3E9LA

Crystal structure of human prp8, residues 1755-2016
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
257
Chain Sequence
EPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of an RNase H domain at the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, splicing
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 81
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12134 PRP8_domainIV PRP8 domain IV core
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3e9lA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3e9lA01
4JKBA 4JK7A 4JKFA 3ENBA 3SBGA 4ILGB 4ILJA 3SBTA 3E9OA 4JKAA 3E66A 4JKDA 4JKGB 4JK9A 4JKCA 4JK8A 3E9LA 3E9PA 4JKGA 4JKEA 4JKHA 4ILHA
chains in the Genus database with same CATH superfamily
4JN4A 1LW2A 5CZ2A 4AH9A 2XO7A 4O0IA 1REVA 1YTAA 3QIPA 1TYQA 2VGMA 3DRRA 4X62K 3TAEA 3RR7A 4CCHA 1BDGA 2VWJA 1Y64A 3PX6A 1YT3A 1DGKN 5JLFA 1TUUA 4HUEA 5M1PA 3OYIA 1V4TA 3AU5A 4ISGA 1ZBUA 3OA9A 2I5JA 3V1QA 1J53A 1NGAA 3ZEUA 4MO5A 1IV0A 4KH6A 4IG3A 4ICLA 1NJYA 3EZWA 3HPGA 3O8MA 3CD6N 1XMQK 3CIPA 2VG5A 3K0SA 4YNQA 4IZ9A 4DKWA 3LPTA 2RN2A 4M3YA 4MLEA 3M8PA 1XQSC 4BE1A 2QWLA 3NHGA 4AF1A 4B3MK 2ASPA 4M3UA 1I94K 2H3GX 3CCQN 4IEEA 1VQMN 3BUZB 4GY2B 4A59A 1YVUA 3DLRA 5AQTA 2GV9A 4CI6A 3RR8A 3MECA 3TANA 3EKUA 3T1HK 4FLYA 1SV5A 5DM6L 1NLVA 4AHCA 4BR5A 5F0XA 1JLFA 4ISFA 4LF6K 1H1VA 4FOEA 4M41A 1BQNA 4EFHA 1XWLA 4J2BA 4FWRA 4NXNK 3PX4A 4GV9A 4CZEA 1SGHA 4U67L 5EX5A 3ZSQA 5HP1A 1HNIA 4DV7K 3NGZA 3HM8A 2QWOA 1VQON 3TPQA 2YJEA 3LDPA 2YKNA 1VQLN 3L4IA 3K5MA 2Q1NA 3B8AX 3MEGA 3P83D 1QSSA 3V1RA 1WSGA 3AVHA 1SKSA 3RRHA 4M45A 2QWNA 3WA0A 4O8UA 1WBDA 3NBPA 4DG1A 2F96A 3ENOA 1KVCA 1S1VA 3OYGA 4W5RA 3QEXA 5KQDA 3THYB 4EP4A 3BGRA 5LMNK 4HVJA 4CFDA 4ZTJA 5HLFA 5LMUK 4I6MB 4YHHK 2I7PA 3DLHA 1VSHA 3EO3A 4NYFA 1W9HA 2D0AA 3I8BA 4DV1K 1EXQA 1RT7A 3DMJA 4C23A 4H0TB 1JXBA 2GUIA 2JWKA 1MWKA 3NF7A 4I2QA 1YXQA 1SL1A 1N36K 3L2WA 4CGHA 4W5QA 5CY4A 5AQGA 4EHUA 4DFJA 4BACA 3DRPA 4CGIA 1C0MA 2QWQA 1L3TA 4N41A 3JS6A 1KFSA 1GLCG 2E5LK 3ASMA 1ZXOA 4AM6A 3VQBA 1CXQA 3SK3A 2ZM6K 4DUYK 1WNSA 2GUPA 1D9FA 2A3ZA 4F8RA 3LZJA 3L4QA 1NBWA 3P39A 4CEZA 3L6QA 2Z1JA 1IBLK 2O8FA 2I7NA 1BL3A 2B5JA 2ZJPL 1T7PA 3ZT0A 2HVIA 3NCIA 4CEOA 1OKJA 1XUPO 1JL2A 3I0RA 4H5WA 3VQPA 4CHQA 4KPYA 1BISA 4CF0A 3NGYA 3NH1A 5KGXA 1KAYA 3ISNC 4BG8A 1WOQA 2P9IB 2XY6A 4MQ3A 4Z4HA 2Z1HA 1LV5A 4IOCL 4AHUA 4CHYA 3U3GA 1NGJA 2HB5A 1C6VA 4Z4IA 4B9TA 1M1KO 1TL3A 5JLHA 2JGUA 1BCMA 3WQTA 3FZMA 1IBMK 1S6PA 2P9UA 4CGGA 3HYFA 1QE1A 3KK1A 1E3MA 4GVEA 3WXLA 2O8EB 1U2VA 3CG7A 3KVGA 1ATSA 3AO2A 5CYQA 2A41A 4E1JA 2ZJRL 2KW4A 5I42A 4V19S 4CJUA 3KLHA 3HT3A 2HNYA 3QICA 4CJFA 1TKXA 1QSLA 4IOAL 2E2OA 3MN9A 4CJ4A 3V4IA 3DOKA 2OPSA 2KTQA 5C10A 4KI6A 4JI6K 1LW0A 1X1PA 3OYKA 5E41A 4K25A 2ZE2A 1U6ZA 2YNFA 3TAMA 4CEQA 3AARA 1SS6A 5EU7A 1R59O 3KK7A 4KFBA 2CGJA 3QEPA 2FSNA 3OJSA 3LP3A 2GBZA 4MLHA 3UE5A 3AVBA 4CHNA 3U7DA 3AVCA 3AA2A 1HKBA 3KTQA 3ALYA 1OH8A 5BN9A 2COPA 4GVMA 3OYLA 1NGBA 4BC2A 1MA9B 1ESVA 1HJRA 4JI8K 3WQUA 1WAFA 5A2QO 5C0YA 1HUXA 3GDQA 2HF3A 2OCEA 1NK9A 1C0TA 4X65K 3U8ZA 1HQUA 4CIEA 4EZ9A 2J4RA 3S9HA 1RT2A 2V52B 2X6SA 2UUCK 4CZKA 1NGEA 4CBUA 3PO4A 2A6AA 1MK9B 1C0FA 5GAHP 2IAJA 1K8KA 3ZT1A 4CD1A 2NRXA 3VTIA 3LALA 5BPMA 1A5XA 4FJ5A 1JCGA 4O5BA 3CPWM 3GBTA 2IVPA 2BTFA 4N76A 3CC4N 1FW6A 4ILJA 1LWCA 2RE2A 3ULDA 2PBDA 2BDPA 2DY4A 1NGCA 2FBTA 1T44A 1KLMA 1X9SA 2E4LA 1RT3A 1YJ9N 5LJWA 3KKRA 4LSNA 4WQ4A 4WFNL 3V81A 3R3LA 4M3WA 1EWRA 4BC4A 3CC7N 2G8HA 1VQ7N 1KD1O 5AZIA 2F9TA 4BRQA 3CCUN 4XH4A 2BE2A 3OYHA 5T7BA 1VQ4N 4O0JA 3HTVA 1N34K 3K57A 4DFKA 4BRFA 4LH4A 2Q2RA 4K0KK 3QB0A 1HMVA 5JS1A 4FPAA 5FDLA 5GIPA 1GOCA 5D3GA 3C7NA 3FGUA 1KQSM 2RPIA 1S72N 2OZMA 1XNRK 3S3MA 4DTUA 4H4OA 1NKEA 4OKKA 4FO0A 3AVIA 2GX9A 3RMAA 1RTJA 3ZX2A 1NVLA 4DTJA 1WSJA 4C8OA 4CZGA 3VERA 5M1FA 1ZBLA 3MMVA 2E8AA 1VQ8N 2X0SA 4DQRA 4CF2A 2P9UB 3QEVA 2OPRA 4CE9A 1OH5A 3AVGA 3M8QA 2YHWA 2CH6A 2FSJA 2UYTA 1ISNA 3HXMA 4DTXA 1VQNN 1JLEA 4F3OA 3O08A 4FJJA 2HBLA 4AHSA 1N6QA 4NB4A 3KD1E 1KRPA 1NOZA 3AY9A 4OPKA 2YCHA 2CB8A 3QBWA 1GLDG 3IRXA 4DS5A 4JV5K 3TR8A 2UUBK 5HL7L 4QAGA 4B3OA 5HRPA 3IAYA 3AVMA 5M1KA 2VWBA 2AJQA 5IJMA 1L3UA 5FPDA 4DQSA 3N4QA 1T8EA 1TGOA 3IVFA 1GLFO 3C6UA 3PSFA 5FRNA 4DV3K 3J7ZO 3VEWA 4E19A 2V7ZA 3KWGA 4XH1A 2UXBK 2WC9A 4PKGA 2PFUA 3CCSN 1Y97A 2Q0UA 3KK3A 4CZMA 1XC3A 1JLGA 3HZ6A 4KAZA 2P9SA 1IBKK 4FW2A 4B1XB 3QEIA 3EEQA 4TSXA 1Q7YO 1BHLA 3H1VX 1GLBG 1RTHA 4W5TA 3CFPA 2E6LA 1U4BA 4HUGA 3LDLA 2G8WA 4Y1DA 4JKCA 3FZFA 1WSHA 4NXMK 1XHXA 3THXA 3V9ZA 2XY5A 3KKSA 5H1SQ 3M5RA 4CBXA 1DIKA 3I56N 3H45C 4ID1A 2BGGA 5GIOA 3QEWA 4NCAA 1U2VB 3HK2A 5B8HA 1HR0K 3PVLA 4NLCA 3JXUA 1VRTA 3Q7CA 3KLFA 3PZDA 2P51A 1WN7A 2FF3B 4KH4A 5BRDA 1NJXA 4JKGB 1L3VA 4Z4CA 1MK7B 3AVLA 1JLAA 1HKGA 1NGFA 3E01A 4LD0A 3OBWA 1OH6A 4CJTA 4OX9K 2WBNA 2KLAA 3HM9A 1TAQA 4DF4A 3C94A 3RSEB 3BEXA 1C0GA 2QXFA 3CFRA 3M1FA 3E1YA 3THWB 1O13A 5BN8A 4EP5A 1VAZA 1NJZA 4I7FA 5AZJB 3QIJA 2V7YA 3LPUA 3R8EA 1G99A 4DTPA 1R0AA 4M3ZA 3MX5A 3OYFA 4LC9B 3VTHA 1H4RA 4FVMA 3EKSA 4BQLA 3OYEA 1JCEA 2VGNA 4DV0K 2PAVA 3DXMA 3K5LA 3TSPA 2DFHA 2J0KA 1CZAN 2G8UA 3AGKA 1VHXA 1HRHA 2RF2A 2ITMA 3NF6A 4B9UA 1HNVA 2F8SA 4DQIA 4FJ7A 3FLCO 3ZLJA 1G15A 3DRSA 4CEFA 1Z26A 4BWJA 3H46O 3TARA 4FLWA 5KPRA 3L2UA 4HCCA 4CHZA 1E4FT 4UQGA 5J2MA 5F2RA 3TTFA 1JXEA 1ZC6A 4OJRA 3WXIA 4ZRJA 3ZDTA 3I33A 4FWSA 2P9LB 1C1CA 2WFBA 2J0MA 4DR1K 1TUYA 1L5UA 3VQQA 3EN9A 4CF9A 1NK5A 3LM2A 2D4WA 3WNEA 2HHWA 3MXJA 4CJVA 3L2RA 5AQOA 1CLQA 4DWIA 4CJKA 2YV0X 4F4KA 3TSUA 1SQKA 4IWVA 4WE1A 2O8BB 2LBBA 4DTRA 3OYDA 4RWTA 4FYDA 3MEEA 3OVNA 1NMNA 1VK0A 4WYBA 4CJEA 2IVOA 2QWRA 1MWMA 4A62A 2R7YA 2P9PB 3C6AA 2GEMA 5BPNA 3QERA 3MXMA 3DLBA 4CJSA 1OVYA 3KWIA 3CCLN 1TL1A 1HLUA 2W6KA 5KRTA 1N32K 3KLIA 3RMDA 5KPZA 4H03B 4M3TA 2F4VK 2EMSA 4RTFD 4BG9A 3A5MC 4BRNA 5GINA 5ADXA 2FSKA 3SI6A 4GV6A 3D7EO 3E66A 1RDCA 4WFBL 1K6YA 3FZKA 5HRSA 5KGWA 3PX0A 1BIZA 3GL1A 4YOVA 1TK8A 2P9PA 4BR4A 3HP9A 3S41A 1U47A 1BOTO 2DTUA 1C1AA 4BRMA 1M90O 4FZXC 3KHYA 4ILHA 2D5RA 2ZF5O 1TYQB 4KHNA 5BPLA 1KLNA 3B6OA 1YI2N 1A5WA 4FSVA 4CZIA 4CFCA 4NLBA 3FE1A 3CQYA 4FLVA 1QQCA 3QLHA 4BRHA 1EETA 1ZYQA 5J1EA 2GTDA 3HRGA 5AQQA 1WSIA 3G25A 2KFZA 4F7GA 3O1WA 1NK7A 4O5FA 2HOEA 3TAPA 1X3MA 4CGJA 4N56A 2D0PA 4FK2A 3AVFA 4U7BA 1GLLO 4BR7A 1T05A 4DV2K 1KAXA 1QHTA 4AQYK 4GKJK 3WXKA 3AA5X 4JKDA 1KCFA 3T19A 3L3UA 4C8MA 3CMAN 4KTWA 4KTZA 1IKWA 3SAHA 1EKEA 4FM2A 2E2PA 3U9DA 4BRKA 1S3XA 4AHRA 3MEDA 5M1OA 4E1MA 3DXMB 1VSKA 3SBGA 4H4MA 4ELUA 3AAPA 4IXCA 1JLCA 4BRIA 3IS9A 4A5AA 5KTQA 2YVCA 3J80O 3MXIA 4ISEA 3O6WA 1VSJA 5TKYA 4A2BA 4BR9A 3IMXA 4PL7A 3SQ4A 3HSCA 4LF7K 1GOAA 3FZLA 2FDQA 4CGFA 3VETA 1U04A 2O4IA 4RW8A 4CZJA 2BUPA 4FK4A 4A57A 4GXBA 4JEPA 4KHWA 1QS4A 3OYBA 4LF8K 2DFFA 3O9QA 4FWLA 2A1RA 2QXLA 2D11A 1HPMA 4DSJA 2DIKA 1SAZA 4B9QA 4FJKA 2RHKA 3VGLA 1BG3A 4CK2A 3ZT4A 4A61A 3RWUA 3CJ1A 4K43A 3T7ZA 4NCBA 2VQEK 4JI7K 4DV6K 4DU4A 4KB0A 4KHUA 3THYA 1N5YA 3S3OA 4OLAA 1HBKA 1S6QA 3K9JA 4PUOA 4Q5VA 3BDPA 3AVKA 4BRGA 1B9DA 1GG3A 5AQLA 1Y19B 1MDUB 3A5OC 3LDOA 3AGRA 1T3VA 4DSKA 3GOIA 2I1KA 1LCUA 2ZPYA 4FZYA 4GKKK 4JI0K 5AZJA 4DQQA 1X9MA 1RDUA 1IG8A 1J6ZA 3DLLL 1NG9A 4PA1A 3SQ0A 4DUZK 2AA4A 2ZQBA 3M8RA 3DYAA 4NO7A 1NI2A 4OPAA 1CXUA 4DS4A 1WBBA 5J2PA 4M63C 3ZCMA 4B1ZA 2I1JA 2GWJA 1NKCA 4JS4A 2VYPA 4M3RA 2DPNA 3SZ2A 4LSLA 2IIRA 2NRZA 3MAQA 5AQMA 3WEEB 1VSLA 2HBMA 5LY3A 3CM5A 2FBXA 2HNDA 4ZTFA 4CZHA 3ID6A 2NLXA 4DR3K 1HB8A 2G8VA 3CCMN 1NOYA 4JKBA 3SPZA 1ASUA 3MCPA 2D0CA 4KI4A 3OYJA 3CCRN 4DR2K 4A2AA 5GAEP 3SMSA 2WTUA 4E3SA 2UUAK 4IJAA 4FM0A 4YL8A 5FPEA 2X74A 3SAGA 4OO1J 1NK0A 1NK8A 1QTMA 3C6HA 4H0PA 3J7YP 3LANA 3R6MA 1TKZA 4L3QA 2HMIA 3WNFA 2D2QA 2FC0A 1HJOA 1HYZA 3CHWA 3EY1A 2YKMA 2IDOA 2Q0RA 4IG0A 3G71N 1DKGD 3OYMA 3QNOA 5DMRA 2O8BA 3DI6A 2EHGA 3L8BA 2YJFA 3SNNA 1JJ2M 4JKAA 4RCHA 1EP4A 5AQZA 3RMCA 3OY9A 1X9WA 4BE0A 1Z6RA 2HHXA 4H5RA 4RG8A 3O9RA 3BF1A 4EIAA 1U49A 4C8NA 3WNHA 3C6TA 1Q18A 3VQ4A 5KQ8A 1BA1A 4OKEA 2HMPA 4RW6A 5HRNA 2P9SB 3OHRA 3P5JA 1WUAA 3QMLA 1Q86O 4X64K 3VQCA 1HNXK 3F73A 3AA4A 2P9NB 3FLVA 2QEXN 2HRJA 4FVUA 5AQVA 4Z94A 2F9WA 3L0QA 2YHXA 1ATRA 4B8AB 4OGEA 4NYNA 3K59A 3O3GA 3CJAA 1D9DA 5E84A 4O55A 4GW6A 3OYNA 4IFEA 4H0VB 3HOSA 3PLAA 2ETJA 5AQHA 2G8FA 3DXKA 4FK0A 1IO2A 4FW1A 4ELTA 4CHPA 4CEAA 1KC7A 4O4GA 1WAJA 4X66K 3VMFB 1NU0A 3ULEA 4DFPA 1B92A 2E1YA 4UY8O 1KXPA 1WLJA 1YUWA 3CETA 2HE7A 4JKHA 3CM6A 3RSEA 4FPBA 1HPZA 4FJHA 4E89A 4JLHA 4BR0A 5GAGP 2E6MA 3E9OA 1HB6A 5DM7L 1OH7A 3CCEN 3LDQA 3LWMA 1NJWA 1DTQA 2Y1JA 3HBTA 1K9MO 1P8ZA 1LOTB 5AQUA 2VG7A 4JD2A 4KV8A 3UB5A 4IDKA 5BR9A 2NRRA 4OPJA 3ZSOA 2HHSA 1HYSA 3UIQA 4M7YA 1FKOA 5C12A 1BA0A 1KSPA 1BI4A 2JWLA 2OPQA 3J81O 3T1AA 4CECA 4B3TK 1JLBA 2G8KA 3VEZA 3CPEA 2QWMA 3CMEN 4QOZB 3V9UA 1RTIA 3QETA 3UKRA 1N8RO 3LAMA 3U3YA 2FXUA 2QM1A 3BF3A 2YHYA 3EL2A 3SQ1A 4QCLA 1NTIA 2FJ9A 4LY7A 2X78A 2D1KA 3D45A 3DLEA 2V51B 1NM1A 4LF4K 4JD2B 2QWPA 4JRQA 3EE9A 4H8KA 1SL2A 4MFBA 4K41A 1T03A 4OGCA 1XHZA 4BR2A 1S5JA 4E7JA 2HF4A 4BQZA 4Z0UA 4BROA 3VOVA 4I9QA 1EX4A 4GV3A 2ATQA 3VGKA 3M6GA 3DWLA 3UKUB 3VQDA 2QKBA 4YORA 3SUNA 4DB3A 1E5WA 4FLXA 3VA0A 1UA1A 1RBRA 1L3SA 2KFNA 2YHBA 4C8LA 1VSIA 3I8DA 4BDYA 2QW9A 1S9EA 2QK9A 3G9WA 1IKXA 3SYZA 3O80A 2UXCK 4H0YB 3PSIA 1ZBHA 3VESA 3AO3A 1S1WA 3H08A 4GNIA 3PIOL 1RT5A 5SWMA 3L2VA 3NVMA 2IVNA 3ENHA 3ID8A 4AILC 1RT6A 5AQWA 4DV4K 1EF1A 3IKMA 1TAUA 2FLOA 3O4WA 3VENA 4FM1A 4R79A 5AQJA 3QFUA 1U45A 3OYCA 4B9SA 3QINA 4KHQA 4ID5A 4DV5K 1MIZB 2PYJA 4HCBA 5I3UA 3VEXA 3OJUA 3TWHA 4DR5K 4DTSA 2PZSA 1XC9A 1VSMA 2E20A 5AQNA 4JK7A 2YHAA 2O4GA 3VQ5A 2Q3SA 5AQRA 1GLJO 5AFUA 3V6DA 3HVTA 1ATNA 3B6PA 2A42A 3FFKB 4EHTA 1VQ6N 3QFPA 3C7NB 3CJ7A 3ZETA 3AVNA 4FZZA 3G6EN 4B3RK 4FWQA 3D2EB 4CK1A 1HYVA 4IJNA 4CGDA 4R5PA 1ZBIA 4RW7A 1K73O 4ILGB 1RNHA 4CERA 4HHTA 1JLQA 4JAXA 3SMPA 3MN5A 2B4JA 1YAGA 3AO1A 4F3TA 2P5OA 3CC2N 4A5BA 5AZIB 3ZT2A 3D2FB 3MWTA 3CJBA 1Z05A 3U6FA 5KPTA 4KB1A 4FJ9A 4QS9A 4JI3K 1S22A 3E9LA 2IC3A 3TSQA 3LWLA 2E88A 3AA3A 1XMOK 2AEHA 4CIFA 1NMDA 4IFYA 2Q36A 4B9LA 1X9JA 5C2FA 4Y0WA 2HBKA 5EOYA 3K58A 3FZHA 4M7XA 1KVBA 2B6AA 2QI2A 2P9IA 4O8KA 1EQYA 4JI4K 3LZIA 1I39A 3ZSRA 1SUQA 2HSTA 1BO5O 2P9KA 2YX6A 4KHYA 1QHAA 4JYAK 4P7IA 3PO5A 2HHUA 3NF8A 3TU5A 3WEEA 1UAXA 4QS8A 1GOBA 3CYMA 3V1OA 5I9EB 3EE8A 3H3NO 1TKTA 1MU2A 3EYZA 4JHDA 2NRHA 3CF5L 3CERA 2CQUA 3C0BA 4BC5A 4B1YB 2ITGA 3U8XA 4B1WB 2WOMA 3MN7A 4EAHD 3AV9A 2LSNA 1QSYA 1KTQA 2EWSA 4PL8A 2O8CB 4C1NI 3K5OA 3EPYA 2OYQA 3EZ5A 5HRRA 1Q8IA 1J5EK 3QDKA 5KI6A 4YOYA 1IKYA 3NDKA 4M42A 2XRIA 4J2AA 2O8FB 2O8DB 4GMJB 1NNEA 1RBSA 2GELA 1RT1A 5C25A 3ZSZA 3HPOA 1JCFA 1TK0A 1Q82O 2EMTA 1LAWA 3CJCA 4JNEA 5AFUH 1HNWK 3GG4A 1VSDA 1TKDA 3MX2A 4CYEA 4BRLA 1RGIA 3VQ6A 3WNGA 3F5TA 4PKIA 3VQEA 4MDAA 2HVHA 4DU1A 2W40A 3TAGA 3TABA 3SJJA 3DLGA 1JKHA 4KREA 4FWPA 3TTDA 1NK4A 3H3OB 2HHVA 4BREA 3UKRB 4JI5K 1GLEG 2OANA 2Q31A 4FL9A 4FOIA 4K42A 2IS3A 1LAVA 4CW7B 4YFUA 3A2FA 3A0IX 4K8ZA 4QS7A 3NH2A 3MN6A 4YOUA 2HHHK 3VQ7A 4KH5A 3VQ9A 3F9MA 5MLCQ 2J0JA 3LDSA 1O1WA 3W0LA 3DAWA 3P38A 3R1XA 4HWIA 1XNQK 3OBYA 1J5OA 1BU6O 4TKNA 1WSEA 3H6EA 3LAKA 1WSFA 3HP6A 1HQEA 4ELVA 2HHQA 4E1NA 3P31A 4H0OA 3NFAA 3C95A 3H1QA 4CBWA 4RW4A 3O4QA 4K8XA 5C24A 4F9OA 1SZ2A 1DTTA 3QIOA 1VBGA 2JLEA 4JHDB 5AQYA 3U4LA 1LWEA 4LFAK 4CVNE 1KBLA 3D2FA 5EY4A 1X3NA 5AQXA 1NGHA 4Q0BA 4HTUA 4DHYA 1FJGK 5AQIA 2OPPA 5FLXO 3HPHA 4LFBK 5BRFA 2FF6A 4KBOA 4PKHA 3K5NA 1Q9YA 4CF1A 2OZSA 4CEDA 1FKPA 4XEIA 5FRMA 2QKKA 3VEYA 1YHQN 5E26A 3ZYYX 4IOXA 3O3HA 4PQUA 4KHPK 3V9WA 3HO1A 5FPMA 1K8KB 4G9ZA 2CGKA 2O8DA 1RBVA 4KTQA 2W42A 2EX3A 5LL6Z 1BQMA 3THVA 4FCYA 1CZ9A 1HKCA 4JI1K 1F21A 1RFQA 3CQXA 4IFVA 3BZCA 4BRAA 3SPYA 3T1YK 1S9GA 4CJ7A 2CGLA 2KQ2A 3DM2A 4W5OA 2ABDA 4IO9L 3IUCA 3S3NA 3FFIA 4CD3A 3A5LC 3BINA 4WQ5A 5CYMA 5AQPA 4OKJA 3CCJN 3BP8A 3M3ZA 2KKZA 5JMVA 4FWMA 3QESA 1SL0A 3G10A 4CHOA 1ASVA 3VN5A 1W2BM 1GC7A 1IH7A 1NGIA 1QQOA 2HBJA 5JVLA 2XY8A 2YNHA 4BRDA 4NY0A 4OPHA 4FXDA 1RDWX 2ASMA 3CI5A 2HHTA 4BWMA 4OLBA 4DTOA 3HJFA 3P4IA 3A5NC 3U9ZA 5KRSA 1I3AA 3NAEA 3PY8A 4BDZA 4BRPA 1DLOA 4WQ4C 3KLGA 3VEVA 3VPZA 4IEIA 5ADXH 3SCXA 4OVLA 4M3XA 1C1BA 4BE2A 2P9NA 5CE3A 2QTDA 1RT4A 4YY3K 4B9MA 2WUSA 2ZJQL 4YOXA 1RILA 1EO1A 1BGXT 4I9LA 1ST7A 2NUBA 4CJWA 2A1SA 2VQFK 1NGGA 1T6CA 2NRVA 5AQSA 5SZTA 1VQ9N 1ASWA 3SV3A 3L2QA 1QQMA 2P9KB 4ZRIA 1YVNA 3Q7BA 2VCPA 3KK2A 1OVQA 4KHSA 5HROA 5CR4A 3OS2A 3FR0A 3LP0A 3MK6A 4KRFA 1ZBFA 4CJQA 3ITHA 1D4XA 3X23A 3CCVN 4IO8A 4KO0A 4FWNA 1D5AA 2YNIA 2YI1A 4CJRA 4FJGA 4DMNA 2XY7A 1JDEA 4AHTA 4CJPA 2KHOA 4FLUA 1S1XA 3ZETB 1C0UA 2F8TA 3SLCA 4HUFA 4BDPA 2D0BA 3ATUA 4EZ6A 3ZEUB 4CEEA 1VSFA 3VF2A 4E7KA 1Q81O 4PY5A 3AU4A 3QBXA 5JVHL 2F7TA 3ZSYA 3I55N 3THWA 2W41A 4DCHA 1J9AA 4LFCK 2HW3A 4JK9A 3NF9A 3PV8A 3T69A 3WXJA 3OYAA 3DJCA 4JKEA 4YDUA 4C1NK 4XIUA 4DSIA 1ZBSA 3ENBA 4G1QA 2DFEA 5IWAK 3LP1A 4RW9A 3JYTA 3J7AP 1P90A 2XHBA 4L8RB 3VGMA 4ZHRA 2RQ1A 1WB9A 2YNGA 3F2KA 4B8CA 4F2RA 1UWBA 4E0DA 5CHIA 2E1ZA 4WCEL 4CJLA 3KJVA 1YITN 1RDBA 3O9UA 3QNNA 1MIXA 3D6RA 3UKUA 1EWQA 2P5GA 4Y1CA 3BZKA 3AO4A 4F2SA 4FLTA 4DFMA 1RTDA 3JAMO 5DK5A 3SUQA 4DSLA 4J2DA 4FJ8A 1VQ5N 3VQ8A 2P9LA 5BR8K 4MDBA 3ZSVA 1VQKN 3DOLA 3ZX0A 1JL1A 3OS0A 5C2DA 3SUPA 4H5NA 1ILYA 1TK5A 5TKWA 2X6NA 3NMUA 1DT9A 2OA8A 1SKRA 1W7AA 3AAQA 1GC6A 3JSMA 3D0PA 5HBMA 1BI4B 3PIPL 2VG6A 4DF8A 2O8EA 1E4GT 4ZRKA 4DR4K 3HSTB 3W3DA 3F9KA 4N5SA 4LF9K 3VEOA 1U48A 5J2NA 4DR7K 2ASOA 3MWPA 2ZGYA 1QVFM 2R82A 2E2NA 4DQPA 2OTJN 3SUOA 1S1TA 3OTOK 1QZ5A 4JI2K 3AVJA 3O1BA 4WQ5C 4DTMA 1B9FA 4H0XB 3WUHA 5EXWA 1J54A 1GGOA 1UOCA 1YF5L 1K8AO 2BANA 4FLZA 5C15A 3TAQA 1SKWA 3RRGA 1YTUA 1RDDA 1A5VA 4WFAL 3ULEB 4BC3A 2HNZA 5AQFA 3L3VA 3V9SA 1CZBA 3D2EA 3CFOA 1J19A 4YOWA 4FJLA 4FJXA 1LWFA 1ITGA 4I2PA 1IKVA 1Z25A 2Z1GA 4IBNA 2A40A 2ZWHA 2O8CA 4DTNA 4NCGA 5AR0A 5AJ3K 1KC8O 2WH5A 4BVPA 1QQNA 4FJMA 3K2PA 3M8SA 4AM7A 1NGDA 3KZBA 4J8FA 4B1UB 4LH5A 4DU3A 1VQPN 3V9XA 2PY5A 3G4SN 4W5NA 3O9TA 3VQAA 4CZFA 3RMBA 2NRTA 4JKFA 4BVOA 3VF6A 1VSEA 4MO4A 1FK9A 3NGIA 4BRCA 4CJ5A 1RCHA 1NWKA 4DQ8A 3KD5E 3J8AA 1RBUA 3NE6A 1FXXA 1NKBA 4H5VA 3ZX3A 2ZD1A 2D10A 4N47A 4EKUA 4PHTX 1KVAA 1S1UA 4B9VA 4Z4FA 1DEJA 1GLAG 4C8KA 3NVKA 4H5TA 2AP1A 3N4PA 5BRHA 4LF5K 4DXAB 1VBHA 1BCOA 5BREA 2RKIA 3HI0A 4CESA 3I0SA 3ATVA 3O4NA 5GADP 2UXDK 4JK8A 4CZLA 4WF9L 4YDUC 1YJNN 1KFDA 4YOTA 2D0OA 1RBTA 3VA3A 1HX1A 4DSFA 4J2EA 3NH0A 4DSEA 5IT9O 2NZTA 1XI1A 1NK6A 3LDNA 5M1QA 3OW2M 3ZSWA 1W0HA 4B1VA 4FWOA 4BGBA 1VRUA 4B08A 3OS1A 4CF8A 1BUPA 3ZT3A 2CH5A 1QZ6A 5JS2A 4Z4EA 1BWFO 3RTVA 3ZSXA 4CFAA 1T6DA 3GE1A 3KIOA 3LL3A 4E7HA 4BGAA 3SV4A 3O3FA 3DLKA 2Y1IA 4CJ3A 1YJWN 1BIUA 2Q97A 3BY5A 4XH5A 4B9NA 3LM9A 1RDAA 4AHVA 1V4SA 2NNWA 5CZ1A 4JS5A 5FPNA 4CK3A 2FBYA 2UU9K 5AQKA 3LP2A 1UA0A 3IDHA 4E7LA 3O9SA 2NRWA 3AVAA 3G0ZA 2GWKA 3MDQA 2WONA 1TVRA 2QA4N 2OTLN 3SBTA 5ELZA 4Z4GA 2A5XA 1NJIO 5M1NA 1N33K 1ACAA 4DR6K 4JRPA 2KZZA 4FJIA 3WT0A 3IG1A 3CXCM 4DLGA 3QO9A 3TTCA 4CFBA 4CEBA 5C42A 5K14A 1KAZA 4HDOA 1TV6A 2E2QA 1IJJA 2IGIA 4CIGA 5HOOA 5FROA 3WXMB 3SAFA 2VWKA 5JICA 5F1XA 4IKFA 4FJNA 4PWDA 4E7IA 1W97L 5JVGL 2PYLA 5LJVA 4IDHA 1HNZK 2BH1A 3P1GA 4HTLA 4I6MA 3K9KA 3CQ8A 2G8IA 3RVCA 4B3SK 3MCAB 2W6LA 3PUFA 3SQ2A 3C65A 3T3FA 3VF4A 3O5BA 2FBVA 2AL6A 4FWKA 3A8YA 3DXKB 5J2QA 3AO5A 3HL8A 4BY9C 1Q9XA 3TAFA 1IG9A 2IOCA 4DLEA 1D8YA 3TI0A 3HVRA 3R9PA 3HOTA 1QVGM 4O44A 1YIJN 2Z1IA 2P1JA 3IFRA 4KKOA 2KZMA 3FP5A 3KLEA 3THXB 2ZGZA 4HDQA 3CJ9A 3E9PA 4JKGA 3SJHA 5EVZA
chains in the Genus database with same CATH topology
5E84A 3CCJN 4JN4A 2WC9A 3BP8A 3M3ZA 2KKZA 4PKGA 2PFUA 3CCSN 4IFEA 5JMVA 4FWMA 2Q0UA 4H0VB 3HOSA 5EY4A 4CZMA 5AQHA 3PLAA 3DXKA 1XC3A 1TYQA 3HZ6A 2P9SA 2VGMA 1W2BM 4B1XB 1GC7A 1BDGA 1NGIA 1Q7YO 1QQOA 2HBJA 5JVLA 1KC7A 3H1VX 1Y64A 1GLBG 1DGKN 4BRDA 3VMFB 4NY0A 4OPHA 1RDWX 2ASMA 3CI5A 3ULEA 5JLFA 1TUUA 2E1YA 3LDLA 4UY8O 1KXPA 4JKCA 3A5NC 3FZFA 3P4IA 3U9ZA 5M1PA 1YUWA 3CETA 1V4TA 2HE7A 3AU5A 4ISGA 4JKHA 3OA9A 4BRPA 3RSEA 4FPBA 4WQ4C 5H1SQ 3M5RA 3VEVA 4IEIA 3VPZA 1DIKA 4BR0A 4CBXA 3H45C 5GAGP 5ADXH 1NGAA 3I56N 3ZEUA 2P9NA 3E9OA 1HB6A 5CE3A 4MO5A 5GIOA 4KH6A 5DM7L 1U2VB 3CCEN 5B8HA 2QTDA 3PVLA 3EZWA 3LDQA 2WUSA 2ZJQL 3O8MA 4YOXA 3CD6N 3CIPA 4NLCA 1EO1A 3JXUA 3HBTA 3Q7CA 1K9MO 1P8ZA 1ST7A 1LOTB 3PZDA 5AQUA 2FF3B 4KH4A 4IZ9A 5BRDA 4JKGB 4JD2A 1NGGA 4DKWA 3UB5A 1MK7B 1T6CA 5BR9A 2NRRA 2NRVA 1HKGA 5AQSA 1VQ9N 1NGFA 1QQMA 2P9KB 4MLEA 4ZRIA 1YVNA 3OBWA 1XQSC 3Q7BA 2VCPA 4M7YA 2QWLA 2WBNA 2KLAA 5CR4A 4AF1A 3FR0A 3RSEB 1BA0A 5C12A 3BEXA 3MK6A 2ASPA 1C0GA 2JWLA 3M1FA 3E1YA 3NVKA 1D4XA 2H3GX 3X23A 1O13A 4IEEA 3BUZB 3CPEA 2QWMA 4GY2B 4IO8A 4FWNA 3VEZA 4A59A 3CCVN 1VAZA 3CMEN 2YI1A 5AZJB 3QIJA 2V7YA 3UKRA 3R8EA 1G99A 5AQTA 1N8RO 4CI6A 2FXUA 1JDEA 2QM1A 3BF3A 2YHYA 3EL2A 3EKUA 3MX5A 1NTIA 2FJ9A 2KHOA 4LC9B 3VTHA 1H4RA 5DM6L 1NLVA 3ZETB 3EKSA 4BQLA 1JCEA 2D1KA 2VGNA 2PAVA 3DXMA 4BR5A 5F0XA 4ISFA 2V51B 3TSPA 1H1VA 3SLCA 2J0KA 1CZAN 1NM1A 3AGKA 4FOEA 4EFHA 3ATUA 3ZEUB 4JD2B 2QWPA 4FWRA 3EE9A 2ITMA 4GV9A 4K41A 4CZEA 1SGHA 4U67L 3FLCO 5EX5A 3VF2A 4BR2A 3HM8A 2QWOA 1Q81O 1VQON 3AU4A 2HF4A 3TPQA 3QBXA 4BQZA 5JVHL 4BROA 2YJEA 3LDPA 3VOVA 3H46O 2F7TA 1VQLN 3I55N 4GV3A 3L4IA 3VGKA 2Q1NA 2W41A 3DWLA 3B8AX 3M6GA 3UKUB 4DCHA 4YORA 5KPRA 4DB3A 4JK9A 1E5WA 1E4FT 5F2RA 3TTFA 3CCQN 1ZC6A 3T69A 3WXJA 3DJCA 4JKEA 4YDUA 3WXIA 4ZRJA 3ZDTA 1ZBSA 3WA0A 2QWNA 3I33A 4FWSA 4C1NK 3ENBA 4O8UA 2P9LB 2QW9A 2WFBA 1P90A 2J0MA 3ENOA 3VGMA 3G9WA 3O80A 1TUYA 2RQ1A 3F2KA 4H0YB 3EN9A 5KQDA 3LM2A 3VESA 2D4WA 5CHIA 2E1ZA 4WCEL 4GNIA 3PIOL 1YITN 3O9UA 5AQOA 4I6MB 1MIXA 3NVMA 2I7PA 3D6RA 3EO3A 2IVNA 3ENHA 3ID8A 3UKUA 3TSUA 1SQKA 5AQWA 1EF1A 3I8BA 4IWVA 3IKMA 2LBBA 2FLOA 3O4WA 4H0TB 4C23A 4RWTA 2JWKA 3VENA 1MWKA 1YXQA 4R79A 5AQJA 3QFUA 4WYBA 2IVOA 5AQGA 2QWRA 1MWMA 4EHUA 1VQ8N 4A62A 1VQ5N 2P9LA 2P9PB 4MDBA 3C6AA 2GEMA 5BPNA 1VQKN 1MIZB 2QWQA 3ZX0A 5C2DA 4H5NA 3JS6A 3VEXA 1ILYA 1OVYA 5TKWA 3NMUA 1GLCG 3KWIA 1DT9A 3CCLN 1HLUA 5KPZA 1ZXOA 4H03B 3AAQA 1GC6A 4AM6A 3SK3A 2EMSA 2GUPA 3PIPL 2E20A 2A3ZA 4RTFD 4JK7A 5AQNA 4BG9A 3A5MC 4BRNA 5AQRA 1E4GT 3L4QA 4ZRKA 1GLJO 5GINA 5AFUA 3W3DA 1NBWA 3P39A 3VEOA 5ADXA 2FSKA 3L6QA 2ASOA 1ATNA 2ZGYA 3MWPA 3D7EO 3E66A 4XH1A 2A42A 5BN8A 4WFBL 3FFKB 4EHTA 4GV6A 1VQ6N 2R82A 2I7NA 3FZKA 3QFPA 2E2NA 3C7NB 3CJ7A 3ZETA 2ZJPL 2OTJN 3G6EN 3GL1A 4FWQA 4YOVA 3D2EB 1OKJA 1QZ5A 1XUPO 2P9PA 4IJNA 4BR4A 3S41A 3O1BA 4WQ5C 1BOTO 4H5WA 4H0XB 4BRMA 1M90O 3KHYA 3WUHA 5EXWA 1K73O 4ILHA 2ZF5O 1TYQB 5BPLA 4ILGB 1KAYA 4BG8A 1YI2N 1GGOA 1WOQA 4FSVA 1YF5L 1K8AO 2P9IB 4CZIA 4NLBA 3FE1A 3CQYA 5C15A 4JAXA 3SMPA 3MN5A 1QVFM 1YAGA 4IOCL 4BRHA 1NGJA 3CC2N 4A5BA 3ULEB 4BC3A 5AZIB 4WFAL 3D2FB 3MWTA 1M1KO 3CJBA 2GTDA 1Z05A 5JLHA 5AQFA 3HRGA 5AQQA 3G25A 4F7GA 3WQTA 3FZMA 5KPTA 2P9UA 3D2EA 1J19A 4QS9A 1S22A 4YOWA 3E9LA 3O1WA 4GVEA 3WXLA 4O5FA 3TSQA 2HOEA 2E88A 1X3MA 1U2VA 2A40A 1ATSA 2ZWHA 2D0PA 3KVGA 2AEHA 1NMDA 2Q36A 2A41A 1X9JA 5AR0A 4U7BA 5C2FA 4E1JA 2ZJRL 2WH5A 1GLLO 4Y0WA 1KC8O 2HBKA 5EOYA 4BR7A 4BVPA 1QQNA 3FZHA 4M7XA 1KAXA 2QI2A 4AM7A 2P9IA 3QICA 1EQYA 4O8KA 3WXKA 4JKDA 4IOAL 2E2OA 3MN9A 1NGDA 2HSTA 3KZBA 1BO5O 4J8FA 4B1UB 3CMAN 2P9KA 2YX6A 1VQPN 1QHAA 3G4SN 5C10A 4P7IA 3SAHA 3TU5A 3O9TA 3WEEA 4CZFA 2E2PA 4K25A 4QS8A 1S3XA 3U9DA 4BRKA 1U6ZA 2NRTA 5M1OA 3DXMB 3AARA 4JKFA 3SBGA 1SS6A 4BVOA 3VF6A 5I9EB 1R59O 3AAPA 3EE8A 3KK7A 3H3NO 4MO4A 2CGJA 4IXCA 2FSNA 4JHDA 2NRHA 3CF5L 3CERA 4BRCA 4MLHA 4BRIA 2CQUA 3C0BA 4A5AA 3UE5A 1NWKA 2YVCA 4DQ8A 3U7DA 4ISEA 3O6WA 4BC5A 4B1YB 1HKBA 3U8XA 5TKYA 4B1WB 4A2BA 4BR9A 3IMXA 3MN7A 5BN9A 4PL7A 4EAHD 2COPA 3J8AA 3HSCA 3FZLA 4H5VA 3ZX3A 2FDQA 1NGBA 4BC2A 2D10A 1MA9B 3VETA 1ESVA 2EWSA 4PL8A 4PHTX 4C1NI 4CZJA 3WQUA 2BUPA 5C0YA 1DEJA 1GLAG 1HUXA 3EPYA 2HF3A 3GDQA 2AP1A 3N4PA 4H5TA 4A57A 5BRHA 3U8ZA 4GXBA 4JEPA 4DXAB 1VBHA 2J4RA 2V52B 5BREA 3O9QA 3QDKA 4FWLA 4YOYA 2QXLA 4CZKA 3HI0A 2D11A 1NGEA 1HPMA 4CBUA 2DIKA 2A6AA 1MK9B 1C0FA 1SAZA 3ATVA 4B9QA 5GAHP 1K8KA 4CD1A 2RHKA 3VGLA 1BG3A 4A61A 2NRXA 5GADP 3CJ1A 2GELA 4K43A 3VTIA 3T7ZA 5BPMA 1JCGA 4JK8A 1JCFA 4CZLA 4WF9L 2EMTA 4YDUC 3GBTA 3CPWM 1YJNN 4YOTA 2D0OA 3CJCA 2IVPA 4JNEA 5AFUH 1HX1A 3GG4A 2BTFA 2NZTA 3LDNA 3MX2A 3CC4N 5M1QA 4CYEA 4BRLA 1RGIA 3OW2M 4ILJA 5AQPA 3F5TA 4PKIA 2RE2A 4B1VA 4MDAA 1HBKA 3K9JA 4FWOA 4BGBA 2PBDA 2W40A 4BRGA 1NGCA 1GG3A 5AQLA 1Y19B 1BUPA 1T44A 4FWPA 1MDUB 2CH5A 3A5OC 3LDOA 1QZ6A 1YJ9N 3AGRA 5LJWA 1T3VA 4WQ4A 4WFNL 3R3LA 1BWFO 3GOIA 2I1KA 3TTDA 1LCUA 3H3OB 2ZPYA 4BC4A 3CC7N 5AZJA 1VQ7N 1RDUA 1T6DA 1KD1O 3GE1A 1IG8A 3LL3A 5AZIA 4BGAA 2F9TA 3UKRB 4BREA 4BRQA 1J6ZA 5EVZA 3DLLL 3CCUN 4XH4A 2OANA 1GLEG 2Q31A 4FL9A 4FOIA 4K42A 1YJWN 2AA4A 1VQ4N 2Q97A 4XH5A 3HTVA 3A0IX 4QS7A 3LM9A 3MN6A 1NI2A 4NO7A 4OPAA 1V4SA 2NNWA 4YOUA 4BRFA 4M63C 2Q2RA 4KH5A 4B1ZA 2I1JA 2GWJA 3QB0A 2VYPA 3F9MA 2DPNA 5MLCQ 2J0JA 2IIRA 2NRZA 4FPAA 3W0LA 5AQMA 3DAWA 5FPNA 3P38A 3WEEB 5GIPA 2HBMA 3R1XA 3C7NA 5LY3A 4HWIA 5AQKA 3OBYA 3FGUA 1BU6O 4TKNA 1KQSM 3IDHA 4CZHA 1S72N 3H6EA 3O9SA 2NRWA 2NLXA 3ID6A 1HB8A 3CCMN 2GWKA 4JKBA 3MDQA 3MCPA 3P31A 4FO0A 4H0OA 2QA4N 2OTLN 3CCRN 3SBTA 3H1QA 2GX9A 5ELZA 4CBWA 4A2AA 5GAEP 2A5XA 1NJIO 5M1NA 3SMSA 1ACAA 3ZX2A 1NVLA 4F9OA 1SZ2A 4IJAA 4YL8A 5FPEA 1Q82O 3SAGA 3WT0A 4OO1J 1VBGA 4CZGA 3CXCM 4JHDB 5AQYA 3C6HA 3U4LA 3VERA 5M1FA 1KBLA 4H0PA 3TTCA 3D2FA 1X3NA 2E8AA 1KAZA 1NGHA 2E2QA 4HDOA 3MMVA 1IJJA 3R6MA 4L3QA 5AQXA 5HOOA 2X0SA 1VQMN 3WXMB 4DHYA 5AQIA 2D2QA 1HJOA 2P9UB 3CHWA 3SAFA 2Q0RA 3G71N 1DKGD 5F1XA 5BRFA 5JICA 2FF6A 4KBOA 4PKHA 1W97L 2YHWA 2CH6A 2YJFA 1JJ2M 4JKAA 2FSJA 4RCHA 5AQZA 5JVGL 5LJVA 4IDHA 2UYTA 1ISNA 2BH1A 4HTLA 1VQNN 4XEIA 1Z6RA 4I6MA 3K9KA 4H5RA 3VEYA 1YHQN 3RVCA 3O08A 3BF1A 3O9RA 2HBLA 3MCAB 5E26A 4EIAA 3ZYYX 4NB4A 3C65A 4IOXA 1Q18A 5KQ8A 5FPMA 1BA1A 3AY9A 3O5BA 3VF4A 2AL6A 4FWKA 1K8KB 2YCHA 2CB8A 2CGKA 3A8YA 3QBWA 4G9ZA 1GLDG 3DXKB 2HMPA 4BY9C 5HL7L 2P9SB 3OHRA 1WUAA 1HKCA 3QMLA 5M1KA 1Q86O 1RFQA 3CQXA 2P9NB 3FLVA 2VWBA 4BRAA 2QEXN 5IJMA 2HRJA 3R9PA 5FPDA 3HOTA 1QVGM 1YIJN 5AQVA 3N4QA 4FVUA 4CJ7A 3IFRA 3IVFA 4Z94A 1GLFO 2CGLA 2F9WA 3L0QA 2YHXA 3FP5A 1ATRA 2ABDA 4IO9L 3IUCA 4CD3A 3J7ZO 3A5LC 3BINA 2ZGZA 4HDQA 3CJ9A 4WQ5A 3VEWA 3CJAA 2V7ZA 3E9PA 4JKGA 3KWGA 3SJHA 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  4JK7 A;  4JKF A;  3ENB A;  3SBG A;  4ILG B;  4ILJ A;  3SBT A;  3E9O A;  4JKA A;  3E66 A;  4JKD A;  4JKG B;  4JK9 A;  4JKC A;  4JK8 A;  3E9L A;  3E9P A;  4JKG A;  4JKE A;  4JKH A;  4ILH A; 
#chains in the Genus database with same CATH topology
 4JN4 A;  1LW2 A;  5CZ2 A;  4AH9 A;  2XO7 A;  4O0I A;  1REV A;  1YTA A;  3QIP A;  1TYQ A;  2VGM A;  3DRR A;  4X62 K;  3TAE A;  3RR7 A;  4CCH A;  1BDG A;  2VWJ A;  1Y64 A;  3PX6 A;  1YT3 A;  1DGK N;  5JLF A;  1TUU A;  4HUE A;  5M1P A;  3OYI A;  1V4T A;  3AU5 A;  4ISG A;  1ZBU A;  3OA9 A;  2I5J A;  3V1Q A;  1J53 A;  1NGA A;  3ZEU A;  4MO5 A;  1IV0 A;  4KH6 A;  4IG3 A;  4ICL A;  1NJY A;  3EZW A;  3HPG A;  3O8M A;  3CD6 N;  1XMQ K;  3CIP A;  2VG5 A;  3K0S A;  4YNQ A;  4IZ9 A;  4DKW A;  3LPT A;  2RN2 A;  4M3Y A;  4MLE A;  3M8P A;  1XQS C;  4BE1 A;  2QWL A;  3NHG A;  4AF1 A;  4B3M K;  2ASP A;  4M3U A;  1I94 K;  2H3G X;  3CCQ N;  4IEE A;  1VQM N;  3BUZ B;  4GY2 B;  4A59 A;  1YVU A;  3DLR A;  5AQT A;  2GV9 A;  4CI6 A;  3RR8 A;  3MEC A;  3TAN A;  3EKU A;  3T1H K;  4FLY A;  1SV5 A;  5DM6 L;  1NLV A;  4AHC A;  4BR5 A;  5F0X A;  1JLF A;  4ISF A;  4LF6 K;  1H1V A;  4FOE A;  4M41 A;  1BQN A;  4EFH A;  1XWL A;  4J2B A;  4FWR A;  4NXN K;  3PX4 A;  4GV9 A;  4CZE A;  1SGH A;  4U67 L;  5EX5 A;  3ZSQ A;  5HP1 A;  1HNI A;  4DV7 K;  3NGZ A;  3HM8 A;  2QWO A;  1VQO N;  3TPQ A;  2YJE A;  3LDP A;  2YKN A;  1VQL N;  3L4I A;  3K5M A;  2Q1N A;  3B8A X;  3MEG A;  3P83 D;  1QSS A;  3V1R A;  1WSG A;  3AVH A;  1SKS A;  3RRH A;  4M45 A;  2QWN A;  3WA0 A;  4O8U A;  1WBD A;  3NBP A;  4DG1 A;  2F96 A;  3ENO A;  1KVC A;  1S1V A;  3OYG A;  4W5R A;  3QEX A;  5KQD A;  3THY B;  4EP4 A;  3BGR A;  5LMN K;  4HVJ A;  4CFD A;  4ZTJ A;  5HLF A;  5LMU K;  4I6M B;  4YHH K;  2I7P A;  3DLH A;  1VSH A;  3EO3 A;  4NYF A;  1W9H A;  2D0A A;  3I8B A;  4DV1 K;  1EXQ A;  1RT7 A;  3DMJ A;  4C23 A;  4H0T B;  1JXB A;  2GUI A;  2JWK A;  1MWK A;  3NF7 A;  4I2Q A;  1YXQ A;  1SL1 A;  1N36 K;  3L2W A;  4CGH A;  4W5Q A;  5CY4 A;  5AQG A;  4EHU A;  4DFJ A;  4BAC A;  3DRP A;  4CGI A;  1C0M A;  2QWQ A;  1L3T A;  4N41 A;  3JS6 A;  1KFS A;  1GLC G;  2E5L K;  3ASM A;  1ZXO A;  4AM6 A;  3VQB A;  1CXQ A;  3SK3 A;  2ZM6 K;  4DUY K;  1WNS A;  2GUP A;  1D9F A;  2A3Z A;  4F8R A;  3LZJ A;  3L4Q A;  1NBW A;  3P39 A;  4CEZ A;  3L6Q A;  2Z1J A;  1IBL K;  2O8F A;  2I7N A;  1BL3 A;  2B5J A;  2ZJP L;  1T7P A;  3ZT0 A;  2HVI A;  3NCI A;  4CEO A;  1OKJ A;  1XUP O;  1JL2 A;  3I0R A;  4H5W A;  3VQP A;  4CHQ A;  4KPY A;  1BIS A;  4CF0 A;  3NGY A;  3NH1 A;  5KGX A;  1KAY A;  3ISN C;  4BG8 A;  1WOQ A;  2P9I B;  2XY6 A;  4MQ3 A;  4Z4H A;  2Z1H A;  1LV5 A;  4IOC L;  4AHU A;  4CHY A;  3U3G A;  1NGJ A;  2HB5 A;  1C6V A;  4Z4I A;  4B9T A;  1M1K O;  1TL3 A;  5JLH A;  2JGU A;  1BCM A;  3WQT A;  3FZM A;  1IBM K;  1S6P A;  2P9U A;  4CGG A;  3HYF A;  1QE1 A;  3KK1 A;  1E3M A;  4GVE A;  3WXL A;  2O8E B;  1U2V A;  3CG7 A;  3KVG A;  1ATS A;  3AO2 A;  5CYQ A;  2A41 A;  4E1J A;  2ZJR L;  2KW4 A;  5I42 A;  4V19 S;  4CJU A;  3KLH A;  3HT3 A;  2HNY A;  3QIC A;  4CJF A;  1TKX A;  1QSL A;  4IOA L;  2E2O A;  3MN9 A;  4CJ4 A;  3V4I A;  3DOK A;  2OPS A;  2KTQ A;  5C10 A;  4KI6 A;  4JI6 K;  1LW0 A;  1X1P A;  3OYK A;  5E41 A;  4K25 A;  2ZE2 A;  1U6Z A;  2YNF A;  3TAM A;  4CEQ A;  3AAR A;  1SS6 A;  5EU7 A;  1R59 O;  3KK7 A;  4KFB A;  2CGJ A;  3QEP A;  2FSN A;  3OJS A;  3LP3 A;  2GBZ A;  4MLH A;  3UE5 A;  3AVB A;  4CHN A;  3U7D A;  3AVC A;  3AA2 A;  1HKB A;  3KTQ A;  3ALY A;  1OH8 A;  5BN9 A;  2COP A;  4GVM A;  3OYL A;  1NGB A;  4BC2 A;  1MA9 B;  1ESV A;  1HJR A;  4JI8 K;  3WQU A;  1WAF A;  5A2Q O;  5C0Y A;  1HUX A;  3GDQ A;  2HF3 A;  2OCE A;  1NK9 A;  1C0T A;  4X65 K;  3U8Z A;  1HQU A;  4CIE A;  4EZ9 A;  2J4R A;  3S9H A;  1RT2 A;  2V52 B;  2X6S A;  2UUC K;  4CZK A;  1NGE A;  4CBU A;  3PO4 A;  2A6A A;  1MK9 B;  1C0F A;  5GAH P;  2IAJ A;  1K8K A;  3ZT1 A;  4CD1 A;  2NRX A;  3VTI A;  3LAL A;  5BPM A;  1A5X A;  4FJ5 A;  1JCG A;  4O5B A;  3CPW M;  3GBT A;  2IVP A;  2BTF A;  4N76 A;  3CC4 N;  1FW6 A;  4ILJ A;  1LWC A;  2RE2 A;  3ULD A;  2PBD A;  2BDP A;  2DY4 A;  1NGC A;  2FBT A;  1T44 A;  1KLM A;  1X9S A;  2E4L A;  1RT3 A;  1YJ9 N;  5LJW A;  3KKR A;  4LSN A;  4WQ4 A;  4WFN L;  3V81 A;  3R3L A;  4M3W A;  1EWR A;  4BC4 A;  3CC7 N;  2G8H A;  1VQ7 N;  1KD1 O;  5AZI A;  2F9T A;  4BRQ A;  3CCU N;  4XH4 A;  2BE2 A;  3OYH A;  5T7B A;  1VQ4 N;  4O0J A;  3HTV A;  1N34 K;  3K57 A;  4DFK A;  4BRF A;  4LH4 A;  2Q2R A;  4K0K K;  3QB0 A;  1HMV A;  5JS1 A;  4FPA A;  5FDL A;  5GIP A;  1GOC A;  5D3G A;  3C7N A;  3FGU A;  1KQS M;  2RPI A;  1S72 N;  2OZM A;  1XNR K;  3S3M A;  4DTU A;  4H4O A;  1NKE A;  4OKK A;  4FO0 A;  3AVI A;  2GX9 A;  3RMA A;  1RTJ A;  3ZX2 A;  1NVL A;  4DTJ A;  1WSJ A;  4C8O A;  4CZG A;  3VER A;  5M1F A;  1ZBL A;  3MMV A;  2E8A A;  1VQ8 N;  2X0S A;  4DQR A;  4CF2 A;  2P9U B;  3QEV A;  2OPR A;  4CE9 A;  1OH5 A;  3AVG A;  3M8Q A;  2YHW A;  2CH6 A;  2FSJ A;  2UYT A;  1ISN A;  3HXM A;  4DTX A;  1VQN N;  1JLE A;  4F3O A;  3O08 A;  4FJJ A;  2HBL A;  4AHS A;  1N6Q A;  4NB4 A;  3KD1 E;  1KRP A;  1NOZ A;  3AY9 A;  4OPK A;  2YCH A;  2CB8 A;  3QBW A;  1GLD G;  3IRX A;  4DS5 A;  4JV5 K;  3TR8 A;  2UUB K;  5HL7 L;  4QAG A;  4B3O A;  5HRP A;  3IAY A;  3AVM A;  5M1K A;  2VWB A;  2AJQ A;  5IJM A;  1L3U A;  5FPD A;  4DQS A;  3N4Q A;  1T8E A;  1TGO A;  3IVF A;  1GLF O;  3C6U A;  3PSF A;  5FRN A;  4DV3 K;  3J7Z O;  3VEW A;  4E19 A;  2V7Z A;  3KWG A;  4XH1 A;  2UXB K;  2WC9 A;  4PKG A;  2PFU A;  3CCS N;  1Y97 A;  2Q0U A;  3KK3 A;  4CZM A;  1XC3 A;  1JLG A;  3HZ6 A;  4KAZ A;  2P9S A;  1IBK K;  4FW2 A;  4B1X B;  3QEI A;  3EEQ A;  4TSX A;  1Q7Y O;  1BHL A;  3H1V X;  1GLB G;  1RTH A;  4W5T A;  3CFP A;  2E6L A;  1U4B A;  4HUG A;  3LDL A;  2G8W A;  4Y1D A;  4JKC A;  3FZF A;  1WSH A;  4NXM K;  1XHX A;  3THX A;  3V9Z A;  2XY5 A;  3KKS A;  5H1S Q;  3M5R A;  4CBX A;  1DIK A;  3I56 N;  3H45 C;  4ID1 A;  2BGG A;  5GIO A;  3QEW A;  4NCA A;  1U2V B;  3HK2 A;  5B8H A;  1HR0 K;  3PVL A;  4NLC A;  3JXU A;  1VRT A;  3Q7C A;  3KLF A;  3PZD A;  2P51 A;  1WN7 A;  2FF3 B;  4KH4 A;  5BRD A;  1NJX A;  4JKG B;  1L3V A;  4Z4C A;  1MK7 B;  3AVL A;  1JLA A;  1HKG A;  1NGF A;  3E01 A;  4LD0 A;  3OBW A;  1OH6 A;  4CJT A;  4OX9 K;  2WBN A;  2KLA A;  3HM9 A;  1TAQ A;  4DF4 A;  3C94 A;  3RSE B;  3BEX A;  1C0G A;  2QXF A;  3CFR A;  3M1F A;  3E1Y A;  3THW B;  1O13 A;  5BN8 A;  4EP5 A;  1VAZ A;  1NJZ A;  4I7F A;  5AZJ B;  3QIJ A;  2V7Y A;  3LPU A;  3R8E A;  1G99 A;  4DTP A;  1R0A A;  4M3Z A;  3MX5 A;  3OYF A;  4LC9 B;  3VTH A;  1H4R A;  4FVM A;  3EKS A;  4BQL A;  3OYE A;  1JCE A;  2VGN A;  4DV0 K;  2PAV A;  3DXM A;  3K5L A;  3TSP A;  2DFH A;  2J0K A;  1CZA N;  2G8U A;  3AGK A;  1VHX A;  1HRH A;  2RF2 A;  2ITM A;  3NF6 A;  4B9U A;  1HNV A;  2F8S A;  4DQI A;  4FJ7 A;  3FLC O;  3ZLJ A;  1G15 A;  3DRS A;  4CEF A;  1Z26 A;  4BWJ A;  3H46 O;  3TAR A;  4FLW A;  5KPR A;  3L2U A;  4HCC A;  4CHZ A;  1E4F T;  4UQG A;  5J2M A;  5F2R A;  3TTF A;  1JXE A;  1ZC6 A;  4OJR A;  3WXI A;  4ZRJ A;  3ZDT A;  3I33 A;  4FWS A;  2P9L B;  1C1C A;  2WFB A;  2J0M A;  4DR1 K;  1TUY A;  1L5U A;  3VQQ A;  3EN9 A;  4CF9 A;  1NK5 A;  3LM2 A;  2D4W A;  3WNE A;  2HHW A;  3MXJ A;  4CJV A;  3L2R A;  5AQO A;  1CLQ A;  4DWI A;  4CJK A;  2YV0 X;  4F4K A;  3TSU A;  1SQK A;  4IWV A;  4WE1 A;  2O8B B;  2LBB A;  4DTR A;  3OYD A;  4RWT A;  4FYD A;  3MEE A;  3OVN A;  1NMN A;  1VK0 A;  4WYB A;  4CJE A;  2IVO A;  2QWR A;  1MWM A;  4A62 A;  2R7Y A;  2P9P B;  3C6A A;  2GEM A;  5BPN A;  3QER A;  3MXM A;  3DLB A;  4CJS A;  1OVY A;  3KWI A;  3CCL N;  1TL1 A;  1HLU A;  2W6K A;  5KRT A;  1N32 K;  3KLI A;  3RMD A;  5KPZ A;  4H03 B;  4M3T A;  2F4V K;  2EMS A;  4RTF D;  4BG9 A;  3A5M C;  4BRN A;  5GIN A;  5ADX A;  2FSK A;  3SI6 A;  4GV6 A;  3D7E O;  3E66 A;  1RDC A;  4WFB L;  1K6Y A;  3FZK A;  5HRS A;  5KGW A;  3PX0 A;  1BIZ A;  3GL1 A;  4YOV A;  1TK8 A;  2P9P A;  4BR4 A;  3HP9 A;  3S41 A;  1U47 A;  1BOT O;  2DTU A;  1C1A A;  4BRM A;  1M90 O;  4FZX C;  3KHY A;  4ILH A;  2D5R A;  2ZF5 O;  1TYQ B;  4KHN A;  5BPL A;  1KLN A;  3B6O A;  1YI2 N;  1A5W A;  4FSV A;  4CZI A;  4CFC A;  4NLB A;  3FE1 A;  3CQY A;  4FLV A;  1QQC A;  3QLH A;  4BRH A;  1EET A;  1ZYQ A;  5J1E A;  2GTD A;  3HRG A;  5AQQ A;  1WSI A;  3G25 A;  2KFZ A;  4F7G A;  3O1W A;  1NK7 A;  4O5F A;  2HOE A;  3TAP A;  1X3M A;  4CGJ A;  4N56 A;  2D0P A;  4FK2 A;  3AVF A;  4U7B A;  1GLL O;  4BR7 A;  1T05 A;  4DV2 K;  1KAX A;  1QHT A;  4AQY K;  4GKJ K;  3WXK A;  3AA5 X;  4JKD A;  1KCF A;  3T19 A;  3L3U A;  4C8M A;  3CMA N;  4KTW A;  4KTZ A;  1IKW A;  3SAH A;  1EKE A;  4FM2 A;  2E2P A;  3U9D A;  4BRK A;  1S3X A;  4AHR A;  3MED A;  5M1O A;  4E1M A;  3DXM B;  1VSK A;  3SBG A;  4H4M A;  4ELU A;  3AAP A;  4IXC A;  1JLC A;  4BRI A;  3IS9 A;  4A5A A;  5KTQ A;  2YVC A;  3J80 O;  3MXI A;  4ISE A;  3O6W A;  1VSJ A;  5TKY A;  4A2B A;  4BR9 A;  3IMX A;  4PL7 A;  3SQ4 A;  3HSC A;  4LF7 K;  1GOA A;  3FZL A;  2FDQ A;  4CGF A;  3VET A;  1U04 A;  2O4I A;  4RW8 A;  4CZJ A;  2BUP A;  4FK4 A;  4A57 A;  4GXB A;  4JEP A;  4KHW A;  1QS4 A;  3OYB A;  4LF8 K;  2DFF A;  3O9Q A;  4FWL A;  2A1R A;  2QXL A;  2D11 A;  1HPM A;  4DSJ A;  2DIK A;  1SAZ A;  4B9Q A;  4FJK A;  2RHK A;  3VGL A;  1BG3 A;  4CK2 A;  3ZT4 A;  4A61 A;  3RWU A;  3CJ1 A;  4K43 A;  3T7Z A;  4NCB A;  2VQE K;  4JI7 K;  4DV6 K;  4DU4 A;  4KB0 A;  4KHU A;  3THY A;  1N5Y A;  3S3O A;  4OLA A;  1HBK A;  1S6Q A;  3K9J A;  4PUO A;  4Q5V A;  3BDP A;  3AVK A;  4BRG A;  1B9D A;  1GG3 A;  5AQL A;  1Y19 B;  1MDU B;  3A5O C;  3LDO A;  3AGR A;  1T3V A;  4DSK A;  3GOI A;  2I1K A;  1LCU A;  2ZPY A;  4FZY A;  4GKK K;  4JI0 K;  5AZJ A;  4DQQ A;  1X9M A;  1RDU A;  1IG8 A;  1J6Z A;  3DLL L;  1NG9 A;  4PA1 A;  3SQ0 A;  4DUZ K;  2AA4 A;  2ZQB A;  3M8R A;  3DYA A;  4NO7 A;  1NI2 A;  4OPA A;  1CXU A;  4DS4 A;  1WBB A;  5J2P A;  4M63 C;  3ZCM A;  4B1Z A;  2I1J A;  2GWJ A;  1NKC A;  4JS4 A;  2VYP A;  4M3R A;  2DPN A;  3SZ2 A;  4LSL A;  2IIR A;  2NRZ A;  3MAQ A;  5AQM A;  3WEE B;  1VSL A;  2HBM A;  5LY3 A;  3CM5 A;  2FBX A;  2HND A;  4ZTF A;  4CZH A;  3ID6 A;  2NLX A;  4DR3 K;  1HB8 A;  2G8V A;  3CCM N;  1NOY A;  4JKB A;  3SPZ A;  1ASU A;  3MCP A;  2D0C A;  4KI4 A;  3OYJ A;  3CCR N;  4DR2 K;  4A2A A;  5GAE P;  3SMS A;  2WTU A;  4E3S A;  2UUA K;  4IJA A;  4FM0 A;  4YL8 A;  5FPE A;  2X74 A;  3SAG A;  4OO1 J;  1NK0 A;  1NK8 A;  1QTM A;  3C6H A;  4H0P A;  3J7Y P;  3LAN A;  3R6M A;  1TKZ A;  4L3Q A;  2HMI A;  3WNF A;  2D2Q A;  2FC0 A;  1HJO A;  1HYZ A;  3CHW A;  3EY1 A;  2YKM A;  2IDO A;  2Q0R A;  4IG0 A;  3G71 N;  1DKG D;  3OYM A;  3QNO A;  5DMR A;  2O8B A;  3DI6 A;  2EHG A;  3L8B A;  2YJF A;  3SNN A;  1JJ2 M;  4JKA A;  4RCH A;  1EP4 A;  5AQZ A;  3RMC A;  3OY9 A;  1X9W A;  4BE0 A;  1Z6R A;  2HHX A;  4H5R A;  4RG8 A;  3O9R A;  3BF1 A;  4EIA A;  1U49 A;  4C8N A;  3WNH A;  3C6T A;  1Q18 A;  3VQ4 A;  5KQ8 A;  1BA1 A;  4OKE A;  2HMP A;  4RW6 A;  5HRN A;  2P9S B;  3OHR A;  3P5J A;  1WUA A;  3QML A;  1Q86 O;  4X64 K;  3VQC A;  1HNX K;  3F73 A;  3AA4 A;  2P9N B;  3FLV A;  2QEX N;  2HRJ A;  4FVU A;  5AQV A;  4Z94 A;  2F9W A;  3L0Q A;  2YHX A;  1ATR A;  4B8A B;  4OGE A;  4NYN A;  3K59 A;  3O3G A;  3CJA A;  1D9D A;  5E84 A;  4O55 A;  4GW6 A;  3OYN A;  4IFE A;  4H0V B;  3HOS A;  3PLA A;  2ETJ A;  5AQH A;  2G8F A;  3DXK A;  4FK0 A;  1IO2 A;  4FW1 A;  4ELT A;  4CHP A;  4CEA A;  1KC7 A;  4O4G A;  1WAJ A;  4X66 K;  3VMF B;  1NU0 A;  3ULE A;  4DFP A;  1B92 A;  2E1Y A;  4UY8 O;  1KXP A;  1WLJ A;  1YUW A;  3CET A;  2HE7 A;  4JKH A;  3CM6 A;  3RSE A;  4FPB A;  1HPZ A;  4FJH A;  4E89 A;  4JLH A;  4BR0 A;  5GAG P;  2E6M A;  3E9O A;  1HB6 A;  5DM7 L;  1OH7 A;  3CCE N;  3LDQ A;  3LWM A;  1NJW A;  1DTQ A;  2Y1J A;  3HBT A;  1K9M O;  1P8Z A;  1LOT B;  5AQU A;  2VG7 A;  4JD2 A;  4KV8 A;  3UB5 A;  4IDK A;  5BR9 A;  2NRR A;  4OPJ A;  3ZSO A;  2HHS A;  1HYS A;  3UIQ A;  4M7Y A;  1FKO A;  5C12 A;  1BA0 A;  1KSP A;  1BI4 A;  2JWL A;  2OPQ A;  3J81 O;  3T1A A;  4CEC A;  4B3T K;  1JLB A;  2G8K A;  3VEZ A;  3CPE A;  2QWM A;  3CME N;  4QOZ B;  3V9U A;  1RTI A;  3QET A;  3UKR A;  1N8R O;  3LAM A;  3U3Y A;  2FXU A;  2QM1 A;  3BF3 A;  2YHY A;  3EL2 A;  3SQ1 A;  4QCL A;  1NTI A;  2FJ9 A;  4LY7 A;  2X78 A;  2D1K A;  3D45 A;  3DLE A;  2V51 B;  1NM1 A;  4LF4 K;  4JD2 B;  2QWP A;  4JRQ A;  3EE9 A;  4H8K A;  1SL2 A;  4MFB A;  4K41 A;  1T03 A;  4OGC A;  1XHZ A;  4BR2 A;  1S5J A;  4E7J A;  2HF4 A;  4BQZ A;  4Z0U A;  4BRO A;  3VOV A;  4I9Q A;  1EX4 A;  4GV3 A;  2ATQ A;  3VGK A;  3M6G A;  3DWL A;  3UKU B;  3VQD A;  2QKB A;  4YOR A;  3SUN A;  4DB3 A;  1E5W A;  4FLX A;  3VA0 A;  1UA1 A;  1RBR A;  1L3S A;  2KFN A;  2YHB A;  4C8L A;  1VSI A;  3I8D A;  4BDY A;  2QW9 A;  1S9E A;  2QK9 A;  3G9W A;  1IKX A;  3SYZ A;  3O80 A;  2UXC K;  4H0Y B;  3PSI A;  1ZBH A;  3VES A;  3AO3 A;  1S1W A;  3H08 A;  4GNI A;  3PIO L;  1RT5 A;  5SWM A;  3L2V A;  3NVM A;  2IVN A;  3ENH A;  3ID8 A;  4AIL C;  1RT6 A;  5AQW A;  4DV4 K;  1EF1 A;  3IKM A;  1TAU A;  2FLO A;  3O4W A;  3VEN A;  4FM1 A;  4R79 A;  5AQJ A;  3QFU A;  1U45 A;  3OYC A;  4B9S A;  3QIN A;  4KHQ A;  4ID5 A;  4DV5 K;  1MIZ B;  2PYJ A;  4HCB A;  5I3U A;  3VEX A;  3OJU A;  3TWH A;  4DR5 K;  4DTS A;  2PZS A;  1XC9 A;  1VSM A;  2E20 A;  5AQN A;  4JK7 A;  2YHA A;  2O4G A;  3VQ5 A;  2Q3S A;  5AQR A;  1GLJ O;  5AFU A;  3V6D A;  3HVT A;  1ATN A;  3B6P A;  2A42 A;  3FFK B;  4EHT A;  1VQ6 N;  3QFP A;  3C7N B;  3CJ7 A;  3ZET A;  3AVN A;  4FZZ A;  3G6E N;  4B3R K;  4FWQ A;  3D2E B;  4CK1 A;  1HYV A;  4IJN A;  4CGD A;  4R5P A;  1ZBI A;  4RW7 A;  1K73 O;  4ILG B;  1RNH A;  4CER A;  4HHT A;  1JLQ A;  4JAX A;  3SMP A;  3MN5 A;  2B4J A;  1YAG A;  3AO1 A;  4F3T A;  2P5O A;  3CC2 N;  4A5B A;  5AZI B;  3ZT2 A;  3D2F B;  3MWT A;  3CJB A;  1Z05 A;  3U6F A;  5KPT A;  4KB1 A;  4FJ9 A;  4QS9 A;  4JI3 K;  1S22 A;  3E9L A;  2IC3 A;  3TSQ A;  3LWL A;  2E88 A;  3AA3 A;  1XMO K;  2AEH A;  4CIF A;  1NMD A;  4IFY A;  2Q36 A;  4B9L A;  1X9J A;  5C2F A;  4Y0W A;  2HBK A;  5EOY A;  3K58 A;  3FZH A;  4M7X A;  1KVB A;  2B6A A;  2QI2 A;  2P9I A;  4O8K A;  1EQY A;  4JI4 K;  3LZI A;  1I39 A;  3ZSR A;  1SUQ A;  2HST A;  1BO5 O;  2P9K A;  2YX6 A;  4KHY A;  1QHA A;  4JYA K;  4P7I A;  3PO5 A;  2HHU A;  3NF8 A;  3TU5 A;  3WEE A;  1UAX A;  4QS8 A;  1GOB A;  3CYM A;  3V1O A;  5I9E B;  3EE8 A;  3H3N O;  1TKT A;  1MU2 A;  3EYZ A;  4JHD A;  2NRH A;  3CF5 L;  3CER A;  2CQU A;  3C0B A;  4BC5 A;  4B1Y B;  2ITG A;  3U8X A;  4B1W B;  2WOM A;  3MN7 A;  4EAH D;  3AV9 A;  2LSN A;  1QSY A;  1KTQ A;  2EWS A;  4PL8 A;  2O8C B;  4C1N I;  3K5O A;  3EPY A;  2OYQ A;  3EZ5 A;  5HRR A;  1Q8I A;  1J5E K;  3QDK A;  5KI6 A;  4YOY A;  1IKY A;  3NDK A;  4M42 A;  2XRI A;  4J2A A;  2O8F B;  2O8D B;  4GMJ B;  1NNE A;  1RBS A;  2GEL A;  1RT1 A;  5C25 A;  3ZSZ A;  3HPO A;  1JCF A;  1TK0 A;  1Q82 O;  2EMT A;  1LAW A;  3CJC A;  4JNE A;  5AFU H;  1HNW K;  3GG4 A;  1VSD A;  1TKD A;  3MX2 A;  4CYE A;  4BRL A;  1RGI A;  3VQ6 A;  3WNG A;  3F5T A;  4PKI A;  3VQE A;  4MDA A;  2HVH A;  4DU1 A;  2W40 A;  3TAG A;  3TAB A;  3SJJ A;  3DLG A;  1JKH A;  4KRE A;  4FWP A;  3TTD A;  1NK4 A;  3H3O B;  2HHV A;  4BRE A;  3UKR B;  4JI5 K;  1GLE G;  2OAN A;  2Q31 A;  4FL9 A;  4FOI A;  4K42 A;  2IS3 A;  1LAV A;  4CW7 B;  4YFU A;  3A2F A;  3A0I X;  4K8Z A;  4QS7 A;  3NH2 A;  3MN6 A;  4YOU A;  2HHH K;  3VQ7 A;  4KH5 A;  3VQ9 A;  3F9M A;  5MLC Q;  2J0J A;  3LDS A;  1O1W A;  3W0L A;  3DAW A;  3P38 A;  3R1X A;  4HWI A;  1XNQ K;  3OBY A;  1J5O A;  1BU6 O;  4TKN A;  1WSE A;  3H6E A;  3LAK A;  1WSF A;  3HP6 A;  1HQE A;  4ELV A;  2HHQ A;  4E1N A;  3P31 A;  4H0O A;  3NFA A;  3C95 A;  3H1Q A;  4CBW A;  4RW4 A;  3O4Q A;  4K8X A;  5C24 A;  4F9O A;  1SZ2 A;  1DTT A;  3QIO A;  1VBG A;  2JLE A;  4JHD B;  5AQY A;  3U4L A;  1LWE A;  4LFA K;  4CVN E;  1KBL A;  3D2F A;  5EY4 A;  1X3N A;  5AQX A;  1NGH A;  4Q0B A;  4HTU A;  4DHY A;  1FJG K;  5AQI A;  2OPP A;  5FLX O;  3HPH A;  4LFB K;  5BRF A;  2FF6 A;  4KBO A;  4PKH A;  3K5N A;  1Q9Y A;  4CF1 A;  2OZS A;  4CED A;  1FKP A;  4XEI A;  5FRM A;  2QKK A;  3VEY A;  1YHQ N;  5E26 A;  3ZYY X;  4IOX A;  3O3H A;  4PQU A;  4KHP K;  3V9W A;  3HO1 A;  5FPM A;  1K8K B;  4G9Z A;  2CGK A;  2O8D A;  1RBV A;  4KTQ A;  2W42 A;  2EX3 A;  5LL6 Z;  1BQM A;  3THV A;  4FCY A;  1CZ9 A;  1HKC A;  4JI1 K;  1F21 A;  1RFQ A;  3CQX A;  4IFV A;  3BZC A;  4BRA A;  3SPY A;  3T1Y K;  1S9G A;  4CJ7 A;  2CGL A;  2KQ2 A;  3DM2 A;  4W5O A;  2ABD A;  4IO9 L;  3IUC A;  3S3N A;  3FFI A;  4CD3 A;  3A5L C;  3BIN A;  4WQ5 A;  5CYM A;  5AQP A;  4OKJ A;  3CCJ N;  3BP8 A;  3M3Z A;  2KKZ A;  5JMV A;  4FWM A;  3QES A;  1SL0 A;  3G10 A;  4CHO A;  1ASV A;  3VN5 A;  1W2B M;  1GC7 A;  1IH7 A;  1NGI A;  1QQO A;  2HBJ A;  5JVL A;  2XY8 A;  2YNH A;  4BRD A;  4NY0 A;  4OPH A;  4FXD A;  1RDW X;  2ASM A;  3CI5 A;  2HHT A;  4BWM A;  4OLB A;  4DTO A;  3HJF A;  3P4I A;  3A5N C;  3U9Z A;  5KRS A;  1I3A A;  3NAE A;  3PY8 A;  4BDZ A;  4BRP A;  1DLO A;  4WQ4 C;  3KLG A;  3VEV A;  3VPZ A;  4IEI A;  5ADX H;  3SCX A;  4OVL A;  4M3X A;  1C1B A;  4BE2 A;  2P9N A;  5CE3 A;  2QTD A;  1RT4 A;  4YY3 K;  4B9M A;  2WUS A;  2ZJQ L;  4YOX A;  1RIL A;  1EO1 A;  1BGX T;  4I9L A;  1ST7 A;  2NUB A;  4CJW A;  2A1S A;  2VQF K;  1NGG A;  1T6C A;  2NRV A;  5AQS A;  5SZT A;  1VQ9 N;  1ASW A;  3SV3 A;  3L2Q A;  1QQM A;  2P9K B;  4ZRI A;  1YVN A;  3Q7B A;  2VCP A;  3KK2 A;  1OVQ A;  4KHS A;  5HRO A;  5CR4 A;  3OS2 A;  3FR0 A;  3LP0 A;  3MK6 A;  4KRF A;  1ZBF A;  4CJQ A;  3ITH A;  1D4X A;  3X23 A;  3CCV N;  4IO8 A;  4KO0 A;  4FWN A;  1D5A A;  2YNI A;  2YI1 A;  4CJR A;  4FJG A;  4DMN A;  2XY7 A;  1JDE A;  4AHT A;  4CJP A;  2KHO A;  4FLU A;  1S1X A;  3ZET B;  1C0U A;  2F8T A;  3SLC A;  4HUF A;  4BDP A;  2D0B A;  3ATU A;  4EZ6 A;  3ZEU B;  4CEE A;  1VSF A;  3VF2 A;  4E7K A;  1Q81 O;  4PY5 A;  3AU4 A;  3QBX A;  5JVH L;  2F7T A;  3ZSY A;  3I55 N;  3THW A;  2W41 A;  4DCH A;  1J9A A;  4LFC K;  2HW3 A;  4JK9 A;  3NF9 A;  3PV8 A;  3T69 A;  3WXJ A;  3OYA A;  3DJC A;  4JKE A;  4YDU A;  4C1N K;  4XIU A;  4DSI A;  1ZBS A;  3ENB A;  4G1Q A;  2DFE A;  5IWA K;  3LP1 A;  4RW9 A;  3JYT A;  3J7A P;  1P90 A;  2XHB A;  4L8R B;  3VGM A;  4ZHR A;  2RQ1 A;  1WB9 A;  2YNG A;  3F2K A;  4B8C A;  4F2R A;  1UWB A;  4E0D A;  5CHI A;  2E1Z A;  4WCE L;  4CJL A;  3KJV A;  1YIT N;  1RDB A;  3O9U A;  3QNN A;  1MIX A;  3D6R A;  3UKU A;  1EWQ A;  2P5G A;  4Y1C A;  3BZK A;  3AO4 A;  4F2S A;  4FLT A;  4DFM A;  1RTD A;  3JAM O;  5DK5 A;  3SUQ A;  4DSL A;  4J2D A;  4FJ8 A;  1VQ5 N;  3VQ8 A;  2P9L A;  5BR8 K;  4MDB A;  3ZSV A;  1VQK N;  3DOL A;  3ZX0 A;  1JL1 A;  3OS0 A;  5C2D A;  3SUP A;  4H5N A;  1ILY A;  1TK5 A;  5TKW A;  2X6N A;  3NMU A;  1DT9 A;  2OA8 A;  1SKR A;  1W7A A;  3AAQ A;  1GC6 A;  3JSM A;  3D0P A;  5HBM A;  1BI4 B;  3PIP L;  2VG6 A;  4DF8 A;  2O8E A;  1E4G T;  4ZRK A;  4DR4 K;  3HST B;  3W3D A;  3F9K A;  4N5S A;  4LF9 K;  3VEO A;  1U48 A;  5J2N A;  4DR7 K;  2ASO A;  3MWP A;  2ZGY A;  1QVF M;  2R82 A;  2E2N A;  4DQP A;  2OTJ N;  3SUO A;  1S1T A;  3OTO K;  1QZ5 A;  4JI2 K;  3AVJ A;  3O1B A;  4WQ5 C;  4DTM A;  1B9F A;  4H0X B;  3WUH A;  5EXW A;  1J54 A;  1GGO A;  1UOC A;  1YF5 L;  1K8A O;  2BAN A;  4FLZ A;  5C15 A;  3TAQ A;  1SKW A;  3RRG A;  1YTU A;  1RDD A;  1A5V A;  4WFA L;  3ULE B;  4BC3 A;  2HNZ A;  5AQF A;  3L3V A;  3V9S A;  1CZB A;  3D2E A;  3CFO A;  1J19 A;  4YOW A;  4FJL A;  4FJX A;  1LWF A;  1ITG A;  4I2P A;  1IKV A;  1Z25 A;  2Z1G A;  4IBN A;  2A40 A;  2ZWH A;  2O8C A;  4DTN A;  4NCG A;  5AR0 A;  5AJ3 K;  1KC8 O;  2WH5 A;  4BVP A;  1QQN A;  4FJM A;  3K2P A;  3M8S A;  4AM7 A;  1NGD A;  3KZB A;  4J8F A;  4B1U B;  4LH5 A;  4DU3 A;  1VQP N;  3V9X A;  2PY5 A;  3G4S N;  4W5N A;  3O9T A;  3VQA A;  4CZF A;  3RMB A;  2NRT A;  4JKF A;  4BVO A;  3VF6 A;  1VSE A;  4MO4 A;  1FK9 A;  3NGI A;  4BRC A;  4CJ5 A;  1RCH A;  1NWK A;  4DQ8 A;  3KD5 E;  3J8A A;  1RBU A;  3NE6 A;  1FXX A;  1NKB A;  4H5V A;  3ZX3 A;  2ZD1 A;  2D10 A;  4N47 A;  4EKU A;  4PHT X;  1KVA A;  1S1U A;  4B9V A;  4Z4F A;  1DEJ A;  1GLA G;  4C8K A;  3NVK A;  4H5T A;  2AP1 A;  3N4P A;  5BRH A;  4LF5 K;  4DXA B;  1VBH A;  1BCO A;  5BRE A;  2RKI A;  3HI0 A;  4CES A;  3I0S A;  3ATV A;  3O4N A;  5GAD P;  2UXD K;  4JK8 A;  4CZL A;  4WF9 L;  4YDU C;  1YJN N;  1KFD A;  4YOT A;  2D0O A;  1RBT A;  3VA3 A;  1HX1 A;  4DSF A;  4J2E A;  3NH0 A;  4DSE A;  5IT9 O;  2NZT A;  1XI1 A;  1NK6 A;  3LDN A;  5M1Q A;  3OW2 M;  3ZSW A;  1W0H A;  4B1V A;  4FWO A;  4BGB A;  1VRU A;  4B08 A;  3OS1 A;  4CF8 A;  1BUP A;  3ZT3 A;  2CH5 A;  1QZ6 A;  5JS2 A;  4Z4E A;  1BWF O;  3RTV A;  3ZSX A;  4CFA A;  1T6D A;  3GE1 A;  3KIO A;  3LL3 A;  4E7H A;  4BGA A;  3SV4 A;  3O3F A;  3DLK A;  2Y1I A;  4CJ3 A;  1YJW N;  1BIU A;  2Q97 A;  3BY5 A;  4XH5 A;  4B9N A;  3LM9 A;  1RDA A;  4AHV A;  1V4S A;  2NNW A;  5CZ1 A;  4JS5 A;  5FPN A;  4CK3 A;  2FBY A;  2UU9 K;  5AQK A;  3LP2 A;  1UA0 A;  3IDH A;  4E7L A;  3O9S A;  2NRW A;  3AVA A;  3G0Z A;  2GWK A;  3MDQ A;  2WON A;  1TVR A;  2QA4 N;  2OTL N;  3SBT A;  5ELZ A;  4Z4G A;  2A5X A;  1NJI O;  5M1N A;  1N33 K;  1ACA A;  4DR6 K;  4JRP A;  2KZZ A;  4FJI A;  3WT0 A;  3IG1 A;  3CXC M;  4DLG A;  3QO9 A;  3TTC A;  4CFB A;  4CEB A;  5C42 A;  5K14 A;  1KAZ A;  4HDO A;  1TV6 A;  2E2Q A;  1IJJ A;  2IGI A;  4CIG A;  5HOO A;  5FRO A;  3WXM B;  3SAF A;  2VWK A;  5JIC A;  5F1X A;  4IKF A;  4FJN A;  4PWD A;  4E7I A;  1W97 L;  5JVG L;  2PYL A;  5LJV A;  4IDH A;  1HNZ K;  2BH1 A;  3P1G A;  4HTL A;  4I6M A;  3K9K A;  3CQ8 A;  2G8I A;  3RVC A;  4B3S K;  3MCA B;  2W6L A;  3PUF A;  3SQ2 A;  3C65 A;  3T3F A;  3VF4 A;  3O5B A;  2FBV A;  2AL6 A;  4FWK A;  3A8Y A;  3DXK B;  5J2Q A;  3AO5 A;  3HL8 A;  4BY9 C;  1Q9X A;  3TAF A;  1IG9 A;  2IOC A;  4DLE A;  1D8Y A;  3TI0 A;  3HVR A;  3R9P A;  3HOT A;  1QVG M;  4O44 A;  1YIJ N;  2Z1I A;  2P1J A;  3IFR A;  4KKO A;  2KZM A;  3FP5 A;  3KLE A;  3THX B;  2ZGZ A;  4HDQ A;  3CJ9 A;  3E9P A;  4JKG A;  3SJH A;  5EVZ A; 
#chains in the Genus database with same CATH homology
 5E84 A;  3CCJ N;  4JN4 A;  2WC9 A;  3BP8 A;  3M3Z A;  2KKZ A;  4PKG A;  2PFU A;  3CCS N;  4IFE A;  5JMV A;  4FWM A;  2Q0U A;  4H0V B;  3HOS A;  5EY4 A;  4CZM A;  5AQH A;  3PLA A;  3DXK A;  1XC3 A;  1TYQ A;  3HZ6 A;  2P9S A;  2VGM A;  1W2B M;  4B1X B;  1GC7 A;  1BDG A;  1NGI A;  1Q7Y O;  1QQO A;  2HBJ A;  5JVL A;  1KC7 A;  3H1V X;  1Y64 A;  1GLB G;  1DGK N;  4BRD A;  3VMF B;  4NY0 A;  4OPH A;  1RDW X;  2ASM A;  3CI5 A;  3ULE A;  5JLF A;  1TUU A;  2E1Y A;  3LDL A;  4UY8 O;  1KXP A;  4JKC A;  3A5N C;  3FZF A;  3P4I A;  3U9Z A;  5M1P A;  1YUW A;  3CET A;  1V4T A;  2HE7 A;  3AU5 A;  4ISG A;  4JKH A;  3OA9 A;  4BRP A;  3RSE A;  4FPB A;  4WQ4 C;  5H1S Q;  3M5R A;  3VEV A;  4IEI A;  3VPZ A;  1DIK A;  4BR0 A;  4CBX A;  3H45 C;  5GAG P;  5ADX H;  1NGA A;  3I56 N;  3ZEU A;  2P9N A;  3E9O A;  1HB6 A;  5CE3 A;  4MO5 A;  5GIO A;  4KH6 A;  5DM7 L;  1U2V B;  3CCE N;  5B8H A;  2QTD A;  3PVL A;  3EZW A;  3LDQ A;  2WUS A;  2ZJQ L;  3O8M A;  4YOX A;  3CD6 N;  3CIP A;  4NLC A;  1EO1 A;  3JXU A;  3HBT A;  3Q7C A;  1K9M O;  1P8Z A;  1ST7 A;  1LOT B;  3PZD A;  5AQU A;  2FF3 B;  4KH4 A;  4IZ9 A;  5BRD A;  4JKG B;  4JD2 A;  1NGG A;  4DKW A;  3UB5 A;  1MK7 B;  1T6C A;  5BR9 A;  2NRR A;  2NRV A;  1HKG A;  5AQS A;  1VQ9 N;  1NGF A;  1QQM A;  2P9K B;  4MLE A;  4ZRI A;  1YVN A;  3OBW A;  1XQS C;  3Q7B A;  2VCP A;  4M7Y A;  2QWL A;  2WBN A;  2KLA A;  5CR4 A;  4AF1 A;  3FR0 A;  3RSE B;  1BA0 A;  5C12 A;  3BEX A;  3MK6 A;  2ASP A;  1C0G A;  2JWL A;  3M1F A;  3E1Y A;  3NVK A;  1D4X A;  2H3G X;  3X23 A;  1O13 A;  4IEE A;  3BUZ B;  3CPE A;  2QWM A;  4GY2 B;  4IO8 A;  4FWN A;  3VEZ A;  4A59 A;  3CCV N;  1VAZ A;  3CME N;  2YI1 A;  5AZJ B;  3QIJ A;  2V7Y A;  3UKR A;  3R8E A;  1G99 A;  5AQT A;  1N8R O;  4CI6 A;  2FXU A;  1JDE A;  2QM1 A;  3BF3 A;  2YHY A;  3EL2 A;  3EKU A;  3MX5 A;  1NTI A;  2FJ9 A;  2KHO A;  4LC9 B;  3VTH A;  1H4R A;  5DM6 L;  1NLV A;  3ZET B;  3EKS A;  4BQL A;  1JCE A;  2D1K A;  2VGN A;  2PAV A;  3DXM A;  4BR5 A;  5F0X A;  4ISF A;  2V51 B;  3TSP A;  1H1V A;  3SLC A;  2J0K A;  1CZA N;  1NM1 A;  3AGK A;  4FOE A;  4EFH A;  3ATU A;  3ZEU B;  4JD2 B;  2QWP A;  4FWR A;  3EE9 A;  2ITM A;  4GV9 A;  4K41 A;  4CZE A;  1SGH A;  4U67 L;  3FLC O;  5EX5 A;  3VF2 A;  4BR2 A;  3HM8 A;  2QWO A;  1Q81 O;  1VQO N;  3AU4 A;  2HF4 A;  3TPQ A;  3QBX A;  4BQZ A;  5JVH L;  4BRO A;  2YJE A;  3LDP A;  3VOV A;  3H46 O;  2F7T A;  1VQL N;  3I55 N;  4GV3 A;  3L4I A;  3VGK A;  2Q1N A;  2W41 A;  3DWL A;  3B8A X;  3M6G A;  3UKU B;  4DCH A;  4YOR A;  5KPR A;  4DB3 A;  4JK9 A;  1E5W A;  1E4F T;  5F2R A;  3TTF A;  3CCQ N;  1ZC6 A;  3T69 A;  3WXJ A;  3DJC A;  4JKE A;  4YDU A;  3WXI A;  4ZRJ A;  3ZDT A;  1ZBS A;  3WA0 A;  2QWN A;  3I33 A;  4FWS A;  4C1N K;  3ENB A;  4O8U A;  2P9L B;  2QW9 A;  2WFB A;  1P90 A;  2J0M A;  3ENO A;  3VGM A;  3G9W A;  3O80 A;  1TUY A;  2RQ1 A;  3F2K A;  4H0Y B;  3EN9 A;  5KQD A;  3LM2 A;  3VES A;  2D4W A;  5CHI A;  2E1Z A;  4WCE L;  4GNI A;  3PIO L;  1YIT N;  3O9U A;  5AQO A;  4I6M B;  1MIX A;  3NVM A;  2I7P A;  3D6R A;  3EO3 A;  2IVN A;  3ENH A;  3ID8 A;  3UKU A;  3TSU A;  1SQK A;  5AQW A;  1EF1 A;  3I8B A;  4IWV A;  3IKM A;  2LBB A;  2FLO A;  3O4W A;  4H0T B;  4C23 A;  4RWT A;  2JWK A;  3VEN A;  1MWK A;  1YXQ A;  4R79 A;  5AQJ A;  3QFU A;  4WYB A;  2IVO A;  5AQG A;  2QWR A;  1MWM A;  4EHU A;  1VQ8 N;  4A62 A;  1VQ5 N;  2P9L A;  2P9P B;  4MDB A;  3C6A A;  2GEM A;  5BPN A;  1VQK N;  1MIZ B;  2QWQ A;  3ZX0 A;  5C2D A;  4H5N A;  3JS6 A;  3VEX A;  1ILY A;  1OVY A;  5TKW A;  3NMU A;  1GLC G;  3KWI A;  1DT9 A;  3CCL N;  1HLU A;  5KPZ A;  1ZXO A;  4H03 B;  3AAQ A;  1GC6 A;  4AM6 A;  3SK3 A;  2EMS A;  2GUP A;  3PIP L;  2E20 A;  2A3Z A;  4RTF D;  4JK7 A;  5AQN A;  4BG9 A;  3A5M C;  4BRN A;  5AQR A;  1E4G T;  3L4Q A;  4ZRK A;  1GLJ O;  5GIN A;  5AFU A;  3W3D A;  1NBW A;  3P39 A;  3VEO A;  5ADX A;  2FSK A;  3L6Q A;  2ASO A;  1ATN A;  2ZGY A;  3MWP A;  3D7E O;  3E66 A;  4XH1 A;  2A42 A;  5BN8 A;  4WFB L;  3FFK B;  4EHT A;  4GV6 A;  1VQ6 N;  2R82 A;  2I7N A;  3FZK A;  3QFP A;  2E2N A;  3C7N B;  3CJ7 A;  3ZET A;  2ZJP L;  2OTJ N;  3G6E N;  3GL1 A;  4FWQ A;  4YOV A;  3D2E B;  1OKJ A;  1QZ5 A;  1XUP O;  2P9P A;  4IJN A;  4BR4 A;  3S41 A;  3O1B A;  4WQ5 C;  1BOT O;  4H5W A;  4H0X B;  4BRM A;  1M90 O;  3KHY A;  3WUH A;  5EXW A;  1K73 O;  4ILH A;  2ZF5 O;  1TYQ B;  5BPL A;  4ILG B;  1KAY A;  4BG8 A;  1YI2 N;  1GGO A;  1WOQ A;  4FSV A;  1YF5 L;  1K8A O;  2P9I B;  4CZI A;  4NLB A;  3FE1 A;  3CQY A;  5C15 A;  4JAX A;  3SMP A;  3MN5 A;  1QVF M;  1YAG A;  4IOC L;  4BRH A;  1NGJ A;  3CC2 N;  4A5B A;  3ULE B;  4BC3 A;  5AZI B;  4WFA L;  3D2F B;  3MWT A;  1M1K O;  3CJB A;  2GTD A;  1Z05 A;  5JLH A;  5AQF A;  3HRG A;  5AQQ A;  3G25 A;  4F7G A;  3WQT A;  3FZM A;  5KPT A;  2P9U A;  3D2E A;  1J19 A;  4QS9 A;  1S22 A;  4YOW A;  3E9L A;  3O1W A;  4GVE A;  3WXL A;  4O5F A;  3TSQ A;  2HOE A;  2E88 A;  1X3M A;  1U2V A;  2A40 A;  1ATS A;  2ZWH A;  2D0P A;  3KVG A;  2AEH A;  1NMD A;  2Q36 A;  2A41 A;  1X9J A;  5AR0 A;  4U7B A;  5C2F A;  4E1J A;  2ZJR L;  2WH5 A;  1GLL O;  4Y0W A;  1KC8 O;  2HBK A;  5EOY A;  4BR7 A;  4BVP A;  1QQN A;  3FZH A;  4M7X A;  1KAX A;  2QI2 A;  4AM7 A;  2P9I A;  3QIC A;  1EQY A;  4O8K A;  3WXK A;  4JKD A;  4IOA L;  2E2O A;  3MN9 A;  1NGD A;  2HST A;  3KZB A;  1BO5 O;  4J8F A;  4B1U B;  3CMA N;  2P9K A;  2YX6 A;  1VQP N;  1QHA A;  3G4S N;  5C10 A;  4P7I A;  3SAH A;  3TU5 A;  3O9T A;  3WEE A;  4CZF A;  2E2P A;  4K25 A;  4QS8 A;  1S3X A;  3U9D A;  4BRK A;  1U6Z A;  2NRT A;  5M1O A;  3DXM B;  3AAR A;  4JKF A;  3SBG A;  1SS6 A;  4BVO A;  3VF6 A;  5I9E B;  1R59 O;  3AAP A;  3EE8 A;  3KK7 A;  3H3N O;  4MO4 A;  2CGJ A;  4IXC A;  2FSN A;  4JHD A;  2NRH A;  3CF5 L;  3CER A;  4BRC A;  4MLH A;  4BRI A;  2CQU A;  3C0B A;  4A5A A;  3UE5 A;  1NWK A;  2YVC A;  4DQ8 A;  3U7D A;  4ISE A;  3O6W A;  4BC5 A;  4B1Y B;  1HKB A;  3U8X A;  5TKY A;  4B1W B;  4A2B A;  4BR9 A;  3IMX A;  3MN7 A;  5BN9 A;  4PL7 A;  4EAH D;  2COP A;  3J8A A;  3HSC A;  3FZL A;  4H5V A;  3ZX3 A;  2FDQ A;  1NGB A;  4BC2 A;  2D10 A;  1MA9 B;  3VET A;  1ESV A;  2EWS A;  4PL8 A;  4PHT X;  4C1N I;  4CZJ A;  3WQU A;  2BUP A;  5C0Y A;  1DEJ A;  1GLA G;  1HUX A;  3EPY A;  2HF3 A;  3GDQ A;  2AP1 A;  3N4P A;  4H5T A;  4A57 A;  5BRH A;  3U8Z A;  4GXB A;  4JEP A;  4DXA B;  1VBH A;  2J4R A;  2V52 B;  5BRE A;  3O9Q A;  3QDK A;  4FWL A;  4YOY A;  2QXL A;  4CZK A;  3HI0 A;  2D11 A;  1NGE A;  1HPM A;  4CBU A;  2DIK A;  2A6A A;  1MK9 B;  1C0F A;  1SAZ A;  3ATV A;  4B9Q A;  5GAH P;  1K8K A;  4CD1 A;  2RHK A;  3VGL A;  1BG3 A;  4A61 A;  2NRX A;  5GAD P;  3CJ1 A;  2GEL A;  4K43 A;  3VTI A;  3T7Z A;  5BPM A;  1JCG A;  4JK8 A;  1JCF A;  4CZL A;  4WF9 L;  2EMT A;  4YDU C;  3GBT A;  3CPW M;  1YJN N;  4YOT A;  2D0O A;  3CJC A;  2IVP A;  4JNE A;  5AFU H;  1HX1 A;  3GG4 A;  2BTF A;  2NZT A;  3LDN A;  3MX2 A;  3CC4 N;  5M1Q A;  4CYE A;  4BRL A;  1RGI A;  3OW2 M;  4ILJ A;  5AQP A;  3F5T A;  4PKI A;  2RE2 A;  4B1V A;  4MDA A;  1HBK A;  3K9J A;  4FWO A;  4BGB A;  2PBD A;  2W40 A;  4BRG A;  1NGC A;  1GG3 A;  5AQL A;  1Y19 B;  1BUP A;  1T44 A;  4FWP A;  1MDU B;  2CH5 A;  3A5O C;  3LDO A;  1QZ6 A;  1YJ9 N;  3AGR A;  5LJW A;  1T3V A;  4WQ4 A;  4WFN L;  3R3L A;  1BWF O;  3GOI A;  2I1K A;  3TTD A;  1LCU A;  3H3O B;  2ZPY A;  4BC4 A;  3CC7 N;  5AZJ A;  1VQ7 N;  1RDU A;  1T6D A;  1KD1 O;  3GE1 A;  1IG8 A;  3LL3 A;  5AZI A;  4BGA A;  2F9T A;  3UKR B;  4BRE A;  4BRQ A;  1J6Z A;  5EVZ A;  3DLL L;  3CCU N;  4XH4 A;  2OAN A;  1GLE G;  2Q31 A;  4FL9 A;  4FOI A;  4K42 A;  1YJW N;  2AA4 A;  1VQ4 N;  2Q97 A;  4XH5 A;  3HTV A;  3A0I X;  4QS7 A;  3LM9 A;  3MN6 A;  1NI2 A;  4NO7 A;  4OPA A;  1V4S A;  2NNW A;  4YOU A;  4BRF A;  4M63 C;  2Q2R A;  4KH5 A;  4B1Z A;  2I1J A;  2GWJ A;  3QB0 A;  2VYP A;  3F9M A;  2DPN A;  5MLC Q;  2J0J A;  2IIR A;  2NRZ A;  4FPA A;  3W0L A;  5AQM A;  3DAW A;  5FPN A;  3P38 A;  3WEE B;  5GIP A;  2HBM A;  3R1X A;  3C7N A;  5LY3 A;  4HWI A;  5AQK A;  3OBY A;  3FGU A;  1BU6 O;  4TKN A;  1KQS M;  3IDH A;  4CZH A;  1S72 N;  3H6E A;  3O9S A;  2NRW A;  2NLX A;  3ID6 A;  1HB8 A;  3CCM N;  2GWK A;  4JKB A;  3MDQ A;  3MCP A;  3P31 A;  4FO0 A;  4H0O A;  2QA4 N;  2OTL N;  3CCR N;  3SBT A;  3H1Q A;  2GX9 A;  5ELZ A;  4CBW A;  4A2A A;  5GAE P;  2A5X A;  1NJI O;  5M1N A;  3SMS A;  1ACA A;  3ZX2 A;  1NVL A;  4F9O A;  1SZ2 A;  4IJA A;  4YL8 A;  5FPE A;  1Q82 O;  3SAG A;  3WT0 A;  4OO1 J;  1VBG A;  4CZG A;  3CXC M;  4JHD B;  5AQY A;  3C6H A;  3U4L A;  3VER A;  5M1F A;  1KBL A;  4H0P A;  3TTC A;  3D2F A;  1X3N A;  2E8A A;  1KAZ A;  1NGH A;  2E2Q A;  4HDO A;  3MMV A;  1IJJ A;  3R6M A;  4L3Q A;  5AQX A;  5HOO A;  2X0S A;  1VQM N;  3WXM B;  4DHY A;  5AQI A;  2D2Q A;  1HJO A;  2P9U B;  3CHW A;  3SAF A;  2Q0R A;  3G71 N;  1DKG D;  5F1X A;  5BRF A;  5JIC A;  2FF6 A;  4KBO A;  4PKH A;  1W97 L;  2YHW A;  2CH6 A;  2YJF A;  1JJ2 M;  4JKA A;  2FSJ A;  4RCH A;  5AQZ A;  5JVG L;  5LJV A;  4IDH A;  2UYT A;  1ISN A;  2BH1 A;  4HTL A;  1VQN N;  4XEI A;  1Z6R A;  4I6M A;  3K9K A;  4H5R A;  3VEY A;  1YHQ N;  3RVC A;  3O08 A;  3BF1 A;  3O9R A;  2HBL A;  3MCA B;  5E26 A;  4EIA A;  3ZYY X;  4NB4 A;  3C65 A;  4IOX A;  1Q18 A;  5KQ8 A;  5FPM A;  1BA1 A;  3AY9 A;  3O5B A;  3VF4 A;  2AL6 A;  4FWK A;  1K8K B;  2YCH A;  2CB8 A;  2CGK A;  3A8Y A;  3QBW A;  4G9Z A;  1GLD G;  3DXK B;  2HMP A;  4BY9 C;  5HL7 L;  2P9S B;  3OHR A;  1WUA A;  1HKC A;  3QML A;  5M1K A;  1Q86 O;  1RFQ A;  3CQX A;  2P9N B;  3FLV A;  2VWB A;  4BRA A;  2QEX N;  5IJM A;  2HRJ A;  3R9P A;  5FPD A;  3HOT A;  1QVG M;  1YIJ N;  5AQV A;  3N4Q A;  4FVU A;  4CJ7 A;  3IFR A;  3IVF A;  4Z94 A;  1GLF O;  2CGL A;  2F9W A;  3L0Q A;  2YHX A;  3FP5 A;  1ATR A;  2ABD A;  4IO9 L;  3IUC A;  4CD3 A;  3J7Z O;  3A5L C;  3BIN A;  2ZGZ A;  4HDQ A;  3CJ9 A;  4WQ5 A;  3VEW A;  3CJA A;  2V7Z A;  3E9P A;  4JKG A;  3KWG A;  3SJH A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...