3E9LA

Crystal structure of human prp8, residues 1755-2016
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
EPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title Structure and function of an RNase H domain at the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, splicing
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12134 PRP8_domainIV PRP8 domain IV core
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3e9lA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3e9lA01
4ILHA 4JK7A 4JK9A 4JKGA 4JK8A 3E66A 4ILJA 4JKDA 3SBTA 4JKGB 4JKHA 3E9OA 4JKCA 4ILGB 4JKAA 3ENBA 4JKEA 3SBGA 4JKFA 3E9PA 3E9LA 4JKBA
chains in the Genus database with same CATH superfamily
1GLBG 3MX5A 3PX6A 3DM2A 3KLGA 5GAHP 3BUZB 2CGKA 3MX2A 4K42A 3TU5A 3Q7BA 5JLHA 3HP6A 5JVGL 4B9UA 3J7AP 4MDAA 3QO9A 2E1ZA 4IXCA 3BP8A 4CIEA 1JKHA 5KPZA 4R5PA 4HCCA 2FBXA 4TKNA 3HP9A 2OPSA 4CGJA 3ZX2A 3L2RA 3J7YP 3SUQA 4DCHA 4BR4A 4FWKA 3HYFA 1A5XA 4B9LA 1X1PA 1N34K 3T19A 3P4IA 3C6TA 4F3TA 2YI1A 3CCMN 1XHZA 2HHHK 2O8CB 1HYSA 5AQFA 3OYFA 3NAEA 5KI6A 4LFAK 4QCLA 2HHTA 1SS6A 3QFUA 4XEIA 5C25A 2OTLN 3HK2A 4CJRA 4OKEA 1Y97A 4EZ9A 3MWPA 1X3NA 4JI6K 4CEQA 4BC5A 1XMOK 4DV6K 4Z4IA 1K8KB 3VA0A 3I33A 2P9UB 5AJ3K 4CZKA 1C0GA 2UXCK 2ZJRL 1IKXA 2HNYA 2QWLA 4WFBL 1TKZA 1WSFA 1VRTA 3MAQA 5EVZA 1Z25A 2AJQA 3RSEA 5CZ2A 3SMSA 2YKNA 4Z4GA 5KPRA 1MWMA 1MDUB 4CGIA 3AAPA 1NJZA 2O8DA 1Y64A 1VQKN 3M1FA 3CC4N 3DXMB 4DQSA 4BVOA 4DQQA 4PQUA 1NGGA 4MDBA 5KRSA 3AGKA 2IC3A 2DIKA 1GLLO 2XY7A 3F73A 4DTSA 4KO0A 4I6MB 3ZSRA 1SL1A 4JD2A 2QXFA 3ZSQA 3I8DA 3FLCO 2YJFA 3LP2A 5FPDA 2UU9K 5TKWA 4B3RK 1O13A 1RDWX 3WQUA 2LSNA 1QZ5A 4HDQA 2BH1A 3EZWA 3VF4A 5MLCQ 2XY8A 4DTOA 5M1PA 4RW7A 1WAFA 1CZAN 4NXMK 5SWMA 3WXIA 2D0OA 2Y1IA 4DQRA 3LAKA 2VWJA 3GDQA 3VEXA 1L5UA 5HBMA 1K73O 3AU5A 3OYNA 2WONA 2GWJA 3EE9A 4GMJB 3O1WA 4BG8A 5C15A 3T1AA 1KSPA 1S1UA 3KZBA 1QQOA 2DTUA 2D0AA 3WXLA 4FJNA 1KLNA 3HM8A 4GVMA 4IKFA 1DIKA 4C8MA 4NYFA 5AQOA 4ISFA 1HMVA 2J0KA 4IOCL 1SAZA 4LY7A 3AVGA 3VGLA 5CZ1A 1RBTA 4RW4A 5F1XA 2Z1JA 1R0AA 1XC3A 2RN2A 4CZFA 3A5OC 3VTHA 3J81O 2KFNA 1BDGA 4BRKA 4NB4A 1TV6A 1IBKK 4BQZA 1NK6A 1VQ6N 3LP1A 3CCJN 1VQ7N 2XRIA 3CJCA 1S1WA 3L3VA 1YVNA 2DFFA 1CLQA 3T1YK 2BUPA 5FRMA 1MK7B 4IDHA 1Q9XA 4IZ9A 4YOXA 4KH5A 1MK9B 3JS6A 3EE8A 3CCVN 3E9LA 3F9MA 2P9LA 4DLEA 1RT3A 5D3GA 2Q36A 4B3TK 4O0IA 1EKEA 3CETA 5HRNA 1RT5A 1HJRA 1RDDA 4B3MK 5I9EB 4YDUC 2OZMA 3MN6A 2RKIA 1YTUA 5AQQA 3A8YA 4BRMA 3D2FA 1E4FT 4GV9A 4BRNA 2KZZA 3LP0A 3VQEA 4DG1A 1M1KO 3E01A 2QK9A 3U3YA 4XIUA 3THXB 1NGIA 4NLBA 3LDOA 1BWFO 1VBGA 4CZGA 1XQSC 3ZCMA 4JHDB 4RW9A 1UA1A 3DRPA 1LW0A 1HYZA 1HKGA 1VSKA 1YI2N 3C6AA 1VQON 3VQ5A 3C0BA 1KBLA 3C7NB 5AQVA 3NMUA 3AO2A 4M45A 4RG8A 3CCQN 5AZIA 5FRNA 3MWTA 3U8XA 3QLHA 4CJTA 2WOMA 1KFSA 3HOSA 2W42A 4EAHD 1BCOA 2YX6A 2HHVA 4CZEA 4F7GA 2CGLA 3O4NA 3I56N 3BDPA 3EYZA 4BY9C 1MA9B 5BRDA 5FROA 4FJMA 2X74A 4CJQA 4CJ3A 2VG6A 2NRRA 3KK1A 1QZ6A 1TK0A 3C6UA 2P9KB 3HVTA 3CXCM 4FLTA 3QNOA 1JCGA 3NH1A 3DLRA 1VQ8N 4AF1A 1GG3A 4JRPA 3M8QA 3CM5A 3SUOA 4FM2A 1LWFA 1U4BA 3AVMA 3T3FA 3G10A 3QNNA 4BVPA 1VQ5N 1C0MA 3AVCA 4N56A 3ZSZA 4ZRKA 3HM9A 4E7JA 1HKCA 1S1XA 1W97L 3WNEA 3KLIA 3RRHA 5GAGP 4HVJA 3V6DA 3MK6A 1FXXA 1HKBA 1V4TA 2PYLA 1HLUA 3ZSXA 2Q0UA 3V4IA 3IMXA 4OGCA 3VQBA 2EMTA 5JVLA 4CF1A 4HTUA 4DQ8A 4BGAA 4FLWA 2NRHA 2ZD1A 4J2BA 4FWMA 3PSIA 5F2RA 4WQ5C 4B8CA 4HUEA 2NRTA 3ZX0A 2RF2A 3QERA 3OYBA 4CERA 3A0IX 4KI4A 2OPQA 4DTXA 2WFBA 5M1OA 4R79A 4JI8K 2NLXA 1X3MA 3EEQA 3AU4A 4YOUA 4CHOA 3QIJA 1U2VA 2HW3A 1RBSA 3OTOK 4DFPA 1Q8IA 1VSJA 1VRUA 4E1NA 4EP5A 3P5JA 2HHUA 3HRGA 5AQRA 3JAMO 3CCSN 4AILC 2QWRA 1WBBA 4UY8O 1ASUA 1SL2A 3WXMB 5AQHA 3ZDTA 1Q18A 3C6HA 2ITGA 1GC7A 4WQ4A 4JI0K 1S6PA 1TL3A 1UAXA 3SZ2A 2E6MA 1NK7A 3LL3A 4OPKA 1BCMA 2FJ9A 3KKSA 4JKDA 3TAFA 3M8RA 4BR7A 3A5LC 4I9LA 5KQ8A 1XNQK 4WCEL 4CZMA 4DR1K 1HBKA 4BACA 3V9UA 1JLCA 2D0PA 2ABDA 1ITGA 5AQLA 5M1KA 3ZX3A 3DLEA 3TSQA 1NGDA 3QBWA 5CYQA 4C1NI 1IBLK 3U9DA 4JI5K 2ATQA 3HT3A 3THWB 1K9MO 2ZM6K 2O8CA 3ISNC 3TTCA 2QWMA 2ZJPL 3SPZA 1NK9A 1WNSA 4CI6A 3OYJA 1XC9A 1YF5L 5LL6Z 4DFKA 3SUNA 2FF3B 4XH5A 2F96A 2P1JA 3HVRA 1NOZA 4GV6A 3TSUA 4DSJA 3VQQA 4OPJA 1BIZA 2FC0A 2P9UA 4QS9A 5E41A 2Q0RA 1BISA 5FPNA 5JVHL 4U7BA 3KLEA 4FJJA 1U04A 4B1VA 5KTQA 4Y0WA 3QBXA 4HTLA 1B9DA 3ZEUB 3PSFA 4O4GA 5DM6L 1OH7A 1FKPA 2P51A 3HJFA 4FJ7A 3DXMA 3RVCA 4CGFA 4HUGA 4XH1A 1RBUA 1NK5A 1QTMA 4Z4HA 5M1NA 3L0QA 2XHBA 3JXUA 4I6MA 4H0XB 4C8OA 2FXUA 3UKRB 3IRXA 4FPBA 3ZT1A 4JKAA 3TAEA 3L2QA 1BL3A 5BPMA 4DV2K 3LDQA 4ISEA 2FSJA 2P9SA 3QICA 1JXBA 4IDKA 4BRQA 3VOVA 3KK3A 4KB1A 2A3ZA 1DTQA 3OYKA 4M7YA 1HB8A 1EETA 3AA4A 4QAGA 3SMPA 3DJCA 1JLEA 4FWNA 4YOVA 3CMAN 1VQ9N 1LV5A 1VK0A 2VG7A 3GE1A 1YT3A 4ILHA 3S3MA 3O8MA 4CD3A 3AO5A 3CC7N 4BRHA 5DM7L 1C1BA 3HPHA 3B6PA 1NLVA 4A2BA 3NGIA 1QVFM 3IUCA 3HXMA 5FPMA 3VQDA 2E2PA 1OH8A 4Z0UA 3O9QA 1HPMA 3ENOA 4FWRA 5JS2A 4LF6K 1HX1A 4DUYK 4AHSA 4KI6A 4YDUA 1T6CA 3VQ7A 4KBOA 3QEVA 2CQUA 5HOOA 1D4XA 2IVNA 3QESA 1D9FA 1LCUA 3VQ8A 3KTQA 1N32K 5GIOA 4DV5K 3D7EO 4AM7A 2G8WA 1KTQA 4H4OA 3SQ4A 5BRHA 5JLFA 1ZBIA 2VGNA 3P31A 2PZSA 3P38A 1VSLA 4DV1K 1GLJO 4DTRA 1JCEA 4IJAA 4IEEA 1JCFA 1OH6A 5LJVA 1KCFA 3KWIA 5ADXA 3PO4A 2X6SA 3RR7A 4ILJA 5C24A 4ICLA 4CW7B 2YNGA 1LW2A 3VEZA 3DLGA 3O6WA 4LC9B 4H0OA 1UOCA 1U2VB 2YHYA 1Z26A 3LPUA 3KIOA 3O9TA 3THXA 3FR0A 1DTTA 4B9TA 3ITHA 3TTFA 3HTVA 5FLXO 4JHDA 4X64K 3AVAA 3DI6A 3RWUA 4CVNE 5AQKA 3E66A 3WNHA 3PLAA 2I1KA 2E2OA 5AQMA 4FPAA 1YJWN 4C23A 3QETA 3KK2A 1TUUA 2E1YA 1HPZA 4FWLA 5GADP 4B9MA 3HI0A 4LF9K 3VEYA 1LWCA 1EWRA 2DFHA 3CCRN 3R3LA 3SCXA 2CGJA 3OA9A 4I2PA 4DR3K 1JJ2M 4CCHA 1C6VA 3FFKB 3BGRA 3VQ9A 2Z1GA 1WSIA 3MEGA 3L2UA 1JLGA 3NF6A 2JWKA 1NKCA 3CCEN 3BZCA 3FP5A 3L4QA 2P9KA 4N76A 5KGWA 5LMUK 3LPTA 2F7TA 5AQIA 4JI3K 1ZBLA 1KXPA 4W5QA 3UB5A 3OYHA 3VTIA 1GOBA 3EPYA 4K41A 2UXBK 4LF4K 3BF1A 2W6LA 4J8FA 4CJVA 1S9GA 1T03A 3HSCA 1HUXA 2F4VK 3L2VA 1EP4A 4DS4A 3VN5A 4EFHA 1I39A 1IJJA 3VERA 3PX0A 1BGXT 1Q9YA 3OYCA 3SBGA 4E7KA 1ZBSA 2GTDA 4KFBA 4DSKA 4O5BA 2BTFA 4I7FA 1WOQA 2Z1HA 1H4RA 3CG7A 3KWGA 3HL8A 5HRSA 1ATRA 3ULDA 1TKXA 2G8FA 4DU3A 4C8LA 2YNHA 4XH4A 4DR6K 3NVKA 5J2MA 4F9OA 1CZBA 2COPA 4IOAL 4JYAK 1RTIA 4JN4A 2VQFK 4CGHA 4DKWA 3VQCA 3JYTA 4FJGA 4AHCA 1E3MA 5J2PA 2F8SA 2EHGA 3NHGA 2PFUA 4CEDA 4FJ5A 3FLVA 2UYTA 4RCHA 3VETA 1X9SA 3FZLA 4PKGA 3PUFA 5AZJA 2P9PB 1RTHA 1YVUA 1YJNN 4H0YB 1L3VA 2OCEA 2P9SB 4YOTA 4FLYA 1T05A 3CJ7A 1FW6A 2XO7A 4KHWA 3CD6N 3CCLN 4B1UB 2HHQA 3E9OA 4GKJK 3AY9A 2H3GX 2JLEA 3FZKA 4E0DA 1J5EK 2YNFA 2QEXN 3VMFB 3VQPA 4N41A 4ZHRA 4H0PA 3CI5A 3QEWA 5AFUA 1T7PA 2D2QA 4NY0A 3AVIA 4FK4A 4RWTA 4H8KA 3LDPA 4MFBA 2ZE2A 5AQWA 3ID8A 1T6DA 2GELA 3TABA 3ZSYA 3CJBA 4IEIA 4QS8A 3DMJA 1C0FA 1CXQA 3O3FA 2HBLA 4B9QA 5C2FA 3WUHA 1WAJA 3THWA 2YHXA 4DV0K 2Z1IA 2BGGA 4CIFA 2HOEA 1O1WA 2WBNA 4M41A 4AHUA 2X0SA 1S22A 2FSKA 2V7ZA 4B9NA 3D0PA 2ZGYA 4DSEA 2HHSA 2OPPA 4WF9L 2VG5A 1VHXA 3VGMA 3THVA 2DY4A 3G71N 1BOTO 3O3HA 4JK8A 3O9RA 1K8AO 4YHHK 2HE7A 2RE2A 4FWPA 3Q7CA 5A2QO 3ULEB 4EZ6A 3DLHA 3VESA 4AHVA 3FZFA 3ZEUA 2E4LA 4RW8A 4CEBA 2HMIA 1OKJA 3U6FA 3SLCA 5IWAK 1N36K 1NBWA 2CH6A 4KTZA 1NMNA 3CM6A 3QEXA 3FZMA 4KHYA 3IG1A 3IFRA 4CK1A 4DTMA 2G8UA 4YNQA 3TI0A 1IKWA 3CHWA 2Y1JA 4BDPA 1RT7A 3OHRA 4M3TA 2JGUA 3L6QA 1KQSM 4OLAA 1RCHA 4W5NA 3CERA 1RGIA 4E89A 4AHTA 4FL9A 4WFNL 3CFOA 4K25A 3PY8A 3UKRA 1N6QA 4DFJA 4KRFA 2I7PA 4DR4K 4B1XB 3NDKA 3IVFA 1TK8A 4BG9A 2HB5A 4BREA 1TK5A 4OVLA 4KTWA 3LM9A 4E7LA 3J80O 4ISGA 1XNRK 3GL1A 3ZT4A 2NRVA 2NNWA 1LAVA 5HP1A 2KHOA 5EY4A 4ZTFA 3TAPA 1DKGD 4FLXA 1BU6O 1BUPA 3F2KA 2XY6A 3B6OA 4B08A 1XMQK 1KVAA 3H6EA 3M5RA 4U67L 1QS4A 2G8KA 1NI2A 4M7XA 1NGAA 2G8VA 4NXNK 1ASWA 1BQMA 3VEOA 3AO1A 2BANA 1KC8O 3OS1A 3L8BA 3K5OA 1G15A 3QB0A 3ZSOA 2IS3A 4KH6A 3KD5E 2D1KA 4BRPA 1RT6A 1RT4A 3WA0A 4CE9A 4CK3A 4LD0A 3HZ6A 4JI1K 4CEAA 3SAHA 1WSEA 1HB6A 1U48A 5F0XA 2PY5A 1ATSA 5GIPA 4CJPA 4A59A 3E9PA 1MWKA 3WNGA 3DXKA 4BDYA 1ZYQA 1MU2A 3N4QA 3QEPA 3MDQA 4B9VA 3O4WA 1IG8A 1NGJA 2AA4A 3ZT0A 4B3SK 3R6MA 1XUPO 1QSLA 3BEXA 3G4SN 1FKOA 1ZXOA 4DUZK 1NJYA 4JEPA 3ZT3A 2YV0X 4CEEA 3AVBA 4CJWA 4FM0A 2PBDA 2QI2A 3H46O 4CF9A 1A5WA 1ZBFA 2QA4N 4LH5A 2Q3SA 2IOCA 3VQAA 3WEEB 4AHRA 4CHPA 3O3GA 3K57A 1Q7YO 1L3SA 3RMDA 2A6AA 1HNXK 5AFUH 4M3WA 3O08A 2BE2A 3I55N 4JK9A 4MQ3A 4JV5K 1WBDA 1JL1A 1JL2A 4EIAA 5JS1A 3OBWA 3AGRA 5BR9A 1J6ZA 3MEDA 2B4JA 4OGEA 5AZJB 1RNHA 2W41A 1RT1A 3SI6A 2OPRA 4IG0A 3TAGA 3NBPA 4FOEA 4KAZA 4FZYA 2FSNA 4GV3A 1ASVA 3ATVA 3EKUA 4MLHA 2Q31A 3CFPA 1EQYA 3NF7A 1Q82O 3H08A 2E8AA 5K14A 3MECA 4BE1A 1RT2A 5AQTA 1NK0A 3FE1A 2B6AA 3W0LA 1YAGA 3VA3A 1HR0K 4EKUA 4CZJA 1IV0A 1YTAA 2FBVA 4KH4A 3O80A 4JRQA 3U4LA 3LDSA 1Q81O 1JLBA 2HF3A 4IFVA 3MXMA 4FYDA 1J54A 2ITMA 1H1VA 2CB8A 1NNEA 2X78A 3BY5A 4CJUA 1NTIA 5BREA 3DRRA 1NU0A 3VF6A 4PHTX 3F5TA 1J5OA 4CJKA 3AARA 2BDPA 1C1CA 4Y1DA 1X9JA 3SAFA 4M42A 4JS4A 3LANA 1KLMA 3OYEA 4YY3K 3EY1A 4K8XA 4H5TA 4H03B 4L8RB 2QKKA 4GW6A 1HNWK 3TWHA 5E26A 1K6YA 1BG3A 4H5WA 2RQ1A 4FW1A 3V1QA 4BRIA 2RPIA 2UUCK 1FK9A 5HRPA 2V51B 4J2AA 3O5BA 4FLVA 1ATNA 1GLFO 4NLCA 2NRXA 3OVNA 3K59A 3MN9A 1EX4A 3WT0A 4CFCA 1QSSA 3KLFA 1KRPA 4A61A 3M3ZA 4YOYA 3AVJA 4ELTA 4NCBA 3IKMA 1NGEA 4DSLA 3RTVA 1TKDA 1NGHA 2XY5A 4WFAL 3V9WA 2ZQBA 2P9NA 2DFEA 2QM1A 4JKGB 4DB3A 4KPYA 1FJGK 4JS5A 3NGZA 1KAYA 5IJMA 2WC9A 3P39A 4I2QA 1BIUA 1BHLA 4JKEA 3HOTA 3CQ8A 3B8AX 3VENA 1QHAA 2FBTA 4MO4A 1TYQB 3CJ9A 3BZKA 2P9PA 4CZIA 1YHQN 4DQIA 2KZMA 1QVGM 3QIPA 4DTJA 4OPHA 4X65K 1J9AA 2E6LA 1NOYA 1J19A 2HBKA 1G99A 4BWMA 3SJHA 3W3DA 1S6QA 4BR2A 4Q0BA 1XHXA 3AA2A 4DMNA 4KHSA 4H5VA 1JXEA 1WUAA 2HHXA 5HLFA 4KB0A 3TSPA 5KRTA 2X6NA 2KQ2A 2F8TA 4F8RA 3AO4A 2W6KA 1BA1A 4B1WB 1QQCA 4CJ4A 2WTUA 2YCHA 3K9JA 1V4SA 3KD1E 3H1VX 4CFBA 1TAUA 4BRCA 5I42A 5BR8K 4ILGB 4QS7A 4DV3K 2ASOA 3DYAA 1JLAA 5JICA 2O8FB 1U49A 2O8BB 3K0SA 2HVIA 2QWQA 3O9UA 4E3SA 2YKMA 3WNFA 1M90O 2O4GA 5CE3A 3DXKB 1L3TA 4PUOA 4J2DA 2Q97A 4CHYA 4GVEA 1QQMA 3R9PA 3J7ZO 4DWIA 4E7IA 1MIXA 4E1MA 1LOTB 1RDCA 2IVPA 5TKYA 2EWSA 5AQPA 1NJIO 1TAQA 4RW6A 4A62A 4PL8A 3ULEA 1IH7A 1SKWA 3V1RA 3K5LA 3M8SA 2VYPA 3DLBA 1JDEA 2E88A 3GOIA 4CBUA 1NM1A 4CFDA 4CJEA 1SQKA 3ATUA 3M8PA 1NWKA 4DF4A 1JLFA 1VSIA 1GLAG 4G9ZA 5AQUA 3GBTA 2A42A 4JNEA 4FJ8A 3S3NA 3HPGA 1D5AA 3D45A 4IO8A 4CEOA 5HL7L 4CEFA 3QFPA 1SV5A 1TKTA 5AQZA 3MCAB 5KGXA 1U45A 5SZTA 4O8UA 4FWOA 4F4KA 5AR0A 1HRHA 4ID5A 1C0TA 4E19A 4N47A 4DXAB 3L2WA 5I3UA 1NGBA 4M3ZA 3S9HA 3OYMA 2D10A 2P9IA 2E5LK 5AQSA 3ZETB 4F2SA 1SL0A 3AA5X 2O8EA 4CJSA 4IBNA 1QE1A 3QIOA 3TARA 4O8KA 1TUYA 2OYQA 3MXJA 4CGGA 5AQGA 3ENBA 1DEJA 4Y1CA 4BRAA 3CQYA 3KKRA 3J8AA 4B9SA 1SGHA 3MMVA 3UE5A 1RTDA 4B8AB 2QWPA 3WXJA 2YHBA 3IDHA 1HJOA 4IO9L 4FWQA 3G0ZA 1NVLA 4WQ4C 1VQ4N 3U7DA 1KFDA 3TR8A 5T7BA 3SV3A 4O5FA 1GOCA 2A40A 2QWNA 4WQ5A 3PIOL 3T69A 1NKEA 2AP1A 1KD1O 2VGMA 4HDOA 4BGBA 5C2DA 5J2NA 4LF7K 4DSIA 4CGDA 1QSYA 2NUBA 4C8KA 4FLZA 4EP4A 3T7ZA 2HNDA 3CPEA 3AVHA 5DMRA 1BA0A 2QXLA 4BC3A 2P5OA 4YORA 2V52B 4BROA 1T3VA 3C94A 1N33K 1GLDG 4BR9A 4BRGA 1L3UA 3WEEA 1YITN 2P9NB 1VBHA 1WSHA 3I0SA 3V9XA 4FWSA 4CESA 2GX9A 5J2QA 4KHNA 4PWDA 3ZSVA 2Q1NA 1NG9A 2NZTA 1KVBA 3VGKA 1YUWA 1I3AA 3OY9A 3DOLA 3AVLA 1N5YA 1RBVA 1KC7A 2QWOA 4P7IA 2F9WA 4F3OA 3SK3A 3T1HK 2HMPA 3RR8A 2UXDK 1T44A 1OH5A 4MLEA 1CXUA 3KJVA 4DTPA 2KFZA 4OJRA 4JLHA 4M3YA 4NCGA 1IKYA 1S9EA 2OA8A 1MIZB 3KLHA 1RDAA 3LZIA 1LWEA 5EX5A 1BI4B 4DHYA 1HYVA 4B1ZA 3ID6A 3CMEN 3SQ2A 5M1QA 4AM6A 3NH2A 1TGOA 3VEVA 3O9SA 5LJWA 4OO1J 3NVMA 1TL1A 4X66K 3D2EB 2GV9A 3DWLA 4CFAA 5IT9O 3TANA 5ADXH 4PA1A 3LZJA 3SV4A 1P90A 4FVMA 5HRRA 3AVFA 3LM2A 4C1NK 3BF3A 1QQNA 5CY4A 2JWLA 1JLQA 5M1FA 3NE6A 3NH0A 2YNIA 3DAWA 1ST7A 2AEHA 5H1SQ 3P83D 4HWIA 4NCAA 2QW9A 4DTNA 4FZZA 1NMDA 3PIPL 1Y19B 2I1JA 2NRWA 1C0UA 3G25A 2FDQA 4M3UA 3O4QA 1X9WA 2G8IA 3MN5A 4W5RA 3A5MC 4KREA 1VQMN 3KVGA 1WN7A 4H5RA 1GGOA 4CZHA 1ISNA 4DU1A 5FDLA 5HROA 4FK2A 4JKHA 3MEEA 4FM1A 2O4IA 4H0TB 2RHKA 2PYJA 4ZTJA 3SQ0A 1P8ZA 4JKFA 4IWVA 4DV4K 3PZDA 3NF9A 3P1GA 3UIQA 4PKIA 4KKOA 4JKGA 4DQPA 4GY2B 3IS9A 1NK8A 3IAYA 4KHPK 4BRFA 1NKBA 4A5AA 4ELVA 3LDLA 2Q2RA 3QEIA 3SPYA 2ETJA 4PKHA 4YFUA 3K5NA 3ZT2A 4FJHA 1TYQA 4H4MA 4CK2A 3UKUB 2D11A 4K43A 1Z05A 2ZPYA 1WSJA 4A5BA 1X9MA 1F21A 2KTQA 5C0YA 2UUBK 4DS5A 2R7YA 3CFRA 2P9IB 1B9FA 2P5GA 2D0CA 4DR5K 1HNVA 4DTUA 2OANA 4CBXA 1RILA 2O8EB 4M3XA 4L3QA 2ZF5O 1GLEG 4CZLA 4UQGA 4O0JA 1U47A 3SJJA 3EZ5A 3CYMA 4FJ9A 4JK7A 5KPTA 2QTDA 4H5NA 2HVHA 1Q86O 2A1SA 4H0VB 4CJ7A 3CF5L 3HBTA 4BR0A 3MN7A 3K5MA 1NJXA 2GUIA 1RFQA 1BQNA 1IKVA 2FBYA 2O8FA 2IIRA 1QHTA 2O8BA 1KAXA 2IDOA 4CD1A 4CECA 3SAGA 1ILYA 4LF5K 3O1BA 4ID1A 4JKBA 3LDNA 1VQLN 4IOXA 4DF8A 4JI7K 3G9WA 4GKKK 1HNZK 3PX4A 3S41A 2ZWHA 4CIGA 4QOZB 3QDKA 3SBTA 3WQTA 4OLBA 4W5TA 3CQXA 3OS2A 5EXWA 4A57A 1C1AA 4JKCA 4PL7A 1S3XA 2OZSA 1R59O 4CF2A 1CZ9A 5AQYA 3H45C 3V9SA 3TAMA 4FW2A 4AQYK 2ZGZA 1VSFA 4BDZA 3FZHA 4E7HA 1GLCG 3LP3A 1E4GT 3RSEB 3HSTB 1RTJA 4C8NA 4Z4CA 4ELUA 2I7NA 1S72N 3RRGA 2O8DB 3RMCA 1ESVA 1NK4A 2J4RA 2KW4A 1RDUA 4IJNA 3A5NC 1HQEA 5FPEA 4BE2A 3AO3A 3CCUN 3FFIA 2J0JA 2J0MA 4JD2B 3LAMA 1DT9A 2R82A 3OYLA 3OW2M 2VQEK 3AAQA 4V19S 3PV8A 4CF0A 1VAZA 2A41A 3SUPA 1XWLA 1DLOA 4M3RA 4DR7K 3SNNA 4IFEA 3ASMA 4EHTA 5LY3A 5AQXA 3CPWM 5C10A 4KTQA 4LSLA 5BN8A 2HRJA 2ASPA 3ZETA 2WUSA 3K2PA 4DLGA 2HSTA 3R1XA 4CHZA 4Z4FA 1YXQA 3PO5A 1WLJA 4CYEA 2LBBA 1VQNN 3THYA 1W9HA 2GEMA 3K58A 1EO1A 3HPOA 1GC6A 4LF8K 4FXDA 3S3OA 2V7YA 3VPZA 3ZLJA 2YVCA 1IO2A 4N5SA 3H3NO 3HO1A 4WYBA 2A1RA 5GINA 2I5JA 4M63C 5CR4A 2IVOA 3M6GA 3CC2N 3H1QA 4FJLA 4FOIA 3OS0A 5BPNA 3EL2A 5CYMA 3TAQA 3KHYA 1W7AA 4ZRIA 1S1TA 5E84A 3ENHA 1I94K 4PY5A 4BRDA 3LWLA 1BO5O 5B8HA 3DOKA 5AQJA 4DV7K 4RTFD 4B1YB 4DFMA 4BC2A 3I0RA 1OVYA 2B5JA 4CEZA 2GWKA 4IFYA 1RDBA 3DLKA 5C12A 4BR5A 3VEWA 3H3OB 2KLAA 3VQ6A 3CJAA 1REVA 2W40A 3EO3A 1K8KA 2VCPA 2P9LB 4FK0A 4KHUA 2ZJQL 4FCYA 4NYNA 3L4IA 4BRLA 2FF6A 2AL6A 4Q5VA 5LMNK 3K9KA 5EOYA 4LFBK 4NO7A 5AQNA 4B3OA 4HUFA 3E1YA 4CJLA 1VQPN 4WE1A 4LSNA 3CJ1A 4BQLA 2CH5A 1GOAA 3D2FB 3QMLA 4HCBA 3QINA 1NGFA 5DK5A 3OBYA 2D0BA 5GAEP 3EN9A 5EU7A 4JI4K 1EWQA 4CJ5A 3MXIA 3PVLA 3AV9A 4G1QA 3GG4A 4CF8A 3ZYYX 2PAVA 4X62K 5JMVA 2HNZA 2HF4A 1N8RO 1IBMK 3SYZA 4FVUA 1HNIA 1YJ9N 3G6EN 2QKBA 1VSHA 3TPQA 3OYAA 3AVNA 1BI4A 1S5JA 2EX3A 3RMBA 4YOWA 2OTJN 3OYIA 4CHQA 5AZIB 3FGUA 2G8HA 3NGYA 2D5RA 4FJKA 1EXQA 4DR2K 2VWBA 5BRFA 3D2EA 1VSDA 4A2AA 3TTDA 3MCPA 3U9ZA 3NCIA 3U3GA 1UWBA 1A5VA 2IAJA 3WXKA 3CIPA 1HQUA 4K0KK 4DU4A 3LWMA 3OJSA 2NRZA 2VWKA 4GNIA 4JAXA 1ZBHA 4YL8A 4FSVA 1T8EA 2GUPA 3DLLL 2YJEA 5KQDA 4Z94A 4TSXA 4KHQA 3R8EA 2ASMA 3N4PA 4O55A 2EMSA 2GBZA 1UA0A 3ZSWA 3V81A 3C95A 2E20A 5C42A 4CHNA 1YIJN 1D9DA 1WB9A 2HBMA 3OYDA 3EKSA 3AA3A 1NJWA 4OKJA 1XI1A 1D8YA 1OVQA 3NFAA 4AH9A 3VF2A 2E2QA 4OX9K 2E2NA 2F9TA 2KKZA 1RBRA 1S1VA 3OYGA 1SKRA 3AVKA 1E5WA 4LFCK 4O44A 5ELZA 3KK7A 3F9KA 4IG3A 5BN9A 3ALYA 1EF1A 4CBWA 1ACAA 5J1EA 1W0HA 3VQ4A 2DPNA 3OJUA 4MO5A 1NGCA 3C65A 4DSFA 1W2BM 4J2EA 3LALA 2WH5A 3JSMA 3RMAA 3A2FA 4I9QA 1LAWA 3NF8A 4W5OA 1SKSA 4BC4A 1ZC6A 1ZBUA 4F2RA 1VSEA 4FJXA 1SUQA 3UKUA 3V9ZA 2UUAK 3X23A 3DRSA 4GXBA 2A5XA 4EHUA 2HHWA 2HBJA 3I8BA 1KVCA 4FO0A 1VSMA 4OKKA 4HHTA 1WSGA 2YHWA 4FZXC 1Z6RA 4JI2K 1J53A 5CHIA 4BWJA 1KAZA 3C7NA 4FJIA 4BE0A 2IGIA 4ZRJA 1TVRA 4E1JA 4FLUA 1IG9A 3BINA 4Z4EA 3U8ZA 1SZ2A 4LH4A 4CJFA 4K8ZA 2YHAA 2D4WA 3V1OA 3THYB 3D6RA 5BPLA 3L3UA 2FLOA 4KV8A 1DGKN 1B92A 1U6ZA 4OPAA 3SQ1A
chains in the Genus database with same CATH topology
1GLBG 2FDQA 4ISEA 3MX5A 3O08A 5GAHP 3I55N 3BUZB 2CGKA 4JK9A 2FSJA 2P9SA 3MX2A 3MN5A 3Q7BA 3A5MC 4K42A 3TU5A 5JLHA 5JVGL 4MDAA 3QICA 1VQMN 3KVGA 2E1ZA 4H5RA 3BP8A 4IXCA 5KPZA 4EIAA 4BRQA 3VOVA 4TKNA 1GGOA 2A3ZA 1ISNA 3OBWA 4CZHA 3AGRA 5BR9A 1J6ZA 3ZX2A 4JKHA 4DCHA 5AZJB 4BR4A 2W41A 4FWKA 4M7YA 1HB8A 3SMPA 3P4IA 3DJCA 4FWNA 4H0TB 2RHKA 2YI1A 4YOVA 3CCMN 3CMAN 1VQ9N 1P8ZA 4JKFA 5AQFA 4IWVA 1SS6A 3QFUA 4XEIA 3PZDA 3GE1A 2OTLN 4ILHA 4FOEA 2FSNA 3O8MA 4CD3A 4GV3A 3ATVA 3MWPA 1X3NA 4PKIA 4JKGA 3EKUA 3CC7N 4GY2B 4MLHA 4BRHA 4BC5A 5DM7L 2Q31A 4BRFA 4A5AA 1EQYA 1NLVA 1Q82O 2E8AA 3LDLA 4A2BA 1K8KB 2Q2RA 5AQTA 3I33A 2P9UB 3FE1A 3IUCA 1QVFM 3W0LA 4CZKA 1C0GA 4PKHA 2ZJRL 1YAGA 5FPMA 4EKUA 4CZJA 2QWLA 2E2PA 4WFBL 1TYQA 3O80A 4KH4A 3O9QA 3U4LA 1HPMA 5EVZA 3ENOA 4FWRA 1Q81O 2HF3A 3RSEA 3SMSA 2ITMA 3UKUB 2D11A 1H1VA 2CB8A 1HX1A 4K43A 5KPRA 4YDUA 1MWMA 1MDUB 1NTIA 5BREA 3AAPA 1Z05A 2ZPYA 3VF6A 4PHTX 1T6CA 4KBOA 4A5BA 3F5TA 1Y64A 1VQKN 3M1FA 3AARA 2CQUA 3DXMB 3CC4N 5HOOA 1D4XA 2IVNA 4BVOA 5C0YA 1NGGA 1X9JA 4MDBA 1LCUA 3AGKA 3SAFA 2P9IB 2DIKA 1GLLO 5GIOA 3D7EO 4AM7A 2OANA 4CBXA 4H5TA 4I6MB 4H03B 4JD2A 4L3QA 2ZF5O 5BRHA 5JLFA 1GLEG 3FLCO 2VGNA 2YJFA 3P31A 3P38A 4CZLA 5FPDA 1GLJO 5E26A 1BG3A 1JCEA 4IJAA 4IEEA 5TKWA 1O13A 4JK7A 4H5WA 1JCFA 5KPTA 1RDWX 2QTDA 5LJVA 2RQ1A 4H5NA 3KWIA 5ADXA 4BRIA 3WQUA 3EZWA 1QZ5A 4HDQA 2BH1A 3VF4A 1Q86O 5MLCQ 2V51B 4ILJA 4H0VB 5M1PA 3O5BA 4CJ7A 3CF5L 1ATNA 1GLFO 3HBTA 3MN7A 2NRXA 4NLCA 1CZAN 3MN9A 4BR0A 1RFQA 3VEZA 2IIRA 3WT0A 3O6WA 1KAXA 4LC9B 4H0OA 4CD1A 2YHYA 1U2VB 2D0OA 3WXIA 4A61A 3SAGA 1ILYA 3M3ZA 3O9TA 4YOYA 3GDQA 3FR0A 3O1BA 3VEXA 4JKBA 3TTFA 3HTVA 3LDNA 1K73O 3AU5A 3IKMA 4JHDA 1NGEA 2GWJA 1VQLN 3EE9A 4IOXA 3O1WA 4BG8A 5C15A 3G9WA 1NGHA 4WFAL 5AQKA 3S41A 2ZWHA 3E66A 2P9NA 3KZBA 3QDKA 1QQOA 2I1KA 3SBTA 3PLAA 3WXLA 2QM1A 4JKGB 4DB3A 3HM8A 3WQTA 1DIKA 2E2OA 5AQMA 3CQXA 4FPAA 1YJWN 5EXWA 4A57A 1KAYA 5AQOA 4C23A 4JKCA 5IJMA 2WC9A 4ISFA 1TUUA 3P39A 4PL7A 2E1YA 2J0KA 4FWLA 4IOCL 5GADP 4JKEA 1SAZA 1S3XA 3HOTA 1R59O 3HI0A 3VEYA 3VGLA 5AQYA 3H45C 3CCRN 3B8AX 3R3LA 1QHAA 3VENA 2ZGZA 2CGJA 4MO4A 5F1XA 1TYQB 3OA9A 1JJ2M 3FZHA 3CJ9A 1XC3A 2P9PA 4CZIA 1GLCG 4CZFA 1YHQN 1E4GT 3A5OC 3FFKB 3RSEB 1QVGM 3VTHA 2I7NA 1BDGA 4BRKA 1S72N 4NB4A 4OPHA 4BQZA 1VQ6N 5KQDA 1J19A 2HBKA 3CCJN 1G99A 1ESVA 1VQ7N 3CJCA 2J4RA 1RDUA 2JWKA 3SJHA 1YVNA 3W3DA 4IJNA 3A5NC 3CCEN 4BR2A 3FP5A 5FPEA 3L4QA 2BUPA 2P9KA 1MK7B 4H5VA 4IDHA 1WUAA 4IZ9A 4YOXA 4KH5A 1MK9B 3CCUN 2F7TA 2J0JA 5AQIA 3JS6A 2J0MA 3EE8A 3CCVN 3E9LA 4JD2B 3F9MA 3TSPA 2P9LA 1KXPA 1DT9A 2R82A 3UB5A 3VTIA 3EPYA 4K41A 2Q36A 3OW2M 3BF1A 3CETA 3AAQA 4J8FA 3HSCA 1HUXA 1BA1A 4B1WB 1VAZA 2YCHA 3K9JA 2A41A 1V4SA 5I9EB 4YDUC 3MN6A 4EFHA 1IJJA 3H1VX 4IFEA 5AQQA 3VERA 4EHTA 5LY3A 5AQXA 4BRCA 3A8YA 4BRMA 3CPWM 3D2FA 4ILGB 1E4FT 4QS7A 2ASOA 5C10A 4GV9A 4BRNA 5BN8A 5JICA 3SBGA 2HRJA 1ZBSA 2GTDA 2BTFA 2ASPA 3ZETA 1M1KO 2WUSA 1WOQA 2QWQA 3O9UA 1H4RA 3KWGA 1ATRA 2HSTA 1NGIA 3R1XA 4NLBA 3LDOA 1BWFO 1M90O 1VBGA 1YXQA 4CZGA 5CE3A 1XQSC 3DLLL 3DXKB 4CYEA 4JHDB 2LBBA 2Q97A 4GVEA 4XH4A 1QQMA 1VQNN 3R9PA 3NVKA 2GEMA 1HKGA 3J7ZO 1GC6A 1EO1A 1YI2N 4F9OA 3C6AA 2COPA 2V7YA 3VPZA 1VQON 4IOAL 1MIXA 2YVCA 1KBLA 3C0BA 3C7NB 1LOTB 4JN4A 2IVPA 5AQVA 5TKYA 3H3NO 4DKWA 4WYBA 3NMUA 2EWSA 5AQPA 5GINA 1NJIO 4M63C 5CR4A 3CCQN 2IVOA 3M6GA 5AZIA 3CC2N 3H1QA 3MWTA 4FOIA 3U8XA 4A62A 2PFUA 3FLVA 2UYTA 5BPNA 3EL2A 4RCHA 4PL8A 3ULEA 3VETA 3KHYA 3HOSA 4ZRIA 5E84A 3FZLA 3ENHA 4PKGA 2YX6A 4BRDA 4EAHD 5AZJA 2P9PB 1YJNN 4H0YB 1BO5O 4CZEA 5B8HA 4F7GA 2VYPA 2P9SB 4YOTA 5AQJA 1JDEA 3CJ7A 2CGLA 2E88A 3GOIA 4RTFD 4B1YB 3I56N 4CBUA 4BC2A 1MA9B 3CCLN 1NM1A 4B1UB 3E9OA 5BRDA 4BY9C 3CD6N 3AY9A 1OVYA 2H3GX 1SQKA 3FZKA 2NRRA 2QEXN 1QZ6A 3VMFB 2GWKA 2P9KB 3ATUA 3CXCM 5C12A 4BR5A 1JCGA 3VEWA 3H3OB 2KLAA 3CJAA 4H0PA 1NWKA 3CI5A 1VQ8N 4AF1A 1GG3A 4G9ZA 2W40A 1GLAG 1K8KA 2VCPA 3EO3A 5AQUA 3GBTA 2P9LB 2A42A 5AFUA 4JNEA 2D2QA 2ZJQL 4NY0A 4IO8A 3L4IA 4BRLA 5HL7L 2FF6A 2AL6A 3QFPA 4BVPA 4RWTA 1VQ5N 3LDPA 5AQZA 4ZRKA 3K9KA 3MCAB 5EOYA 1HKCA 5AQWA 1W97L 4O8UA 3ID8A 4FWOA 4NO7A 1T6DA 2GELA 5AQNA 5AR0A 3E1YA 3CJBA 4IEIA 1VQPN 5GAGP 4QS8A 3CJ1A 4BQLA 4DXAB 2CH5A 1HKBA 1V4TA 3D2FB 3MK6A 1C0FA 1HLUA 2HBLA 3QMLA 4B9QA 5C2FA 1NGBA 2Q0UA 3WUHA 3IMXA 2D10A 2P9IA 1NGFA 5AQSA 3OBYA 3ZETB 5GAEP 3EN9A 2EMTA 2YHXA 5JVLA 3PVLA 2HOEA 3GG4A 3ZYYX 2PAVA 2WBNA 2X0SA 5JMVA 4DQ8A 1S22A 2HF4A 4BGAA 1N8RO 4O8KA 2FSKA 2NRHA 2V7ZA 1TUYA 2ZGYA 4FWMA 5F2RA 4FVUA 5AQGA 3ENBA 4WQ5C 1YJ9N 3G6EN 2NRTA 3ZX0A 1DEJA 3TPQA 3A0IX 4BRAA 3CQYA 4WF9L 3J8AA 3VGMA 1SGHA 2WFBA 3MMVA 5M1OA 3UE5A 4R79A 4YOWA 2OTJN 3G71N 1BOTO 2QWPA 2NLXA 3WXJA 1X3MA 5AZIB 3AU4A 3FGUA 3IDHA 4JK8A 1HJOA 3O9RA 4YOUA 4FWQA 4IO9L 1K8AO 2HE7A 3QIJA 2RE2A 1NVLA 4FWPA 4WQ4C 1U2VA 1VQ4N 3Q7CA 3U7DA 2VWBA 3ULEB 4O5FA 2A40A 2QWNA 4WQ5A 5BRFA 3PIOL 3VESA 3FZFA 3D2EA 3ZEUA 4A2AA 3T69A 3MCPA 3TTDA 3U9ZA 1OKJA 3SLCA 3WXKA 3CIPA 1NBWA 2CH6A 2AP1A 3HRGA 1KD1O 2VGMA 4HDOA 5AQRA 4BGBA 2QWRA 3FZMA 3CCSN 4UY8O 5C2DA 3WXMB 3IFRA 3T7ZA 2NRZA 3ZDTA 3C6HA 1Q18A 3CPEA 5AQHA 1BA0A 1GC7A 3CHWA 4WQ4A 3OHRA 4GNIA 2QXLA 4JAXA 4YL8A 4BC3A 4FSVA 3LL3A 4YORA 3L6QA 1KQSM 2GUPA 2V52B 2YJEA 1T3VA 2FJ9A 3CERA 4BROA 4Z94A 4JKDA 1RGIA 1GLDG 3R8EA 2ASMA 4FL9A 3N4PA 4WFNL 4K25A 2EMSA 4BR9A 4BRGA 3UKRA 4BR7A 3A5LC 3WEEA 5KQ8A 1YITN 2E20A 4WCEL 2I7PA 4CZMA 2P9NB 4B1XB 1VBHA 1YIJN 3IVFA 4BG9A 1HBKA 4BREA 2HBMA 4FWSA 3EKSA 2GX9A 2D0PA 2ABDA 2Q1NA 5AQLA 3LM9A 5M1KA 3ZX3A 2NZTA 4ISGA 3GL1A 2NRVA 2NNWA 3TSQA 1NGDA 3QBWA 3VGKA 1YUWA 2KHOA 3VF2A 2E2QA 5EY4A 2E2NA 2F9TA 1KC7A 2QWOA 2KKZA 4C1NI 4P7IA 3U9DA 1DKGD 2F9WA 1BU6O 3SK3A 1E5WA 1BUPA 3F2KA 2HMPA 1K9MO 5ELZA 3KK7A 3H6EA 5BN9A 3M5RA 1T44A 1EF1A 3TTCA 4U67L 2QWMA 4MLEA 2ZJPL 1NI2A 4M7XA 1ACAA 1NGAA 4CBWA 3VEOA 4CI6A 1KC8O 1YF5L 2DPNA 2FF3B 4XH5A 3QB0A 4MO5A 1NGCA 3C65A 4KH6A 1W2BM 4GV6A 1MIZB 2D1KA 4BRPA 3TSUA 2WH5A 5EX5A 3WA0A 4DHYA 2P9UA 4QS9A 3HZ6A 2Q0RA 4B1ZA 3ID6A 5FPNA 5JVHL 3CMEN 5M1QA 4BC4A 3SAHA 1ZC6A 4AM6A 4U7BA 3VEVA 1HB6A 4B1VA 3O9SA 5LJWA 4Y0WA 3UKUA 3QBXA 5F0XA 1ATSA 3NVMA 4HTLA 5GIPA 4OO1J 3D2EB 3ZEUB 3X23A 4GXBA 3DWLA 5DM6L 4A59A 3E9PA 2A5XA 4EHUA 1MWKA 5ADXH 3DXKA 2HBJA 3I8BA 3DXMA 4FO0A 3N4QA 1P90A 3RVCA 3MDQA 2YHWA 4XH1A 3O4WA 1Z6RA 1IG8A 3LM2A 5M1NA 3L0QA 4C1NK 1NGJA 3BF3A 2AA4A 1QQNA 5CHIA 3JXUA 1KAZA 3R6MA 1XUPO 3C7NA 2JWLA 3BEXA 4ZRJA 4E1JA 3G4SN 5M1FA 3BINA 1ZXOA 4I6MA 4JEPA 3U8ZA 1SZ2A 4H0XB 2PBDA 2QI2A 3H46O 3DAWA 1ST7A 2FXUA 2AEHA 5H1SQ 2QA4N 2D4WA 3UKRB 4HWIA 4FPBA 3WEEB 4JKAA 2QW9A 3D6RA 5BPLA 1NMDA 3PIPL 1Q7YO 2FLOA 5BPMA 1Y19B 2I1JA 1DGKN 2A6AA 2NRWA 3LDQA 1U6ZA 5AFUH 4OPAA 3G25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILH A;  4JK7 A;  4JK9 A;  4JKG A;  4JK8 A;  3E66 A;  4ILJ A;  4JKD A;  3SBT A;  4JKG B;  4JKH A;  3E9O A;  4JKC A;  4ILG B;  4JKA A;  3ENB A;  4JKE A;  3SBG A;  4JKF A;  3E9P A;  3E9L A;  4JKB A; 
#chains in the Genus database with same CATH topology
 1GLB G;  3MX5 A;  3PX6 A;  3DM2 A;  3KLG A;  5GAH P;  3BUZ B;  2CGK A;  3MX2 A;  4K42 A;  3TU5 A;  3Q7B A;  5JLH A;  3HP6 A;  5JVG L;  4B9U A;  3J7A P;  4MDA A;  3QO9 A;  2E1Z A;  4IXC A;  3BP8 A;  4CIE A;  1JKH A;  5KPZ A;  4R5P A;  4HCC A;  2FBX A;  4TKN A;  3HP9 A;  2OPS A;  4CGJ A;  3ZX2 A;  3L2R A;  3J7Y P;  3SUQ A;  4DCH A;  4BR4 A;  4FWK A;  3HYF A;  1A5X A;  4B9L A;  1X1P A;  1N34 K;  3T19 A;  3P4I A;  3C6T A;  4F3T A;  2YI1 A;  3CCM N;  1XHZ A;  2HHH K;  2O8C B;  1HYS A;  5AQF A;  3OYF A;  3NAE A;  5KI6 A;  4LFA K;  4QCL A;  2HHT A;  1SS6 A;  3QFU A;  4XEI A;  5C25 A;  2OTL N;  3HK2 A;  4CJR A;  4OKE A;  1Y97 A;  4EZ9 A;  3MWP A;  1X3N A;  4JI6 K;  4CEQ A;  4BC5 A;  1XMO K;  4DV6 K;  4Z4I A;  1K8K B;  3VA0 A;  3I33 A;  2P9U B;  5AJ3 K;  4CZK A;  1C0G A;  2UXC K;  2ZJR L;  1IKX A;  2HNY A;  2QWL A;  4WFB L;  1TKZ A;  1WSF A;  1VRT A;  3MAQ A;  5EVZ A;  1Z25 A;  2AJQ A;  3RSE A;  5CZ2 A;  3SMS A;  2YKN A;  4Z4G A;  5KPR A;  1MWM A;  1MDU B;  4CGI A;  3AAP A;  1NJZ A;  2O8D A;  1Y64 A;  1VQK N;  3M1F A;  3CC4 N;  3DXM B;  4DQS A;  4BVO A;  4DQQ A;  4PQU A;  1NGG A;  4MDB A;  5KRS A;  3AGK A;  2IC3 A;  2DIK A;  1GLL O;  2XY7 A;  3F73 A;  4DTS A;  4KO0 A;  4I6M B;  3ZSR A;  1SL1 A;  4JD2 A;  2QXF A;  3ZSQ A;  3I8D A;  3FLC O;  2YJF A;  3LP2 A;  5FPD A;  2UU9 K;  5TKW A;  4B3R K;  1O13 A;  1RDW X;  3WQU A;  2LSN A;  1QZ5 A;  4HDQ A;  2BH1 A;  3EZW A;  3VF4 A;  5MLC Q;  2XY8 A;  4DTO A;  5M1P A;  4RW7 A;  1WAF A;  1CZA N;  4NXM K;  5SWM A;  3WXI A;  2D0O A;  2Y1I A;  4DQR A;  3LAK A;  2VWJ A;  3GDQ A;  3VEX A;  1L5U A;  5HBM A;  1K73 O;  3AU5 A;  3OYN A;  2WON A;  2GWJ A;  3EE9 A;  4GMJ B;  3O1W A;  4BG8 A;  5C15 A;  3T1A A;  1KSP A;  1S1U A;  3KZB A;  1QQO A;  2DTU A;  2D0A A;  3WXL A;  4FJN A;  1KLN A;  3HM8 A;  4GVM A;  4IKF A;  1DIK A;  4C8M A;  4NYF A;  5AQO A;  4ISF A;  1HMV A;  2J0K A;  4IOC L;  1SAZ A;  4LY7 A;  3AVG A;  3VGL A;  5CZ1 A;  1RBT A;  4RW4 A;  5F1X A;  2Z1J A;  1R0A A;  1XC3 A;  2RN2 A;  4CZF A;  3A5O C;  3VTH A;  3J81 O;  2KFN A;  1BDG A;  4BRK A;  4NB4 A;  1TV6 A;  1IBK K;  4BQZ A;  1NK6 A;  1VQ6 N;  3LP1 A;  3CCJ N;  1VQ7 N;  2XRI A;  3CJC A;  1S1W A;  3L3V A;  1YVN A;  2DFF A;  1CLQ A;  3T1Y K;  2BUP A;  5FRM A;  1MK7 B;  4IDH A;  1Q9X A;  4IZ9 A;  4YOX A;  4KH5 A;  1MK9 B;  3JS6 A;  3EE8 A;  3CCV N;  3E9L A;  3F9M A;  2P9L A;  4DLE A;  1RT3 A;  5D3G A;  2Q36 A;  4B3T K;  4O0I A;  1EKE A;  3CET A;  5HRN A;  1RT5 A;  1HJR A;  1RDD A;  4B3M K;  5I9E B;  4YDU C;  2OZM A;  3MN6 A;  2RKI A;  1YTU A;  5AQQ A;  3A8Y A;  4BRM A;  3D2F A;  1E4F T;  4GV9 A;  4BRN A;  2KZZ A;  3LP0 A;  3VQE A;  4DG1 A;  1M1K O;  3E01 A;  2QK9 A;  3U3Y A;  4XIU A;  3THX B;  1NGI A;  4NLB A;  3LDO A;  1BWF O;  1VBG A;  4CZG A;  1XQS C;  3ZCM A;  4JHD B;  4RW9 A;  1UA1 A;  3DRP A;  1LW0 A;  1HYZ A;  1HKG A;  1VSK A;  1YI2 N;  3C6A A;  1VQO N;  3VQ5 A;  3C0B A;  1KBL A;  3C7N B;  5AQV A;  3NMU A;  3AO2 A;  4M45 A;  4RG8 A;  3CCQ N;  5AZI A;  5FRN A;  3MWT A;  3U8X A;  3QLH A;  4CJT A;  2WOM A;  1KFS A;  3HOS A;  2W42 A;  4EAH D;  1BCO A;  2YX6 A;  2HHV A;  4CZE A;  4F7G A;  2CGL A;  3O4N A;  3I56 N;  3BDP A;  3EYZ A;  4BY9 C;  1MA9 B;  5BRD A;  5FRO A;  4FJM A;  2X74 A;  4CJQ A;  4CJ3 A;  2VG6 A;  2NRR A;  3KK1 A;  1QZ6 A;  1TK0 A;  3C6U A;  2P9K B;  3HVT A;  3CXC M;  4FLT A;  3QNO A;  1JCG A;  3NH1 A;  3DLR A;  1VQ8 N;  4AF1 A;  1GG3 A;  4JRP A;  3M8Q A;  3CM5 A;  3SUO A;  4FM2 A;  1LWF A;  1U4B A;  3AVM A;  3T3F A;  3G10 A;  3QNN A;  4BVP A;  1VQ5 N;  1C0M A;  3AVC A;  4N56 A;  3ZSZ A;  4ZRK A;  3HM9 A;  4E7J A;  1HKC A;  1S1X A;  1W97 L;  3WNE A;  3KLI A;  3RRH A;  5GAG P;  4HVJ A;  3V6D A;  3MK6 A;  1FXX A;  1HKB A;  1V4T A;  2PYL A;  1HLU A;  3ZSX A;  2Q0U A;  3V4I A;  3IMX A;  4OGC A;  3VQB A;  2EMT A;  5JVL A;  4CF1 A;  4HTU A;  4DQ8 A;  4BGA A;  4FLW A;  2NRH A;  2ZD1 A;  4J2B A;  4FWM A;  3PSI A;  5F2R A;  4WQ5 C;  4B8C A;  4HUE A;  2NRT A;  3ZX0 A;  2RF2 A;  3QER A;  3OYB A;  4CER A;  3A0I X;  4KI4 A;  2OPQ A;  4DTX A;  2WFB A;  5M1O A;  4R79 A;  4JI8 K;  2NLX A;  1X3M A;  3EEQ A;  3AU4 A;  4YOU A;  4CHO A;  3QIJ A;  1U2V A;  2HW3 A;  1RBS A;  3OTO K;  4DFP A;  1Q8I A;  1VSJ A;  1VRU A;  4E1N A;  4EP5 A;  3P5J A;  2HHU A;  3HRG A;  5AQR A;  3JAM O;  3CCS N;  4AIL C;  2QWR A;  1WBB A;  4UY8 O;  1ASU A;  1SL2 A;  3WXM B;  5AQH A;  3ZDT A;  1Q18 A;  3C6H A;  2ITG A;  1GC7 A;  4WQ4 A;  4JI0 K;  1S6P A;  1TL3 A;  1UAX A;  3SZ2 A;  2E6M A;  1NK7 A;  3LL3 A;  4OPK A;  1BCM A;  2FJ9 A;  3KKS A;  4JKD A;  3TAF A;  3M8R A;  4BR7 A;  3A5L C;  4I9L A;  5KQ8 A;  1XNQ K;  4WCE L;  4CZM A;  4DR1 K;  1HBK A;  4BAC A;  3V9U A;  1JLC A;  2D0P A;  2ABD A;  1ITG A;  5AQL A;  5M1K A;  3ZX3 A;  3DLE A;  3TSQ A;  1NGD A;  3QBW A;  5CYQ A;  4C1N I;  1IBL K;  3U9D A;  4JI5 K;  2ATQ A;  3HT3 A;  3THW B;  1K9M O;  2ZM6 K;  2O8C A;  3ISN C;  3TTC A;  2QWM A;  2ZJP L;  3SPZ A;  1NK9 A;  1WNS A;  4CI6 A;  3OYJ A;  1XC9 A;  1YF5 L;  5LL6 Z;  4DFK A;  3SUN A;  2FF3 B;  4XH5 A;  2F96 A;  2P1J A;  3HVR A;  1NOZ A;  4GV6 A;  3TSU A;  4DSJ A;  3VQQ A;  4OPJ A;  1BIZ A;  2FC0 A;  2P9U A;  4QS9 A;  5E41 A;  2Q0R A;  1BIS A;  5FPN A;  5JVH L;  4U7B A;  3KLE A;  4FJJ A;  1U04 A;  4B1V A;  5KTQ A;  4Y0W A;  3QBX A;  4HTL A;  1B9D A;  3ZEU B;  3PSF A;  4O4G A;  5DM6 L;  1OH7 A;  1FKP A;  2P51 A;  3HJF A;  4FJ7 A;  3DXM A;  3RVC A;  4CGF A;  4HUG A;  4XH1 A;  1RBU A;  1NK5 A;  1QTM A;  4Z4H A;  5M1N A;  3L0Q A;  2XHB A;  3JXU A;  4I6M A;  4H0X B;  4C8O A;  2FXU A;  3UKR B;  3IRX A;  4FPB A;  3ZT1 A;  4JKA A;  3TAE A;  3L2Q A;  1BL3 A;  5BPM A;  4DV2 K;  3LDQ A;  4ISE A;  2FSJ A;  2P9S A;  3QIC A;  1JXB A;  4IDK A;  4BRQ A;  3VOV A;  3KK3 A;  4KB1 A;  2A3Z A;  1DTQ A;  3OYK A;  4M7Y A;  1HB8 A;  1EET A;  3AA4 A;  4QAG A;  3SMP A;  3DJC A;  1JLE A;  4FWN A;  4YOV A;  3CMA N;  1VQ9 N;  1LV5 A;  1VK0 A;  2VG7 A;  3GE1 A;  1YT3 A;  4ILH A;  3S3M A;  3O8M A;  4CD3 A;  3AO5 A;  3CC7 N;  4BRH A;  5DM7 L;  1C1B A;  3HPH A;  3B6P A;  1NLV A;  4A2B A;  3NGI A;  1QVF M;  3IUC A;  3HXM A;  5FPM A;  3VQD A;  2E2P A;  1OH8 A;  4Z0U A;  3O9Q A;  1HPM A;  3ENO A;  4FWR A;  5JS2 A;  4LF6 K;  1HX1 A;  4DUY K;  4AHS A;  4KI6 A;  4YDU A;  1T6C A;  3VQ7 A;  4KBO A;  3QEV A;  2CQU A;  5HOO A;  1D4X A;  2IVN A;  3QES A;  1D9F A;  1LCU A;  3VQ8 A;  3KTQ A;  1N32 K;  5GIO A;  4DV5 K;  3D7E O;  4AM7 A;  2G8W A;  1KTQ A;  4H4O A;  3SQ4 A;  5BRH A;  5JLF A;  1ZBI A;  2VGN A;  3P31 A;  2PZS A;  3P38 A;  1VSL A;  4DV1 K;  1GLJ O;  4DTR A;  1JCE A;  4IJA A;  4IEE A;  1JCF A;  1OH6 A;  5LJV A;  1KCF A;  3KWI A;  5ADX A;  3PO4 A;  2X6S A;  3RR7 A;  4ILJ A;  5C24 A;  4ICL A;  4CW7 B;  2YNG A;  1LW2 A;  3VEZ A;  3DLG A;  3O6W A;  4LC9 B;  4H0O A;  1UOC A;  1U2V B;  2YHY A;  1Z26 A;  3LPU A;  3KIO A;  3O9T A;  3THX A;  3FR0 A;  1DTT A;  4B9T A;  3ITH A;  3TTF A;  3HTV A;  5FLX O;  4JHD A;  4X64 K;  3AVA A;  3DI6 A;  3RWU A;  4CVN E;  5AQK A;  3E66 A;  3WNH A;  3PLA A;  2I1K A;  2E2O A;  5AQM A;  4FPA A;  1YJW N;  4C23 A;  3QET A;  3KK2 A;  1TUU A;  2E1Y A;  1HPZ A;  4FWL A;  5GAD P;  4B9M A;  3HI0 A;  4LF9 K;  3VEY A;  1LWC A;  1EWR A;  2DFH A;  3CCR N;  3R3L A;  3SCX A;  2CGJ A;  3OA9 A;  4I2P A;  4DR3 K;  1JJ2 M;  4CCH A;  1C6V A;  3FFK B;  3BGR A;  3VQ9 A;  2Z1G A;  1WSI A;  3MEG A;  3L2U A;  1JLG A;  3NF6 A;  2JWK A;  1NKC A;  3CCE N;  3BZC A;  3FP5 A;  3L4Q A;  2P9K A;  4N76 A;  5KGW A;  5LMU K;  3LPT A;  2F7T A;  5AQI A;  4JI3 K;  1ZBL A;  1KXP A;  4W5Q A;  3UB5 A;  3OYH A;  3VTI A;  1GOB A;  3EPY A;  4K41 A;  2UXB K;  4LF4 K;  3BF1 A;  2W6L A;  4J8F A;  4CJV A;  1S9G A;  1T03 A;  3HSC A;  1HUX A;  2F4V K;  3L2V A;  1EP4 A;  4DS4 A;  3VN5 A;  4EFH A;  1I39 A;  1IJJ A;  3VER A;  3PX0 A;  1BGX T;  1Q9Y A;  3OYC A;  3SBG A;  4E7K A;  1ZBS A;  2GTD A;  4KFB A;  4DSK A;  4O5B A;  2BTF A;  4I7F A;  1WOQ A;  2Z1H A;  1H4R A;  3CG7 A;  3KWG A;  3HL8 A;  5HRS A;  1ATR A;  3ULD A;  1TKX A;  2G8F A;  4DU3 A;  4C8L A;  2YNH A;  4XH4 A;  4DR6 K;  3NVK A;  5J2M A;  4F9O A;  1CZB A;  2COP A;  4IOA L;  4JYA K;  1RTI A;  4JN4 A;  2VQF K;  4CGH A;  4DKW A;  3VQC A;  3JYT A;  4FJG A;  4AHC A;  1E3M A;  5J2P A;  2F8S A;  2EHG A;  3NHG A;  2PFU A;  4CED A;  4FJ5 A;  3FLV A;  2UYT A;  4RCH A;  3VET A;  1X9S A;  3FZL A;  4PKG A;  3PUF A;  5AZJ A;  2P9P B;  1RTH A;  1YVU A;  1YJN N;  4H0Y B;  1L3V A;  2OCE A;  2P9S B;  4YOT A;  4FLY A;  1T05 A;  3CJ7 A;  1FW6 A;  2XO7 A;  4KHW A;  3CD6 N;  3CCL N;  4B1U B;  2HHQ A;  3E9O A;  4GKJ K;  3AY9 A;  2H3G X;  2JLE A;  3FZK A;  4E0D A;  1J5E K;  2YNF A;  2QEX N;  3VMF B;  3VQP A;  4N41 A;  4ZHR A;  4H0P A;  3CI5 A;  3QEW A;  5AFU A;  1T7P A;  2D2Q A;  4NY0 A;  3AVI A;  4FK4 A;  4RWT A;  4H8K A;  3LDP A;  4MFB A;  2ZE2 A;  5AQW A;  3ID8 A;  1T6D A;  2GEL A;  3TAB A;  3ZSY A;  3CJB A;  4IEI A;  4QS8 A;  3DMJ A;  1C0F A;  1CXQ A;  3O3F A;  2HBL A;  4B9Q A;  5C2F A;  3WUH A;  1WAJ A;  3THW A;  2YHX A;  4DV0 K;  2Z1I A;  2BGG A;  4CIF A;  2HOE A;  1O1W A;  2WBN A;  4M41 A;  4AHU A;  2X0S A;  1S22 A;  2FSK A;  2V7Z A;  4B9N A;  3D0P A;  2ZGY A;  4DSE A;  2HHS A;  2OPP A;  4WF9 L;  2VG5 A;  1VHX A;  3VGM A;  3THV A;  2DY4 A;  3G71 N;  1BOT O;  3O3H A;  4JK8 A;  3O9R A;  1K8A O;  4YHH K;  2HE7 A;  2RE2 A;  4FWP A;  3Q7C A;  5A2Q O;  3ULE B;  4EZ6 A;  3DLH A;  3VES A;  4AHV A;  3FZF A;  3ZEU A;  2E4L A;  4RW8 A;  4CEB A;  2HMI A;  1OKJ A;  3U6F A;  3SLC A;  5IWA K;  1N36 K;  1NBW A;  2CH6 A;  4KTZ A;  1NMN A;  3CM6 A;  3QEX A;  3FZM A;  4KHY A;  3IG1 A;  3IFR A;  4CK1 A;  4DTM A;  2G8U A;  4YNQ A;  3TI0 A;  1IKW A;  3CHW A;  2Y1J A;  4BDP A;  1RT7 A;  3OHR A;  4M3T A;  2JGU A;  3L6Q A;  1KQS M;  4OLA A;  1RCH A;  4W5N A;  3CER A;  1RGI A;  4E89 A;  4AHT A;  4FL9 A;  4WFN L;  3CFO A;  4K25 A;  3PY8 A;  3UKR A;  1N6Q A;  4DFJ A;  4KRF A;  2I7P A;  4DR4 K;  4B1X B;  3NDK A;  3IVF A;  1TK8 A;  4BG9 A;  2HB5 A;  4BRE A;  1TK5 A;  4OVL A;  4KTW A;  3LM9 A;  4E7L A;  3J80 O;  4ISG A;  1XNR K;  3GL1 A;  3ZT4 A;  2NRV A;  2NNW A;  1LAV A;  5HP1 A;  2KHO A;  5EY4 A;  4ZTF A;  3TAP A;  1DKG D;  4FLX A;  1BU6 O;  1BUP A;  3F2K A;  2XY6 A;  3B6O A;  4B08 A;  1XMQ K;  1KVA A;  3H6E A;  3M5R A;  4U67 L;  1QS4 A;  2G8K A;  1NI2 A;  4M7X A;  1NGA A;  2G8V A;  4NXN K;  1ASW A;  1BQM A;  3VEO A;  3AO1 A;  2BAN A;  1KC8 O;  3OS1 A;  3L8B A;  3K5O A;  1G15 A;  3QB0 A;  3ZSO A;  2IS3 A;  4KH6 A;  3KD5 E;  2D1K A;  4BRP A;  1RT6 A;  1RT4 A;  3WA0 A;  4CE9 A;  4CK3 A;  4LD0 A;  3HZ6 A;  4JI1 K;  4CEA A;  3SAH A;  1WSE A;  1HB6 A;  1U48 A;  5F0X A;  2PY5 A;  1ATS A;  5GIP A;  4CJP A;  4A59 A;  3E9P A;  1MWK A;  3WNG A;  3DXK A;  4BDY A;  1ZYQ A;  1MU2 A;  3N4Q A;  3QEP A;  3MDQ A;  4B9V A;  3O4W A;  1IG8 A;  1NGJ A;  2AA4 A;  3ZT0 A;  4B3S K;  3R6M A;  1XUP O;  1QSL A;  3BEX A;  3G4S N;  1FKO A;  1ZXO A;  4DUZ K;  1NJY A;  4JEP A;  3ZT3 A;  2YV0 X;  4CEE A;  3AVB A;  4CJW A;  4FM0 A;  2PBD A;  2QI2 A;  3H46 O;  4CF9 A;  1A5W A;  1ZBF A;  2QA4 N;  4LH5 A;  2Q3S A;  2IOC A;  3VQA A;  3WEE B;  4AHR A;  4CHP A;  3O3G A;  3K57 A;  1Q7Y O;  1L3S A;  3RMD A;  2A6A A;  1HNX K;  5AFU H;  4M3W A;  3O08 A;  2BE2 A;  3I55 N;  4JK9 A;  4MQ3 A;  4JV5 K;  1WBD A;  1JL1 A;  1JL2 A;  4EIA A;  5JS1 A;  3OBW A;  3AGR A;  5BR9 A;  1J6Z A;  3MED A;  2B4J A;  4OGE A;  5AZJ B;  1RNH A;  2W41 A;  1RT1 A;  3SI6 A;  2OPR A;  4IG0 A;  3TAG A;  3NBP A;  4FOE A;  4KAZ A;  4FZY A;  2FSN A;  4GV3 A;  1ASV A;  3ATV A;  3EKU A;  4MLH A;  2Q31 A;  3CFP A;  1EQY A;  3NF7 A;  1Q82 O;  3H08 A;  2E8A A;  5K14 A;  3MEC A;  4BE1 A;  1RT2 A;  5AQT A;  1NK0 A;  3FE1 A;  2B6A A;  3W0L A;  1YAG A;  3VA3 A;  1HR0 K;  4EKU A;  4CZJ A;  1IV0 A;  1YTA A;  2FBV A;  4KH4 A;  3O80 A;  4JRQ A;  3U4L A;  3LDS A;  1Q81 O;  1JLB A;  2HF3 A;  4IFV A;  3MXM A;  4FYD A;  1J54 A;  2ITM A;  1H1V A;  2CB8 A;  1NNE A;  2X78 A;  3BY5 A;  4CJU A;  1NTI A;  5BRE A;  3DRR A;  1NU0 A;  3VF6 A;  4PHT X;  3F5T A;  1J5O A;  4CJK A;  3AAR A;  2BDP A;  1C1C A;  4Y1D A;  1X9J A;  3SAF A;  4M42 A;  4JS4 A;  3LAN A;  1KLM A;  3OYE A;  4YY3 K;  3EY1 A;  4K8X A;  4H5T A;  4H03 B;  4L8R B;  2QKK A;  4GW6 A;  1HNW K;  3TWH A;  5E26 A;  1K6Y A;  1BG3 A;  4H5W A;  2RQ1 A;  4FW1 A;  3V1Q A;  4BRI A;  2RPI A;  2UUC K;  1FK9 A;  5HRP A;  2V51 B;  4J2A A;  3O5B A;  4FLV A;  1ATN A;  1GLF O;  4NLC A;  2NRX A;  3OVN A;  3K59 A;  3MN9 A;  1EX4 A;  3WT0 A;  4CFC A;  1QSS A;  3KLF A;  1KRP A;  4A61 A;  3M3Z A;  4YOY A;  3AVJ A;  4ELT A;  4NCB A;  3IKM A;  1NGE A;  4DSL A;  3RTV A;  1TKD A;  1NGH A;  2XY5 A;  4WFA L;  3V9W A;  2ZQB A;  2P9N A;  2DFE A;  2QM1 A;  4JKG B;  4DB3 A;  4KPY A;  1FJG K;  4JS5 A;  3NGZ A;  1KAY A;  5IJM A;  2WC9 A;  3P39 A;  4I2Q A;  1BIU A;  1BHL A;  4JKE A;  3HOT A;  3CQ8 A;  3B8A X;  3VEN A;  1QHA A;  2FBT A;  4MO4 A;  1TYQ B;  3CJ9 A;  3BZK A;  2P9P A;  4CZI A;  1YHQ N;  4DQI A;  2KZM A;  1QVG M;  3QIP A;  4DTJ A;  4OPH A;  4X65 K;  1J9A A;  2E6L A;  1NOY A;  1J19 A;  2HBK A;  1G99 A;  4BWM A;  3SJH A;  3W3D A;  1S6Q A;  4BR2 A;  4Q0B A;  1XHX A;  3AA2 A;  4DMN A;  4KHS A;  4H5V A;  1JXE A;  1WUA A;  2HHX A;  5HLF A;  4KB0 A;  3TSP A;  5KRT A;  2X6N A;  2KQ2 A;  2F8T A;  4F8R A;  3AO4 A;  2W6K A;  1BA1 A;  4B1W B;  1QQC A;  4CJ4 A;  2WTU A;  2YCH A;  3K9J A;  1V4S A;  3KD1 E;  3H1V X;  4CFB A;  1TAU A;  4BRC A;  5I42 A;  5BR8 K;  4ILG B;  4QS7 A;  4DV3 K;  2ASO A;  3DYA A;  1JLA A;  5JIC A;  2O8F B;  1U49 A;  2O8B B;  3K0S A;  2HVI A;  2QWQ A;  3O9U A;  4E3S A;  2YKM A;  3WNF A;  1M90 O;  2O4G A;  5CE3 A;  3DXK B;  1L3T A;  4PUO A;  4J2D A;  2Q97 A;  4CHY A;  4GVE A;  1QQM A;  3R9P A;  3J7Z O;  4DWI A;  4E7I A;  1MIX A;  4E1M A;  1LOT B;  1RDC A;  2IVP A;  5TKY A;  2EWS A;  5AQP A;  1NJI O;  1TAQ A;  4RW6 A;  4A62 A;  4PL8 A;  3ULE A;  1IH7 A;  1SKW A;  3V1R A;  3K5L A;  3M8S A;  2VYP A;  3DLB A;  1JDE A;  2E88 A;  3GOI A;  4CBU A;  1NM1 A;  4CFD A;  4CJE A;  1SQK A;  3ATU A;  3M8P A;  1NWK A;  4DF4 A;  1JLF A;  1VSI A;  1GLA G;  4G9Z A;  5AQU A;  3GBT A;  2A42 A;  4JNE A;  4FJ8 A;  3S3N A;  3HPG A;  1D5A A;  3D45 A;  4IO8 A;  4CEO A;  5HL7 L;  4CEF A;  3QFP A;  1SV5 A;  1TKT A;  5AQZ A;  3MCA B;  5KGX A;  1U45 A;  5SZT A;  4O8U A;  4FWO A;  4F4K A;  5AR0 A;  1HRH A;  4ID5 A;  1C0T A;  4E19 A;  4N47 A;  4DXA B;  3L2W A;  5I3U A;  1NGB A;  4M3Z A;  3S9H A;  3OYM A;  2D10 A;  2P9I A;  2E5L K;  5AQS A;  3ZET B;  4F2S A;  1SL0 A;  3AA5 X;  2O8E A;  4CJS A;  4IBN A;  1QE1 A;  3QIO A;  3TAR A;  4O8K A;  1TUY A;  2OYQ A;  3MXJ A;  4CGG A;  5AQG A;  3ENB A;  1DEJ A;  4Y1C A;  4BRA A;  3CQY A;  3KKR A;  3J8A A;  4B9S A;  1SGH A;  3MMV A;  3UE5 A;  1RTD A;  4B8A B;  2QWP A;  3WXJ A;  2YHB A;  3IDH A;  1HJO A;  4IO9 L;  4FWQ A;  3G0Z A;  1NVL A;  4WQ4 C;  1VQ4 N;  3U7D A;  1KFD A;  3TR8 A;  5T7B A;  3SV3 A;  4O5F A;  1GOC A;  2A40 A;  2QWN A;  4WQ5 A;  3PIO L;  3T69 A;  1NKE A;  2AP1 A;  1KD1 O;  2VGM A;  4HDO A;  4BGB A;  5C2D A;  5J2N A;  4LF7 K;  4DSI A;  4CGD A;  1QSY A;  2NUB A;  4C8K A;  4FLZ A;  4EP4 A;  3T7Z A;  2HND A;  3CPE A;  3AVH A;  5DMR A;  1BA0 A;  2QXL A;  4BC3 A;  2P5O A;  4YOR A;  2V52 B;  4BRO A;  1T3V A;  3C94 A;  1N33 K;  1GLD G;  4BR9 A;  4BRG A;  1L3U A;  3WEE A;  1YIT N;  2P9N B;  1VBH A;  1WSH A;  3I0S A;  3V9X A;  4FWS A;  4CES A;  2GX9 A;  5J2Q A;  4KHN A;  4PWD A;  3ZSV A;  2Q1N A;  1NG9 A;  2NZT A;  1KVB A;  3VGK A;  1YUW A;  1I3A A;  3OY9 A;  3DOL A;  3AVL A;  1N5Y A;  1RBV A;  1KC7 A;  2QWO A;  4P7I A;  2F9W A;  4F3O A;  3SK3 A;  3T1H K;  2HMP A;  3RR8 A;  2UXD K;  1T44 A;  1OH5 A;  4MLE A;  1CXU A;  3KJV A;  4DTP A;  2KFZ A;  4OJR A;  4JLH A;  4M3Y A;  4NCG A;  1IKY A;  1S9E A;  2OA8 A;  1MIZ B;  3KLH A;  1RDA A;  3LZI A;  1LWE A;  5EX5 A;  1BI4 B;  4DHY A;  1HYV A;  4B1Z A;  3ID6 A;  3CME N;  3SQ2 A;  5M1Q A;  4AM6 A;  3NH2 A;  1TGO A;  3VEV A;  3O9S A;  5LJW A;  4OO1 J;  3NVM A;  1TL1 A;  4X66 K;  3D2E B;  2GV9 A;  3DWL A;  4CFA A;  5IT9 O;  3TAN A;  5ADX H;  4PA1 A;  3LZJ A;  3SV4 A;  1P90 A;  4FVM A;  5HRR A;  3AVF A;  3LM2 A;  4C1N K;  3BF3 A;  1QQN A;  5CY4 A;  2JWL A;  1JLQ A;  5M1F A;  3NE6 A;  3NH0 A;  2YNI A;  3DAW A;  1ST7 A;  2AEH A;  5H1S Q;  3P83 D;  4HWI A;  4NCA A;  2QW9 A;  4DTN A;  4FZZ A;  1NMD A;  3PIP L;  1Y19 B;  2I1J A;  2NRW A;  1C0U A;  3G25 A;  2FDQ A;  4M3U A;  3O4Q A;  1X9W A;  2G8I A;  3MN5 A;  4W5R A;  3A5M C;  4KRE A;  1VQM N;  3KVG A;  1WN7 A;  4H5R A;  1GGO A;  4CZH A;  1ISN A;  4DU1 A;  5FDL A;  5HRO A;  4FK2 A;  4JKH A;  3MEE A;  4FM1 A;  2O4I A;  4H0T B;  2RHK A;  2PYJ A;  4ZTJ A;  3SQ0 A;  1P8Z A;  4JKF A;  4IWV A;  4DV4 K;  3PZD A;  3NF9 A;  3P1G A;  3UIQ A;  4PKI A;  4KKO A;  4JKG A;  4DQP A;  4GY2 B;  3IS9 A;  1NK8 A;  3IAY A;  4KHP K;  4BRF A;  1NKB A;  4A5A A;  4ELV A;  3LDL A;  2Q2R A;  3QEI A;  3SPY A;  2ETJ A;  4PKH A;  4YFU A;  3K5N A;  3ZT2 A;  4FJH A;  1TYQ A;  4H4M A;  4CK2 A;  3UKU B;  2D11 A;  4K43 A;  1Z05 A;  2ZPY A;  1WSJ A;  4A5B A;  1X9M A;  1F21 A;  2KTQ A;  5C0Y A;  2UUB K;  4DS5 A;  2R7Y A;  3CFR A;  2P9I B;  1B9F A;  2P5G A;  2D0C A;  4DR5 K;  1HNV A;  4DTU A;  2OAN A;  4CBX A;  1RIL A;  2O8E B;  4M3X A;  4L3Q A;  2ZF5 O;  1GLE G;  4CZL A;  4UQG A;  4O0J A;  1U47 A;  3SJJ A;  3EZ5 A;  3CYM A;  4FJ9 A;  4JK7 A;  5KPT A;  2QTD A;  4H5N A;  2HVH A;  1Q86 O;  2A1S A;  4H0V B;  4CJ7 A;  3CF5 L;  3HBT A;  4BR0 A;  3MN7 A;  3K5M A;  1NJX A;  2GUI A;  1RFQ A;  1BQN A;  1IKV A;  2FBY A;  2O8F A;  2IIR A;  1QHT A;  2O8B A;  1KAX A;  2IDO A;  4CD1 A;  4CEC A;  3SAG A;  1ILY A;  4LF5 K;  3O1B A;  4ID1 A;  4JKB A;  3LDN A;  1VQL N;  4IOX A;  4DF8 A;  4JI7 K;  3G9W A;  4GKK K;  1HNZ K;  3PX4 A;  3S41 A;  2ZWH A;  4CIG A;  4QOZ B;  3QDK A;  3SBT A;  3WQT A;  4OLB A;  4W5T A;  3CQX A;  3OS2 A;  5EXW A;  4A57 A;  1C1A A;  4JKC A;  4PL7 A;  1S3X A;  2OZS A;  1R59 O;  4CF2 A;  1CZ9 A;  5AQY A;  3H45 C;  3V9S A;  3TAM A;  4FW2 A;  4AQY K;  2ZGZ A;  1VSF A;  4BDZ A;  3FZH A;  4E7H A;  1GLC G;  3LP3 A;  1E4G T;  3RSE B;  3HST B;  1RTJ A;  4C8N A;  4Z4C A;  4ELU A;  2I7N A;  1S72 N;  3RRG A;  2O8D B;  3RMC A;  1ESV A;  1NK4 A;  2J4R A;  2KW4 A;  1RDU A;  4IJN A;  3A5N C;  1HQE A;  5FPE A;  4BE2 A;  3AO3 A;  3CCU N;  3FFI A;  2J0J A;  2J0M A;  4JD2 B;  3LAM A;  1DT9 A;  2R82 A;  3OYL A;  3OW2 M;  2VQE K;  3AAQ A;  4V19 S;  3PV8 A;  4CF0 A;  1VAZ A;  2A41 A;  3SUP A;  1XWL A;  1DLO A;  4M3R A;  4DR7 K;  3SNN A;  4IFE A;  3ASM A;  4EHT A;  5LY3 A;  5AQX A;  3CPW M;  5C10 A;  4KTQ A;  4LSL A;  5BN8 A;  2HRJ A;  2ASP A;  3ZET A;  2WUS A;  3K2P A;  4DLG A;  2HST A;  3R1X A;  4CHZ A;  4Z4F A;  1YXQ A;  3PO5 A;  1WLJ A;  4CYE A;  2LBB A;  1VQN N;  3THY A;  1W9H A;  2GEM A;  3K58 A;  1EO1 A;  3HPO A;  1GC6 A;  4LF8 K;  4FXD A;  3S3O A;  2V7Y A;  3VPZ A;  3ZLJ A;  2YVC A;  1IO2 A;  4N5S A;  3H3N O;  3HO1 A;  4WYB A;  2A1R A;  5GIN A;  2I5J A;  4M63 C;  5CR4 A;  2IVO A;  3M6G A;  3CC2 N;  3H1Q A;  4FJL A;  4FOI A;  3OS0 A;  5BPN A;  3EL2 A;  5CYM A;  3TAQ A;  3KHY A;  1W7A A;  4ZRI A;  1S1T A;  5E84 A;  3ENH A;  1I94 K;  4PY5 A;  4BRD A;  3LWL A;  1BO5 O;  5B8H A;  3DOK A;  5AQJ A;  4DV7 K;  4RTF D;  4B1Y B;  4DFM A;  4BC2 A;  3I0R A;  1OVY A;  2B5J A;  4CEZ A;  2GWK A;  4IFY A;  1RDB A;  3DLK A;  5C12 A;  4BR5 A;  3VEW A;  3H3O B;  2KLA A;  3VQ6 A;  3CJA A;  1REV A;  2W40 A;  3EO3 A;  1K8K A;  2VCP A;  2P9L B;  4FK0 A;  4KHU A;  2ZJQ L;  4FCY A;  4NYN A;  3L4I A;  4BRL A;  2FF6 A;  2AL6 A;  4Q5V A;  5LMN K;  3K9K A;  5EOY A;  4LFB K;  4NO7 A;  5AQN A;  4B3O A;  4HUF A;  3E1Y A;  4CJL A;  1VQP N;  4WE1 A;  4LSN A;  3CJ1 A;  4BQL A;  2CH5 A;  1GOA A;  3D2F B;  3QML A;  4HCB A;  3QIN A;  1NGF A;  5DK5 A;  3OBY A;  2D0B A;  5GAE P;  3EN9 A;  5EU7 A;  4JI4 K;  1EWQ A;  4CJ5 A;  3MXI A;  3PVL A;  3AV9 A;  4G1Q A;  3GG4 A;  4CF8 A;  3ZYY X;  2PAV A;  4X62 K;  5JMV A;  2HNZ A;  2HF4 A;  1N8R O;  1IBM K;  3SYZ A;  4FVU A;  1HNI A;  1YJ9 N;  3G6E N;  2QKB A;  1VSH A;  3TPQ A;  3OYA A;  3AVN A;  1BI4 A;  1S5J A;  2EX3 A;  3RMB A;  4YOW A;  2OTJ N;  3OYI A;  4CHQ A;  5AZI B;  3FGU A;  2G8H A;  3NGY A;  2D5R A;  4FJK A;  1EXQ A;  4DR2 K;  2VWB A;  5BRF A;  3D2E A;  1VSD A;  4A2A A;  3TTD A;  3MCP A;  3U9Z A;  3NCI A;  3U3G A;  1UWB A;  1A5V A;  2IAJ A;  3WXK A;  3CIP A;  1HQU A;  4K0K K;  4DU4 A;  3LWM A;  3OJS A;  2NRZ A;  2VWK A;  4GNI A;  4JAX A;  1ZBH A;  4YL8 A;  4FSV A;  1T8E A;  2GUP A;  3DLL L;  2YJE A;  5KQD A;  4Z94 A;  4TSX A;  4KHQ A;  3R8E A;  2ASM A;  3N4P A;  4O55 A;  2EMS A;  2GBZ A;  1UA0 A;  3ZSW A;  3V81 A;  3C95 A;  2E20 A;  5C42 A;  4CHN A;  1YIJ N;  1D9D A;  1WB9 A;  2HBM A;  3OYD A;  3EKS A;  3AA3 A;  1NJW A;  4OKJ A;  1XI1 A;  1D8Y A;  1OVQ A;  3NFA A;  4AH9 A;  3VF2 A;  2E2Q A;  4OX9 K;  2E2N A;  2F9T A;  2KKZ A;  1RBR A;  1S1V A;  3OYG A;  1SKR A;  3AVK A;  1E5W A;  4LFC K;  4O44 A;  5ELZ A;  3KK7 A;  3F9K A;  4IG3 A;  5BN9 A;  3ALY A;  1EF1 A;  4CBW A;  1ACA A;  5J1E A;  1W0H A;  3VQ4 A;  2DPN A;  3OJU A;  4MO5 A;  1NGC A;  3C65 A;  4DSF A;  1W2B M;  4J2E A;  3LAL A;  2WH5 A;  3JSM A;  3RMA A;  3A2F A;  4I9Q A;  1LAW A;  3NF8 A;  4W5O A;  1SKS A;  4BC4 A;  1ZC6 A;  1ZBU A;  4F2R A;  1VSE A;  4FJX A;  1SUQ A;  3UKU A;  3V9Z A;  2UUA K;  3X23 A;  3DRS A;  4GXB A;  2A5X A;  4EHU A;  2HHW A;  2HBJ A;  3I8B A;  1KVC A;  4FO0 A;  1VSM A;  4OKK A;  4HHT A;  1WSG A;  2YHW A;  4FZX C;  1Z6R A;  4JI2 K;  1J53 A;  5CHI A;  4BWJ A;  1KAZ A;  3C7N A;  4FJI A;  4BE0 A;  2IGI A;  4ZRJ A;  1TVR A;  4E1J A;  4FLU A;  1IG9 A;  3BIN A;  4Z4E A;  3U8Z A;  1SZ2 A;  4LH4 A;  4CJF A;  4K8Z A;  2YHA A;  2D4W A;  3V1O A;  3THY B;  3D6R A;  5BPL A;  3L3U A;  2FLO A;  4KV8 A;  1DGK N;  1B92 A;  1U6Z A;  4OPA A;  3SQ1 A; 
#chains in the Genus database with same CATH homology
 1GLB G;  2FDQ A;  4ISE A;  3MX5 A;  3O08 A;  5GAH P;  3I55 N;  3BUZ B;  2CGK A;  4JK9 A;  2FSJ A;  2P9S A;  3MX2 A;  3MN5 A;  3Q7B A;  3A5M C;  4K42 A;  3TU5 A;  5JLH A;  5JVG L;  4MDA A;  3QIC A;  1VQM N;  3KVG A;  2E1Z A;  4H5R A;  3BP8 A;  4IXC A;  5KPZ A;  4EIA A;  4BRQ A;  3VOV A;  4TKN A;  1GGO A;  2A3Z A;  1ISN A;  3OBW A;  4CZH A;  3AGR A;  5BR9 A;  1J6Z A;  3ZX2 A;  4JKH A;  4DCH A;  5AZJ B;  4BR4 A;  2W41 A;  4FWK A;  4M7Y A;  1HB8 A;  3SMP A;  3P4I A;  3DJC A;  4FWN A;  4H0T B;  2RHK A;  2YI1 A;  4YOV A;  3CCM N;  3CMA N;  1VQ9 N;  1P8Z A;  4JKF A;  5AQF A;  4IWV A;  1SS6 A;  3QFU A;  4XEI A;  3PZD A;  3GE1 A;  2OTL N;  4ILH A;  4FOE A;  2FSN A;  3O8M A;  4CD3 A;  4GV3 A;  3ATV A;  3MWP A;  1X3N A;  4PKI A;  4JKG A;  3EKU A;  3CC7 N;  4GY2 B;  4MLH A;  4BRH A;  4BC5 A;  5DM7 L;  2Q31 A;  4BRF A;  4A5A A;  1EQY A;  1NLV A;  1Q82 O;  2E8A A;  3LDL A;  4A2B A;  1K8K B;  2Q2R A;  5AQT A;  3I33 A;  2P9U B;  3FE1 A;  3IUC A;  1QVF M;  3W0L A;  4CZK A;  1C0G A;  4PKH A;  2ZJR L;  1YAG A;  5FPM A;  4EKU A;  4CZJ A;  2QWL A;  2E2P A;  4WFB L;  1TYQ A;  3O80 A;  4KH4 A;  3O9Q A;  3U4L A;  1HPM A;  5EVZ A;  3ENO A;  4FWR A;  1Q81 O;  2HF3 A;  3RSE A;  3SMS A;  2ITM A;  3UKU B;  2D11 A;  1H1V A;  2CB8 A;  1HX1 A;  4K43 A;  5KPR A;  4YDU A;  1MWM A;  1MDU B;  1NTI A;  5BRE A;  3AAP A;  1Z05 A;  2ZPY A;  3VF6 A;  4PHT X;  1T6C A;  4KBO A;  4A5B A;  3F5T A;  1Y64 A;  1VQK N;  3M1F A;  3AAR A;  2CQU A;  3DXM B;  3CC4 N;  5HOO A;  1D4X A;  2IVN A;  4BVO A;  5C0Y A;  1NGG A;  1X9J A;  4MDB A;  1LCU A;  3AGK A;  3SAF A;  2P9I B;  2DIK A;  1GLL O;  5GIO A;  3D7E O;  4AM7 A;  2OAN A;  4CBX A;  4H5T A;  4I6M B;  4H03 B;  4JD2 A;  4L3Q A;  2ZF5 O;  5BRH A;  5JLF A;  1GLE G;  3FLC O;  2VGN A;  2YJF A;  3P31 A;  3P38 A;  4CZL A;  5FPD A;  1GLJ O;  5E26 A;  1BG3 A;  1JCE A;  4IJA A;  4IEE A;  5TKW A;  1O13 A;  4JK7 A;  4H5W A;  1JCF A;  5KPT A;  1RDW X;  2QTD A;  5LJV A;  2RQ1 A;  4H5N A;  3KWI A;  5ADX A;  4BRI A;  3WQU A;  3EZW A;  1QZ5 A;  4HDQ A;  2BH1 A;  3VF4 A;  1Q86 O;  5MLC Q;  2V51 B;  4ILJ A;  4H0V B;  5M1P A;  3O5B A;  4CJ7 A;  3CF5 L;  1ATN A;  1GLF O;  3HBT A;  3MN7 A;  2NRX A;  4NLC A;  1CZA N;  3MN9 A;  4BR0 A;  1RFQ A;  3VEZ A;  2IIR A;  3WT0 A;  3O6W A;  1KAX A;  4LC9 B;  4H0O A;  4CD1 A;  2YHY A;  1U2V B;  2D0O A;  3WXI A;  4A61 A;  3SAG A;  1ILY A;  3M3Z A;  3O9T A;  4YOY A;  3GDQ A;  3FR0 A;  3O1B A;  3VEX A;  4JKB A;  3TTF A;  3HTV A;  3LDN A;  1K73 O;  3AU5 A;  3IKM A;  4JHD A;  1NGE A;  2GWJ A;  1VQL N;  3EE9 A;  4IOX A;  3O1W A;  4BG8 A;  5C15 A;  3G9W A;  1NGH A;  4WFA L;  5AQK A;  3S41 A;  2ZWH A;  3E66 A;  2P9N A;  3KZB A;  3QDK A;  1QQO A;  2I1K A;  3SBT A;  3PLA A;  3WXL A;  2QM1 A;  4JKG B;  4DB3 A;  3HM8 A;  3WQT A;  1DIK A;  2E2O A;  5AQM A;  3CQX A;  4FPA A;  1YJW N;  5EXW A;  4A57 A;  1KAY A;  5AQO A;  4C23 A;  4JKC A;  5IJM A;  2WC9 A;  4ISF A;  1TUU A;  3P39 A;  4PL7 A;  2E1Y A;  2J0K A;  4FWL A;  4IOC L;  5GAD P;  4JKE A;  1SAZ A;  1S3X A;  3HOT A;  1R59 O;  3HI0 A;  3VEY A;  3VGL A;  5AQY A;  3H45 C;  3CCR N;  3B8A X;  3R3L A;  1QHA A;  3VEN A;  2ZGZ A;  2CGJ A;  4MO4 A;  5F1X A;  1TYQ B;  3OA9 A;  1JJ2 M;  3FZH A;  3CJ9 A;  1XC3 A;  2P9P A;  4CZI A;  1GLC G;  4CZF A;  1YHQ N;  1E4G T;  3A5O C;  3FFK B;  3RSE B;  1QVG M;  3VTH A;  2I7N A;  1BDG A;  4BRK A;  1S72 N;  4NB4 A;  4OPH A;  4BQZ A;  1VQ6 N;  5KQD A;  1J19 A;  2HBK A;  3CCJ N;  1G99 A;  1ESV A;  1VQ7 N;  3CJC A;  2J4R A;  1RDU A;  2JWK A;  3SJH A;  1YVN A;  3W3D A;  4IJN A;  3A5N C;  3CCE N;  4BR2 A;  3FP5 A;  5FPE A;  3L4Q A;  2BUP A;  2P9K A;  1MK7 B;  4H5V A;  4IDH A;  1WUA A;  4IZ9 A;  4YOX A;  4KH5 A;  1MK9 B;  3CCU N;  2F7T A;  2J0J A;  5AQI A;  3JS6 A;  2J0M A;  3EE8 A;  3CCV N;  3E9L A;  4JD2 B;  3F9M A;  3TSP A;  2P9L A;  1KXP A;  1DT9 A;  2R82 A;  3UB5 A;  3VTI A;  3EPY A;  4K41 A;  2Q36 A;  3OW2 M;  3BF1 A;  3CET A;  3AAQ A;  4J8F A;  3HSC A;  1HUX A;  1BA1 A;  4B1W B;  1VAZ A;  2YCH A;  3K9J A;  2A41 A;  1V4S A;  5I9E B;  4YDU C;  3MN6 A;  4EFH A;  1IJJ A;  3H1V X;  4IFE A;  5AQQ A;  3VER A;  4EHT A;  5LY3 A;  5AQX A;  4BRC A;  3A8Y A;  4BRM A;  3CPW M;  3D2F A;  4ILG B;  1E4F T;  4QS7 A;  2ASO A;  5C10 A;  4GV9 A;  4BRN A;  5BN8 A;  5JIC A;  3SBG A;  2HRJ A;  1ZBS A;  2GTD A;  2BTF A;  2ASP A;  3ZET A;  1M1K O;  2WUS A;  1WOQ A;  2QWQ A;  3O9U A;  1H4R A;  3KWG A;  1ATR A;  2HST A;  1NGI A;  3R1X A;  4NLB A;  3LDO A;  1BWF O;  1M90 O;  1VBG A;  1YXQ A;  4CZG A;  5CE3 A;  1XQS C;  3DLL L;  3DXK B;  4CYE A;  4JHD B;  2LBB A;  2Q97 A;  4GVE A;  4XH4 A;  1QQM A;  1VQN N;  3R9P A;  3NVK A;  2GEM A;  1HKG A;  3J7Z O;  1GC6 A;  1EO1 A;  1YI2 N;  4F9O A;  3C6A A;  2COP A;  2V7Y A;  3VPZ A;  1VQO N;  4IOA L;  1MIX A;  2YVC A;  1KBL A;  3C0B A;  3C7N B;  1LOT B;  4JN4 A;  2IVP A;  5AQV A;  5TKY A;  3H3N O;  4DKW A;  4WYB A;  3NMU A;  2EWS A;  5AQP A;  5GIN A;  1NJI O;  4M63 C;  5CR4 A;  3CCQ N;  2IVO A;  3M6G A;  5AZI A;  3CC2 N;  3H1Q A;  3MWT A;  4FOI A;  3U8X A;  4A62 A;  2PFU A;  3FLV A;  2UYT A;  5BPN A;  3EL2 A;  4RCH A;  4PL8 A;  3ULE A;  3VET A;  3KHY A;  3HOS A;  4ZRI A;  5E84 A;  3FZL A;  3ENH A;  4PKG A;  2YX6 A;  4BRD A;  4EAH D;  5AZJ A;  2P9P B;  1YJN N;  4H0Y B;  1BO5 O;  4CZE A;  5B8H A;  4F7G A;  2VYP A;  2P9S B;  4YOT A;  5AQJ A;  1JDE A;  3CJ7 A;  2CGL A;  2E88 A;  3GOI A;  4RTF D;  4B1Y B;  3I56 N;  4CBU A;  4BC2 A;  1MA9 B;  3CCL N;  1NM1 A;  4B1U B;  3E9O A;  5BRD A;  4BY9 C;  3CD6 N;  3AY9 A;  1OVY A;  2H3G X;  1SQK A;  3FZK A;  2NRR A;  2QEX N;  1QZ6 A;  3VMF B;  2GWK A;  2P9K B;  3ATU A;  3CXC M;  5C12 A;  4BR5 A;  1JCG A;  3VEW A;  3H3O B;  2KLA A;  3CJA A;  4H0P A;  1NWK A;  3CI5 A;  1VQ8 N;  4AF1 A;  1GG3 A;  4G9Z A;  2W40 A;  1GLA G;  1K8K A;  2VCP A;  3EO3 A;  5AQU A;  3GBT A;  2P9L B;  2A42 A;  5AFU A;  4JNE A;  2D2Q A;  2ZJQ L;  4NY0 A;  4IO8 A;  3L4I A;  4BRL A;  5HL7 L;  2FF6 A;  2AL6 A;  3QFP A;  4BVP A;  4RWT A;  1VQ5 N;  3LDP A;  5AQZ A;  4ZRK A;  3K9K A;  3MCA B;  5EOY A;  1HKC A;  5AQW A;  1W97 L;  4O8U A;  3ID8 A;  4FWO A;  4NO7 A;  1T6D A;  2GEL A;  5AQN A;  5AR0 A;  3E1Y A;  3CJB A;  4IEI A;  1VQP N;  5GAG P;  4QS8 A;  3CJ1 A;  4BQL A;  4DXA B;  2CH5 A;  1HKB A;  1V4T A;  3D2F B;  3MK6 A;  1C0F A;  1HLU A;  2HBL A;  3QML A;  4B9Q A;  5C2F A;  1NGB A;  2Q0U A;  3WUH A;  3IMX A;  2D10 A;  2P9I A;  1NGF A;  5AQS A;  3OBY A;  3ZET B;  5GAE P;  3EN9 A;  2EMT A;  2YHX A;  5JVL A;  3PVL A;  2HOE A;  3GG4 A;  3ZYY X;  2PAV A;  2WBN A;  2X0S A;  5JMV A;  4DQ8 A;  1S22 A;  2HF4 A;  4BGA A;  1N8R O;  4O8K A;  2FSK A;  2NRH A;  2V7Z A;  1TUY A;  2ZGY A;  4FWM A;  5F2R A;  4FVU A;  5AQG A;  3ENB A;  4WQ5 C;  1YJ9 N;  3G6E N;  2NRT A;  3ZX0 A;  1DEJ A;  3TPQ A;  3A0I X;  4BRA A;  3CQY A;  4WF9 L;  3J8A A;  3VGM A;  1SGH A;  2WFB A;  3MMV A;  5M1O A;  3UE5 A;  4R79 A;  4YOW A;  2OTJ N;  3G71 N;  1BOT O;  2QWP A;  2NLX A;  3WXJ A;  1X3M A;  5AZI B;  3AU4 A;  3FGU A;  3IDH A;  4JK8 A;  1HJO A;  3O9R A;  4YOU A;  4FWQ A;  4IO9 L;  1K8A O;  2HE7 A;  3QIJ A;  2RE2 A;  1NVL A;  4FWP A;  4WQ4 C;  1U2V A;  1VQ4 N;  3Q7C A;  3U7D A;  2VWB A;  3ULE B;  4O5F A;  2A40 A;  2QWN A;  4WQ5 A;  5BRF A;  3PIO L;  3VES A;  3FZF A;  3D2E A;  3ZEU A;  4A2A A;  3T69 A;  3MCP A;  3TTD A;  3U9Z A;  1OKJ A;  3SLC A;  3WXK A;  3CIP A;  1NBW A;  2CH6 A;  2AP1 A;  3HRG A;  1KD1 O;  2VGM A;  4HDO A;  5AQR A;  4BGB A;  2QWR A;  3FZM A;  3CCS N;  4UY8 O;  5C2D A;  3WXM B;  3IFR A;  3T7Z A;  2NRZ A;  3ZDT A;  3C6H A;  1Q18 A;  3CPE A;  5AQH A;  1BA0 A;  1GC7 A;  3CHW A;  4WQ4 A;  3OHR A;  4GNI A;  2QXL A;  4JAX A;  4YL8 A;  4BC3 A;  4FSV A;  3LL3 A;  4YOR A;  3L6Q A;  1KQS M;  2GUP A;  2V52 B;  2YJE A;  1T3V A;  2FJ9 A;  3CER A;  4BRO A;  4Z94 A;  4JKD A;  1RGI A;  1GLD G;  3R8E A;  2ASM A;  4FL9 A;  3N4P A;  4WFN L;  4K25 A;  2EMS A;  4BR9 A;  4BRG A;  3UKR A;  4BR7 A;  3A5L C;  3WEE A;  5KQ8 A;  1YIT N;  2E20 A;  4WCE L;  2I7P A;  4CZM A;  2P9N B;  4B1X B;  1VBH A;  1YIJ N;  3IVF A;  4BG9 A;  1HBK A;  4BRE A;  2HBM A;  4FWS A;  3EKS A;  2GX9 A;  2D0P A;  2ABD A;  2Q1N A;  5AQL A;  3LM9 A;  5M1K A;  3ZX3 A;  2NZT A;  4ISG A;  3GL1 A;  2NRV A;  2NNW A;  3TSQ A;  1NGD A;  3QBW A;  3VGK A;  1YUW A;  2KHO A;  3VF2 A;  2E2Q A;  5EY4 A;  2E2N A;  2F9T A;  1KC7 A;  2QWO A;  2KKZ A;  4C1N I;  4P7I A;  3U9D A;  1DKG D;  2F9W A;  1BU6 O;  3SK3 A;  1E5W A;  1BUP A;  3F2K A;  2HMP A;  1K9M O;  5ELZ A;  3KK7 A;  3H6E A;  5BN9 A;  3M5R A;  1T44 A;  1EF1 A;  3TTC A;  4U67 L;  2QWM A;  4MLE A;  2ZJP L;  1NI2 A;  4M7X A;  1ACA A;  1NGA A;  4CBW A;  3VEO A;  4CI6 A;  1KC8 O;  1YF5 L;  2DPN A;  2FF3 B;  4XH5 A;  3QB0 A;  4MO5 A;  1NGC A;  3C65 A;  4KH6 A;  1W2B M;  4GV6 A;  1MIZ B;  2D1K A;  4BRP A;  3TSU A;  2WH5 A;  5EX5 A;  3WA0 A;  4DHY A;  2P9U A;  4QS9 A;  3HZ6 A;  2Q0R A;  4B1Z A;  3ID6 A;  5FPN A;  5JVH L;  3CME N;  5M1Q A;  4BC4 A;  3SAH A;  1ZC6 A;  4AM6 A;  4U7B A;  3VEV A;  1HB6 A;  4B1V A;  3O9S A;  5LJW A;  4Y0W A;  3UKU A;  3QBX A;  5F0X A;  1ATS A;  3NVM A;  4HTL A;  5GIP A;  4OO1 J;  3D2E B;  3ZEU B;  3X23 A;  4GXB A;  3DWL A;  5DM6 L;  4A59 A;  3E9P A;  2A5X A;  4EHU A;  1MWK A;  5ADX H;  3DXK A;  2HBJ A;  3I8B A;  3DXM A;  4FO0 A;  3N4Q A;  1P90 A;  3RVC A;  3MDQ A;  2YHW A;  4XH1 A;  3O4W A;  1Z6R A;  1IG8 A;  3LM2 A;  5M1N A;  3L0Q A;  4C1N K;  1NGJ A;  3BF3 A;  2AA4 A;  1QQN A;  5CHI A;  3JXU A;  1KAZ A;  3R6M A;  1XUP O;  3C7N A;  2JWL A;  3BEX A;  4ZRJ A;  4E1J A;  3G4S N;  5M1F A;  3BIN A;  1ZXO A;  4I6M A;  4JEP A;  3U8Z A;  1SZ2 A;  4H0X B;  2PBD A;  2QI2 A;  3H46 O;  3DAW A;  1ST7 A;  2FXU A;  2AEH A;  5H1S Q;  2QA4 N;  2D4W A;  3UKR B;  4HWI A;  4FPB A;  3WEE B;  4JKA A;  2QW9 A;  3D6R A;  5BPL A;  1NMD A;  3PIP L;  1Q7Y O;  2FLO A;  5BPM A;  1Y19 B;  2I1J A;  1DGK N;  2A6A A;  2NRW A;  3LDQ A;  1U6Z A;  5AFU H;  4OPA A;  3G25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...