3E9TA

Crystal structure of apo-form calx cbd1 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
b'EFIRMYFEPGHYTVMENCGEFEVRVVRRGDISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSEGVKLAVPMIATVMILDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Na/Ca exchange protein
publication title Crystal structure of apo-form of Calx CBD1 domain
rcsb
source organism Drosophila melanogaster
molecule tags Membrane protein
total genus 27
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3e9tA00
2DPKA 3EADA 3E9TA 3H6AA 3FQ4A 2FWUA 2KLTA 2QVMA 3RB7A 2FWSA 3FSOA 3GINA 2KLSA 2LT9A 2QVKA 3US9A 3RB5A 3E9UA
chains in the Genus database with same CATH superfamily
3Q2LA 1FFPA 4Y4FC 4NERA 2X4OB 3WFCL 3PWJA 5C0JB 2YZ8A 3VWJD 2ADGB 2PWFA 1EJFA 2J73A 4M3HA 2BP3A 1M3JA 4I2XB 2OXHA 4PP1D 1RY7B 4IBUA 1BQHA 4ZW3A 1N18A 3V0IA 1NSNL 5EORL 4H40A 3DK2A 1LEIB 1DQVA 5E9DA 3CG8A 4ZO6A 2B9AA 5TF1H 1AXTL 4IBLT 4LFHG 3CSFA 3F65A 1A3RH 4QRPA 4MDIB 4Y5XB 5GGUB 3RDTD 4YHOL 1JL8A 1L9TA 2D3NA 5D72L 1J18A 5I1GL 3QQ3B 1M7IB 4IBYA 1KCVL 3FQXA 2F74B 5KYWB 2NDFA 2ORBL 1KB5L 1EAJA 2A1WH 1PFCA 3ZE0E 1PCSA 4OTXH 2YEVB 1U8HA 3GMNB 2B1OA 4KI5F 5E2WH 1TVHB 3E3QC 3WY1A 1JZ2A 3JWNH 4UTAH 2N01B 5DVOA 2HUHA 3SO5A 4HKBB 3NPZB 3LSOB 3CDYA 1KYUA 3D39E 2WXPA 4FFYL 2KBGA 1T1XA 2L04A 5CHNB 3OMZA 4HBCH 5F72S 3RBSA 3TYGL 4G8GA 4QF1B 2GTWB 3BESR 5BOJA 1CL7I 1E42A 3V0JA 3M1BA 2WNXA 4MB5A 2QQKL 3HE6C 1KYFA 3D08A 2AK1L 2CA3A 3V4PL 5EPMB 2IQAA 1HQRA 2WLIA 1X5ZA 3QUXD 1HIMH 1QWNA 2IH3B 5AEAA 2AJXH 2UUDK 4YSOA 5H35B 2DQEL 3CVIL 2MTPA 3MLTB 5BRQA 2ZUVA 5EO0B 3RJOA 4XPBH 3ZZ1A 2NNRA 1DVXA 2QSCH 4JFXB 3MO1A 4M9PA 3QXDB 4FC3E 5ENWB 2RJMA 2X10A 4EN3C 1OAUH 1IBBA 4FXTA 1BFOA 1ZHKA 3UBGA 1UURA 4PGCB 1T3FA 4S0HA 1D5BB 5E24E 1HQ4B 3LNEA 2FZ3A 1JXJA 3LZPA 2R27A 3CU1A 4QCIB 2W0LA 4EJ1C 3FN9A 2Y1VA 3MLUL 2G2NA 2OI9B 4F92B 5D93C 1ES0A 2YK1L 3O2WL 1S9YB 4BXVA 4NCDA 4KRMB 4MB3A 3SE8L 4AK2A 4MGXA 2BW5A 5FUOL 1U2CA 3T0WA 4AJWA 5E8PA 3VU2A 2EC9T 3QUMA 1RK1B 5ACZB 1SOSA 3PDGA 1X7TA 1NCWH 5F9DC 1EDQA 1NEPA 4FNUA 4NNYB 4APQB 5F6HI 5IBUG 3G6JF 1YYLL 2R51A 4QT5B 1SQMA 3FB8A 4L4VA 2NW2A 2ZPKL 4FF9A 4NKIL 1G7PA 4YN3A 4Q52A 1JVLA 1CG9A 2DQGL 3UOAB 3RP1A 2YFNA 3CTTA 3O9WA 1A7BA 1N59A 3P73A 3RVXD 1A7OH 1RKRA 4QTHB 4WLCA 2FJGB 1OM3H 3DSFL 3O45A 5GZND 1WICA 4NQXA 3U9PL 3VWKB 4CVWA 3TEYA 4F8OA 2DM7A 4M6ML 2AS5M 2DL9A 3EOBA 4O2CB 4UT9H 4J3OH 4G43B 3L3DB 2F18A 1G9MH 1EO8L 4HT1L 4R4BA 4J3OF 3UJJH 3VFPB 2O61A 3G6AA 3NDYE 4QHLB 1FYTE 3K72A 5DHVA 1N7ML 2E7DA 2EACA 2CUAA 2APBA 4GIPD 4GRWE 1NUDA 1T21B 4DF9A 3W9DB 1E6OH 3A6CH 4LXFA 3SE4C 3TX4A 1I3RA 3MV9A 2PN5A 1EAQA 1TFPA 2FJFB 4LSSH 1HE8A 3QR0A 3VMOA 2OM5A 5ICZB 4GQPH 2IWFA 3QZNA 3HLAA 5I8KH 1JNJA 3LNFA 4R83A 1EJ6A 3B7YA 1NSNH 1P2CA 1DUZA 4AI7A 5JHLH 3L45A 1NC4A 5KBNC 3TO4A 1BQKA 5FLUA 2VJ8A 2E7BA 4GKLA 2V9QA 3DI3B 1NMAH 2VH5H 5GRYA 1MHPL 4XH2A 2P5PA 5I1GH 4OZIB 2EXYC 4Y19D 1H3VA 1M56B 3PP4H 1E5BA 4ENED 3BYTA 1I4FA 4PTTB 4NENB 3IGFA 1ETJA 1M7DB 2VGLM 4G1EB 4A7GF 4F7PB 3CFCL 5I19H 2B15A 1DN2A 3G6DH 3NYKA 4QRPB 5D2LF 1FZMB 3ATFA 3MOAL 1MVFA 3VFVB 3QI9C 3MSPA 4TRPL 2GHWB 2QPEB 2DQCH 1A6AA 3Q3GA 5LBGA 4L8CB 2V5RA 3KPRD 3SE9L 1N8ZB 1YJDL 2IANE 4XCYA 3WFZA 2Y7QB 4JN2B 1I9JH 4HDIA 3FFDB 2Z31C 3Q6FA 3I6KA 3U46B 2EUWA 2ZCHH 1XGZA 1ZJBA 4TF4A 5DVKA 3RGHA 4TNGA 4L8SA 2K9FB 4XTRC 4LL9A 3HHSA 4KRPC 3V4VA 4JG1L 1T1XB 2FYYA 3LS4H 4PYGA 1GYAA 4G8GB 4KGLA 4FERA 1INEH 1TJHL 2IAMB 4HYTB 5MEQA 3M1BB 4BSVA 3X2QB 2EIDA 1F58H 4P48A 1J1XL 5CLYA 2ZYHA 5I24A 1M71A 2IQAB 5KVFL 1UT9A 4I3RL 3H4FA 4FP8H 5B38B 2FEDD 2A0LD 2NY2D 4PRHD 2GITA 1LEGA 1NCGA 2BOLA 2I60H 2CDGB 3Q8CA 2D7QA 3WIAA 3FB5A 4N2IA 3IYLW 2PCYA 1WGVA 3BEVA 4HIIA 5CD5D 3TVMC 3VD0A 2P80D 3VU1A 1TPXC 1NINA 5ISZA 4DK3A 4XPTL 4PBVC 3SD5A 1R47A 1OLZA 3ARRA 3MO1B 1V10A 5TE7L 3K0YA 2WYTA 1B9ZA 5F21B 1EEYB 2QVTA 2YK1H 3NIFE 1YNLH 2GJ6A 1NPJA 1P9MC 3QJZA 4KKCD 1DUYB 2F7PA 4NIYE 4LPUA 2FR4B 4PS3A 2J5LB 4R97B 4N5EC 3DO7A 4WTZG 5E2TH 3W9EB 1P84J 2IVFC 4NNPH 4R5XA 5KAQG 5IVXB 5EMYA 2P42B 1ES0B 3S3DB 3ZGIA 3RNQA 3NDZE 3CNKA 1YYLH 4H0HB 3QJTB 5E8PB 3V0WH 3QUMB 3VA2C 2DQGH 1BZ7B 5F9WC 3KPOA 2JI3A 4ZXBD 1RFDL 3ZKMC 2BC4A 2ZAHA 4L3CA 1I7UA 1ZIBA 3ROOA 3WEAA 1G7PB 4DZBA 3R4DA 1CG9B 5DJCA 1CWVA 4LZKA 5DRZB 4MKMA 3NABH 4HT1H 1EO8H 5JHMA 1MFNA 5DMYA 2XIBA 2NMSA 1LO0L 4R4NC 3SDAA 2B0SL 1DJHA 1F6LL 4LLYA 4OLYH 5IB4B 4ELMF 3ZT5A 1XX9C 3O0RL 3EOBB 4FQ2L 5J9PA 4FZEL 3X13A 1H6FA 4R4BB 1YNKL 4NQDD 3TWCL 2ROXA 2D0FA 1NCDL 1SZNA 3V6OA 5CD3B 4FX5A 1DEEB 1QNZL 3E6HA 3CLEL 3PWPA 3BP5A 5CZVL 4RRPG 1I3RB 3MV9B 4HLEA 3OWEA 4KAQH 3VCLA 2YMTA 4OJDH 5E8OB 1TVBB 1K2DB 3US0A 4MXVF 1R3IL 1GKEA 1UM6H 3OB0H 4YZWA 4OAWA 5CEZD 1IL1B 5C07A 2IADB 4ZW8A 4L9LC 1NC4B 2G2RA 4WI2A 2WLJA 4XXCA 3O3BB 1TLMA 1F13A 1WD9A 2EDEA 3ZX1A 4IRJA 2IPKB 1W9XA 4OT1L 3BSZA 2X89A 4HSQA 2CIIA 4ZFOL 4DP1X 4XH2B 3BUPA 3EYOA 5GGTL 3MOBL 3VE0B 4HS6A 1LMKA 4URKA 3CCHB 2XZQH 5IHLB 3SE9H 2NY7L 3VXRD 3MRNA 4ODBD 1IC4H 4ZTPH 3ULVL 5JORB 3V0FA 1NMCB 4JCWA 4NKOB 2GTZA 4B53A 4ZMNA 4AVJA 4HWBL 2WZ0A 1F97A 2X6UA 4PJCA 2WTRB 1FJ1B 3QDJA 1HE7A 5F7KC 5I6KA 3HZKA 2X2HA 1IT9H 4JM2B 4JG1H 4JUSA 5HGHA 2P5EA 4PG9B 5CJQL 4MRBA 5KTEL 3Q6FB 2F15A 1JTTA 1OSZB 2V0AA 4ANUA 3GS0A 1T1WB 2BNQA 5D7IE 3D5OF 2DTSA 3AQZA 2NX5D 3DJ9A 4N0UE 1FVEA 3HR5A 1ZV5A 1W72A 4JW3A 4NBZB 4MA8H 1J1OH 3LIUA 4X80L 4CADB 2NY6C 1Q9KA 5E6YA 2QSTA 1JPTL 4BSVB 1QASA 2JELL 3OZKA 4KDTA 3E0GA 3FS9A 3RILA 2KS0A 3TN0D 4UB0L 2FT7A 4DJMA 5DEZA 1JXKA 1M71B 3EJZC 5KS9F 5DHXB 5I1HL 5DJ6A 3ARDA 2PCPA 3V5HA 2JI1A 2YD4A 2GITB 4ONFH 1LEGB 4N2BA 3IMBA 1CF1A 1HINL 4JFFE 3L5XL 4BBWA 3RUGB 2PETA 3A5VA 2MJWA 2EIKB 3CBKB 3HI1B 3B2DC 3DHUA 3FQYA 2XVLA 4U6TA 5C3TA 3SYPA 2BSRA 3LKSB 3QIUB 4YSRA 5DD0H 4FXKB 5E03A 5AD0A 5IKCA 4N22A 3D2UA 4JRXA 5EU6A 2HG5A 4MQXC 1CFVL 4GXFA 2FJHA 1YEJH 3DWTA 5ESQA 2J21A 3TNMB 2B16A 3DYPA 4BUGA 4E2OA 1U2HA 2DZEA 5DK0A 3RIAK 3BUYB 4FN0A 3INUH 5ELIA 3SB3A 3WY2A 3D0AA 2GBUA 4FNQA 4N6RB 4FABL 1CLOH 4NO0A 3BWAA 1JV5A 3B3IA 3TJHD 2J2ZA 5M95B 3IU4L 5I1CH 1I9RL 1F3JA 2BC4B 4I4WB 3CGTA 2PO6D 4XAWH 1TZIB 4BFNA 4XP4L 5C0BA 1DVFC 1XGQA 4G83A 1DYZA 4FG2A 1BSIA 4JQIA 4FCAA 2ETWA 3WELA 1MJJA 4G8IA 1YNKH 4JO4L 5F1SA 3AROA 4J4PD 3IDYB 4TUJB 1WAAA 2DWEB 2DLHA 2WCGA 5CZVH 5ERWB 2M83A 4BZ1A 5J1SC 3ARPA 1H3PH 3RKPA 3KPSE 4P2YA 3PABA 4TLUA 2ZICA 1U8PA 3I6LD 3SGKC 5DT1L 3B43A 4Y9FA 1MPAH 1T1YA 2AAAA 4NAMA 4PS4L 3FSWA 3K8KA 3PWPB 3O2DH 3E8VA 5I1LA 2GIXA 1A4KB 4R7VA 5EF0A 2VLJE 4PRIA 1QHQA 1YG9A 3LXBA 1HXKA 2IGTA 3WDHA 5DJ0A 2H0FA 3LPWA 4LEXL 1KEMH 3P2BA 4LB8A 4OIIL 1OD9A 4POZC 3DJRA 3L1OH 3ME0A 2QKIB 1XAUA 3DA0A 4ZPTA 1L7TH 3FAWA 3TT1H 4ELKA 5DSCB 4JX0A 4B3EA 1NFDF 4LASH 1P4LA 3ZL4L 1SM3H 3TYFB 1RHFA 4POUB 3DROA 3FT2B 2RBLA 4WUUD 3GXFA 4GT7A 1BMGA 4P5MA 3QXVA 4OI7A 3DRQB 3EYFA 1E3ZA 2VJXA 1P4IL 2XETA 2JCCF 4TV3A 4H88L 1PQZB 5A43C 5A2IH 1R3LA 4P07A 4P4KC 4DKTA 4N87A 4Q2ZA 3AG2B 1WC7B 4XHQA 3HRZC 4L2LA 1LWRA 1Z32X 2XQYG 5FCUL 1WPCA 3QDJB 4HUCA 3UL4A 1T7ZA 1B3JA 5F89B 2P5EB 5BO1L 1DQJA 4DAGL 2IGLA 1TKWB 1RZPA 2LLNA 4JM4H 3H7LA 1FORL 2ZYSA 1JPTH 5TK2A 1HKFA 1J86A 4HKZA 3GHBL 3ZE1E 4C56A 3W57A 3T77B 2Y5EA 1J48A 5CLZA 4JFDA 3LRSB 1OCCB 5TE4H 3GZPA 2VLLA 3HR5B 1E3XA 1PEZA 1W72B 2BIMA 1MCNA 4PMEA 3UTSB 5ABZA 1ZEAH 1JZ5A 2H2SC 5B8CC 1VHPA 1FE8L 2F54D 4MTMA 3I3BA 5A2AA 4H20H 5EU7E 1WFOA 2HSIA 1WJ3A 1P5UA 5K9QG 3GBNL 2LTQC 1MHCB 3C75A 3CFNA 3DX9B 2EIMB 3IBEA 3WIIH 1Q0YH 3VQMA 2NLJA 4MMZB 1MIML 3T4AC 4Z76A 4M1GH 3V6ZA 1JPST 3VAEA 1ZT7A 3TBSA 2B2XL 3S8FB 4GKNA 4LCYB 1JWSB 3F84A 4M43H 3V5DA 2IWEA 5LHDA 1P7QA 4R7XA 5INCB 3WIHA 3MRLA 5BVJA 3DBSA 4QRSA 2FO8A 1BCIA 1L3NA 2RACA 4KX8A 4G9FB 2X2UA 4XGZA 1AR1B 3GXUB 2WK2A 1UM4L 2BSRB 5HSFA 3ZHNA 3GYRA 2UY7B 2R29L 3ECUA 2R0KH 4H2CA 3WEOA 4KFMA 3EXJA 4JKKA 3ILPA 1VFUA 1JI1A 4AG4H 1XZ0A 5JQ6L 5ESQB 4Y7OC 1IKFL 3FTXA 2JQMA 3F7KA 4MKTA 5DK0B 3RWEB 4MNGA 3Q2CA 1DDHB 3BKJL 2VXVH 2XTJC 4NQVB 3GSNH 2VMFA 3DV4A 4XP4H 3L13A 3BP4A 4X5WA 4Z5RB 5J89A 3MJ6A 5HYSA 5DJAA 5T8IA 1CZ8H 4JFYA 4N2HA 2PW1B 3VG0H 4J3WA 2IMNA 2CUMA 2XVKA 4I48B 2R0ZL 4M8RA 4ORGA 5HI5D 3DPBA 3HI5H 4WUKL 1XGQB 4LLUB 1BYPA 5E6ID 1E5UI 3BAJA 2D31B 3CXHJ 4OLWH 4MAZA 4AW7A 4YHPA 3GIZL 4P5SA 2C9XA 2EEDA 1SJEA 4YSCA 2NY4D 1KTBA 4YEFA 4MAUH 1IARB 5DT1H 1RERA 1EVTC 1EUUA 5J5EA 4PS4H 1PIFA 5A2FA 1KCKA 1XB3A 1S3KL 4YDNA 3RKDD 4M62L 2DIBA 1T04A 1UJ3C 3DTXA 1EFXB 4Q14A 1X7QA 2HLFD 5HHQA 1OEZW 1HJBC 3MCKB 2Z8SA 1WIUA 2NZ9C 2UVFA 1M1SA 1PZ3A 3CSGA 3ETBF 1P4BL 1XTLA 1A7PL 5DWUH 3D12B 3HNVH 2N1TE 5F1IB 5AW6B 4KXZI 3RZCC 5DJ0B 3RVUD 1GAFH 1XF4B 5DCCA 3V0VB 1MFDH 3GFUA 4AQ1C 3B5GA 4FLOA 3U6XA 4HUNB 5F97E 4ELDA 1F2XK 2VMDA 3SCMA 3QEHB 3NEEA 3DROB 4NPKA 3W0WD 4MS8C 2TRHA 3UYOD 1BZ8A 4PJ9A 5CCGE 2MFNA 2YMXH 2X2JA 5KUMA 1DJSA 3E1F1 2ZF8A 4FTVD 4P5MB 5FCUH 4UNUA 3T71A 3QR2A 3AT0A 3QFDA 4AVIA 3S5LB 2Z31D 3AB0C 1ZKAA 2DS4A 3D3VB 5MI0C 1HX0A 4BV1A 1S7UA 2ZWYA 5AB2A 3KR3H 1F0LA 2L8AA 4GLRI 4DAGH 1XCWA 1AVAA 4XCEB 4OCLC 5D2NA 1FORH 4Y4HA 3J8F7 2ADJA 3MRPB 4TTDD 2DQHH 3CE1A 3O81A 4ZQKB 4Q9RH 3RTLA 4NZRH 2AQPA 2PYEE 4G8EB 4HPOH 2A6JB 4JM0A 1RU9L 2FCBA 1DQJB 3VWJA 4K9EC 4YVNA 4FHKA 4XO3A 3NT0A 1ED3A 5JYLA 4IOFD 2R23B 5KSAB 1I7TB 3ARZA 1I7ZA 5I76B 2YPLD 3BRDA 5GRXG 2CR0A 2X88A 3KPLA 4J23A 4PG2A 1T6WA 4U2ZA 1VF5C 1A65A 2VLLB 3QZMA 3FMGL 2C9UA 4XNZC 2L7JA 3EO9L 4HALA 3OD3A 3F62A 3IFLL 3QCTL 4NJAL 3RDTA 3Q48A 3ZYZA 1P5UB 1DQTA 5JHAA 2CLVA 5HPMA 3HS0C 4N2CA 4ZTOH 3TVMD 2RQ8A 2VDPB 2A9DA 4TVPE 4G11A 5DZVA 3SJVD 4YX2L 4HQQH 3V6ZB 3JBG7 4HXBL 3F58L 5I8CA 3CFJA 3GSQA 3AC0A 3U30B 4GKNB 3OAYH 1U4EA 1UM4H 3B7UX 2X9XA 2QQLL 2E4FA 4LQFL 1KTKE 4GSQA 2R29H 3PYCA 4QRSB 2DMKA 2V8LA 3BW9A 2XG4A 4N5ED 4NN6C 4NNXB 2X3AA 3L2MA 3PIQB 4OCWL 2XN9E 2K0RA 1BA9A 2XNAB 4YHNA 2Z92A 3G5XB 1HEHC 3L3IA 2CLRB 1OCWH 3BQVA 1UH2A 1IGCL 3HUJA 3OZ9L 4UNTA 2X4TA 1OP5K 3PWVA 3D25A 4AH2A 4TNWF 4J5VA 4Z7NF 2K8MA 1EPFA 5KYYA 3MJWA 1MIEH 3NTCH 3ZKMD 3US1A 3QUXA 1BXUA 2VDKL 2HFGL 4I0PC 4LSRL 1IAMA 2OSLB 1U3ZA 4XPHH 4FAAB 4POYA 4XN5A 2X44D 4ZUTB 3DV4B 4WUKH 3ZRFC 4Y4KC 4OFVA 3FFCE 3N06B 5I26A 3QRLA 3BVTA 4KHXL 4YDZA 5ETUB 3ZDZE 5HYSB 3JWNC 4NO2B 5CKGA 3SO3B 3CVBA 1DSYA 2WYHA 2AJUL 2YQBA 1R3KA 1QRNA 1AYOA 3CHRA 4TUKH 1JDCA 3AACA 4UBDC 4Q6KA 1Z2KA 4PJAF 4M48L 4OZGB 3N1QC 1SOKA 3NVQA 4UQ3B 3QXTA 1M7UA 1G87A 4YHPB 3X1EA 4A2HA 1XF2A 4PGDA 2ITDB 3BMWA 3GT6A 5DFTA 3V4LA 3RZWA 5AVWB 2VJ0A 1NCNA 2ZXCA 5E08H 1RJYB 3CC1A 3DXAB 4G7VL 3ETTA 2VZUA 1B3IA 2KMWA 1G6RL 1KXVC 1T04B 3KXFD 3PL6D 4OCRH 1A7PH 1B6UA 2YPKB 1WFUA 2KHAA 2EO1A 3QZOA 1S7RA 4R0LA 4M61A 4UAOC 2J88H 5J8OA 1KTJA 4U1JB 3V10A 1EZVX 3RFZC 3SOBH 3CPUA 2KC0A 4A7SA 1TCRA 1QP1A 1ZS8B 4QHPA 2VERN 1WTLA 1OQOA 3ULUE 4TNVF 1OF0A 3DK0A 3HMXA 3ETBJ 2DD8H 3I9PA 1IFRA 2EXTA 2H26B 1SDYA 4YPJA 1KIPB 4E9VA 1A1MA 4H25A 2HJFB 1S7QB 1U8NA 5IW1B 5GZNA 1M6UA 3PNWB 4L4TE 2NTFA 3AT9A 4HMCA 3BC9A 2AJVH 3KJ4B 3KVQA 4PJ9B 1T1ZB 1THAA 4CNIA 2AK4B 3T6QC 1D9KD 5E6ZA 1DZ0A 4IM8A 1QUNA 2ZKXA 4AY0A 4K8RD 5B1CA 1ULVA 1OAQL 1B0RA 4W9FC 5FB8B 4S1RH 4P4RA 1QWHA 2YHGA 4PP2A 1R34A 4YBQC 4B27A 5ITFA 2ICCA 3DX1A 4MB1A 4OD2A 5EBGA 2O1AA 4LP8A 3WEMA 2FAUA 2GUOB 2P8LA 3GSXA 5C7XH 3QWRA 2YPVH 4FS0A 4PJBA 5HGAB 4HUWA 4N1CA 4Y4HB 1YMHB 4NI6A 4WWID 1NLDL 1U4FA 4ABWA 1A9VA 4AYMC 4M93B 1QFHA 4OQTA 1T20A 4JREC 4LESA 5D71L 4TSCH 5JOFA 2EILB 5I66A 2R7EB 4OCXH 1ED3B 4PFEA 4NRXA 4NJAH 4N0YL 2VLMD 3PP3H 4JDVB 3KPLB 4M56A 4Y19A 4L0PB 5FGBA 1PNCA 3GUTB 2FEJA 4YDIL 4J3OC 1ZXKA 1NBYB 4AYID 5EBWA 4X4MA 1SVCP 2DB8A 1YEHL 4N25A 3OMNB 3ECWA 1O5DT 3W81A 4YX2H 4AE0A 3BKML 4A67A 3RDTB 1F4WH 3I9GH 5HPMB 4LQFH 4XVUC 4F2EA 1L9QA 4X2UA 4KMQA 1CE1L 5B7FA 3MR9B 1L9NA 5DUML 3VYNA 4CSSA 3NPSB 3FH5A 1FYHB 2DJ4A 5IGXH 1CE6A 1DL7H 3GSQB 4S1SL 4Y1AA 2VSDA 3FTSA 4X42A 1A21A 5SX5H 3ZU8A 1RK7A 3BUDA 4J8RA 3H3PH 1AFVL 1YRKA 3FAXA 1NGYB 2IO5A 2Z8WC 2XG4B 3H2WA 2VN4A 3WHXA 4BFRA 5T1LD 3OXSA 3UZVA 3U1SL 3O41A 1BIIA 4TQEL 1WE5A 5DYFA 2IFFH 43CAB 2HZHA 1KDJA 2VDKH 3HUJB 3JV5A 2X4TB 3T0XA 4LSRH 3OGOE 3SQOL 3PWVB 3D25B 3EOAB 4X99B 3NIDF 4DP2X 2VNCA 1DJYA 1E4XH 1B88A 2B1AH 2NYYD 4J2XA 4WIQA 4UQ9A 4L3EA 3MDJA 3QUHA 5JXEC 1TZ8A 3QUXB 3LZRA 4XPGL 2XXGA 5JHDE 2B59A 1XSKA 2CRYA 1XH3A 1XMEB 2W0PA 5ANMA 5I0YA 1IGJB 2IGFH 4QNPE 5IWLC 2KI6A 4PM1A 4KV5E 2V7HB 3TIEA 3GHEL 1XWVA 3VVVA 2P80A 2VITB 3HE7A 4O5LH 1CPUA 3ORJA 2BSED 2WGXA 2CCLA 3C87A 3C60A 1FZOA 3U9UA 1HYSC 4ODVL 1DBML 2JF1A 4I2XE 2BW4A 3CFUA 1A6WH 4TTGA 1IBDA 3GSRA 1AJ7L 5G5DB 4YO0B 5FYKE 4PRAA 4UYQA 1N8OE 3OAUL 2X6VA 5BZWB 4N2MA 3MKGA 1T5WA 4ONGL 4K3DH 3KS0H 3EFDL 3HC2A 4F5CE 1EHLH 1A2YB 3Q5OA 3D34A 4HOMA 2C8NA 1AGCA 4JE0A 4KK8C 3DNKA 1N6UA 3UYPB 3S37H 2ATKA 3UBXA 5F9JB 1CQYA 1F6AA 3MA7A 1GCYA 2PLTA 2HVBA 3DHPA 4PB0H 2I25N 4POZD 4QY8B 4GQQA 4M61B 4P2RD 3D50A 3MJ9A 3RNKA 3G9VA 2WIIA 4LCIH 1U95B 1BBJA 1MI5B 1AIZA 1TZGL 1D5IL 4H2AA 3K2KA 5DEFA 4X6DF 3RWGB 4H1LA 1PZ2A 1S7VA 3BZFA 3O11A 3LX9A 3HC4H 4JY6B 4A1RA 4JZJC 1HCVA 4OH2A 3AQYA 3QJFB 4G3YL 4N8CL 4TLSA 1NCTA 3VFRA 1P7BA 2AV1B 1UEYA 4H25B 2V5MA 4YDLC 1A6UL 1U8NB 5TFSH 1BDYA 1VGEH 2IIJA 4D9QE 5A7BA 5I30H 2NTFB 2NY1C 4P4KD 1T03H 1BVNT 1XR8B 2EYSB 1N2RA 3DOSB 4F8LA 1MVUA 2AKRA 2BIQA 4HP5A 5T5FL 5EUOB 4YXKL 3FO1A 4X7SH 4ZFGL 1NJ9A 1D7DA 4L1DA 1NDMA 5HVFB 1KDIA 1GYWA 1MEXH 4FG0A 4P4RB 4AVHA 5JYMA 3SHSA 2HT3D 5ITBL 4BQ8A 5ITFB 5D71H 2DQJH 2CO4A 5EIIG 4P46A 2DQDL 4PJBB 4HUWB 5BPPA 3ZTNL 1RUQL 3U48A 2K6ZA 3GTVA 5EV7A 2FX9L 1MREH 1KPVA 2H8PA 2BP8B 3HBQA 3D09A 2H2SD 1CDHA 4LP4A 4OZHB 1YEHH 4HD9A 1QD0A 5DS2A 2D2OA 1IEAB 4B50A 4Y2DD 3SPGA 2AQTA 4NRXB 2O72A 5FYJH 3QPQC 1K6QH 4KBPA 4Y19B 1U8LB 4KKQA 2ZUSA 1YEEH 4XNQA 3UO8B 5EBWB 3D18B 3DOHA 1CVSC 3X3FL 1FFRA 4LLVB 1HT6A 5DFVD 2O6CA 3TOPA 4CKQA 4S1SH 1NGQL 1R3JA 5CN2A 5DD1L 4MYWB 1WHOA 4TSAH 4YSEA 5M94B 3TNNB 3VB9A 4XNXH 3KPRB 1OAJA 4KKLD 2X9ZA 2WKOF 3QAZB 5IK3A 3RTQD 1GZQB 3N9GH 5KG9B 3MODL 2DY2A 4MSWB 4TQEH 4OJEH 3IJ8A 4G8FB 4GRMA 2C4FT 3MJ7A 3VTMA 4J8RB 2HVJA 5JZ7D 2XTLA 4LLWA 4HWZB 2NX5A 3T0EE 3WHXB 1V5JA 3OXSB 1OK8A 1AZZC 5IW6B 2BDNL 5FOJA 1N6QH 2VMEA 4NQCD 4LEOB 1KG0A 2FEEL 3L2LA 4HLJA 4QRTA 3BWSA 2NOYA 5IT2H 2FGWL 1CQKA 4F91B 1D7CA 1C5CL 1HCYA 5J06A 4BFFA 1PMYA 3GF8A 4X8JB 5MENE 3K1DA 3BFQG 4F1ZA 1V3MA 4BIKA 4RMWA 2DLFL 1Y18A 4XC1L 1MCOL 5DD3L 2G60L 2HXAA 1I1RA 3RVVC 4W70A 1A0QH 2IWGA 4FQLL 4PRHB 3FSZA 5F93C 3BT0A 1FUNA 1K4CB 1NUGA 4XRCA 2OJZH 1U3JA 2RCSH 1X5LA 3E2HB 1QYGL 4KZEL 2VT0A 3E80A 2D7TH 3BH8A 4BEIA 3C8DA 1LP9F 2H9GA 3R18A 5IFJA 1GHFL 1OWRM 1IO4C 1R9FA 4J39A 4PY7B 4M5ZL 4PWJA 1I1FA 3O4LA 3Q9QA 4IMLA 3BPOB 4BQ6A 1O6VA 1TNMA 4NP4H 4HFWA 4OZIE 5FHAL 4N2GA 4PRAB 4AYDC 3QP3A 5E9DE 1INQB 1T5WB 4WJ5A 4S1QL 5C8JB 2NZ9D 2WWNA 4QRPE 5E4EC 3WCYA 4QLWA 2L3BA 5FYLL 4FI6A 5F96L 2ATKB 3UBXB 1F6AB 1RZKH 1TZGH 2PNDA 4HEPA 1A9EB 4U7KA 4NO3B 2OMNA 4AC2A 4JFUA 5F70A 5JDSB 3RNKB 4ZXBB 3KDMB 2ZAIA 1HAUA 4TOYL 3FYIB 2VDQL 1BBJB 4BFEA 5DEFB 3VXSA 1P69B 3I50H 4DW2H 1GGBH 1IKNA 3FT4B 4LE8A 1ECZA 1TO5A 3LD8B 4UI2A 5L2KB 1KCWA 4P23D 3A22A 4G8GE 4ZW7A 4BZ2L 3FO9A 4DSYA 3VNYA 2GK0A 3EYQC 2XWDA 1CD8A 4HU2A 2G4EA 1TFHA 2E7CA 4MZ3A 3F6IA 1ZLUH 2VDOB 2UXGA 1G5AA 1SYSB 2AKRB 3BT2L 2H0JA 4EIZC 5J1TC 5TPWH 4NQDB 4K7PH 3IEAA 1OTUC 4I0KA 5TDOB 3TV3L 3WNLA 5I8EB 3QCVL 1RUQH 4Y4FA 1I8UA 2BNRD 1R5VA 3U7WH 5I71C 2OSYA 2JLPA 3S35H 1OPGL 1ET5A 1CGVA 1HHIB 1FLTX 3GKZA 2DF3A 4ZFOA 3ESUF 1CGUA 2MCMA 3NJIA 4AYEC 5GGTA 5CN3A 3GMLB 4A04A 3CZNA 1OHQA 2OA9A 4L5FH 2N4IA 3N0PB 1KPVB 5I15L 5IEKA 3HIZA 1JPGA 1MLCA 1KB9J 3Q8FA 4FQIH 1ZTXE 2BVYA 4JZNB 3VQLA 5ADOL 1F2QA 2ARJA 4JHWL 1A1NA 5ECJE 5ESAB 2VIRA 3VFNA 3BAXA 2YRZA 4WUUA 1MW3A 2RALA 2BFVH 2XOTA 4XNQB 1AXIB 3TBCA 3VXRB 2E6PA 1I9IL 3FSVA 3U4EB 2BZ7A 3MODH 4Q6IB 2ZCZA 1RZ8A 4GMSH 4OCMC 1EHKB 2Q2EB 4N0CC 5FFGA 3GNMH 4FQQA 3S34H 3V9EA 3PV6A 3QO0A 3QNZA 4AGNA 4L4VE 2E74C 2YAMA 5EHFA 1KTCA 5KWYC 2AQ1A 5DLML 1CTMA 1S5IL 4KZDH 4GRMB 3TEZA 3TM6A 3ESVF 3JT2A 1TU2A 1R4XA 4JY5H 4NWTL 3ZY7A 1L9PA 3HE6A 3O3AA 4ZMVA 4JG9A 3QEGL 3AVEA 1G9NH 2BIPA 2MH4A 2NX5B 3QRBA 2ED6A 2J71A 1BD2A 1G43A 1E65A 4NHCH 1XR9B 1LO4H 1OAYH 4QRTB 2X4SB 4MDRA 3NIGF 4K94L 4KI5D 3WUWA 2NRDA 4FQLH 2N1KA 5HHPA 3ZR6A 4OUUA 1PLGL 3TN0B 4OQ1A 1QYGH 1E2ZA 4L8BA 1Y18B 5CR8A 3MV9E 3HZVB 1XF3B 3V0DA 2B14A 2XJKA 4X0KA 1A22B 1GHFH 4UBDD 4OCYL 4EN3A 2CCVA 4ZMQA 2XLLA 1A6VL 4XAKE 1IGMH 3MMEA 1GMIA 4JRLA 3U6RA 1JCKA 2ZJSH 1HKLH 5IFJB 2Y24A 3OZLA 4ANWA 5D6CA 4LKXA 3H3BC 4WI5A 2EUXA 1ACCA 4IMLB 5BUPA 4KITB 3LKQA 1SRDA 1AMYA 3CZUB 1C8PA 1L6PA 1FN4A 1NAKL 4NZUH 5T3ZE 5IHUH 1BX2A 3AGWA 4ONHA 4M6NL 1PW3A 1OGAD 3HAEA 4FQHA 1G7LB 4GW4A 5IVXF 4JB9L 3D07A 5GRJL 2I07A 5JW4Q 4TOYH 1L0PA 2OR9H 4ZAKC 2PW2A 1BLIA 1T22B 1QZNA 3OKMA 1JNNL 2R4RL 2COVD 2A7BA 4AIEA 4BFBD 2YD3A 1YUKB 2WXFA 3UAAA 2NR6C 5IQ7H 3GO1L 2PO6B 5DQJA 1DLFH 3GDCA 4N2EA 4WW2C 5AVUB 1NCUA 1WVZA 1YAIA 5EU4B 5J3HD 4IRSC 3QPKA 1FDLL 4IGBB 4DUXA 4N86A 2XJLA 3ARGC 5FPIA 5IJBC 1GGCH 2Z0UA 4YFLF 5DMGC 3V6BR 4YC2C 4RSVA 5DJYB 3WFBL 5KYNA 1BGXH 5CZXC 4PV9B 4YZFF 3SE4A 5GS0L 1FH5L 1GKOA 4Q97A 1JF6A 4Y1TA 5E99H 2FQGA 4HCRA 5G55A 1P4UA 2IDSA 1OPGH 1QPXA 4KQ0A 2FJUB 5EOCH 1LVEA 5HYJD 3DO3A 2GUYA 4LU5L 5KSBA 4KK5C 3H0TB 3OPZH 1H5BC 1R5VB 2GB2A 1ROWA 3KBEA 1FVCA 4OLXH 2A73B 4XNAA 1H9DA 3GRWL 1J9RA 1ZVHA 4IQHA 4BK5C 4LPVA 2ESVD 2O30A 4JHWH 4DN3L 3OR6A 5ISZE 1R0AL 2WINA 4J3OD 2ARJQ 5A6IA 3BIBX 3HBGA 3LS5H 4JVPA 4MA3A 1UZ6F 4LOVA 1UKSA 4G7YH 3QEUA 1ASPA 2Y36L 2AEIT 1HN1A 1RUAL 5A1AA 2L0DA 3QI9A 2VE6A 4WSGA 3IFOA 4XVUD 3LKRB 3VFNB 2HLAA 4WUUB 4HBQA 2W9EH 3RX7A 3JT0A 1WQVT 4JJ5B 4BDVB 4E9RA 5KYUB 1BBDL 2KLTA 2XV0A 2Z31A 5BS0A 2K7QA 3KPQA 3HN8A 4ZMAT 1Z9LA 1KLUB 3R7QA 3DETD 3EOTH 2VDMB 2YAEA 2IPTL 4KMLB 5EO9A 3I3EA 3EKCA 3RAJH 3JUYA 3HVDA 4DESA 3QEGH 2JKSA 4I89A 4XNUH 4I9XA 3PV6B 5CGYC 2WGNB 3QNZB 3S37X 3VGAC 4BFJA 5C0CA 5ID1A 3LIZL 5FEBA 1KSRA 2CKBL 3LKPB 4Z7UA 5G4MA 1E28B 3CUPA 1IEBA 5AVVB 2IXQB 3QFGA 1OAXL 3GIVA 3PAUA 1TQUA 1A9BA 3HG5A 1XEDA 3N41B 1N9PA 1JPFB 2YZ1A 4RGMC 5EZOL 1T0MA 5CINL 4KVCL 4IKIA 4LCWD 4XPFL 5B39B 3VFSB 2F54B 1ZSHA 4EI0A 4TULL 1OPOA 3WOVA 3L5IA 3WUWB 5DD5H 3DGCR 1OL0A 2Z6FA 2QPDB 3V6OE 4XP9H 1TYJA 1JHKL 2H3XC 3TVMA 3PWPE 2BSSA 4NCC2 2VR5A 5IB1A 1AE6L 2R69L 1BVZA 3TCLA 3UBHA 4BWTA 3P0VL 3GXIA 1HYSD 2WVVB 4P2QD 4TUOB 3BH4A 1MAMH 3H56A 4HZLA 1E4HA 4OV5B 1P9MA 3RUGF 4B9JA 5CXPA 4YL4A 3SDXA 3W5NA 1XIWD 1IBZA 2ITCA 2XWBB 4AYGA 4X8XA 1NAKH 1EXUA 2JNZA 3S96A 2X2YA 1XD1A 2OR8A 3BWUF 4GSRA 4M6NH 4OY9A 3MJGX 5D93B 5HGDA 1JUFA 1WCQA 2H2PD 1FG9C 3IWVA 3NCCB 4P9HL 4N2KA 1OP3H 1URIA 1U8OA 5EG6C 4N1HB 3T65A 2M8XA 2XV6B 4G1MB 4GRWF 4ODXB 5EZJA 5C0EA 2GSGA 2WLHA 2AP2A 3N2JA 4M5YH 3IF1B 4ONHB 4PCKA 4WJKB 5GJTL 3RRQA 3ZDXE 5TQ2H 4Z3FA 4FQHB 1LDPH 5B21A 4C83B 4KVNL 1VEMA 2I07B 4UZGA 4HIQA 2WUBH 4P3DA 5E95B 3JZ7A 1TITA 2WWMD 4HHAA 2QTVA 2PW2B 4QHMA 3TWYA 5MHSE 5C6PB 1PNDA 4PJCE 4XBPA 3QDJE 3MRHA 2B4CH 5B38G 3OKOA 5L88L 1CTNA 1LK2A 1N12A 2FJSA 2P5EE 2W65B 2K45A 4Y9BA 3SKJL 3P69A 4Y8DC 2I9LA 3G5YA 1EGJH 1YN7A 2AEPH 4RA0C 2BNQE 3E8UH 3UYRH 4ZMPA 5GS0H 5E6IB 1JHLL 1QSED 1T5XA 1RIVH 1AY1H 2ZE0A 3UEQA 1HHHB 4QKTA 4PJEF 2NY4B 4PLKD 4K71B 4PLJC 4PQXA 3UGEA 2DWXA 1CL7L 2FYVA 1NL0L 4Y2OA 4KOBA 4CMHC 1ZSDA 4ODSH 4X7EC 3ZTDC 4UWQB 4MQSB 2H1PH 2MCPL 1XGYH 2FLRT 2OMVA 2VB5A 3CH1B 3CVCA 5KSBB 5BCAA 5BW7C 2DQTL 4DN3H 4L9LA 4JZOA 5K59E 1FZJA 5MERB 5C2UB 1O6SA 1CYWA 1J8HA 4DIXA 1RZ7L 2XZZA 3LDBB 2HYMA 2BO0A 3D0VA 3MNWA 5KJRH 2ED9A 4QI3A 4GY4A 2BHUA 3P4OA 3QPQD 1EO7A 1LDSA 2WINB 5I23A 5GS2D 3IAPA 5TE6H 3BPLC 3WXVH 4XVSH 2YBRB 4R5VA 2WNGA 5ILTL 2IH1B 2CGYA 5DJDB 1TQTA 3EGDB 4PMFA 2F5AH 2Q8AH 1YZZA 3EJSA 4JRXE 5BMFL 2BLFA 2EUZA 4MNHA 1B4JL 3G04B 4ECNA 3W0WB 1TQWA 4PJXF 3RB7A 1Z9OA 3NZ8A 4FTVB 3FSAA 1O7DE 4NO5B 1IEHA 2P7TB 3KPPA 1G7HA 3B2XA 2V7NB 4ADIA 5A16A 2UX7A 3LIZH 3DRTA 2VO8A 1WV7T 4OLZH 5FM5O 4L37B 3Q2VA 1CI5A 4R84A 2NUTB 4ZTEA 4A39A 4U0RB 2R0WL 3ARBD 1X7SA 3UP1A 4TN9A 3PGFL 1L6ZA 2ODHA 4H8PA 3KMDA 3KLAA 4FYRA 3B2UC 3A6BL 2E7LC 2HRGA 4XHJD 4ISVB 5BQ7B 2FL5B 3DO4A 1WAEA 3O4OC 1XEUA 1BAGA 4OM1H 4I18B 1AG0A 4KTEH 3KGTA 1AIFA 4XPFH 4ZYKA 1HXMA 2V9UA 1BG9A 1N3NA 3DJSA 2WBXA 2YPLB 1IM3D 1C08A 3GIVB 4MXQC 4LLQB 1A9BB 1WAAE 4RZCB 5C0GA 2VRAA 4FE9A 4Z7QB 4QRQA 1J5DA 4UMGA 4OUOA 2ATPA 4XVOA 3H9SA 5DGRA 1J10A 2WQAA 2XT1B 3MCYA 4LCCC 4A2DA 3RIFK 2Z4QA 3E38A 5E5MB 1EUTA 2EDKA 5KW9H 3CFEB 2WQ8A 4UIKL 1XD0A 3TVMB 3GJEA 4UCFA 5BRPA 4QJ4B 3GSOB 5ACMA 1JZIA 5SWSD 3SYAA 5KBDA 3FO2A 1U36A 2UZYA 3MLVL 3NZHL 2DBLL 4KK6C 3SJVB 4LLMB 2I5YL 1KWGA 2J4WH 4G6KL 5JMRA 4JKWA 3QS3A 3MNMA 3OHXB 3S35X 3SDXB 1MLBA 3G5ZA 1UA7A 4A7QA 2HAZA 4ZG1A 3JV6A 5T1LA 1WWWX 4PJIB 1EXUB 5J1AB 4RGOH 5HGDB 5IG7A 4WHYH 1ILUA 4XNMB 4RFOH 1SXNA 1T2XA 1MJ8H 4J6RH 3W3BA 3DMMD 2YFOA 4OFIA 5KN5A 2F19L 2HFFA 4LO9A 2CXKA 3DVIA 1UXWA 2JJVA 1SY6L 1FPTH 4NGHL 5F9WB 1AXSA 1RD6A 1X9QA 4GW5B 5HDBB 1IQWL 1ZV2A 5LXVA 1J87A 1MUJB 2A9NH 3T08A 2X12A 1DVFA 2Z0BA 2WOBA 3Q1SL 2A6DB 1AACA 4FLHA 2ZP0T 1FVDB 1FNAA 1O75A 3MRHB 4DH2A 5IESL 3OKOB 5DTFA 3CPLB 1LTXA 2PPDA 2BSEA 4QMEA 2XYBA 3PDOB 1HNFA 3DX6B 2I9LB 3PE9A 4UQCA 1YN7B 1JF1B 3SKOB 2QMJA 4C56E 3K6SB 1FH2A 1T5XB 2XTSA 4A7TA 3SGKA 5JOPD 1OTUD 4PW3A 4A63A 4B5EA 4HZAA 5IP4A 3SEPA 1UACH 1QEWB 3UTQA 3WTVA 3CLFH 3VI4A 4DN4H 4M1DH 3FH7A 2NUPB 4R8WL 4Y2OB 4C4BA 1SDAB 2X4RA 4U6VH 5GJSL 2VWEE 2VLKD 3NRPA 2OBGA 3KXFB 3PL6B 3KLSA 1PZCA 4GFTB 4CJ1A 4JJOA 1DBKL 4WCYL 1CU4L 3L16A 4XZUB 1ND0A 4UT6H 3RX5A 4RAVA 3HHMA 1PZ5A 2VRQA 3QG7L 5LB1A 3V7MA 5HHNB 2QVKA 5EO1B 5D7IF 4PWKA 3KWXA 3MNWB 3CVHB 4DP5X 3B9KD 5C9KA 3P4OB 1OWWA 1F00I 3TBYB 4WNQA 4YNYB 4A7UA 3KLDA 4K5MA 1L3WA 2X4NA 3V2AR 4UNIA 5GIRB 3PG2A 2Y7OA 3NCYP 3OKLA 5IB3B 1ZPLA 5FLVA 1REIA 3L5WA 2M1KA 1Q9LA 3FHAA 5CCKL 2N7AA 4P4KA 4PJ8D 1GVIA 1YY9C 2ICES 1G7IB 3IKCA 3MGOA 5H37H 3HRZA 3D69B 1OLLA 1D9KB 3NZ8B 3MNZB 3NSXA 4MNGE 2Q3ZA 3KPPB 2ZOLA 4FI8A 4MZ2A 4PRDA 1UWGL 2HPOA 1BXVA 2WSKA 1HCFX 4F7MA 4KKPA 5A16B 4YE0A 5HY9B 2EVJA 3ESOA 4PJDB 4UDTA 3CHSA 3DGDA 3I75A 1T7XA 1AQKL 2WO2B 3HG1D 2DQUH 4ETYA 1G1OA 2GCYA 3QZPA 3KLAB 5C7ZA 2UVEA 1G7MB 1Z3GH 5DJ2A 4EIBA 1O9ZA 5MEPA 5B8CA 1HI6B 4TSBH 3VFMA 3LXCA 2N0MA 2Y06L 3N42F 4XC3L 1X4XA 1HXMB 2VZ3A 3L3JA 1F8TH 1KGXA 3CN2A 1Z5LA 4G6MH 5BZDB 1C08B 3C5SA 1JFQL 3BCDA 5FW6A 3U0WL 1SFHA 3T4AA 1CXEA 2EDQA 4G5ZH 1RZJL 2R4SL 2GJZB 2Z4QB 3IS0X 4L18A 1KXTA 4DP9X 1RSFA 1AI1H 4HUXA 3DX4A 4LSPL 3RJDA 4EUPB 4DP4X 3QXAB 5L0QB 5CFHA 4JPWH 3L4TA 3BVNB 3I9AA 4M7LL 3MREB 2I7SA 3FO2B 3QEQD 1U8CB 4NXKA 1ZVSA 1BM3H 2G4GA 3WE1A 3WE6B 2F6AA 4K23L 1P84K 4RIRB 4MXWL 1EZVY 3O6KH 5DJZA 3BXNB 1NFAA 4JQVC 5D7KD 4FNLH 4ZUUA 1MLBB 5GSVA 4LRIC 5AYUL 2ZXDA 2O5YL 4RX4D 2QL1A 2EJ1A 3IFNL 1FNGA 5I1JL 2BHFA 5IG7B 3WGVB 1WIOA 1UXSB 3RY6C 4JKMA 3ESNA 5IM7A 5JOEA 4Y5XC 3GSWA 3NP4A 1FFOB 2HFEB 2LR4A 5FC9A 2P8PB 1CI3M 1S7SA 4K3JL 5TQ0H 2HFFB 4NZTL 2FWLB 2QLYA 1UXWB 5GGVL 2XBTA 5IESH 3RDJA 3FQ2A 1YEKH 2NR6D 3EAKA 4WY7H 3UBXI 4AUUA 5EZLB 3UGXA 2WP3T 4XP5H 1JDDA 4IRSD 1CDYA 2BSTA 5IHZA 3LEVH 2BVPA 5D2NE 3ARGD 1COBA 1HH9A 2QR0B 4YL9A 4U4IA 5CMAB 3ZL1A 3Q43A 1FA4A 5CZXD 2VR8A 2Q7AA 3P2TA 3EF4A 1KCUL 2NSXA 5JIKA 3ESPA 5DDHB 5FM8A 4AL8L 2WYIA 1UB6A 5E00A 1UJ3A 4KQ3L 4I77H 4UV7L 4AW4A 1MF2H 4KGJA 3X11A 2AC0A 4LF3B 2YARA 3BLBA 1KTRL 5FF6B 8FABA 3UTQB 3II1A 4KRLB 3E1ZA 4WHYG 3NAAH 2ERJC 5ESVA 1BYOA 5F8RC 3KLHD 4AQOA 4BKLB 2BINA 3RZCA 1K9TA 5BRZD 3GI9L 3A24A 1LYQA 2KUTA 3L95B 2IPUK 1ND0B 2CRMA 4UM8B 1KULA 4E36A 4P2RB 4RAVB 1PZ5B 5LCVA 4PJGF 5JW4N 4AQ1A 1UT1A 1IAII 5A3ID 2ZX8A 3VQ1C 1AD9A 5DC4B 4N2NA 1GGTA 3A0OA 5AVZB 2FQFA 2J8OA 2HUEA 3I3DA 3FC8A 2F8OA 5FO9A 3DX7B 5B1BB 4HKXA 3NJNA 3P0YL 3GBML 4AQZA 4HEMA 4K5OA 4ODHL 4AGPA 3E9TA 3RVWC 5KSVB 1FO0A 3MRMA 4KO7A 5FUZL 2Z65C 3L5WB 1ADQA 3HUJE 3MBEC 1A14L 1JK8A 3FPYA 1PDKB 4PRNA 2OI9C 1Q9LB 4HFUL 3MV8D 4P4KB 1L9OA 1SN0A 2R1XB 3X1GA 3BD4A 2J1ZA 1MWAL 5JTWA 1AANA 1AQKH 4MX7A 4XMKL 3VXUD 2DICA 3GK8L 2BNRA 2ZOLB 5FFOA 1RZKC 4F7MB 4BSWB 5CSGA 1D5MB 4Y8AA 4TVPL 4ZDHB 1KJ2H 4APQC 3II2A 2PPCA 4UDTB 1OP9A 4X4KA 5PCYA 5B4MD 3RGVD 2XQ0A 5D5MF 4Y5VA 5E6RB 5J6GA 3D7PA 3K8MA 5F6HJ 1FGVH 5B3JF 1IQDB 1ORSB 1QRNE 3QC5X 5J0BA 4UQAA 1SOQA 4E41D 3K5SA 4I0CC 1USQA 4AIOA 4Z18A 3MRCB 4C55A 1X5AA 2EDOA 5B8CB 4NZJA 2Y4SA 4XPAH 4WQOA 3T04D 3WNOA 2DQMA 3VWKC 2VMJA 5FDYA 1E9QA 4NJ9H 1M6OA 2D8KA 4Y2DB 3HS0A 1OXYA 3DGGB 4KXDA 4U1GB 3C5SB 5DQ9A 2OMWA 4P2OD 3ZHKA 1L9MA 2QPSA 4BXSV 2H45A 1VCAA 4W9LC 2YOCA 3ZMRA 1F41A 3LZNA 3QBTB 2PTTB 2Y25A 4Z0XA 1NBQA 3S5LG 4F7CA 3IETB 5F7UA 4KX7A 1X3DA 4B41A 2WZPD 1M05B 3F6JA 1UT2A 3PWLB 1A02N 3CN4A 1W80A 3OHMB 2BHYA 3RTQB 1TEYA 3OKNA 4PW9A 2O5YH 1ZVSB 1BLNB 2HJKA 3EO0A 4FG4A 4BH7A 2VABA 2XZAH 2EE2A 4IJ3B 5E8EA 4BKSC 2X4UA 5IFHL 1FL6B 5LDUA 3LHPL 5J57B 4A2GA 1TG8A 4S1DD 3F7VA 1SLUA 1IJNA 2ICEC 3MBXH 1AGEB 1MY7A 3W2DH 2F7IA 3EF7A 1FNGB 1FP5A 4OLVL 4EI6A 1IC7H 2EINB 3MV7D 3ZYOA 1RP8A 4I0PA 4NQCB 3SKNB 1B90A 5IM7B 2RB8A 4YHIB 3JWDC 5IOPA 4Y4KA 1SLXA 5EN2B 5T1KA 4CGUB 4MWFA 4DOHE 4XMLH 2FGZA 5HHOA 1IGIH 4UTAA 4QRRD 1IGTB 5CM1A 5L4FA 2COQA 4KY1L 4A2EA 2W8CA 1MHEA 1CXHA 4LMQI 2OL3L 3U2SB 1KCUH 2YD0A 4PJBE 4WTZA 4XMVA 3Q06A 2E7MA 1CR9L 4XCNB 4ENZA 3HA0A 4PJHB 4UV7H 1E9OA 3S5YA 4B9YA 5HYQA 1MHHA 3NCWA 3K71A 1TQCC 3NUKA 3ULUL 4OZFH 1PX8A 4YGVB 2JKTM 2H32H 1FL3A 1D6VL 4OZHE 5FUCE 2V3FA 3PRZA 5JLZB 3C08L 4ZS6C 1FRGH 1G9NC 4FA8A 1KXVA 2CLZA 2HP4A 1UJ3B 2IAMC 5L4IA 5HYFA 4Y19E 5IUCA 2DQIL 2DQFB 4R5TA 1BZ9B 4WTXA 2SODB 1J88A 3NJMA 1LE9B 4NRYA 3IVKA 2JJSC 3MU3A 3PAYA 1OGAA 5JUEL 3RFZA 4I88A 4J6IA 5DMIL 3N91A 4JG0H 3U79A 5B1AB 2YGQA 5C08A 1V3LA 1DQQB 2R56H 3A3YB 4X5QA 4Y1AE 1AD9B 4KJWC 1G9HA 4BK8A 5HYSG 4PGJA 1TO4A 3OJMB 2BHZA 3WDIA 3P77B 4O2EA 1HH6B 4JFSA 2LAGB 4JO2L 1YPZA 4AENB 1J0HA 3HBZA 2UY6B 4HFUH 4UQDA 3JXAA 3T0DA 4WDIA 2VDLL 4E9YA 3D4GA 2G75A 3WUZA 4P23B 2V17L 1FO0B 2J5LC 5CIPB 3CFBA 3Q5YA 2E9GA 4FA6A 4ADGA 2BNUB 1OARH 5EDXA 5DLLA 4PRNB 3S4SB 2G0LA 5I5JA 1IGFL 3T9WA 2G5UA 3CSTA 4O02L 4G5AA 1JV2B 1JK9B 1JGUH 3GMRA 3TBTA 5HYJA 4L3EE 3K5RA 1ET8A 2DW5A 2WKLA 2L7UA 3FUKA 4MX7B 4P59L 5E1AB 1U6AH 2BNRB 5IIEA 1DQLL 4BHUA 3W38A 3IKKA 3NOIA 4LAQH 2FVNA 4OM0H 4G82A 5LAXA 5ANME 1MH5B 1ZCRA 2AJYL 1OM9A 2Z35A 3LNDA 3QQNA 4IRZL 3RA7L 3CZSA 3RYMA 1AQ8A 4Y5VB 6FABL 4MXQD 5BXFA 2PKDA 3DYMA 1JG9A 3QNXA 4WK4B 1RIUH 4P2AA 1BZOA 1DQML 2N7SA 3AJ7A 3LZLA 3T3MF 4DCQB 2VL5A 2YRLA 5A2KH 2VUKA 3PFQA 4GUPB 5E51A 2WWKT 3S36L 1S7TA 3NZSA 5EA0L 1NPUA 4RH4A 1CFBA 4CRPA 3DX8B 1AQDA 4UINL 2E6JA 3B8SA 1E9QB 1IBGH 4A6YB 5CBAA 2Q3XA 3IMRA 4Q9QL 5I5IA 2DQ6A 4LLAA 2QDWA 4JN1H 3MLXL 5JW3L 2MQ0A 1Q90A 3PGDB 4U49A 3H9YA 1J5CA 2EE9A 3BZ4A 4S2SA 5IMOB 5JHLA 1DN0A 3UCQA 3K2UH 3X3GH 4Z0XB 1QLEL 3QJHA 1CO1A 2EDFA 4F7CB 4ABVA 5IFHH 4CSPA 3LHPH 1DVYA 1NBVL 4ZZKA 2WWOA 2ZSVA 1ZT1A 1H0DB 2FLMA 3NQIA 4KPHL 4JDEB 1JNLL 3F5WA 4OLVH 3BO8B 5DHDA 4TPRL 1TQBB 2X4UB 1UOWA 1SN5A 3RJQB 3AXLB 3SDYH 3A4EA 1UQSA 1CGSH 3OVUB 5D2LA 3QNYA 3WNJA 5KOVC 2QELA 3UMTA 2DKSA 3HB3D 3ECQA 5JXEA 2CE6A 5FW8A 5FYKL 1AZRA 3KW8A 2EO9A 4EI6B 4KY2A 4MZRA 5AWNH 2IQ9L 2R2EB 1XGPB 1NMCC 3NFPA 4JO3L 3HFFA 4AMXA 5IWLA 1Q72H 4EAEA 3ZTJH 1L0YA 2IJ0C 2WLMA 5KVEE 1CR9H 2Y2YA 3CXHK 3FN0H 1CD0A 4V1DA 4DGVH 1BOGB 3T0VA 1A1OA 2Z8VC 4FQ1L 4JM2C 4XOEA 1WIPA 5FDWB 5BZZA 3OMIB 1L5GB 3WU1A 4WWPA 3ULUF 3LXAA 1K5NB 5KVGH 3C08H 4ZFFA 1UWXH 1TSHA 3B6SA 1P1ZA 5CEZE 1E9OB 4WZ9A 3MX0B 4UQEA 1E5AA 4NUPA 1MHHB 4PRPA 1QUPA 3K71B 4OJCA 2CO7A 4OB5L 1K4DB 4PGBA 1YN6B 2OMTA 3V5KA 2J1YA 3L9EA 3C2AL 5JUEH 1BECA 4LIQE 4HS8H 4RDQF 4YHML 4YQXL 2J25A 5E4IA 2ZSWA 4D3CH 1XHHA 3Q8AA 1I7RB 4NRYB 1OGAB 3MAWA 3CHQA 2FSDA 3MLYL 3F3HA 3RFZB 5IMMA 1I3GH 1CGYA 2D4DA 1GC1L 2Z8RA 2A6KA 5DI8A 3BAEL 3NFNB 1SJVA 4KJPC 4U3XA 3BISA 4JZJA 4NCC1 3TZVD 4AT6A 2NDGA 2HX9A 3C5ZC 1XMWA 2JB5H 2WQVA 3IGLA 2CBMA 3QJQB 1NCCL 2O6DA 4HH8A 3DKHA 1MCQA 2K70A 4MB4A 3QNFA 3RWDB 4ACPA 3BD3A 5C2BH 5SV4A 3QIUC 1YY9D 4GFXA 1MFBL 2R2HA 1UM5H 1WD8A 1KPRA 4FXKC 2NX5E 4GUCA 4J8QA 1QR1B 4X7DC 2JV6A 4B9ZA 2D7PA 5B1KA 5E7FA 3ZKSD 3DBXA 2VDOH 1LQSR 2ZF9A 3EG9B 3LQAH 3RPIB 3GRWA 3NACL 4GOSA 1BXXA 3GXTA 2DM2A 5CJOH 5AAMC 3G6JB 4O00A 3PWNB 2ODIA 5HYJB 5IQ9A 2BS71 1CCZA 2WBWB 3GUFA 4GAGL 1P0SE 5DMJB 5GHWL 3UG5A 4NM8H 4H0IA 4X4YA 5IIEB 1UGNA 1NCBH 4UF7C 2B4CC 5IY5B 5ID0A 5LAXB 5TK4A 2WZ6A 3S36H 2Z35B 4B96A 4RWYH 5F6IC 2OYPA 2ESVB 1NEUA 4AE1A 1H6TA 5CLTA 5JW3H 1JN6A 4WHTA 2DI9A 3L81A 3O4LE 1XZWA 3IDYC 1E27A 1AAJA 1QSFA 3OLDA 1H6EA 1AQDB 2MRYA 2SEBA 1FFQA 1SN2A 2XQYA 5D1ZD 4EMZA 2JMRA 3A67H 3CC5A 2A38A 3GMPA 1V7NL 3OXRB 5AVXB 4AM0A 3AWGA 3ILQC 4XWGH 1AGDB 1MQKL 3LZOA 5DJ8A 1FNEA 3U0PA 1OCZB 1F4YH 1NBVH 1W2KT 3FDWA 3MGAA 3QDGA 1RCYA 4K9JA 5LQBH 4KPHH 4NP9A 4QNPF 1JNLH 2NZ1A 4GO6B 4KXZH 4R96B 3STLA 4KV5F 5D1XD 4LMQE 4HLZH 1A7QL 2LFEA 3B7RL 4G70B 4UZSA 5AW1B 2CGRL 4M1CC 2AITA 5C0RL 5TH2B 3DUHA 3TIDB 3KNBB 4NKQB 2XFXB 4CU8A 5F7HA 5FO8B 2QKIC 2DTML 1L6XA 3ASWA 5GZOC 4M6AA 3HC0A 2BCKB 2YAOA 2FE0A 3QIBC 3VXSE 1XB6A 1X6LA 3QDMA 3SN6N 1UQSB 5D2LB 1FI8C 4WI8A 3WBDA 1QEXA 4Z7VA 2Y0SA 4ZMYA 5H2BA 3MYZA 4LCWB 2IH8A 2YSSB 3FF8A 4QGTA 4UT7L 1MRDH 2J5WA 2M2DA 3WS6C 5D1QB 5D8JL 5AW3B 1MFAL 3RY4A 3A21A 4WNJA 4XBGB 2XA8L 2AZUA 4LARL 3IDMA 1I53A 1QTPA 4HF5L 2WTPA 2FSEB 4P2QB 2E7HA 1TUPA 4Z95H 3UZQB 4ZFFB 1NZRA 1VZGA 3FTGA 4CC0A 4XMXA 3IFPA 4QDGA 5AAWC 2VTFA 1XIWB 4YQXH 1JVKA 2DMCA 3CXDH 1SYVB 3EFFA 3F83A 1QI3A 3VXNA 1X5KA 1GOFA 1A7RH 3CX2A 1VFBB 3V5KB 1CD1A 4D9LL 3D4CA 2WQSA 4HAKA 4HJJH 3BIKB 5AW4B 4WUUE 2ZXBA 5I74C 5I1IL 1N10A 4KJQC 3KWWB 3UC2A 1AZNA 1J9CT 4MMZC 3E3QE 2C7UB 2C1PB 4QAMB 2VW6A 5IMMB 3WHE0 5L7XH 2ICWA 1KCRL 4PUBH 2ZAGA 4LPYA 3F12A 3VI3A 1KGYE 4H7VA 4L29B 1QTYT 4FNRA 4QHUB 4HU8A 3SYCA 4TVUA 1QFUH 4OD3L 1AR1C 3MBED 4NDMA 5I18H 5CLWA 2AXWA 1BOYA 2P5WA 4P04A 2VC2H 4M7JL 3BN3B 4WI4A 4XX5A 2PPAA 5EBMA 3VTAA 1UCBH 3IMTA 3QCUL 2FBJH 1QSEB 1ZTXL 2EDLA 1BD2E 1JE6A 2VXSL 2QV2A 2YWZA 3F2LA 2F54E 2WXQA 4HKJA 3WMQA 2OQJB 3HNSL 4GW1A 3MLRH 1LE5A 1Y6KR 4I13B 1ZD6A 3C12A 4PJFF 3X17A 4AEHH 1WWBX 5DUBB 2PUQT 4AIZB 4M6OL 3LXUX 3QUML 2Q76A 1VEOA 4X4YB 3PV7A 3UBXG 3OSVA 4HJSA 3R06A 4IU3B 2F61A 4NUJB 4YMPA 5AZEL 1OT4A 3RURA 5AOKA 2H0PA 2PMZA 2ZWLT 4MCZB 4ELMB 2OMXB 5EFIA 4NUQA 4LL4A 3IU3B 2KZKA 4HHGA 2JJUA 5EEWA 1E2VA 1OAZH 3NA9L 2ZYIA 4WHTB 5LAPA 2A77L 5F7AA 5KOMC 2O5ZL 3VXQB 1ZANL 2OFQA 3F7PC 3QUKB 5DS8B 3S6CA 4J3VA 3CWGA 3O2DA 3N5AA 4HK3N 1U91B 5HJ3A 3CC5B 2MKLC 2XY2A 3JQOB 4KH2A 4Z3EA 5C0AD 1AGBB 5JR1L 1AH1A 4U4BA 5DR5L 1DQDL 3U7YL 4YSQA 5C3LD 2ITFA 3ZTCC 5DJ8B 2VISA 4NQED 3U0PB 5D7SL 4XMPH 4YXLL 2WLLB 5GGRB 2Q7YB 1ZLVH 1K8IA 3WS3B 3OAYK 1LO3H 3QE5A 1BFVL 3IDGB 1A66A 2VW4A 2C3WA 4GB9A 2W94A 1NFDA 2I26N 5EU3A 2K9UA 3LPOA 2VMCA 4K3EL 4R7NB 2GC7C 3ARBB 3ZDYF 4KROC 4HAGA 2O93L 2O5XH 3MRKB 4DEWA 2LFGA 4ZJ9A 2TRYA 3HC0B 1TZHA 1T89C 2JXMA 3BH9A 4WW1B 4QO1A 4WWKD 3T8XA 4GG8B 4C4UA 2YEZA 3FU9A 1A4JA 4TNWK 4F3FA 2NTSP 4YDJB 5CWSA 3B5TA 1IM3B 3VD3A 1S9WB 3N41F 4IEFB 3OLIA 1R24A 5T3ZL 4LARH 5LKNA 2LQRA 1K3ZA 1CFNA 3CFIC 5KSBE 2CO6B 5IROC 3QJOA 3TT3H 4O2FB 3FT0A 3Q44A 3RY5A 5SWSB 4DP8X 3QA3A 1MFEH 3BOVA 3BJLA 2YWYA 4FFZH 4ZS6D 3HPJA 1W0VB 3GMMB 2DLIA 3MQIA 3C6SA 4Z1PA 3SYOA 2J8UA 3KYNB 1OGTA 1A7NH 4HGMA 5KSAC 2LGNA 5AG9A 3S3PA 3WIFA 4TM9A 3VXNB 3V4VL 5E4EB 4PR5A 5KS9B 1IVLA 3FPXA 3TC9A 3WD5H 4FMFA 1DR9A 2ISDA 4ZAKA 4DVRL 2FWOB 3DMMB 2ZCKL 4XXWC 3KBFA 3CBJB 4CSTA 1NGZA 3T2NL 5K9JL 3KZ8A 1UZ8A 1NAMH 2X3CA 2P3YA 4RDBA 1H15B 5ADPL 4HIXL 3WFHA 1BP3B 2NR6A 2Y9RT 3NSCA 5BS0E 4WW2A 2K8QA 3SDCD 4IRSA 1HOCB 2BWIA 5F88A 1QR4A 5D4HA 4F1SA 4TNVK 3EZ8A 2EVHA 3VW3L 1KGCD 3ARGA 3BUBA 5JA8B 1ZTXH 5C0CE 4LSQL 3UX9B 1NKRA 4KX9A 3GKWL 2VXSH 1AD0A 4Z7UE 2F53D 3QJRB 3X11B 2VLRA 5EBMB 3AMLA 2BVTA 1J0YA 2APVA 5E2VL 2YPLE 5C09A 1IJ9A 1A6ZB 3V4UH 4XBMA 4LSUH 1N64H 3EDJA 3GSNA 4MD5B 2FH8A 4ZOEA 4Z7QE 1MCDA 3DVFA 1H5BA 5FA3A 4M6OH 3APDA 1IKOP 3BI9X 4HKJB 4MNQA 3VFWB 1Z3RA 5HHMD 4GW1B 4BK5A 3IJHA 2E5EA 4D8PB 3P4MA 1NLBH 1FNSH 5AZEH 3WN5B 2VLKB 4OD1L 3UIYA 4LGPB 3PHSA 4OGQC 4CVXB 1HHJB 5JIMA 1JPSL 1UFGA 5D96B 4ZNCD 3SJVE 3FZUD 3UCRA 4R7DB 2NT0A 2V8MA 1ASOA 1DJIA 5KVMC 2AI0H 4HEPG 4P5RA 5DC9B 5AKSA 5IB5A 2O5ZH 2BY0A 1ET7A 2FB4H 3P02A 3B9KB 1CFSA 5EFIB 3SDXE 1OW0C 4MVBC 4OGXH 3GXPA 3OAWA 3PJLA 4FOMA 5JR1H 3TH2T 4PJIE 4DP0X 3T4YB 3GGWB 5DR5H 1F4HA 1N4XL 3LKOA 5EUKB 1UXMA 3T1FA 4AITA 2ID5A 2DWYA 1OE3A 3FONA 1N0LA 4BM7A 2BY2A 4Q58C 5AG8A 1OZTG 4DTGH 2JKJA 4PJ8B 3FKUS 4ZO7A 2CXGA 5BV7L 1W91A 2OV0A 4U1SA 3D39D 3ZZQA 1JAEA 2W88A 3F05A 3TPUA 3CAFA 5DVMA 3QQ4B 3V6FB 3IXTA 4L8DA 4XT1C 1ECYA 1D5XB 3QB7C 1OTTD 1XXFC 3FQ4A 3OX8A 4DKEL 5LDSA 1IRAY 3WENA 4DZ8A 3UG4A 1XH0A 4X9BA 1NFDB 4DVBB 3HG1B 3N44F 5JHBA 4LHUD 3IDNA 3ASOB 3CZFA 2M26A 2ZUTA 2MSPA 5T33L 5C71A 2IOOA 4MCYA 2JXMB 2JCCB 1AR2A 2YEZB 1F11A 1QVOB 3OC8A 1A4JB 4BA8A 2HH0H 5I6NA 2GTQA 1D2PA 1I1AD 1SXCA 2YSTA 3KEHA 3BSZL 3R8BB 2GFBA 3KJ4C 3ZT6A 4BFOA 3N6YA 1R24B 2WUCL 5ALBH 2XPZA 4FFTA 4L48A 2C3VA 2AABH 1CFNB 4RAUB 3PXLA 1FWXA 4EBQH 1AP2B 3ULSA 2YR3A 4NPYA 5HDOA 3LV3B 1XXDC 1J8HE 5SWZA 4IBTA 2HPTA 2Z93A 2X09A 3AITA 3QEQB 3FUIA 4M93C 1KY7A 1CUOA 2E3VA 4LBEA 3G7TA 3ARYA 1AOZA 4MJ5B 1SMDA 2QTEA 3FQWA 1OP5H 3IJEB 4XE5B 5IVZB 3UJTL 1EEZA 3QQDB 2BFGA 3BWZA 2ZCKH 1KBPA 3S36X 3L4CA 1A6TA 3BJ91 4XOAA 5K9JH 1HHGA 3P30L 5ADPH 3QFJB 4OBSA 2VXQH 3FL7A 3G5VA 3KYKH 1W72L 3FCUB 3KH3A 2CDEB 3TA3D 2GHZA 3C6EA 4ZS7H 1FLRH 2YGPA 5B39G 5T5NF 5TJWK 2NNCA 5INDA 1MRFL 3C5ZD 1TLKA 4LSTL 3WUWG 1U30A 1PYWA 2VM3A 1ROCA 2W1NA 3KCPA 4BUQA 3GKWH 1A6PA 3WFEL 1JCVA 4IRSB 5F88B 1KV7A 2HG0A 1RURL 3CSPA 2OLDA 3LEYL 3MCLL 2UYLA 3EYVB 4ZSOA 3GTNA 3ARGB 1SDDB 3AM8C 4DKFL 1FYTD 1KIRA 3L7EA 5JO5A 4XBEL 3REWA 5LXGH 4BFKA 3GC3A 1R5IB 2QVFB 1AD0B 1H3WM 1CF8L 1UFUA 1OF2B 4G7QB 2AEQH 3O2VH 2OTWA 4OIFA 2OK0L 4P99A 1CFMA 1QTSA 4G9DB 2VO5A 1R75A 5JXAH 5I16A 2VLME 1E6JL 4OKVA 4HJGA 3UTZB 4FQPA 1ZA6A 4OD1H 4HGWA 1PSKL 1WF5A 3GSNB 3H7BA 2XKUA 5FV1L 5BW7A 1TEGA 3K2MC 1H5BB 1C5BL 3T0AA 3H9SE 9PCYA 1X5JA 1M2VA 3PJSB 3IJHB 2H47C 3MRIB 1YECH 3B2PA 3P4MB 5CJ5A 3V79C 1GIGH 4XNBA 1JWMB 1N68A 3GB7B 1KB9K 2HJLB 2VUOA 5BRZB 1FAIH 1UEMA 5GS0D 3MCG1 3BMVA 5HVHB 3EOYG 1IC5H 3HCVB 1YYML 5DJXA 1XT5A 3ARUA 1KELL 5EIVA 3F64A 2WXJA 1GYCA 1N4XH 1CK0H 4LSDA 3VSVA 1F45A 3J7HA 3GS7A 4QXGH 4JQIL 1MVYA 3FT3B 3ILQD 4Z7WF 3TBVA 3CQPA 4UILL 2DDQL 1NCOA 4J3XA 3BP6A 3NJKA 3QG6A 3OJVC 2BCMA 1LILA 2RMNA 2EIZA 2NXZD 5EIIA 3LKOB 3SPHA 5IR1B 3BZEA 5DMKA 3MV8B 5I75B 3SZKC 1NANI 1OT1A 1P5VA 4K8RH 2AXFB 4YSSA 2YAPA 1I1YB 4JFZL 4M1CD 1S8DB 2FATH 3VGAB 3VXUB 3IXTB 4HOZA 1MRCL 4L8DB 2Q2LA 1EIBA 2E7LA 3Q6GH 2JK5A 2PP7A 3QIBD 3FBQA 3RIKA 3L17A 1ZJAA 1KTDB 1O6TA 1QI5A 3T3PE 3RGVB 1YEDA 3BKCH 2WLKA 1AC0A 3IE4A 5T1DH 3F7YB 2BM3A 2CWRA 4E41B 2R1YB 1KBVA 2XBDA 1MJUH 4ZFZB 5FKPA 4NQSA 3COOA 3HFMH 2HKFH 4MCYB 3FUMA 3H1ZA 5DUPH 3FULA 4LCCA 4MA1C 1ASQA 5BUAA 4N8VB 4XXDA 1NGPH 4E0RB 2GFBB 3ZDXF 1QHPA 4XB3A 3VI4E 4P2OB 4Z0BL 3SPCA 2RIKA 2LU3A 1EX0A 2YPVA 2DYPD 5I6XC 4PJCF 4GMTH 2NCMA 3RWFB 3NMEA 2IV8A 4LQ1A 1PL3A 3H9HA 4W9ZA 3L9BA 2C26A 2IF7A 2X1PA 1T6BX 1LEKB 2BVOA 2Q86B 2Q6WA 2Z93B 4JE4B 5ALCH 2OYLA 2K7PA 5TDNB 1F3RB 1IAIM 1DBBL 3M8OH 5DFWH 2G5BA 3B34A 3R19A 5B3NA 3B3BA 3ZRCC 1YHPA 4CBPA 5D70L 1CDUA 1QW8A 2F5BL 1EV2E 2OTUA 1A6TB 2VZSA 1HHGB 2FX7H 1WK0A 4ENEC 2TSBA 3MV7B 4LSTH 5DZAA 4F57L 1JYWA 1VFMA 3IRCA 3EJYD 6TAAA 1AZVA 3WFEH 2EVGA 3MCLH 2Y7LA 1XGRA 1RJLA 5F1KC 1LJMA 1NGXA 3ABMB 2CDFA 5K59F 3ALPA 3MLZH 4RFNB 4QRRB 5E2UL 2VDPL 4U3SA 1Q9WA 3QAZC 4EIUA 1HJCA 5GRVK 5FGRA 3N55A 5KVDE 4L4TA 1ZE3H 2OSWA 1OALA 5L9DL 3L7EB 3WIHL 3REWB 1BQRA 1E4WL 2O5NA 4G6JH 3CX5J 4Z7NB 5GSRA 1QQDA 1TTCA 5CR1A 1C5BH 1WZ1H 2EXWD 2OTWB 3ZYJA 3C8HA 4PRBA 4CMHB 5JQHC 2ZP8A 3BGAA 2E76C 4KJYB 1EMTH 1ZDQA 3Q5TA 4HJGB 4QXTA 5LNEA 3LNIA 4DT2A 4PJ7F 4F20A 3H7BB 1ZLWH 4BYHA 2E9IA 4YLQT 2KZWA 3QSKB 2YAFA 2XXFA 3SSGA 1CTOA 4FFWD 1J05B 3BHBB 5LUMA 1KELH 2E8ZA 2FEDC 2A0LC 4YXHH 2R8SL 4BHUI 1TQSA 2OXGA 5HDQH 2FIKA 4PJAB 4TQ8A 4B97A 3E2HC 2OCFD 4L05A 3FNKA 2D7MA 2OZ4H 4OGYL 5IFAL 4E42B 4PWIA 5CD5C 4QOKB 4H0GA 1MCPL 4EDWH 2DDQH 4YSPA 3P54A 4U6XA 3UZEC 2F58L 4H44C 4Z78A 5D7JD 2VSKB 3GJFA 3X1NA 1IAKB 3GXMA 3J2PA 1KNOB 2IBGA 3MBWB 5CU5A 1WAAF 1BHGA 1S7WA 1D5ZB 1TMCB 4PB9L 4KKCC 4BZ1H 5J6HA 4X9FA 3MLWL 2VR7A 2EIZB 1Z5HA 1E9PA 2XTJE 1Y7VA 4FHBD 1BWMA 4OU3A 5DS1A 2QSQA 4WU5B 3NJHA 4IRZA 3QRGL 1J8RA 3ES6A 4LAJH 5DMKB 4XMWA 4OCSH 1P5VB 1RZIA 1S9VB 3ZKXC 1IIKA 3VGEA 5GXBB 2EYRB 4KROD 1UKTA 4QIRA 1SGKA 1DFBL 2Z64C 3U7AA 4H26B 5DRXB 4ZXBC 1UUNA 3T8MA 4YOKA 2JK5B 4G6AC 3II3A 2Y6TE 1HEJC 2ZKMX 2J6WA 2WVSA 4PJHE 1ZHLB 1HSAB 5JW4M 3S88H 2FLBT 4FZ8H 1INDL 2AQQA 1NIAA 1TTGA 4S0TD 1OOWA 3ALXA 3TJEL 3ZE2E 4IS6A 4UTBA 3LD8C 4X5XB 3I6SA 2EH8L 3BCFA 3ROLA 1JZ6A 2V4LA 4NQSB 2IALA 4OZ4A 2ZXEB 1D6EA 3D3VD 4YBLC 4G42A 5D1ZA 3STZA 1JZ7A 1NDGA 3LQAC 4XXDB 2Z34A 1BMWA 3CSBA 4AZ8A 2VZVA 5T3XH 5K9OB 4QRBA 2EH7L 3U1PA 5L2KA 1KT2A 4AGQA 4OJFH 1OB1B 5DVPA 5I1KH 3H2QA 4GSDH 4FXGB 3BVXA 4M3JA 1SLWA 2ADGA 5ICUA 5C1MB 2XWTB 4BELD 3MFFB 4JQVA 4KNTA 3P3TA 1KJMB 4L1BA 2Y5TA 2YXMA 1RVFH 3KPNA 4LRIA 3WLBB 2BVOB 3JWOH 2Q6WB 1ESOA 1LEIA 1JMZA 3F04A 4GAJL 4ABUA 4ZRGA 3RY6A 4F57H 4Y5XA 3HNTH 4MDIA 3BVUA 1Q0XL 4O4YH 1Q38A 2B77A 5GGUA 3VFUB 4HEME 1ITCA 3NH7H 4X7CC 3QQ3A 4C47A 5IVNA 3WFDL 5KYWA 3HB3B 2EECA 3EYSH 5FM4A 5LBSL 2WZAA 4G8AC 3P1VA 2YKLH 5F8QC 1A3LH 3GMNA 2WKOA 4UV4H 2PYFB 2ZKHL 1TVHA 2BXZA 2IC2A 4Q6IC 4NUGL 1TJIL 3LRMA 4P3CH 3FU6A 3MRGB 2CDFB 2BNRE 2ARWA 2PCFA 3WIHH 2FT8A 3K3QA 1OZUA 1Q9WB 5CHNA 3AS3A 1EANA 4QF1A 1MCEA 2GTWA 3S3BB 4EUPG 5DQDH 2Z7UA 3L8QA 1MCBA 32C2A 3KPSD 5LWYH 2VDKB 3MC0A 4X98B 3NIDB 1F90H 4ICXA 5DZLA 5EPMA 4K3GA 5GSRB 1UYWL 5IEHB 4XCFL 5LGHL 4W9GC 2VLJD 3HR6A 3SE6A 2IH3A 4H8WL 5AVQB 2FO4B 1PG7H 3GI8H 5EO0A 4YWGL 4Y16D 5CP3H 2AJZA 1DBJL 5FO7B 1KEGL 3TN0C 3MLSL 2BIOA 2Q87A 2EVIA 2NXYC 2Y07H 3L3KB 4JFXA 1J5OH 1S78C 1PKOA 5ENWA 5F7EL 1I8MB 2PR9A 2Q10A 1TJGH 4RISH 3N0AA 5D7LD 2FIKB 5K1JA 2F0CA 4PGCA 3PAZA 1ANUA 2XN0A 3EJPA 1QFWH 1U0QA 3D8MA 4OR1A 3TZVB 1KN4L 4OFYA 1BZEA 1HQ4A 1LK3L 4QCIA 3MBEA 4JGUA 4JMXA 4LOEA 2XPYA 4U6XB 5IQLA 3CFTA 1JRHI 4AKPA 2P26A 1S9YA 4BK4A 5HVWA 2OJ1A 2PP9A 4L1HA 1G1KA 4MJIB 5J6HB 1FNLA 3FO0L 1HL5A 3LRKA 2P44B 5ICXB 1RK1A 3WNPA 5ACZA 1E9PB 2H1LM 3L6FB 3HJ0A 4NNYA 4P57A 4APQA 1KIQB 5I17A 4YPGB 2J43A 4PJ5D 1X5XA 4X4ZA 5HHOE 3JWNE 3S2CA 3OBAA 4X6DB 4RGNC 2ALWA 1M53A 2OX5B 3TGXA 4KVPA 3TJHC 1UHVA 4QPEA 2ZX5A 3REVB 1AO7D 3D52A 2EH8H 2FJGA 2PO6C 4MASA 3VWKA 4NFBA 4FJZA 4EI5C 4O2CA 2QGEA 3L3DA 4G43A 3ZPDA 4IGBC 4NZDA 3VFPA 3QUYD 4G59C 1WZMA 3HMXL 2AK4D 4QHLA 1RHHA 1UWYA 3QISA 4KHTL 4DQOH 3AQXA 4J4PC 4ZMOA 2BVQA 3ROLB 4A6YH 3NP3A 1W6LA 2BSDA 2DMGA 3KJ6L 1XCQB 3RWIB 5D1ZB 1I82A 4CAGA 5C0AA 3VSQA 4AZ8B 1S5HB 1K3IA 4QYAA 1OGAE 2WANA 1KT2B 3VD7A 2WYZA 1J9TA 2WWKO 3MA9L 4XNYH 3WSQH 3QHTC 3KGUA 1EERB 5EN3A 4PGEB 4XVTH 5D1XB 3V52H 5C08E 3IPBA 1AYRA 2QGDA 3UTTD 4F7KA 1U8JA 1MAJA 2YN5A 2Y5TB 2ICEA 3KPNB 4OZIA 2CM6A 1U92B 2BY1A 1ZT4B 1CVRA 3JTSB 4JFED 4MZIA 4CILA 2QT6A 2YXFA 4PTTA 5EEVA 4NENA 4OQTL 1M7DA 1YPZE 4G1EA 4F7PA 4YDKH 3R0NA 3P11H 1ZV9A 1F4XL 3UJIH 1OP3K 9CGTA 1FZMA 4YDMA 3B8YA 4ZO8A 3VFVA 4FG6C 5AYQA 1Q1PA 1OD7A 4L8CA 3CQFA 1DSFL 4MCMA 1N8ZA 1WP6A 4PREB 2KDYA 4NRZB 4RMUA 3KYAA 4TNFA 2Y7QA 4JN2A 4G72B 3FFDA 3G6JE 1W15A 4GRLB 5HYJE 4F27A 3U46A 2HX8A 1TTRA 3BDXA 2ICWI 2PCFB 1Q1JL 3P4LA 2NYKA 4YHKH 4Z6AT 4K7FA 4YHZL 4JKNA 3IJSA 2UZIL 4GI6A 1FG2B 5I6LA 3IS1X 5AENA 32C2B 2IAMA 5HHVL 35C8H 1JD7A 3K8LA 4BUHA 5KYXB 3O6ML 1RJCA 4YWGH 4M7ZC 5A2LH 4QRFA 4FYTA 4DGIH 1CYXA 2NYZA 2JJSA 3MRFB 5JIIA 2DWDB 1FNHA 2ERJB 4M00A 4L1LA 3LMJH 2ZUUA 5B38A 4JO8A 1PGRB 4LGSB 2DM3A 1YLBB 4QTIL 2CDGA 4HPYL 3P9MA 3PPEA 1WBZB 2AJZB 3GQFA 2VDNL 4GAYB 1PD1A 5FW7A 4PJ6A 1LP9B 2G2PA 4IBQA 4JDTH 5EZIH 5EEXA 1CBVH 3JV4B 3I2CH 4LCUB 5HYIA 2ED8A 2ZONA 2HT2D 4NXSA 5GGSY 1EEYA 4F58L 2X6CA 1DUYA 3IJYB 1EJOH 2RGSA 2FR4A 2X4PB 4A38A 3LVEA 4NT6B 2QQNL 3W9EA 3MBEB 2VSCA 1E8ZA 1WA1X 5IVXA 3QJVB 3M1OA 2DAVA 2AHIA 2D03L 5D2LE 5IBUB 4U1KB 3MUUA 3SE3C 3CZKA 4ESKA 4RAHA 4A37A 4ALAH 3VXMD 5DXWA 1BZ7A 3DPDA 2PYED 4AV5A 1IUZA 2HKAA 2K6YA 4Q7DA 1VZHA 4XX1E 4BH8B 2YMOA 4P57B 5I17B 4B60A 43C9A 1MI5D 1JXFA 4WO4D 4MMXC 3UAJC 1ZHBB 4V1DE 2DIJA 1M1XA 3CDGB 1FBIH 1PJWA 4PSPA 5DRZA 3N43F 3MJ9L 3DOIA 4KHTH 1KPUB 2IV9A 3HW7A 1N5YH 1YQVH 5IB4A 5HI5C 1TYEB 2D9CA 1L7IL 4L1TA 5E6IC 4PRPE 2VL4A 1HAWA 1RHHB 1V55B 2NY4C 2RR3A 2BVQB 2NW3B 3NFSH 1DEEA 4K71C 5CD3A 3QUZD 1AKPA 3MUGA 5L8KB 4LNVA 2UWEF 1VADB 2PR4L 5CSBA 3WFCH 3HMWL 4B7LA 2P49B 3GLAA 3RKDC 4CW1B 5DRNB 4WVRA 2Q1EA 5AW8B 2CPCA 4J12A 1TVBA 1K2DA 5E8OA 5C0AB 1KLFB 1D2OA 2HLFC 4NQEB 4JFVA 1IL1A 1ZK5A 5EORH 2IADA 4F37F 5PAZA 3PJNA 3FUDA 4LDCA 5KVEL 1SXSA 2A9CA 2FRGP 3O3BA 3LDBC 3L3HB 4MJ2A 1AXTH 1HS6A 2IPKA 1QA9B 1U8JB 3RVUC 4ZX6A 3ABGA 4OLUL 1IAIL 2ICEB 4YHOH 5D72H 4FMKA 4N85A 1I8AA 1BJ8A 4X6EB 3VE0A 2XVGA 3CCHA 5C9JB 1KCVH 4PBWD 4XO8A 5CEZL 2ORBH 4L1SA 1MN4A 1KB5H 1F56A 3EHBD 1SEQL 4WWKB 5JORA 2WLNA 1HK6A 3GMOB 3H42L 4NKOA 4W68A 4CMMB 4HK0A 7FABL 3RWHB 2NNAB 4LIQL 1HZHL 2R2BB 4UUJB