1GLAG 3DXMB 5EOYA 3FLVA 3LDLA 3VEXA 2EWSA 4FL9A 1NGEA 1E4GT 3O6WA 4CZIA 5BRFA 3SLCA 1HX1A 4BRKA 3PLAA 4BVPA 4H0XB 4JK8A 1XC3A 3G6EN 4PKGA 3EPYA 4LC9B 2R82A 2P9NB 4KBOA 3WEEB 4FWRA 4HTLA 3ZX0A 3QBWA 3G4SN 4H0TB 2CB8A 3BINA 3CIPA 4RWTA 2ZJPL 5FPEA 2IIRA 2NLXA 4BRNA 4EHUA 3VF4A 1BDGA 2VGMA 1R59O 3D6RA 5C2DA 3ULEA 3KWGA 4IDHA 4M63C 4BR7A 1T3VA 4H5NA 3ENBA 3C7NA 2HBLA 4RTFD 2UYTA 3N4PA 1ISNA 3F9MA 2QXLA 3CXCM 1GLLO 3G9WA 1XQSC 4H5TA 4JHDB 2ZF5O 3VF2A 4BC3A 5IJMA 3BP8A 3PIPL 1Q82O 3SJHA 2FF6A 1S3XA 5KQ8A 3CJBA 2PAVA 5F2RA 4C1NK 5BRDA 1NGJA 3T69A 3CJ1A 3AGRA 3KWIA 3IMXA 1ZC6A 5TKWA 3VEZA 4BC2A 1ZXOA 1H4RA 1EQYA 2A6AA 2ASOA 2I1JA 5M1OA 2QWPA 3HI0A 4IO8A 4K25A 2QEXN 3D2FA 2A5XA 2D0OA 2WC9A 5AQMA 3TTDA 4A57A 3TSUA 2GELA 4JKAA 3ENOA 3QB0A 3EN9A 1KAXA 3AU5A 1QQMA 1EF1A 3VGMA 4BQZA 5F1XA 5HOOA 3PIOL 2ZJRL 4QS7A 1X3NA 4CBUA 1YJNN 4JD2A 2P9PA 3ZX3A 3R3LA 4B1ZA 1NGAA 2NRHA 1NVLA 4IJAA 4YOTA 4CZJA 4DQ8A 3ID6A 3L6QA 3H3OB 1DEJA 2RE2A 2A42A 3DWLA 3E1YA 3NVKA 4KH5A 4GY2B 5BPMA 1NMDA 4WYBA 1YAGA 3M5RA 3W3DA 2FSKA 4GV3A 2BH1A 2VYPA 2WFBA 2A3ZA 1BUPA 3VGKA 3UB5A 2E1ZA 3AY9A 3VESA 2AP1A 3MCPA 4FWMA 2Q0RA 1K8KA 4ISFA 2P9UB 1VBHA 3ZETA 1E5WA 3H46O 3VPZA 2IVPA 5FPMA 3SMSA 1Q18A 3VGLA 1HUXA 5B8HA 3CJAA 1IJJA 3VTIA 2QWRA 2DIKA 2P9KB 3ENHA 3HM8A 5AQPA 5HL7L 1VQ7N 1NJIO 4IOAL 4YOYA 2QWOA 3M3ZA 3BF1A 3AAPA 5KPZA 1W2BM 2RQ1A 3QBXA 3VF6A 3FR0A 4ZRIA 4EHTA 1VAZA 3CHWA 3IFRA 3CCEN 2FDQA 1NGFA 4A61A 1Y19B 4JKFA 2E2QA 3SAGA 2P9IA 4JKGB 2D1KA 2GUPA 3P4IA 4PKIA 4R79A 4K41A 4WFAL 3TTCA 1VQ4N 1QQNA 1QZ5A 2NRVA 3CQYA 5GADP 2ZJQL 3HOTA 4U7BA 3OBYA 1BWFO 1TYQB 5ADXA 1ATNA 2ITMA 3LM9A 2GTDA 3MN6A 1MK7B 4K43A 3CC4N 4AF1A 3GE1A 5FPNA 5JMVA 3E9LA 3TPQA 2V52B 2CH6A 2I7NA 3VMFB 3OA9A 1RDWX 3K9KA 4B1WB 2ZGYA 4DB3A 1HKCA 3DXMA 4YDUC 4CI6A 1BU6O 3KVGA 3TU5A 2HOEA 2KKZA 3ZEUB 1K73O 1D4XA 4BROA 3TTFA 3GOIA 1JCFA 4B1YB 4E1JA 5LJVA 4I6MB 4FPAA 3G71N 3DLLL 3I33A 3R1XA 3WXMB 4H0PA 3GG4A 2P9NA 4BR0A 3WEEA 3FFKB 1CZAN 2E1YA 3IDHA 4L3QA 3MWTA 4CD3A 4CZGA 4DKWA 5BR9A 1VQ5N 3EKUA 4G9ZA 4HDOA 2Q0UA 4NLBA 5JVGL 4FWKA 1YF5L 1MDUB 5AQJA 2ZWHA 1HB6A 2HF4A 2YCHA 4BRCA 1HKBA 3CC7N 1YJWN 2PFUA 4GV9A 3H1VX 3EE8A 4K42A 4BRFA 1NM1A 4JHDA 4IEEA 3CCUN 1KD1O 3MN7A 2W40A 2E2NA 3F5TA 2ASPA 3C6AA 3ZYYX 2P9LB 3UKRB 5AZJB 5KPRA 1X9JA 5M1FA 3KK7A 3E9PA 3SBGA 3MCAB 3O9RA 3U8XA 3M6GA 1DIKA 1P90A 2V51B 4CZMA 3A5LC 3A5MC 3HTVA 4FWNA 4C23A 5C0YA 2JWKA 2DPNA 4JK7A 1LCUA 3ATUA 5AQGA 3SAFA 1GLEG 3H6EA 4XH4A 4Z94A 3HSCA 1SAZA 4IOXA 2HE7A 2P9SB 3CI5A 3WT0A 5DM7L 3HZ6A 1GGOA 4MDAA 1JJ2M 4YOVA 4J8FA 1U2VB 1BA0A 3O80A 3EL2A 3WXLA 4AM7A 1M90O 2GWKA 2E8AA 4BRAA 2Q97A 2GX9A 4NO7A 3O9SA 5AQKA 5AQSA 5I9EB 4MDBA 1DT9A 2CH5A 4BQLA 3EO3A 1MIXA 2HBMA 3DXKB 1X3MA 3JS6A 5M1PA 4F9OA 4WFBL 2V7YA 3QICA 3MMVA 3FGUA 3WXIA 4P7IA 4PKHA 2P9UA 1OVYA 4XEIA 5BN8A 2CGKA 4UY8O 5AQRA 3FE1A 1GLFO 4WCEL 2YHYA 2YJEA 3FZHA 3AGKA 3OW2M 4ILJA 5CR4A 4JAXA 2CQUA 2VCPA 3A0IX 4O8KA 2HMPA 1Y64A 1KQSM 1GC7A 4FOEA 1MK9B 1LOTB 2P9KA 2PBDA 4YOXA 1WOQA 1J6ZA 4IZ9A 4QS8A 4YDUA 5C2FA 1YXQA 3WQUA 2QWMA 3EKSA 1V4SA 3ZDTA 1JCGA 1HJOA 4MLEA 3O9QA 5BPNA 3MK6A 1VQNN 3D2EB 1GG3A 3HOSA 1E4FT 2D10A 5EX5A 4CBXA 4A5AA 5GAGP 2NZTA 2FXUA 4JKGA 1TUUA 4TKNA 2ZPYA 3BUZB 1XUPO 4BRGA 5JLHA 1S72N 5JVLA 1SQKA 1Z05A 5MLCQ 2J0KA 2E88A 2X0SA 1U6ZA 3RVCA 1TYQA 3PZDA 5KQDA 5AZIB 2FJ9A 4BRHA 4MO5A 2YI1A 3LDOA 5H1SQ 4ISGA 3CCSN 3CC2N 3X23A 1ATSA 4BVOA 3CD6N 3O5BA 4JNEA 4HDQA 1NTIA 1T6CA 3O4WA 4YL8A 4FPBA 4OPHA 3FZKA 4PHTX 3KZBA 4IWVA 3BF3A 4FVUA 3CCJN 1ACAA 3UE5A 3D7EO 4H0OA 3ZEUA 5AQHA 2CGLA 5AR0A 3VENA 2NRXA 3MX2A 4CD1A 2Q36A 4JKEA 1C0FA 3MX5A 3RSEB 4NLCA 4I6MA 4WQ5C 3L0QA 1DKGD 5JICA 5AQNA 5E84A 2LBBA 4C1NI 3ZX2A 4WFNL 3BEXA 2F7TA 3FLCO 1G99A 4H0VB 4JEPA 1NLVA 3M1FA 3R6MA 5AQIA 3LL3A 2BTFA 1VQKN 1MWMA 5E26A 5AFUH 5C10A 3J7ZO 1NBWA 5BREA 2Q2RA 1NGHA 1VQ8N 1ST7A 3U9DA 4NY0A 3IVFA 4ILHA 5AQZA 3VEOA 3L4QA 5GIOA 5DM6L 3CMEN 5AQTA 1MIZB 4BRQA 1OKJA 3CF5L 4BG9A 3CERA 1HPMA 1N8RO 2P9LA 1V4TA 4JN4A 3VETA 3GDQA 3UKRA 5EY4A 4BR4A 4BR9A 5GAEP 2Q1NA 5AZJA 5AQUA 2YVCA 1VQ6N 3J8AA 4MLHA 3VERA 5JLFA 2HBJA 2D4WA 3EE9A 4FWQA 3P38A 4FSVA 3MN5A 5AQXA 3A8YA 5AQWA 1RGIA 5CHIA 4IO9L 4IFEA 3MDQA 5JVHL 2AA4A 1J19A 1YIJN 5F0XA 1KBLA 2WUSA 4B1XB 3CMAN 3FP5A 2P9SA 4PL8A 1VQLN 4ILGB 2I7PA 3NMUA 3SMPA 2W41A 4XH5A 1YITN 1U2VA 3VTHA 4CJ7A 5C12A 5M1NA 3CCLN 3EZWA 2OANA 4BRPA 2GWJA 4YOUA 3U8ZA 1VQMN 4GNIA 5AQOA 4JKDA 2ZGZA 5AFUA 2NRZA 3H45C 4JKCA 4WQ4C 1P8ZA 3Q7CA 3IKMA 4FWPA 2D11A 1HKGA 4Y0WA 5GIPA 1KC8O 3DXKA 2D2QA 2WH5A 2QTDA 4BRLA 3SK3A 2E20A 3CJCA 3OBWA 1HLUA 1ZBSA 1RFQA 3GBTA 4EKUA 2HSTA 4BR5A 2FSNA 3U7DA 4H5RA 4BC5A 1SZ2A 2BUPA 3UKUB 1WUAA 2OTJN 4M7YA 1VQ9N 5EVZA 4OO1J 5AQLA 4QS9A 4B1VA 1QVGM 3O1WA 1GC6A 1C0GA 1RDUA 3KHYA 1YI2N 2JWLA 3CPWM 2YHWA 5LY3A 3ATVA 3L4IA 3CPEA 1SGHA 1GLDG 4O8UA 3LDQA 4CZLA 3QDKA 1T6DA 3CETA 4A59A 2AL6A 5BRHA 5C15A 3CCMN 1Q86O 3C0BA 2FF3B 4BG8A 4A62A 2A40A 1HBKA 4ZRKA 3SBTA 2AEHA 5AQFA 4EIAA 1VQON 2QWLA 3D2EA 5GINA 1BOTO 4WQ5A 1NGDA 3OHRA 3F2KA 5AQQA 4H0YB 2QA4N 1MA9B 5M1QA 3TSPA 2I1KA 2WBNA 3HBTA 3Q7BA 2J0MA 4EFHA 4DXAB 2VGNA 3R9PA 3TSQA 3SAHA 4A5BA 4HWIA 2FSJA 4BGBA 3NVMA 1M1KO 3ULEB 3O9UA 3N4QA 5AZIA 4BR2A 2FLOA 5KPTA 3C7NB 1IG8A 1KXPA 4FO0A 4B1UB 3AAQA 4FWLA 3U4LA 1K9MO 3AARA 4KH6A 4KH4A 2QM1A 1KAZA 2HF3A 2YHXA 3O08A 5AQVA 1ESVA 3A5OC 1W97L 3CQXA 2QWQA 3ID8A 3LDNA 4CZHA 1EO1A 4U67L 3FZFA 4CYEA 3CCRN 2NRRA 4O5FA 2E2OA 2KHOA 3DAWA 2HRJA 3H3NO 4F7GA 4H5VA 5CE3A 1MWKA 2GEMA 3RSEA 1QVFM 1ATRA 3FZMA 3HRGA 3WA0A 5EXWA 3I56N 1Q81O 2NRTA 3FZLA 4H03B 5ADXH 3QMLA 4XH1A 2F9WA 3MWPA 3D2FB 4A2BA 3GL1A 4IOCL 1Q7YO 4BY9C 3I8BA 3O1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK9 A;  4JKF A;  4ILH A;  4JKG B;  3E9P A;  3SBG A;  3E9O A;  4JKA A;  4JKD A;  3ENB A;  4JKE A;  4JKG A;  4JKC A;  3SBT A;  4JK7 A;  3E9L A;  4ILJ A;  4JKH A;  3E66 A;  4JK8 A;  4JKB A;  4ILG B; 
#chains in the Genus database with same CATH topology
 1BO5 O;  4ISE A;  2OZS A;  2VQF K;  2YHA A;  3A5N C;  2E2P A;  1VSI A;  2NRW A;  5HLF A;  1RT1 A;  5LJW A;  2PYL A;  4CIE A;  3PVL A;  1YVN A;  4C8O A;  3JXU A;  4RW4 A;  3ZSY A;  3ALY A;  5FPD A;  4IXC A;  3LZJ A;  3W0L A;  2X6S A;  3J7A P;  1JL1 A;  3VOV A;  1KC7 A;  3LZI A;  2KLA A;  4Q0B A;  3VEW A;  2J4R A;  2HND A;  2B4J A;  3HVT A;  2EMS A;  4CZK A;  2VWJ A;  3E9O A;  4JI6 K;  4AQY K;  2QK9 A;  1VSH A;  4WE1 A;  4KFB A;  2BAN A;  4B9L A;  3R8E A;  3QFU A;  4CF2 A;  2O8B A;  3M8R A;  4DF4 A;  2QWN A;  1QZ6 A;  4JKB A;  3SCX A;  1CZ9 A;  4BRM A;  1O13 A;  4DV4 K;  1TK8 A;  1RIL A;  4AM6 A;  2A41 A;  3MXM A;  3WNG A;  3WXK A;  3A2F A;  4FWS A;  1VBG A;  2COP A;  4O5B A;  1C1C A;  3C65 A;  1HYV A;  1RT7 A;  4CVN E;  3C6U A;  3KLG A;  1VSE A;  5EOY A;  5LMN K;  1WSI A;  4HUE A;  2P1J A;  1NGE A;  4BE0 A;  4DV0 K;  1D9F A;  4AHR A;  1J54 A;  1XC3 A;  3G6E N;  1KFD A;  2R82 A;  2P9N B;  4FWR A;  4FJ5 A;  3BIN A;  3CIP A;  4CEQ A;  4RWT A;  4TSX A;  5FPE A;  3NE6 A;  4EHU A;  3AVC A;  2KZM A;  4FJH A;  2RKI A;  4H5N A;  3C7N A;  3QER A;  3J80 O;  4DQS A;  5T7B A;  4FJJ A;  4DU1 A;  4H5T A;  2JLE A;  2RN2 A;  2ZF5 O;  3BP8 A;  3SJH A;  2FF6 A;  5KQ8 A;  2KZZ A;  2OA8 A;  3TAB A;  3V1Q A;  5FLX O;  3IMX A;  5TKW A;  4BC2 A;  1J5O A;  2ASO A;  2I1J A;  4K25 A;  2WC9 A;  5AQM A;  3DRP A;  3QB0 A;  1KAX A;  1S6Q A;  1SV5 A;  3VGM A;  5F1X A;  3PIO L;  2O8F A;  4QS7 A;  1X3N A;  3F9K A;  4CBU A;  1YJN N;  3ZSZ A;  2P9P A;  2F8S A;  3R3L A;  4B8A B;  4E7L A;  4B1Z A;  4OGC A;  1NVL A;  4BDP A;  1QE1 A;  4DTM A;  3L6Q A;  3H3O B;  4ICL A;  1DEJ A;  3DWL A;  5SWM A;  3NVK A;  4WYB A;  2FSK A;  1L3S A;  2VYP A;  2WFB A;  1CXQ A;  2A3Z A;  3VGK A;  3VA3 A;  3AY9 A;  2AP1 A;  3K5O A;  4ISF A;  4FJ7 A;  3H46 O;  4DR5 K;  1WAJ A;  2D0C A;  5HRR A;  1Q18 A;  5B8H A;  1XWL A;  1IJJ A;  2B6A A;  3V6D A;  3NGY A;  2UU9 K;  4FJM A;  4IOA L;  4ELT A;  5KI6 A;  2O4I A;  5KPZ A;  1W2B M;  2RQ1 A;  4OLB A;  1S6P A;  4BE1 A;  4Z4I A;  3VA0 A;  4A61 A;  4AH9 A;  1XI1 A;  1Y19 B;  4FYD A;  1YIJ N;  2P9I A;  3P4I A;  1VQ4 N;  4K41 A;  3AVJ A;  1QZ5 A;  3CQY A;  4MFB A;  5GAD P;  3V4I A;  3OBY A;  2BDP A;  4C8M A;  3QEX A;  1ATN A;  2W6L A;  4FZX C;  4DR4 K;  4DSK A;  4OPK A;  3CC4 N;  3VQP A;  3K2P A;  1G15 A;  3U6F A;  4Z4C A;  4B1W B;  1HKC A;  4IFY A;  4KRE A;  3RWU A;  4X62 K;  4LFC K;  3LP3 A;  3ZEU B;  1D4X A;  3TTF A;  3TAE A;  4E1J A;  1JXB A;  3KK1 A;  1VRU A;  1TAQ A;  3I33 A;  4QCL A;  4CFD A;  4BR0 A;  4E1M A;  3WEE A;  3FFK B;  1CZA N;  4DTS A;  1C0U A;  4CZG A;  4CJT A;  2Q0U A;  1RDA A;  3M8Q A;  3IG1 A;  4Z4F A;  3LAM A;  2ZWH A;  1RBS A;  1HKB A;  4GV9 A;  1NM1 A;  2HHU A;  3KKR A;  3CCU N;  4BE2 A;  1LW0 A;  4O44 A;  1TVR A;  3RR7 A;  1Z26 A;  4CHQ A;  4H4O A;  3KK7 A;  1NJW A;  3U8X A;  3M6G A;  3TAN A;  3S3M A;  2I5J A;  3CYM A;  5C0Y A;  5AQG A;  1LCU A;  4PWD A;  2Z1I A;  1GLE G;  1SAZ A;  2P9S B;  2KTQ A;  1VSK A;  4IDK A;  1JJ2 M;  4CF1 A;  2E8A A;  4BRA A;  3K58 A;  4CHZ A;  3O9S A;  3LPU A;  4O55 A;  4MDB A;  2CH5 A;  2X74 A;  3EO3 A;  1MIX A;  2WON A;  4H8K A;  2ETJ A;  1TKD A;  2V7Y A;  1JL2 A;  2X78 A;  3WXI A;  2A1R A;  2O8D B;  4PKH A;  2P9U A;  3TAR A;  3KLF A;  1GLF O;  4F2S A;  4WCE L;  4M3U A;  3AGK A;  5HBM A;  4ILJ A;  4B3M K;  1XMO K;  2HMP A;  1Y64 A;  1Q9X A;  3AVM A;  1MK9 B;  1BHL A;  3VQQ A;  3EKS A;  1T7P A;  1HMV A;  1GG3 A;  1E4F T;  2NZT A;  4JKG A;  4C8N A;  1S72 N;  1CZB A;  4BRG A;  1Z05 A;  2J0K A;  2E88 A;  2DFH A;  1LW2 A;  1GOC A;  4CGF A;  4MO5 A;  2OCE A;  3LDO A;  3L2R A;  3CCS N;  3CC2 N;  1VSL A;  3V9S A;  3CD6 N;  3AO2 A;  1QTM A;  1TK0 A;  3BF3 A;  1VRT A;  3TR8 A;  4N41 A;  5AR0 A;  2KW4 A;  3NF9 A;  4I6M A;  3L0Q A;  2VG6 A;  2LSN A;  5BR8 K;  5E84 A;  2O4G A;  5LL6 Z;  3ZX2 A;  3HP9 A;  1O1W A;  4CHN A;  1OH7 A;  1VQK N;  1W9H A;  1L3T A;  3K0S A;  5C10 A;  3J7Z O;  4KB0 A;  5BRE A;  1NGH A;  4FLU A;  1HNV A;  4ILH A;  3VEO A;  1OKJ A;  3HPO A;  3CER A;  3AA4 A;  2P9L A;  4BR4 A;  3QLH A;  3UKR A;  4BR9 A;  5AZJ A;  5GAE P;  2Z1H A;  1B92 A;  3V1O A;  2VQE K;  3VER A;  2HBJ A;  2D4W A;  1EXQ A;  5AQX A;  4E7J A;  3A8Y A;  5CHI A;  3O3F A;  4DLG A;  1FJG K;  3SI6 A;  1XHZ A;  1C6V A;  1KBL A;  4DLE A;  4B3S K;  2O8E B;  3KLI A;  2O8C B;  4PL8 A;  1X1P A;  3HL8 A;  4ILG B;  2FBV A;  3NMU A;  1FW6 A;  3ZLJ A;  1ASV A;  1U2V A;  5FRM A;  1HRH A;  3VTH A;  3T19 A;  3U8Z A;  4LF5 K;  5AQO A;  3JYT A;  1P8Z A;  4IG3 A;  3DXK A;  3VQE A;  3AVB A;  1RCH A;  4N47 A;  1FK9 A;  2FSN A;  3L2Q A;  4JRP A;  1SZ2 A;  2OTJ N;  5EVZ A;  4OO1 J;  1NG9 A;  3O1W A;  2JWL A;  1OVQ A;  2Z1J A;  5LY3 A;  1NK7 A;  1UOC A;  2A1S A;  5HP1 A;  1GLD G;  3CET A;  3HPG A;  4FJX A;  3SZ2 A;  1Q86 O;  2FF3 B;  4FJ8 A;  2A40 A;  3K59 A;  3T1H K;  1HBK A;  4I2Q A;  3VQD A;  2QWL A;  4FVM A;  5KRT A;  3OHR A;  5AQQ A;  1S1X A;  4H0Y B;  4CJR A;  3RMC A;  4DS4 A;  1IKX A;  3ZT3 A;  2D0B A;  2J0M A;  4EFH A;  1BI4 B;  4BGB A;  3NF8 A;  3N4Q A;  3AAQ A;  4FWL A;  1S1V A;  4FLZ A;  2HNZ A;  5LMU K;  2BE2 A;  3AAR A;  3NBP A;  5AQV A;  3AVA A;  2YHX A;  2G8U A;  5E41 A;  4CHO A;  3QO9 A;  4ELV A;  3CCR N;  1K6Y A;  2E2O A;  2KHO A;  2HRJ A;  1UA1 A;  3NH2 A;  4B9M A;  1MWK A;  3RSE A;  3G10 A;  4KPY A;  5EXW A;  1Q81 O;  2NRT A;  1EWQ A;  3SYZ A;  3D2F B;  2OPQ A;  1NKE A;  3O1B A;  4RCH A;  2IVN A;  4J2E A;  4JD2 B;  4WF9 L;  4YOR A;  3WQT A;  4M7X A;  3VQC A;  4F4K A;  4R5P A;  1J53 A;  3P31 A;  4DFJ A;  4LH5 A;  1VQP N;  3DOK A;  2NNW A;  5AQY A;  4JKH A;  3E66 A;  1DGK N;  2F4V K;  1VHX A;  1HPZ A;  3ZET B;  3I55 N;  3OTO K;  1HNW K;  3WXJ A;  4NB4 A;  2YX6 A;  1NGB A;  3VQ4 A;  4CZE A;  3CCV N;  1MU2 A;  2QW9 A;  3DJC A;  4KAZ A;  4PL7 A;  4O0J A;  1JDE A;  3H1Q A;  4CBW A;  1GLB G;  3HVR A;  3K9J A;  1NI2 A;  3EZ5 A;  4FJN A;  3KLE A;  4CJ3 A;  3OJU A;  3KK2 A;  1YUW A;  1RTH A;  2RPI A;  4LF9 K;  1Z6R A;  3AU4 A;  3C6H A;  4Z0U A;  1T44 A;  2YJF A;  3G25 A;  5C42 A;  1IBM K;  3UKU A;  3SUO A;  1N5Y A;  3VQ9 A;  1NWK A;  1NGG A;  1VSD A;  2JGU A;  4FOI A;  4JYA K;  3DXM B;  3LDL A;  4PY5 A;  5JS1 A;  2E5L K;  3O6W A;  1FKP A;  4DR6 K;  4E7H A;  4BRK A;  3PLA A;  4H0X B;  2WTU A;  4JK8 A;  1REV A;  4LC9 B;  4RW7 A;  4KHN A;  4KBO A;  3G4S N;  3QBW A;  3PX4 A;  3HYF A;  1TKZ A;  3THX A;  2ZJP L;  2FBX A;  2IIR A;  4BRN A;  3DI6 A;  2VGM A;  4CED A;  3AO3 A;  1EWR A;  4IDH A;  1T3V A;  4DQQ A;  4DS5 A;  4Z4G A;  3LWL A;  4CJL A;  3F9M A;  1GOA A;  3CXC M;  1GLL O;  3G9W A;  1XQS C;  4BDZ A;  2VWK A;  2HHV A;  3TWH A;  3VQ5 A;  1YTU A;  1HR0 K;  1NK4 A;  4L8R B;  1U04 A;  3THW A;  4A57 A;  2D5R A;  1LAV A;  2GEL A;  3AA3 A;  3ENO A;  1EF1 A;  4AHC A;  4BQZ A;  5HOO A;  1TKT A;  4KI4 A;  2XO7 A;  4BWJ A;  3PY8 A;  4W5N A;  2Y1J A;  1RTI A;  1NGA A;  4IJA A;  1RT3 A;  4CZJ A;  1XNR K;  1N36 K;  3E1Y A;  4NYN A;  1YAG A;  2EHG A;  2BH1 A;  3TI0 A;  4CEB A;  3PO4 A;  2E1Z A;  4JI7 K;  1RT2 A;  4HTU A;  4ZTJ A;  5FPM A;  3ZT4 A;  5J2N A;  3SQ1 A;  3M8P A;  1HUX A;  4FJG A;  3CJA A;  4Z4H A;  4F3T A;  3L3V A;  2QWR A;  3OY9 A;  2P9K B;  5HL7 L;  3M8S A;  4YOY A;  5CY4 A;  4RG8 A;  3BF1 A;  5FRO A;  2HMI A;  1VAZ A;  3CHW A;  2ITG A;  2FDQ A;  2ZE2 A;  3SAG A;  2E2Q A;  3TAP A;  4PKI A;  4R79 A;  3DM2 A;  3KD1 E;  1QQN A;  2HB5 A;  5I3U A;  4U7B A;  1WNS A;  1BWF O;  3L2W A;  3LM9 A;  4NYF A;  2GTD A;  3MN6 A;  4OJR A;  2HVH A;  2FBT A;  1DLO A;  5FPN A;  3C95 A;  1KRP A;  3SQ4 A;  4DB3 A;  4LF8 K;  2EX3 A;  4FLV A;  2FC0 A;  3KVG A;  4CE9 A;  2HOE A;  3ULD A;  4BRO A;  2XRI A;  1JCF A;  1BQN A;  4FPA A;  3G71 N;  4H0P A;  3GG4 A;  2P9N A;  4W5Q A;  1RNH A;  4LFB K;  3ZSR A;  4CD3 A;  4BAC A;  3EKU A;  4G9Z A;  4HDO A;  1VSJ A;  4J2B A;  1C1B A;  5JVG L;  4CJP A;  3V81 A;  4CJV A;  3OYF A;  3CC7 N;  2PFU A;  3MXI A;  3H1V X;  3EE8 A;  4K42 A;  3BZC A;  3J81 O;  2HVI A;  4GKJ K;  3F5T A;  1JLG A;  3ZYY X;  4B3R K;  1KVB A;  5KTQ A;  2YNG A;  3MEG A;  3QES A;  4M3X A;  1Z25 A;  3HTV A;  4E19 A;  4B08 A;  2HHS A;  1QS4 A;  2JWK A;  4JK7 A;  1WN7 A;  3AVH A;  3SAF A;  3H6E A;  3NHG A;  3WT0 A;  4CES A;  5DM7 L;  1GGO A;  4MDA A;  4Y1D A;  4YOV A;  4OPJ A;  3O80 A;  3EL2 A;  3C6T A;  2GWK A;  2Q97 A;  4NO7 A;  2G8H A;  5AQK A;  5AQS A;  4AHT A;  3VQ8 A;  4KKO A;  1U48 A;  3NH0 A;  3QIC A;  4FJK A;  3D45 A;  1NK6 A;  1C1A A;  3FE1 A;  1NK9 A;  4PA1 A;  3OYK A;  4JAX A;  2CQU A;  4O8K A;  2NUB A;  1KQS M;  3DLG A;  4FOE A;  4OLA A;  1LOT B;  2PBD A;  4YOX A;  1LWC A;  4IZ9 A;  1TV6 A;  1I39 A;  5C2F A;  3WQU A;  4IFV A;  1V4S A;  2IOC A;  1JCG A;  3O9Q A;  3MK6 A;  1VQN N;  3D2E B;  4NXM K;  1J5E K;  3HOS A;  4DTO A;  4PQU A;  2XY7 A;  1ASW A;  5MLC Q;  2X0S A;  2B5J A;  1U6Z A;  3OYA A;  5H1S Q;  4ISG A;  3OYN A;  1T6C A;  3O4W A;  4YL8 A;  4FPB A;  4LF6 K;  4OPH A;  3SUN A;  2G8F A;  3OYG A;  3AA5 X;  3VQ6 A;  4M41 A;  4FVU A;  4FM2 A;  3BY5 A;  3UE5 A;  3ZEU A;  2NRX A;  3MX2 A;  4CD1 A;  1C0F A;  3RRH A;  2G8W A;  1SUQ A;  3QET A;  1DKG D;  3SV4 A;  3SPY A;  2LBB A;  4C1N I;  4DUY K;  3BEX A;  2F7T A;  1HYS A;  1RT5 A;  4H0V B;  4JEP A;  1NLV A;  5AQI A;  2OYQ A;  5AFU H;  4M3R A;  2Q2R A;  2HHH K;  5AQZ A;  3DLH A;  5DM6 L;  1Q9Y A;  1MIZ B;  1HPM A;  1IO2 A;  1QSL A;  5EY4 A;  5C25 A;  1VQ6 N;  4MLH A;  2Q3S A;  1X9W A;  2Z1G A;  3EE9 A;  4FWQ A;  4DSE A;  4IFE A;  3MDQ A;  5JVH L;  1J19 A;  4I9Q A;  1KVC A;  4EZ6 A;  4JRQ A;  3FP5 A;  2P9S A;  3PX0 A;  3K5M A;  1TK5 A;  4FM1 A;  3CCL N;  2YKN A;  2GWJ A;  4F8R A;  1I3A A;  3PUF A;  5AFU A;  4JKC A;  3Q7C A;  4FWP A;  4KTQ A;  3TAF A;  4CHP A;  2D2Q A;  3ASM A;  4BRL A;  4M3Y A;  2E20 A;  4ELU A;  1B9F A;  1KLN A;  1HLU A;  1ZBS A;  1RDD A;  4BR5 A;  2O8D A;  4H5R A;  4BC5 A;  4M7Y A;  3LAK A;  5AQL A;  4QS9 A;  1QVG M;  3O4Q A;  1SL2 A;  3I0S A;  4K8Z A;  3CPW M;  3AO1 A;  3ATV A;  3LDQ A;  1T6D A;  5KRS A;  5C15 A;  3C0B A;  1ZBL A;  4A62 A;  4GKK K;  1VQO N;  3BGR A;  5GIN A;  1B9D A;  3IAY A;  1RT6 A;  3F2K A;  3VN5 A;  4LD0 A;  2R7Y A;  1XC9 A;  4DFK A;  2VGN A;  4Z4E A;  1FXX A;  4HWI A;  3ULE B;  3DYA A;  3O9U A;  4CCH A;  2FLO A;  4E7I A;  2P5G A;  3U4L A;  3P83 D;  1K9M O;  3HO1 A;  4KRF A;  2HNY A;  2QM1 A;  2E4L A;  3QEP A;  3CQX A;  1KSP A;  2QWQ A;  3OJS A;  3ID8 A;  3LDN A;  1EO1 A;  2KFN A;  3ZSQ A;  4BDY A;  4CYE A;  4O5F A;  3DAW A;  3SNN A;  2UUB K;  5KGW A;  3HRG A;  3I56 N;  4HHT A;  3S3O A;  5ADX H;  2F9W A;  3ITH A;  4A2B A;  3GL1 A;  2KQ2 A;  4IOC L;  1Q7Y O;  4BY9 C;  3ID6 A;  4GY2 B;  3HT3 A;  4K8X A;  3WUH A;  1JLF A;  4W5O A;  4DTU A;  1ILY A;  1SS6 A;  2D0P A;  4JI4 K;  3U3G A;  1H1V A;  4CZF A;  3T7Z A;  4V19 S;  3K5N A;  4M3W A;  1NU0 A;  2AJQ A;  1A5X A;  5GAH P;  2J0J A;  4BRE A;  4GXB A;  2CGJ A;  4A2A A;  4MO4 A;  1K8K B;  4DQR A;  4BGA A;  4JK9 A;  3EEQ A;  4DHY A;  2RHK A;  1NOZ A;  2QXF A;  3DLK A;  4FWO A;  2ASM A;  3U9Z A;  4DG1 A;  2Q31 A;  3VEY A;  2O8C A;  1TL3 A;  4BRD A;  3KIO A;  2P5O A;  3QIO A;  4DSJ A;  1IH7 A;  5EU7 A;  3LAL A;  4OPA A;  3S41 A;  4YOW A;  3CCQ N;  4GVE A;  5BN9 A;  4CGH A;  1BCM A;  1S22 A;  1GLC G;  4IJN A;  1KAY A;  3VQ7 A;  4CFC A;  3QFP A;  4CF0 A;  3OYM A;  2IC3 A;  2QI2 A;  4CJK A;  3THY B;  1R0A A;  4DCH A;  4B9Q A;  4DTR A;  3RRG A;  4GV6 A;  3RR8 A;  5IWA K;  3AVF A;  2F96 A;  3EYZ A;  4HCC A;  3I8D A;  1Y97 A;  5M1K A;  4CJ4 A;  1SL1 A;  1K8A O;  4IEI A;  1GLA G;  3FLV A;  1XMQ K;  4CEC A;  5HRN A;  4FL9 A;  1E4G T;  4CZI A;  4FLX A;  1WBD A;  1HX1 A;  2X6N A;  4BVP A;  3O4N A;  3NH1 A;  5CYM A;  4E89 A;  4HUG A;  4KHU A;  2UXC K;  3FFI A;  1TL1 A;  2CB8 A;  3PSI A;  3OS2 A;  2NLX A;  3WNE A;  1BI4 A;  3O3G A;  1R59 O;  3D6R A;  4N76 A;  5C2D A;  3BZK A;  3KWG A;  3MXJ A;  4M63 C;  4BR7 A;  4DQI A;  4DTN A;  3ENB A;  4RTF D;  4CFB A;  1T8E A;  5J2P A;  1ISN A;  2QXL A;  3K5L A;  4BC3 A;  4ZHR A;  1WSJ A;  4JHD B;  3OYI A;  3VF2 A;  5IJM A;  3L3U A;  4B3T K;  1JKH A;  3CJB A;  5F2R A;  5BRD A;  3PV8 A;  4CGI A;  1RDC A;  3CJ1 A;  1WSG A;  1ZC6 A;  3VEZ A;  1BQM A;  1BIS A;  1EX4 A;  1ZXO A;  4CK1 A;  4CER A;  4IO8 A;  3D2F A;  2A5X A;  1VK0 A;  2D0O A;  3TTD A;  1EP4 A;  3NGI A;  4JKA A;  3EN9 A;  1QQM A;  3AU5 A;  4E3S A;  3RMD A;  4CGJ A;  4JD2 A;  4OKE A;  3TAG A;  3ZX3 A;  2HW3 A;  2NRH A;  4YOT A;  4DQP A;  2RE2 A;  2A42 A;  4B3O A;  1DTQ A;  5BPM A;  1ZBU A;  2FBY A;  1IBL K;  1ZBI A;  5KGX A;  3UB5 A;  3VES A;  3MCP A;  1JLA A;  2HHT A;  1BL3 A;  1VBH A;  3ZET A;  1E5W A;  2IAJ A;  3VGL A;  3PO5 A;  4LF4 K;  3T1Y K;  4JV5 K;  4CJU A;  2DIK A;  5AQP A;  3PSF A;  3ZSO A;  1VQ7 N;  4X65 K;  1HNI A;  4CW7 B;  3QBX A;  4CEE A;  3NDK A;  2UXB K;  4ZRI A;  3DMJ A;  3IFR A;  1NGF A;  3DRR A;  4GVM A;  3DLR A;  4JKF A;  3AVI A;  1YJW N;  2D1K A;  3OYJ A;  1L3U A;  2NRV A;  3LDS A;  3OYE A;  1OH5 A;  1TYQ B;  1RDB A;  4DSI A;  1MK7 B;  4K43 A;  1NOY A;  2DFF A;  4JI1 K;  4DU3 A;  3E9L A;  3VMF B;  2I7N A;  3I0R A;  3P1G A;  3OA9 A;  1RDW X;  4CEA A;  4DTX A;  3DXM A;  3MEE A;  4CEO A;  4CI6 A;  4Y1C A;  2KKZ A;  2ZD1 A;  4DFM A;  1K73 O;  3GOI A;  3UIQ A;  3ZCM A;  2E1Y A;  3IDH A;  4L3Q A;  1WBB A;  1LWE A;  2OPR A;  2ZM6 K;  5BR9 A;  1VQ5 N;  4CF8 A;  3WNF A;  3AA2 A;  3KK3 A;  1S1U A;  1YF5 L;  1ZBH A;  4G1Q A;  4X64 K;  1HB6 A;  4BRF A;  4JI2 K;  4YFU A;  4B9U A;  2DFE A;  2PZS A;  3VQB A;  1D8Y A;  3OYH A;  4KB1 A;  3E9P A;  1LWF A;  1NK5 A;  3TAQ A;  3MCA B;  3O9R A;  2V51 B;  3AV9 A;  3A5M C;  4FWN A;  4C23 A;  2DPN A;  4B9T A;  4XH4 A;  4Z94 A;  5J2Q A;  1N6Q A;  4KHW A;  3CI5 A;  2G8V A;  2KFZ A;  1XNQ K;  1M90 O;  4JLH A;  2GX9 A;  4FM0 A;  5HRO A;  3HXM A;  4I7F A;  3AVL A;  4KHP K;  1DT9 A;  1WSF A;  5SZT A;  1KLM A;  3LP2 A;  2HBM A;  1RTD A;  1YVU A;  2GV9 A;  4F9O A;  4E1N A;  3FGU A;  4FW1 A;  4C8K A;  4GW6 A;  4P7I A;  4XEI A;  5AQR A;  1OH8 A;  1S9G A;  1YT3 A;  4CGD A;  3AVK A;  4DTP A;  5CR4 A;  2G8I A;  2VCP A;  3A0I X;  4KTZ A;  1GC7 A;  2P9K A;  1WOQ A;  1J6Z A;  4YDU A;  3KLH A;  3OYC A;  1YXQ A;  2QWM A;  1HJO A;  4MLE A;  5BPN A;  3KTQ A;  1IV0 A;  2D10 A;  5EX5 A;  4CBX A;  5GAG P;  5FRN A;  2FXU A;  2ZPY A;  4DTJ A;  1XUP O;  5JVL A;  1SQK A;  1L5U A;  3C94 A;  3L2U A;  4EZ9 A;  5CYQ A;  5KQD A;  3AO4 A;  5AZI B;  2FJ9 A;  1YTA A;  3X23 A;  1TAU A;  4BVO A;  3O5B A;  4JNE A;  1NTI A;  1QQC A;  1RBV A;  1NNE A;  3T3F A;  4PHT X;  2GUI A;  1S5J A;  4IWV A;  3CCJ N;  1ACA A;  3D7E O;  2QKB A;  4H0O A;  5AQH A;  2CGL A;  3VEN A;  2Q36 A;  3DLE A;  4JKE A;  4NLC A;  1D9D A;  4OGE A;  5AQN A;  1JLQ A;  1U49 A;  4WFN L;  2YHB A;  3M1F A;  1T03 A;  2BTF A;  3IRX A;  4CJE A;  4NCG A;  4JI5 K;  1NBW A;  4DR1 K;  4KTW A;  4N5S A;  4M42 A;  4CGG A;  5GIO A;  4CJS A;  3CF5 L;  4BG9 A;  3QIN A;  1N8R O;  1YIT N;  3GDQ A;  2Q1N A;  5AQU A;  2RF2 A;  2GBZ A;  3P38 A;  4DU4 A;  4FSV A;  3MN5 A;  2IS3 A;  5AQW A;  4NXN K;  5A2Q O;  2AA4 A;  2YKM A;  2Y1I A;  5F0X A;  3JAM O;  2WUS A;  4B1X B;  1QHT A;  3ZSV A;  3NFA A;  1VQL N;  2I7P A;  4IKF A;  3SJJ A;  3SMP A;  3IS9 A;  4XH5 A;  1N34 K;  4CJF A;  4UQG A;  2HHW A;  4CJ7 A;  1X9M A;  3EZW A;  4BRP A;  4FJI A;  3ZSW A;  2ZGZ A;  5JS2 A;  4FLW A;  1DTT A;  3RMB A;  2O8B B;  2NRZ A;  3H45 C;  3MAQ A;  3G0Z A;  3IKM A;  4FLY A;  4Y0W A;  5GIP A;  1KC8 O;  2QTD A;  3SK3 A;  1VSM A;  3OBW A;  4PUO A;  3GBT A;  3SQ2 A;  2HST A;  2F8T A;  4YHH K;  1E3M A;  1WUA A;  3O3H A;  4FZY A;  1GC6 A;  3CFR A;  2YHW A;  3L4I A;  1SGH A;  4O8U A;  3QDK A;  4CIF A;  3MED A;  4A59 A;  4FK2 A;  2UUA K;  1A5V A;  4BG8 A;  4KHQ A;  4ZRK A;  3HPH A;  3SBT A;  2AEH A;  5AQF A;  3SV3 A;  3D2E A;  2ZQB A;  4WQ5 A;  2E6M A;  2QA4 N;  4CJW A;  1MA9 B;  1QSS A;  2QKK A;  3V9X A;  3TSQ A;  3SAH A;  3LP1 A;  4A5B A;  1M1K O;  4F3O A;  1IG9 A;  3P5J A;  4BR2 A;  3NCI A;  3KD5 E;  1WSE A;  5IT9 O;  2PY5 A;  3C7N B;  1IG8 A;  4FJ9 A;  1KXP A;  4FO0 A;  4B1U B;  4KH6 A;  1KAZ A;  2HF3 A;  3O08 A;  3NAE A;  1IKY A;  1ESV A;  1W97 L;  4CEZ A;  4CZH A;  4DSF A;  4JI8 K;  3FZF A;  2NRR A;  5CE3 A;  4H5V A;  1NK8 A;  2VG7 A;  4NCB A;  4CFA A;  4KO0 A;  4DF8 A;  1L3V A;  1QVF M;  3WA0 A;  4X66 K;  4E7K A;  1S1T A;  3MWP A;  3I8B A;  4J2A A;  4AHS A;  4LF7 K;  3CJ7 A;  1TUY A;  2PYJ A;  1ITG A;  2O8F B;  3CM6 A;  3JSM A;  3KKS A;  2P9P B;  3IUC A;  1D5A A;  5ELZ A;  1IKV A;  3O9T A;  3QEV A;  4KHY A;  5CZ2 A;  3T1A A;  2BGG A;  5J2M A;  3QIJ A;  4EAH D;  4KHS A;  2V7Z A;  4WQ4 A;  1BG3 A;  1NGC A;  3SPZ A;  1C0M A;  3LDP A;  3O8M A;  4FK4 A;  1NGI A;  1BGX T;  1JCE A;  3B6P A;  3QNN A;  2OTL N;  4DV6 K;  4M3T A;  4CK2 A;  2VWB A;  4BC4 A;  1JLE A;  5TKY A;  3CFP A;  3DOL A;  2HBK A;  4H5W A;  4EP4 A;  1YJ9 N;  2IVO A;  1QQO A;  3LM2 A;  2G8K A;  4ZRJ A;  2IGI A;  3AO5 A;  2F9T A;  1F21 A;  2W42 A;  5K14 A;  4M45 A;  1QHA A;  2P9I B;  4CK3 A;  4BRI A;  2UUC K;  3B8A X;  3CJ9 A;  1GLJ O;  4FK0 A;  1HB8 A;  1BA1 A;  2EMT A;  4QAG A;  3ZSX A;  1YHQ N;  3MN9 A;  4OX9 K;  5BPL A;  2ABD A;  3P39 A;  2HHX A;  2H3G X;  4IG0 A;  4W5R A;  3VEV A;  1HYZ A;  3VEX A;  2EWS A;  3CG7 A;  2E6L A;  4OKJ A;  5BRF A;  3QEI A;  3SLC A;  3LWM A;  1U47 A;  4FXD A;  4PKG A;  3EPY A;  3WEE B;  4HTL A;  3ZX0 A;  4B9V A;  4H0T B;  3D0P A;  2W6K A;  3VF4 A;  1BDG A;  4K0K K;  3AVG A;  1W0H A;  3ULE A;  5C24 A;  2HBL A;  2UYT A;  3NF6 A;  4AHU A;  3CFO A;  3N4P A;  3LAN A;  1WAF A;  4FZZ A;  1Q82 O;  3PIP L;  4FCY A;  2D0A A;  3NF7 A;  1WB9 A;  1NKC A;  1S3X A;  3OYL A;  4C1N K;  2PAV A;  4HCB A;  4FLT A;  1NGJ A;  3T69 A;  1U4B A;  3AGR A;  3KWI A;  4ID5 A;  4DV5 K;  1H4R A;  1EQY A;  2A6A A;  5M1O A;  1QSY A;  1CXU A;  2QWP A;  3HI0 A;  2QEX N;  2DY4 A;  3TSU A;  1Q8I A;  1W7A A;  2ZJR L;  1I94 K;  1BIU A;  2XY5 A;  1UAX A;  3V9U A;  4DQ8 A;  2VG5 A;  3H08 A;  4KH5 A;  4C8L A;  2OPP A;  1NMD A;  4GV3 A;  3M5R A;  3W3D A;  4E0D A;  3OYD A;  1BUP A;  3QNO A;  4FWM A;  2Q0R A;  1K8K A;  4DMN A;  1X9S A;  2P9U B;  5FDL A;  4RW9 A;  3VPZ A;  4LFA K;  2IVP A;  3SMS A;  4ZTF A;  2YNI A;  3VTI A;  3ENH A;  3HM8 A;  1NJI O;  4CF9 A;  2QWO A;  3M3Z A;  1WLJ A;  2WOM A;  3AAP A;  3VF6 A;  3FR0 A;  4DR7 K;  4CJ5 A;  4EHT A;  3CCE N;  1JLB A;  4DWI A;  2O8E A;  1NJX A;  4JKG B;  2GUP A;  4WFA L;  3TTC A;  1NJY A;  2ZJQ L;  3THV A;  3HOT A;  1LAW A;  4CEF A;  3THY A;  5ADX A;  2ITM A;  2YV0 X;  3BDP A;  3OYB A;  4LY7 A;  3OS1 A;  4KI6 A;  4FW2 A;  4AF1 A;  4ID1 A;  3GE1 A;  5JMV A;  3MEC A;  3TPQ A;  4DV3 K;  3ZT1 A;  2V52 B;  2CH6 A;  3QEW A;  3K9K A;  1HQU A;  2ZGY A;  2ATQ A;  4YDU C;  4B9N A;  1BU6 O;  3TU5 A;  1RBR A;  4W5T A;  4B1Y B;  5LJV A;  4LSN A;  4I6M B;  3DLL L;  3R1X A;  1N33 K;  3TAM A;  3WXM B;  1BCO A;  4RW6 A;  1N32 K;  3LP0 A;  3MWT A;  4DKW A;  3DLB A;  4DV7 K;  1RT4 A;  4NLB A;  1SL0 A;  1RTJ A;  4FWK A;  1MDU B;  3DRS A;  5AQJ A;  2HF4 A;  2YCH A;  4BRC A;  1J9A A;  4JHD A;  3K57 A;  4OKK A;  4IEE A;  1KD1 O;  3MN7 A;  2W40 A;  2E2N A;  2ASP A;  3C6A A;  2P9L B;  4F2R A;  3UKR B;  5AZJ B;  5KPR A;  1X9J A;  5M1F A;  4M3Z A;  3SBG A;  1DIK A;  1P90 A;  4CZM A;  3A5L C;  5AJ3 K;  2OPS A;  1ZYQ A;  3ATU A;  1WSH A;  3PX6 A;  3HSC A;  4IOX A;  2HE7 A;  3HZ6 A;  1EET A;  1FKO A;  4KV8 A;  2UXD K;  4J8F A;  1U2V B;  1KTQ A;  1S9E A;  1BA0 A;  3WXL A;  4AM7 A;  3CM5 A;  4I2P A;  1IBK K;  1S1W A;  2YNH A;  4OVL A;  3KJV A;  1IKW A;  5I9E B;  4CIG A;  4BQL A;  1BIZ A;  4DV2 K;  1C0T A;  2XY6 A;  3DXK B;  3JS6 A;  1X3M A;  5M1P A;  4N56 A;  3NGZ A;  3F73 A;  4WFB L;  4B9S A;  3OVN A;  3MMV A;  5BN8 A;  1OVY A;  2CGK A;  3B6O A;  4UY8 O;  2YHY A;  4FJL A;  2YJE A;  3FZH A;  4EP5 A;  3OW2 M;  1UA0 A;  5D3G A;  1CLQ A;  4J2D A;  4O4G A;  1EKE A;  1TKX A;  3VQA A;  4NCA A;  1KCF A;  4QS8 A;  2XHB A;  3HM9 A;  3ZDT A;  4YNQ A;  4AIL C;  4XIU A;  4A5A A;  3RMA A;  1TUU A;  3V1R A;  4TKN A;  3BUZ B;  5JLH A;  3HP6 A;  3RVC A;  1TYQ A;  3ZT0 A;  3PZD A;  4BRH A;  2YI1 A;  3ISN C;  1SKW A;  1ATS A;  2IDO A;  3S3N A;  1HNX K;  4HDQ A;  3LPT A;  3FZK A;  1UWB A;  1JLC A;  3HK2 A;  3KZB A;  1NK0 A;  4DR3 K;  3MX5 A;  3RSE B;  5HRS A;  4WQ5 C;  4DUZ K;  1HJR A;  3ZT2 A;  5JIC A;  3OS0 A;  3FLC O;  1G99 A;  3R6M A;  5J1E A;  1ASU A;  3LL3 A;  4IBN A;  4YY3 K;  1MWM A;  5E26 A;  4DR2 K;  4I9L A;  1VQ8 N;  1ST7 A;  3U9D A;  4NY0 A;  1HNZ K;  3IVF A;  3U3Y A;  3L4Q A;  3CME N;  5AQT A;  4BRQ A;  2OZM A;  1VSF A;  1SKS A;  1V4T A;  4JN4 A;  3VET A;  3RTV A;  4QOZ B;  4BWM A;  2YVC A;  3J8A A;  5JLF A;  3J7Y P;  4IO9 L;  1RGI A;  4H4M A;  4JI0 K;  3CMA N;  4CJQ A;  1NKB A;  1GOB A;  5DK5 A;  4LH4 A;  1RBU A;  3CQ8 A;  2W41 A;  3E01 A;  2P51 A;  5C12 A;  5M1N A;  2OAN A;  1XHX A;  4YOU A;  1VQM N;  4GNI A;  4HVJ A;  4JKD A;  4DV1 K;  1ZBF A;  4WQ4 C;  2D11 A;  1HKG A;  3SQ0 A;  1RBT A;  1A5W A;  2WH5 A;  3CJC A;  4DFP A;  1RFQ A;  4EKU A;  3U7D A;  3L8B A;  3EY1 A;  4HUF A;  1LV5 A;  2BUP A;  3UKU B;  1VQ9 N;  1KFS A;  3SUQ A;  5CZ1 A;  4B1V A;  1C0G A;  4Q5V A;  1RDU A;  3KHY A;  3V9Z A;  4GMJ B;  1YI2 N;  1T05 A;  3HJF A;  3CPE A;  4CZL A;  3V9W A;  2HHQ A;  1U45 A;  3L2V A;  3AVN A;  2AL6 A;  5BRH A;  3CCM N;  1NJZ A;  1OH6 A;  3HST B;  3QIP A;  5DMR A;  4JS5 A;  2XY8 A;  4EIA A;  1BOT O;  1NGD A;  2YNF A;  5M1Q A;  3TSP A;  4O0I A;  2I1K A;  3THX B;  2WBN A;  3HBT A;  3Q7B A;  1NMN A;  1JXE A;  2DTU A;  4DXA B;  3R9P A;  1SKR A;  4B8C A;  4MQ3 A;  4DSL A;  5HRP A;  2FSJ A;  3NVM A;  5AZI A;  4JI3 K;  5KPT A;  3WNH A;  4KH4 A;  4CHY A;  3A5O C;  4AHV A;  3S9H A;  3SUP A;  4U67 L;  1KVA A;  3H3N O;  4LSL A;  4F7G A;  4RW8 A;  4JS4 A;  2GEM A;  1ATR A;  3FZM A;  5I42 A;  1TGO A;  3FZL A;  4H03 B;  3THW B;  3QML A;  4XH1 A;  1HQE A; 
#chains in the Genus database with same CATH homology
 3CJ7 A;  1TUY A;  1BO5 O;  4ISE A;  4RCH A;  3WUH A;  2IVN A;  4JD2 B;  4WF9 L;  4YOR A;  2P9P B;  3A5N C;  3IUC A;  1SS6 A;  4M7X A;  5ELZ A;  3WQT A;  1ILY A;  2D0P A;  2E2P A;  3O9T A;  1H1V A;  3P31 A;  4CZF A;  3T7Z A;  2NRW A;  1VQP N;  3QIJ A;  4EAH D;  5LJW A;  3PVL A;  1YVN A;  5GAH P;  2V7Z A;  4WQ4 A;  2J0J A;  1BG3 A;  1NGC A;  4BRE A;  2NNW A;  3JXU A;  3LDP A;  3O8M A;  4GXB A;  4JKH A;  2CGJ A;  5AQY A;  5FPD A;  3E66 A;  1DGK N;  4IXC A;  1NGI A;  3W0L A;  1JCE A;  4A2A A;  4MO4 A;  1K8K B;  3VOV A;  2OTL N;  3ZET B;  1KC7 A;  4BGA A;  3I55 N;  2KLA A;  4JK9 A;  4DHY A;  2RHK A;  3WXJ A;  3VEW A;  3U9Z A;  4NB4 A;  2J4R A;  2ASM A;  2VWB A;  2YX6 A;  1NGB A;  2Q31 A;  4FWO A;  4BC4 A;  3VEY A;  4CZE A;  2EMS A;  5TKY A;  4CZK A;  3CCV N;  4BRD A;  3E9O A;  2HBK A;  2QW9 A;  3DJC A;  4H5W A;  4PL7 A;  1YJ9 N;  2IVO A;  1JDE A;  3H1Q A;  1QQO A;  4OPA A;  4CBW A;  1GLB G;  3S41 A;  4YOW A;  3K9J A;  3LM2 A;  1NI2 A;  3R8E A;  3CCQ N;  4ZRJ A;  3QFU A;  4GVE A;  5BN9 A;  1S22 A;  1YUW A;  1GLC G;  2F9T A;  2QWN A;  4IJN A;  1KAY A;  1QZ6 A;  1QHA A;  1Z6R A;  2P9I B;  3QFP A;  4BRI A;  3AU4 A;  4JKB A;  3C6H A;  4BRM A;  3B8A X;  1O13 A;  2QI2 A;  3CJ9 A;  1GLJ O;  1T44 A;  2YJF A;  3G25 A;  1HB8 A;  1BA1 A;  4B9Q A;  4DCH A;  2EMT A;  4AM6 A;  4GV6 A;  2A41 A;  3UKU A;  3WXK A;  4FWS A;  1VBG A;  2COP A;  1YHQ N;  3MN9 A;  5BPL A;  3C65 A;  1NWK A;  5M1K A;  2ABD A;  1K8A O;  3P39 A;  1NGG A;  2H3G X;  4FOI A;  4IEI A;  3VEV A;  1GLA G;  3DXM B;  5EOY A;  3FLV A;  3LDL A;  3VEX A;  2EWS A;  4FL9 A;  1NGE A;  1E4G T;  3O6W A;  4CZI A;  5BRF A;  3SLC A;  1HX1 A;  4BRK A;  3PLA A;  4BVP A;  4H0X B;  4JK8 A;  1XC3 A;  3G6E N;  4PKG A;  3EPY A;  4LC9 B;  2R82 A;  2P9N B;  4KBO A;  3WEE B;  4FWR A;  4HTL A;  3ZX0 A;  3QBW A;  3G4S N;  4H0T B;  2CB8 A;  3BIN A;  3CIP A;  4RWT A;  2ZJP L;  5FPE A;  2IIR A;  2NLX A;  4BRN A;  4EHU A;  3VF4 A;  1BDG A;  2VGM A;  1R59 O;  3D6R A;  5C2D A;  3ULE A;  3KWG A;  4IDH A;  4M63 C;  4BR7 A;  1T3V A;  4H5N A;  3ENB A;  3C7N A;  2HBL A;  4RTF D;  2UYT A;  3N4P A;  1ISN A;  3F9M A;  2QXL A;  3CXC M;  1GLL O;  3G9W A;  1XQS C;  4H5T A;  4JHD B;  2ZF5 O;  3VF2 A;  4BC3 A;  5IJM A;  3BP8 A;  3PIP L;  1Q82 O;  3SJH A;  2FF6 A;  1S3X A;  5KQ8 A;  3CJB A;  2PAV A;  5F2R A;  4C1N K;  5BRD A;  1NGJ A;  3T69 A;  3CJ1 A;  3AGR A;  3KWI A;  3IMX A;  1ZC6 A;  5TKW A;  3VEZ A;  4BC2 A;  1ZXO A;  1H4R A;  1EQY A;  2A6A A;  2ASO A;  2I1J A;  5M1O A;  2QWP A;  3HI0 A;  4IO8 A;  4K25 A;  2QEX N;  3D2F A;  2A5X A;  2D0O A;  2WC9 A;  5AQM A;  3TTD A;  4A57 A;  3TSU A;  2GEL A;  4JKA A;  3ENO A;  3QB0 A;  3EN9 A;  1KAX A;  3AU5 A;  1QQM A;  1EF1 A;  3VGM A;  4BQZ A;  5F1X A;  5HOO A;  3PIO L;  2ZJR L;  4QS7 A;  1X3N A;  4CBU A;  1YJN N;  4JD2 A;  2P9P A;  3ZX3 A;  3R3L A;  4B1Z A;  1NGA A;  2NRH A;  1NVL A;  4IJA A;  4YOT A;  4CZJ A;  4DQ8 A;  3ID6 A;  3L6Q A;  3H3O B;  1DEJ A;  2RE2 A;  2A42 A;  3DWL A;  3E1Y A;  3NVK A;  4KH5 A;  4GY2 B;  5BPM A;  1NMD A;  4WYB A;  1YAG A;  3M5R A;  3W3D A;  2FSK A;  4GV3 A;  2BH1 A;  2VYP A;  2WFB A;  2A3Z A;  1BUP A;  3VGK A;  3UB5 A;  2E1Z A;  3AY9 A;  3VES A;  2AP1 A;  3MCP A;  4FWM A;  2Q0R A;  1K8K A;  4ISF A;  2P9U B;  1VBH A;  3ZET A;  1E5W A;  3H46 O;  3VPZ A;  2IVP A;  5FPM A;  3SMS A;  1Q18 A;  3VGL A;  1HUX A;  5B8H A;  3CJA A;  1IJJ A;  3VTI A;  2QWR A;  2DIK A;  2P9K B;  3ENH A;  3HM8 A;  5AQP A;  5HL7 L;  1VQ7 N;  1NJI O;  4IOA L;  4YOY A;  2QWO A;  3M3Z A;  3BF1 A;  3AAP A;  5KPZ A;  1W2B M;  2RQ1 A;  3QBX A;  3VF6 A;  3FR0 A;  4ZRI A;  4EHT A;  1VAZ A;  3CHW A;  3IFR A;  3CCE N;  2FDQ A;  1NGF A;  4A61 A;  1Y19 B;  4JKF A;  2E2Q A;  3SAG A;  2P9I A;  4JKG B;  2D1K A;  2GUP A;  3P4I A;  4PKI A;  4R79 A;  4K41 A;  4WFA L;  3TTC A;  1VQ4 N;  1QQN A;  1QZ5 A;  2NRV A;  3CQY A;  5GAD P;  2ZJQ L;  3HOT A;  4U7B A;  3OBY A;  1BWF O;  1TYQ B;  5ADX A;  1ATN A;  2ITM A;  3LM9 A;  2GTD A;  3MN6 A;  1MK7 B;  4K43 A;  3CC4 N;  4AF1 A;  3GE1 A;  5FPN A;  5JMV A;  3E9L A;  3TPQ A;  2V52 B;  2CH6 A;  2I7N A;  3VMF B;  3OA9 A;  1RDW X;  3K9K A;  4B1W B;  2ZGY A;  4DB3 A;  1HKC A;  3DXM A;  4YDU C;  4CI6 A;  1BU6 O;  3KVG A;  3TU5 A;  2HOE A;  2KKZ A;  3ZEU B;  1K73 O;  1D4X A;  4BRO A;  3TTF A;  3GOI A;  1JCF A;  4B1Y B;  4E1J A;  5LJV A;  4I6M B;  4FPA A;  3G71 N;  3DLL L;  3I33 A;  3R1X A;  3WXM B;  4H0P A;  3GG4 A;  2P9N A;  4BR0 A;  3WEE A;  3FFK B;  1CZA N;  2E1Y A;  3IDH A;  4L3Q A;  3MWT A;  4CD3 A;  4CZG A;  4DKW A;  5BR9 A;  1VQ5 N;  3EKU A;  4G9Z A;  4HDO A;  2Q0U A;  4NLB A;  5JVG L;  4FWK A;  1YF5 L;  1MDU B;  5AQJ A;  2ZWH A;  1HB6 A;  2HF4 A;  2YCH A;  4BRC A;  1HKB A;  3CC7 N;  1YJW N;  2PFU A;  4GV9 A;  3H1V X;  3EE8 A;  4K42 A;  4BRF A;  1NM1 A;  4JHD A;  4IEE A;  3CCU N;  1KD1 O;  3MN7 A;  2W40 A;  2E2N A;  3F5T A;  2ASP A;  3C6A A;  3ZYY X;  2P9L B;  3UKR B;  5AZJ B;  5KPR A;  1X9J A;  5M1F A;  3KK7 A;  3E9P A;  3SBG A;  3MCA B;  3O9R A;  3U8X A;  3M6G A;  1DIK A;  1P90 A;  2V51 B;  4CZM A;  3A5L C;  3A5M C;  3HTV A;  4FWN A;  4C23 A;  5C0Y A;  2JWK A;  2DPN A;  4JK7 A;  1LCU A;  3ATU A;  5AQG A;  3SAF A;  1GLE G;  3H6E A;  4XH4 A;  4Z94 A;  3HSC A;  1SAZ A;  4IOX A;  2HE7 A;  2P9S B;  3CI5 A;  3WT0 A;  5DM7 L;  3HZ6 A;  1GGO A;  4MDA A;  1JJ2 M;  4YOV A;  4J8F A;  1U2V B;  1BA0 A;  3O80 A;  3EL2 A;  3WXL A;  4AM7 A;  1M90 O;  2GWK A;  2E8A A;  4BRA A;  2Q97 A;  2GX9 A;  4NO7 A;  3O9S A;  5AQK A;  5AQS A;  5I9E B;  4MDB A;  1DT9 A;  2CH5 A;  4BQL A;  3EO3 A;  1MIX A;  2HBM A;  3DXK B;  1X3M A;  3JS6 A;  5M1P A;  4F9O A;  4WFB L;  2V7Y A;  3QIC A;  3MMV A;  3FGU A;  3WXI A;  4P7I A;  4PKH A;  2P9U A;  1OVY A;  4XEI A;  5BN8 A;  2CGK A;  4UY8 O;  5AQR A;  3FE1 A;  1GLF O;  4WCE L;  2YHY A;  2YJE A;  3FZH A;  3AGK A;  3OW2 M;  4ILJ A;  5CR4 A;  4JAX A;  2CQU A;  2VCP A;  3A0I X;  4O8K A;  2HMP A;  1Y64 A;  1KQS M;  1GC7 A;  4FOE A;  1MK9 B;  1LOT B;  2P9K A;  2PBD A;  4YOX A;  1WOQ A;  1J6Z A;  4IZ9 A;  4QS8 A;  4YDU A;  5C2F A;  1YXQ A;  3WQU A;  2QWM A;  3EKS A;  1V4S A;  3ZDT A;  1JCG A;  1HJO A;  4MLE A;  3O9Q A;  5BPN A;  3MK6 A;  1VQN N;  3D2E B;  1GG3 A;  3HOS A;  1E4F T;  2D10 A;  5EX5 A;  4CBX A;  4A5A A;  5GAG P;  2NZT A;  2FXU A;  4JKG A;  1TUU A;  4TKN A;  2ZPY A;  3BUZ B;  1XUP O;  4BRG A;  5JLH A;  1S72 N;  5JVL A;  1SQK A;  1Z05 A;  5MLC Q;  2J0K A;  2E88 A;  2X0S A;  1U6Z A;  3RVC A;  1TYQ A;  3PZD A;  5KQD A;  5AZI B;  2FJ9 A;  4BRH A;  4MO5 A;  2YI1 A;  3LDO A;  5H1S Q;  4ISG A;  3CCS N;  3CC2 N;  3X23 A;  1ATS A;  4BVO A;  3CD6 N;  3O5B A;  4JNE A;  4HDQ A;  1NTI A;  1T6C A;  3O4W A;  4YL8 A;  4FPB A;  4OPH A;  3FZK A;  4PHT X;  3KZB A;  4IWV A;  3BF3 A;  4FVU A;  3CCJ N;  1ACA A;  3UE5 A;  3D7E O;  4H0O A;  3ZEU A;  5AQH A;  2CGL A;  5AR0 A;  3VEN A;  2NRX A;  3MX2 A;  4CD1 A;  2Q36 A;  4JKE A;  1C0F A;  3MX5 A;  3RSE B;  4NLC A;  4I6M A;  4WQ5 C;  3L0Q A;  1DKG D;  5JIC A;  5AQN A;  5E84 A;  2LBB A;  4C1N I;  3ZX2 A;  4WFN L;  3BEX A;  2F7T A;  3FLC O;  1G99 A;  4H0V B;  4JEP A;  1NLV A;  3M1F A;  3R6M A;  5AQI A;  3LL3 A;  2BTF A;  1VQK N;  1MWM A;  5E26 A;  5AFU H;  5C10 A;  3J7Z O;  1NBW A;  5BRE A;  2Q2R A;  1NGH A;  1VQ8 N;  1ST7 A;  3U9D A;  4NY0 A;  3IVF A;  4ILH A;  5AQZ A;  3VEO A;  3L4Q A;  5GIO A;  5DM6 L;  3CME N;  5AQT A;  1MIZ B;  4BRQ A;  1OKJ A;  3CF5 L;  4BG9 A;  3CER A;  1HPM A;  1N8R O;  2P9L A;  1V4T A;  4JN4 A;  3VET A;  3GDQ A;  3UKR A;  5EY4 A;  4BR4 A;  4BR9 A;  5GAE P;  2Q1N A;  5AZJ A;  5AQU A;  2YVC A;  1VQ6 N;  3J8A A;  4MLH A;  3VER A;  5JLF A;  2HBJ A;  2D4W A;  3EE9 A;  4FWQ A;  3P38 A;  4FSV A;  3MN5 A;  5AQX A;  3A8Y A;  5AQW A;  1RGI A;  5CHI A;  4IO9 L;  4IFE A;  3MDQ A;  5JVH L;  2AA4 A;  1J19 A;  1YIJ N;  5F0X A;  1KBL A;  2WUS A;  4B1X B;  3CMA N;  3FP5 A;  2P9S A;  4PL8 A;  1VQL N;  4ILG B;  2I7P A;  3NMU A;  3SMP A;  2W41 A;  4XH5 A;  1YIT N;  1U2V A;  3VTH A;  4CJ7 A;  5C12 A;  5M1N A;  3CCL N;  3EZW A;  2OAN A;  4BRP A;  2GWJ A;  4YOU A;  3U8Z A;  1VQM N;  4GNI A;  5AQO A;  4JKD A;  2ZGZ A;  5AFU A;  2NRZ A;  3H45 C;  4JKC A;  4WQ4 C;  1P8Z A;  3Q7C A;  3IKM A;  4FWP A;  2D11 A;  1HKG A;  4Y0W A;  5GIP A;  1KC8 O;  3DXK A;  2D2Q A;  2WH5 A;  2QTD A;  4BRL A;  3SK3 A;  2E20 A;  3CJC A;  3OBW A;  1HLU A;  1ZBS A;  1RFQ A;  3GBT A;  4EKU A;  2HST A;  4BR5 A;  2FSN A;  3U7D A;  4H5R A;  4BC5 A;  1SZ2 A;  2BUP A;  3UKU B;  1WUA A;  2OTJ N;  4M7Y A;  1VQ9 N;  5EVZ A;  4OO1 J;  5AQL A;  4QS9 A;  4B1V A;  1QVG M;  3O1W A;  1GC6 A;  1C0G A;  1RDU A;  3KHY A;  1YI2 N;  2JWL A;  3CPW M;  2YHW A;  5LY3 A;  3ATV A;  3L4I A;  3CPE A;  1SGH A;  1GLD G;  4O8U A;  3LDQ A;  4CZL A;  3QDK A;  1T6D A;  3CET A;  4A59 A;  2AL6 A;  5BRH A;  5C15 A;  3CCM N;  1Q86 O;  3C0B A;  2FF3 B;  4BG8 A;  4A62 A;  2A40 A;  1HBK A;  4ZRK A;  3SBT A;  2AEH A;  5AQF A;  4EIA A;  1VQO N;  2QWL A;  3D2E A;  5GIN A;  1BOT O;  4WQ5 A;  1NGD A;  3OHR A;  3F2K A;  5AQQ A;  4H0Y B;  2QA4 N;  1MA9 B;  5M1Q A;  3TSP A;  2I1K A;  2WBN A;  3HBT A;  3Q7B A;  2J0M A;  4EFH A;  4DXA B;  2VGN A;  3R9P A;  3TSQ A;  3SAH A;  4A5B A;  4HWI A;  2FSJ A;  4BGB A;  3NVM A;  1M1K O;  3ULE B;  3O9U A;  3N4Q A;  5AZI A;  4BR2 A;  2FLO A;  5KPT A;  3C7N B;  1IG8 A;  1KXP A;  4FO0 A;  4B1U B;  3AAQ A;  4FWL A;  3U4L A;  1K9M O;  3AAR A;  4KH6 A;  4KH4 A;  2QM1 A;  1KAZ A;  2HF3 A;  2YHX A;  3O08 A;  5AQV A;  1ESV A;  3A5O C;  1W97 L;  3CQX A;  2QWQ A;  3ID8 A;  3LDN A;  4CZH A;  1EO1 A;  4U67 L;  3FZF A;  4CYE A;  3CCR N;  2NRR A;  4O5F A;  2E2O A;  2KHO A;  3DAW A;  2HRJ A;  3H3N O;  4F7G A;  4H5V A;  5CE3 A;  1MWK A;  2GEM A;  3RSE A;  1QVF M;  1ATR A;  3FZM A;  3HRG A;  3WA0 A;  5EXW A;  3I56 N;  1Q81 O;  2NRT A;  3FZL A;  4H03 B;  5ADX H;  3QML A;  4XH1 A;  2F9W A;  3MWP A;  3D2F B;  4A2B A;  3GL1 A;  4IOC L;  1Q7Y O;  4BY9 C;  3I8B A;  3O1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...