3E9TA

Crystal structure of apo-form calx cbd1 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
EFIRMYFEPGHYTVMENCGEFEVRVVRRGDISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSEGVKLAVPMIATVMILDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of apo-form of Calx CBD1 domain
rcsb
source organism Drosophila melanogaster
molecule tags Membrane protein
molecule keywords Na/Ca exchange protein
total genus 27
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3e9tA00
3H6AA 3FSOA 2FWUA 3RB7A 2LT9A 3US9A 2DPKA 3GINA 3EADA 2QVMA 3FQ4A 2FWSA 2KLSA 2QVKA 2KLTA 3RB5A 3E9TA 3E9UA
chains in the Genus database with same CATH superfamily
4OZIE 5CSGA 1MCWM 1RZJC 2PYEE 3QUZD 3ZDXF 2GFBB 2GJRA 5C3LD 2Q76B 1J1OL 4PJFE 3V4PB 5GZOC 4IRJA 4OB5H 4GAYA 1BVLA 3TJEL 1WA1X 1K4DA 3ARDB 4OFIA 1MW1A 3CLEL 3VFMB 3KCPB 1V3LA 4JPKH 5KOMC 2J1KA 1PSKL 5IVXF 1O9VA 1U95B 4K5NA 4Z7QF 4PJBB 1UD3A 5KVDL 3DK0A 5INCA 4HPYH 4HKZA 2VDOL 4XWOC 5DQDL 2HT3D 3OWEA 4FYTA 5HYIA 2R8SL 2NUTB 3KR3L 3S48A 5TE7L 4N5ED 4TUOB 4XBPB 5H37H 4KRMB 2A74B 2AGJH 3CVIL 3LKPA 1TT6A 4M7LH 2QGEA 3T2OA 5C9JB 1ZT7B 3MRNA 4ZOEA 1SN2A 4NKIH 5H94B 5EDXA 4Y1AD 1IBGH 3BO8B 4QXGH 1IGJA 3DGDA 1JYVA 4WGKA 1LHZA 4Z7UE 3V9FA 3WXVH 4JRXD 2MOGA 2A9BA 4CC4C 1JZJA 1FFQA 3B9KA 4QXTA 2X4UA 2IAND 4YUEH 4FEMA 3KYMA 3VSTA 5GRYA 2PNDA 2YAQA 1M6OA 4RFOH 5FK9A 1KTJA 3QQXA 4PAZA 2FHCA 1C16B 4X6EA 2CLVA 3KM2A 4HALA 4HGWB 2DBJA 2HFTA 4BUGA 2VDLL 4OQTH 5CJBA 1U91A 3BP5A 4YHZL 3IRPX 1TU2A 3IDJB 4UYQA 3NP4A 4YZFE 5JW3H 3S3SA 1ESOA 5INDA 3MLWL 1BVNT 1EZLA 3B2PA 5AD0A 1CGWA 1S5IH 2E27H 1A2YB 2HB0A 3AS0A 3DURB 5CHNA 2ATAA 4MJIB 4PJ5A 1FNSL 3S98A 3VFVB 1OSPH 4ZMPA 1UM6L 5JPNA 1JXKA 2FBOJ 2GJPA 3MV7D 3QEQE 3HC0A 3Q5YA 3TCLB 4QRTA 4X2UA 3CU7A 2HA1A 3F12A 1BZ9B 1P2CB 3C87A 4QXUH 5BVPH 3ATAA 5K59E 4RMBA 1ZLDA 4LVOB 4CSZA 3U6XS 3S88H 1Y18B 1E27A 4MB5A 2CO6B 3BH8A 2XQYG 2YIHA 3H55A 3MXVH 4AMKL 4KZEH 2BVOA 4Z3HA 3LEVH 5I0VA 3PWPE 5T1KB 1DJWA 4KKAC 1GZHA 4BFJA 1QSFA 3QT2A 1ZV9A 1HL4A 1RUKH 2KZBA 5J11B 3NGBC 3QJOA 5KBLA 3L8QA 3HAEH 1KCKA 1Z2KA 1KB9K 1ZA6A 1J8SA 1PLAA 5HHXH 2OI9C 2OSXA 3PGFH 3EYSL 4P2QD 1D9KC 1MAMH 3DXAD 2NY5L 3Q6FA 1H15B 1L9QA 2L7UA 1AHWA 2X28A 3DK2A 3DVIA 3VXRD 5CEXA 2E8YA 2JQMA 5H37G 4G80B 4OVUA 3J7HA 4ZO9A 5CZXD 3HBPA 4JFFA 4ZUSB 3IPBA 2V33A 4X7CC 5EBLB 3X3FH 2NUPB 6FABH 5C0GA 1PY9A 3UPRA 1A1MB 4RAVB 3UL4A 3G5ZB 1QNZH 1ZXQA 3MV9E 5FO9A 2A6IA 2VQ4A 2R2BA 2JB5L 2KQMA 2HJFA 3V4UL 1UOKA 5IW6A 4BKLA 3CAFA 3L3HB 4OSUL 2ADFL 3QGVA 4R7XA 1QFWL 2UY6B 4NO2A 4FFVC 3SGDH 2PXYA 1NBYA 1GL4B 1GMIA 2VZTA 3T1FB 3G04B 4PJBA 1F3RB 2FR4B 1YC7A 5AVSB 1A64A 4U6XA 3ARTA 3GMLB 3N6YA 5I76A 1M2VB 1LGVA 1NIAA 1FL6A 3UH8A 4DP7X 5C6TH 5HVWA 4H40A 3SKOA 4NXSA 2CCWA 1HQ4A 1Q0YH 3NPSB 3E2HB 1NCIA 5ADOL 3QDME 1WBXB 3MNVB 2EYRA 2IPKB 1QBLL 2LLLA 4PTUB 4H8QA 4UTBH 4F5CA 3LZQA 3ELAT 2V2WA 4NCC2 2NYZA 2F7IA 3ESMA 4NQEB 3FUHA 2PO6D 5CJ8A 4LLUA 4N8UA 4WO4C 2YEQA 5DZ9A 4ENED 3NIGB 4GS7B 3F64A 3P0GB 2QQKH 5HDBB 1QI3A 1EJFA 4H1LG 2W60A 3CLWA 1WZKA 1PS3A 1T5WA 4TQIA 2CHZA 2GBAA 4HKJA 4MS8D 4PJHB 2IOIA 3QULA 3MA7B 4KUCF 2DLFH 3K1DA 2BCKB 4EI5D 4OIBA 3NVQA 1DBBL 3LXAA 4NP4L 1UYWH 4GSRA 5LLIC 1PMYA 1OE1A 1JSYA 4HWUA 2EDXA 1JZFA 2CNZA 4LCIH 4ODSL 1DVYA 3LQAH 3VJ6A 5SX5K 2CBQA 3OC5A 4LBEA 4JAMA 3CGTA 3FTYA 3KCWA 2X4QA 4L8BB 5EOQH 3NSJA 5HHNB 3RE0A 3SOBL 1JGVH 4BJLA 1N59B 5GGRA 1MHPL 3O6LH 2X2UA 1R4XA 5I1JL 2O5XL 3N1PC 5KSAA 2AXJA 2OXHA 4Y1TA 5I5IA 5I73B 1EFXA 3RWFA 1XCTB 3NJLA 4G8AC 2P8MA 4UM8A 3EHBB 3FCSA 3HLAA 1QSEB 1MW0A 1O75A 1HL9A 1RK0A 1ZWIB 3TH2T 4BWTA 4RSYA 1NCUA 1BD2B 4R90H 3MJ8B 3GUTA 3BWUC 3QO0B 1T5XB 1KN4L 2OMYA 3RTQC 4OF0A 2OJZL 2Z8WC 3NZSA 4G8EB 3T08A 4ZMWA 2ICEA 5HP5A 5DEFA 1WFIA 3TN0A 4QOKA 3U2IA 1UGNA 1OY3B 1QHOA 1HSAA 4C83B 2DMGA 1U8CB 3KPRD 2ICWJ 4ONGL 3L5WB 1IILE 5D1QA 1S46A 2AGJL 3CVIH 2GW5A 1D6EB 5I1EL 4I0PC 1M2VA 2W0PA 1U93A 5BQDA 4MJ5B 4IOSA 4WI0A 1F18A 1XCWA 1P53A 1TJGH 2LTQB 5SV3A 2N59A 4Q9QH 5LCVL 3NRQA 2DQGH 5TTRA 3WN5B 4JPKL 3N1FC 5IVZB 3B3BA 2ZOKB 1ZLSH 4PJXB 3SKJH 3UTPE 1L0PA 1UB6A 5B1KA 1VGEH 4KVNL 4BFEA 5L4JA 3E6HB 2R59A 5B8CA 3B83A 4TNWF 3FFCD 1C8PA 2WLNA 3C60B 4OIIH 1AGEB 2I5YL 4PR5A 2EDKA 4NN5C 4PJDE 2P46B 3EOBA 4IRZL 2J8UE 3ARZA 3ECBA 5IFHH 1DQTA 1N2RB 3WHE0 4YR6B 2XN9E 3HLKA 1AKJA 3P11H 1ZGLA 4BFRA 2DDQL 4HKBA 1CFTA 5I18L 1THCA 2EILB 3OKYA 1TIUA 3FRUA 5IUCA 4Z0XA 1A7NH 4DGYH 1LDSA 2BSED 3DGGB 4LLAA 2Q8AH 1BCIA 1KBWA 1EXGA 5CD3A 1CXFA 2YXMA 5ID1A 3X1NA 2DTSA 5ISZE 2Q1EA 1EEQA 3PRZA 4OD3H 5HGAB 3BSGA 2GJJA 1CD9B 4Y4KC 2GJZB 4JB9H 3S9DB 4MS6A 4ZOCA 1T20B 1TLMA 3EBAA 5MI0B 1JWSB 1I53A 3FRPA 1EXUB 3J2PA 3QUXB 5DRZA 1E4WL 1N2RA 2X3BA 1OAKL 5I1DB 4MXVE 5M94B 1CBVL 3QEQA 3HBGA 1K9TA 3FBQA 2NPLX 1TEYA 5E9DB 2K7PA 1RJZB 3PWNA 5C09B 1W9XA 3DXAA 4G9FE 2QMJA 3GXIA 1YN7B 4MB4A 5BMFH 1RIVH 2AANA 1EXHA 3C60A 5CEYA 1GYUA 1WFNA 3CDYA 3O3AA 4HJEA 1P6AB 2KKQA 5F7DB 3TFKD 4OGXH 1HHKB 1UB6B 4HZLA 3DOSB 3V9CA 3FO0H 3OLIA 3QCTL 3NIDE 3MUJA 2RR3A 5FLVA 3LDBB 4WI0B 4U1SA 1A6WH 3TX4A 3VU1A 1ITCA 1YUHA 5DJZA 5EUOF 3OJMB 4QAMB 4ATWA 1U41A 3FQWB 3HB3D 5EU4A 3W37A 3P9WB 3RGVA 3DJ9A 3RZWA 2EDHA 1BEXA 3T3PB 3VXTA 3LAFA 2FT7A 4L1HA 5J6SA 4KRPB 1U8IA 1I7RA 4X80L 4WO4B 3IAGC 3MV7A 1NAMH 3ZMRA 3D6GA 4JN1H 4WWOA 1MI5E 5DJDB 2ZSWA 3ABKB 1NBZA 4MLSA 3K5RA 4KROC 3T0EE 2E3VA 3LRSB 3DI3B 3MRRB 1DDTA 3QIUB 4XOEA 3WS3B 2PMZA 5C08B 3GUTB 2EC9T 2NY7L 3SE9L 3VVWA 2YD1A 3GMOB 1B2YA 1QSEA 1RK0B 4F2MA 1JPTH 3L9BA 5CZRA 1X6LA 2V2XA 5I15L 4OAWB 1O6SA 3HKFA 5C07B 1KCWA 1D7FA 4APXA 5I28A 2I69A 4W9LC 4WFGD 3GKWH 2EIZA 4Q74A 2IDCA 3DJRA 3MVSA 3OKKA 5CAYB 4RA3A 1CD1B 2FX7L 4I88A 4M6AA 2Y2YA 2BSSB 4HJ1A 4U1MB 4KV5F 1G0XA 4R8WL 3CVHB 3PUUA 4HP5A 1A22B 3BPCB 2ZCLH 3DV4A 4DEPB 2XWEA 2BXZA 2KC0A 2OCJA 1TVHB 3LDBC 3NP3A 3KPSA 3TBSB 3S5LG 4DEUA 5DHYA 4M62H 5DJ0A 3SZ6A 3D0AA 1RJYB 2OPCA 32C2A 5BW7C 1PTZA 1TXKA 2VO8A 3MLTA 4PJHA 3TV3L 5AW9B 1WITA 3AU0A 1G1OA 1NAMA 4XPTL 3F05A 4OD2A 1YG9A 5AG8A 3ASOB 4OZHB 1E4KC 2EXWD 3IMVA 1NGXB 3RWDA 3NFNA 5LAPA 1MELA 2EEBA 2QFRA 4YE0A 3U30B 1PKQA 4I18A 4XBEH 4ABUA 1NGXA 4AV5A 3D2TA 2PABA 2XBDA 2AXWA 3VMNA 2XVKA 1VCAA 4CVZB 4R7NA 1OW0A 1IAMA 4XXDA 4Z7UA 2IAAC 5F7MC 2AK1L 3LH9A 4YLCA 2JMRA 3IDUA 5A2AA 2XKNB 1QBMH 4ZPTA 1SHXA 3RB7A 5I71B 2WBJA 4IHOA 4LCCB 1R5IA 5FCUH 1OGAD 4N26A 2ODHA 4FNLH 2J8OA 1OT1A 2UWEF 3TT1L 3MX0B 4LKCA 1LO0L 1I8UA 3N85L 3BWAA 3R7RA 2AJZA 2VN3A 4G3YH 3TIDA 1L6ZA 5T3ZH 5DI8A 2A6KB 2ZKHH 3QXAB 2EDWA 3LTVA 3OKKB 4R5XA 3IDXL 5JDJA 1RL1A 3IDNB 2ZOOA 2XJLA 2G75A 2VE6B 4N68A 2O26U 3SSGA 3AAZA 3X12B 4NO2B 5KTEH 1JVKA 3P0VL 1CDJA 4QOKD 2FECI 3DSFH 3DJSA 3L5JA 2E86A 1HKFA 4EF3A 5GRWA 4G9DB 4JJ5A 3BKJH 5CINH 4ZPVB 4Z0BH 5CUSL 2YK1L 2FLBT 5IHZA 3VD5A 4NRYA 4P5SA 2YJQA 4E68A 5EUKB 3OXRA 1U8IB 1G0DA 4IDJL 5AG9A 1Z9LA 2BSTB 2ZD0A 4QKTA 2E4FA 4S0HA 2DD8L 1ED3A 2HG5A 4FQXD 1S9XB 3IKCA 1SLVA 2ZXAA 1B3JA 2WZ0A 1OF2B 1VFOA 4GJTB 4ZS7L 3KXFD 4AYFB 2CHNA 2BH0A 2GCYA 3D0LB 2VMCA 3NJXA 1L7TL 4A2LA 2NY0C 1CDIA 3CXDL 1XGTA 3V5KB 2ITFA 3WCYA 2APSA 4XRCB 2AJVH 4ELMF 4EOWH 1Z3RA 2DJUA 2ARJA 1VKXB 1MLBB 2NY4B 1DLHB 1ZGLM 1HQRA 4XB8A 1WBYA 1A6VH 1A7OH 3V2AR 4GKSB 3QQDB 4CNIA 2AEQL 3T0DA 1Q4NX 4ZSOA 4M6MH 1BQKA 5AW7B 4KX7A 5I5RA 1BQSA 3KPRE 1G7JA 1MUJA 4WJKB 3PXLA 3IKKA 1I31A 4WEEA 3BWSA 5IBTH 3LPWA 4L3CA 3O2DH 2I25N 3FUNA 2BOCA 2Q8BL 2F19H 1HJBC 1K3IA 5LXGL 3GSWA 4TL4A 3KPMA 3RTQD 4I48B 3ZMNA 4FFZA 4CL7A 3MPCA 2LABA 3E9TA 1I7UB 1F97A 4Z95H 4XMPH 1JL8A 4AW4A 3CFCL 1J9QA 3IJYA 1QFWI 3Q6GL 4DQAA 3O6FC 1BOGB 1FVCA 4YDIH 3KPQB 4C4BA 2CZNA 4UILH 3WD5L 4PPTA 2CDFA 4ZZFA 4QCIA 4XCYB 2RALA 3P9MB 1CGUA 3MACL 3RFRA 4M1CD 5HJDA 2UY7A 3VD0A 5EC2A 4BIKA 3C5SA 1KFGA 1V7MH 4YZWA 1YEHL 3O9WA 4HD9A 2ICWB 1KWGA 2D7QA 1BG9A 2A83B 4FTVA 2GBVA 4X6DE 1DYZA 1KYOJ 1QRNB 2CLRB 2D9QB 2Y1AA 3JBG7 4J3OG 1JE6A 4R7DB 4FI6A 5J5EA 4ICWA 4NFCA 3LHPH 3HFFA 1QPXA 3CFDA 5GSVB 3R7QA 3TH4T 3RI5K 2J4WL 4QRRE 3LZFL 3H2WA 3S36H 1HDMB 3LS4L 4OY9A 5J3HC 4BDVA 4FNTA 4HUWA 4P49A 5E8PB 4OJFH 5HHOB 2NZ9C 3VXSE 5C9JA 3WFDL 3VFWA 4JFFD 4LASH 2GEQA 1IFHL 3VRIA 4EKXA 3D12B 4F8OA 43CAA 1Q0EA 2ZWLT 2QEJA 3CDGA 1NC2A 4XI5D 1WYJA 1W0VA 5ESVA 3VW3L 5DD5L 4UNIA 3EFFB 4TQEL 3NZHH 4NUQA 4XCCL 5DD5H 4LOUC 1CWVA 3BGMA 3OF6D 1IM9B 2VR8A 5JHAA 2YMXL 3OGCA 4NQEE 3STZA 5FXCH 2FH6A 1PJWA 4MA1B 4PJ9D 3ZDWA 4BCXA 2WN2A 1F6LL 4UB0L 4XAWL 2R1WB 3JVFC 4N1EA 1SOSA 1ETA1 3EO0A 3N3EA 2F8XC 1INQA 3MLXL 5TQ2H 1DVUA 2QADD 2X89D 3MJ9L 4LHUA 1CFMA 3TN0B 4YX2H 1WEJH 3RZCC 4OGYH 5GGTA 2IPUK 4X0NA 2AFNA 1NDGA 3MJ8A 4OLEA 3QUZB 3D09A 4LVHB 4XP1L 1G1CA 3GJFA 2GSIB 3FUEA 2EVIA 1NANH 5IB4A 5KSBE 5JIPA 2UX7A 3MBEA 5E6ZA 4GT0A 3GHEH 4OLUL 1O9ZA 1SXZA 1U0QA 3GHEL 4R3SB 4MQSB 1F0LA 2V7NA 3Q5OA 2YAFA 3TN0C 1GKOA 3CFNA 1S4IA 4X6CB 4KVCL 3GI8L 1G9MH 4M7ZC 3RIKA 4EN3C 3Q6GH 1GC1H 4H2AA 4TOYH 3NJGA 1SJXA 1USQA 2EDLA 1C5BH 3FCBA 4NKDB 1YEFH 2NY4D 1C08A 3SDAB 5BO1L 3SDDD 1CICA 1OF0A 4QGYA 4TNVF 4XO5A 5J6GB 4AQZA 4G83A 2ERJB 1H5BB 3LB6D 4HKJB 1T83A 5EU6A 1QHQA 2I7OA 4UAHA 3KLHD 4JRXA 3GGWA 5C8JA 4WWNA 1AS8A 5DMIH 1ICTA 4XNQB 4Y0GA 1KB5H 5DXWA 4ZFFB 4GRWE 4L3EA 1YYLL 2EYTA 2BMKA 1I1YA 5DVKA 1ETJA 1QHPA 3QJZA 5KYNA 1CK0L 2CR0A 3KPTA 4CGUB 1T22A 1XCXA 4GFXA 5FO8A 5E9DD 2E5EA 3FOMB 3OHXB 4ZTPH 4FG6C 1NBZB 2I9LA 1I3GH 2EIJB 5AOZA 4Z3FA 1A0QH 3R06A 2KDYA 4Q14A 3P02A 3G3LA 3LX9A 3DIVA 4DGIH 2OP4L 3NAAL 3L9RA 1LNUA 4PEEA 3WFDH 1ASQA 4FZEL 4HXBL 5DD0L 4OUOA 4X8XA 5F93C 3SKNB 2B3RA 2Y6SC 4X7FC 5JLZB 4NQDD 2VDML 2NY3C 4JKPL 1JZ5A 1JPFB 5I82A 1NL0L 4JKKA 4QUOA 2J4WH 3NBNA 3OKDA 4GY4A 3V6FB 3ZKXC 1N19A 1NFIA 4L4VD 3HC2A 4IU2B 4Y4HC 3ULUL 4ZS6C 3MROB 4BE6A 1NC2B 2D73A 5CGYC 2UY6A 1JTPA 3V0GA 1YEHH 4F3FB 4YO0B 3BRFA 1HHHA 1JZEA 1VFBB 1IE4A 3WFZA 2AABL 2WXQA 4LGSB 2KL6A 4F8NA 2DTML 1FIGL 2LVCA 4OFDA 1E2VA 4PYGA 3RIFF 5K9JH 4G6KH 1PAMA 4UQIM 4EBQL 4DUWA 5E2TH 2CR6A 2C3GA 5DQ9B 4FQ2H 3RWIA 3X13B 2DBLL 1RVFH 5I74B 1DJGA 4U0QB 3DSNB 1DBAL 2YAEA 4DAGL 1JWSA 3UTTB 3DMMD 3L1EA 1LO4H 1I1FB 2EC8A 1GZPB 2QLYA 2BY2A 5FGCE 3DVFA 5E0QA 2A0LC 4J27A 3EGXB 4J39A 3RWHA 5BOZG 4JDTH 1OGTA 3DO4A 1U8MB 1T1ZB 2G5BA 4OR1A 3V0DA 2Y7OA 4AM0Q 2AQRA 3FAWA 3QIWD 2A1WH 4XCFL 4R0LC 2J72A 1H0DB 1EH9A 2OX5A 5F7WC 4NEHB 2QVIA 3H9HA 2WUBL 1EBAA 1I7UA 1NBQA 2CUIA 4XP5L 3FQ4A 2F1BA 1ZHLA 3OPZL 4I48A 4NN6B 4K2UH 3RBGA 3UZEC 1ZGLB 4NIKB 1LE9B 3INOA 2Z7YA 4OCXL 2VLRD 2VXQH 5AW5B 5F1IA 4LDEB 6TAAA 4L3CB 5CJQH 2MPVA 4WI6A 2XWBB 3RWGB 2CUAA 3TPKA 4YEFA 1T80A 2IDQA 1PX3A 4XBGA 3VFVA 1I8KA 1J9RA 3QDMD 4ZUVB 5C08D 2JKWA 2JXMA 1RZKH 3LIZA 4N2KA 1QUNA 3V6OE 3JV4B 1NOLA 4IDJH 3ML8A 4FXKA 3RL1B 2R0WL 2XTLA 4PCSA 2AJSH 3FPYA 3T3ME 5HHMB 4OZFB 2EDQA 4QY8A 1HQRB 4WUKL 5IQMA 1OGAB 4ANUA 2HUHA 1QEWB 1WZMA 4WCYL 4L29B 4L0YA 3TCXA 5EU7C 3C9NB 1GYAA 3FT0A 1QVOB 1T03L 4ZNEA 3K72B 1E2WA 4Z7VB 5CR8A 1GYCA 3ZE2B 4JDEB 3UEZA 3KPLA 2Y72A 4W9CC 1DFBH 1LMKA 3U46B 5I17A 2ADJA 1NKOA 2BDNL 3COOA 5HDQL 4H0LC 2WYIA 3IPFA 1TLKA 3KMDA 1E0OB 4NFBA 4EVNA 1GY1A 2XJKA 4GBXB 1BIIB 1HSAB 4C83A 1B9KA 4N8CL 1F2XK 5BVJA 1BVZA 1AYRA 2FL5B 3C6LB 3Q8CA 4PY7B 3SPJA 1TKWA 4IGBD 1LO0H 4FXGC 2D0FA 4NT6A 3NJVA 3FTSA 3US0A 4TUOA 4O51B 4IOIA 4DEWA 5TDPA 1ETZA 3LIZH 2BLFA 1M57B 2NY1C 1EJ6A 3B7TA 4AEHH 5E2UH 3LRLA 4WLCA 5IWLC 5INCB 1LQBC 4OIFA 4X6DA 1S7TA 2PYEA 2J3SA 5CCGE 4FQIL 5JO5A 3PAZA 4HJJH 1DCEA 3VFMA 2H0EA 2AJZB 3MRKA 5C0RL 3RPBA 2A99A 4JFEB 1DVFD 2YSSA 3VD4A 1IM3D 1NCDH 2C9PA 3NABL 1TOXA 5DJYB 2EIDA 1R47A 3WXWL 2APVA 4J2QA 4D0BA 5D2NE 3MXWL 1HKLH 1SDDA 1HCFX 4APQC 4F5CE 1SHSA 3ARFA 4XNXL 3K6FA 1KN2L 1D7CA 4PFEA 4G7VL 5CIPH 2VDRB 1LEGA 2UZPA 2V5MA 2XN1A 3LHAA 2J5WA 2BJMH 2XFXB 4U0RB 3C12A 1P69B 4NM8L 4UF7C 4PJ9C 1G43A 3P54A 4G7QB 4OZHA 3Q0HA 3BUTA 4GRLB 4M03A 3US9A 4JN2A 1F4XH 3B2DC 3ARFB 5F3HB 1BV8A 1ET7A 32C2B 3LKRA 5B1CA 2Y9RT 3U6RA 4GG6B 2DQJL 5I24A 4X6FB 3F8UB 4WU7A 4X0KB 1HH9A 5GGRY 1OZUA 2V17L 5JW4N 3LEXA 2OSYA 3MUZ1 3V6BR 4DO4A 1K8IB 3LZPA 4U1HB 1TJIH 1VZIA 2YLHA 4MD0B 2F1EA 3T2QA 4EN2A 3I9GH 3CX5J 1DO5A 4Q52A 1MCEA 1G0YR 2H2SD 3BI9X 2EE9A 3I3DA 1UA6H 4XVUC 1FSKB 1AJ7H 2YPLD 1SVCP 4GQRA 4IBVA 4QRQA 1TMCB 5EEYA 3MGAA 3ZDYE 2K3HA 5BS0A 2HX7A 2Y5TB 5C2UB 4N9GA 1AANA 3GMNA 4NKMB 1NZRA 1RZPA 3CXHK 4O02A 4LQ1A 1KJMB 4CILA 1KWKA 4GAFB 5JPMC 4XXWC 2ZSWB 4G2AA 2Y7QA 5IMOA 2VLKB 4XHJD 1KYUA 3HG1E 3PDGA 3VWJC 3ARGA 1U3NA 4ZXBB 1IE5A 3VVVA 5F7HA 2HMIC 2X4NB 5CU9A 4KTYA 1W6LA 1AHWB 3EOAB 3VGFA 4Z7NF 2EINB 3M1OA 2H3NA 1G6VK 1LQSR 4LLWA 3GB7A 4QEGA 2P52A 4G9FD 5HYJB 3CHXA 3ZZSA 1J1PH 5JOPD 2FSEA 2VSKB 4F7TA 2ZQKA 4YSTA 2E46A 3B7UX 3ALXA 1OPGH 3TS8A 4LF3A 4G8GE 4JPSA 1E8YA 5IQ9B 3MJ6A 1B2WL 2VR7A 1YC8A 2W95A 3IFOB 4CAGA 3QAZC 2ADIB 1YNTA 4N24A 1R6VA 4MBOA 2ZUSA 4MA3A 2XKSA 1FFTB 5C0CA 1E6JH 2XWBA 2WVSA 2WYTA 4U1IA 3QJFB 1ZA3A 5I1JH 4JZOA 4W9GC 1J0KA 2VRKA 3BZEB 2HFEA 2XG5A 1S7XA 3CX2A 3G5YB 5DYOB 4B53A 1HVXA 4MZIA 1X7QA 3PE9A 4BFBD 2JTDA 4OV6F 1UOVA 1AJ7L 2DS4A 2F54B 4LCIL 4MHHG 4QHUB 3BIBX 2DWDB 5D9SA 3RNKA 1G7PA 4AENB 3BUBA 4E36A 5JQ6H 3IDJA 4OCWH 1E42A 3BVXA 1MAJA 2HFGL 4I3SL 2EUXA 3S5YA 1VKXA 4M56A 3TTYA 3DX6B 3MLSL 4ZO6A 2NY3D 4HAGA 3B5HA 3U83A 1EFQA 3VI4A 1FG2B 4QYOB 3L1FA 4OLXL 1FL3B 3GB7B 1EDQA 4X9YA 3LPGA 1M9SA 4WFGE 2ITCA 1HHJB 1QASA 3DV6B 4ZUUA 3VD1A 1E9OB 1KYDA 5GJTH 4Q9QL 2AQ2A 1G7IA 3ET9F 4HGMA 1NBVH 3D69A 4AX3A 4C4KT 1OZTG 5EZIL 5C09E 4H5SA 3U9UA 2YOCA 5EUKA 4LLDB 1JRHL 1S7SB 3FFCB 5T3ZE 4AIOA 2Y7QB 5DDHA 3AWEA 2J56A 3MRNB 5I1EH 4WFED 3A6OA 3F58L 4DIXA 5KYWA 3IJHB 4FJYA 5C6TL 1OLZA 3FO1B 1X5XA 5DK2B 3TZVA 3GMNB 4RQQB 2XKUA 3ZZQA 5HHVH 4NQTA 3OKMA 4Q9CA 1P7HL 2OJZH 2X5PA 1MH5B 3S37X 5A16A 4LEOA 5B3JE 2XACC 3LZNA 2LFEA 3N43B 1X5GA 5E95B 4MNHB 3G5XA 4ADIA 5DI8B 3CCHA 2V9TA 4YDJB 3G6AA 4Z7WE 4X99A 1D6EA 4TVPE 4IRJB 3V4UH 3EYQC 4OGZA 3CFQA 3QO1B 1NCBL 4QNPE 1R3IH 5JNYA 3NSDA 1AGCB 1JGVL 2BVTA 4CVXB 2ORBH 4E9LA 1HSBA 2FHFA 2OQJA 5GSRB 3S4SB 5IM7B 5EZJA 3X3FL 5FYLE 1Z9PA 1P4LA 4HLZH 4XHJC 2MQ3A 3H53A 3CHOA 1EPFA 1FQ9C 4MNQA 3ARQA 1LTXA 5C6PB 2VMFA 5IWLA 1EEZA 2J6WA 2NY5H 1DBBH 3KHOA 3PJSA 1XCTA 4UM8B 3O0LA 1BIHA 2VXVL 3HPLB 1ZS8A 1YJDC 2OYKA 1M4KA 5F44A 5TDOA 4PS4L 2CMRL 2DKMA 2IVFC 4PJGE 4QOKE 5JPNC 4YGAB 3WDJA 4NJAH 5C2BL 1RJYA 4FFYL 3EYVB 3T0BA 3UZVB 4DO5A 1GKEA 3LS5H 3ATBA 2CHXA 4POUB 4DGVL 3GSNL 1MCOH 2NX5A 1PQZB 3WHE1 3MXVL 1ZLUH 2WLYA 5DD1L 4HUXB 4PRPD 3Q2WA 4XH2A 4F15B 3AM8A 3UERA 3IDGA 5MEOA 2ZX8A 4L9LA 4HWBH 1CDUA 2W92A 2QFPA 4MMYB 1WWAX 2X4OB 1P7BA 4XPFL 2R15A 4BZ2H 4DZ8B 3ZL1A 4XNXH 3STLA 4X9BA 2DL2A 2AQTA 4AH2B 1E90A 1WHPA 3WELA 3H3PL 3FT9A 4G6JH 1SNRA 4NN6C 4Y7OC 5F89A 2G2RB 1VGKB 1Y7VA 2CRZA 3NN8A 4HXAH 2VUOA 2X88A 1P4LB 3V7MA 4RGOH 1DBML 2E7BA 5EHFA 5GS2D 5HPMA 4F9PC 4HX1A 3UOAB 4WTZG 1D2PA 4Q0XL 1MIML 2NYYD 4B3EA 3V5HB 4LAQH 5EO0A 1F8TL 1N26A 2MPAH 5B22A 5EBMB 1OT2A 3E8UH 1TETL 3RKDD 4NO3A 6FABL 1YMHB 1QKZH 3IN2A 4HIXL 3FMGH 3VFUA 3ZDXB 2VQUA 3D7PA 3BGMB 2R2HB 4HWEH 5GRVK 1O7DC 1P4UA 3GJFK 4QXGL 3S37L 1OE3A 4FOMA 3NEOA 1WT5C 2A9DA 4DAGH 5ABZA 4X5PA 5AOMA 3VI4F 4N8CH 1RVFL 5LNDA 1WD9A 3V4VH 4LMQI 2XETA 4AL8C 1P4BL 5C0CD 4J5VA 4L8CA 2XYBA 5I2IA 3B7YA 5K9JL 2GG1A 1JPEA 4X7TA 1DFBL 1FORL 4IKJA 3VQ2C 3MV01 3RJOA 1A1MA 4FEIA 4XC1H 1HN1A 5D7EA 2NXZB 1R5WB 2WXGA 3U9WA 4WI3A 2AABH 4M5SA 1E4JA 5I1DA 4MMZC 4FERA 1OQXA 2IQAB 4KWUA 2YD9A 4YS4A 5F9JA 4DKEH 1NGWB 3ZRFC 3IGAB 4QRRD 1PZBA 3HG4A 5LDSA 1KXVA 4WUUB 1WQVT 3BSZA 3K2IA 4CDHA 4XXCA 5T3XE 4UAOB 4DN4L 4EUPG 1H9VA 3LRHA 1HEHC 3MGTB 2C9RA 3TO4B 1NGZB 4FFYA 4JO4H 3KYKL 4MXVF 4NIYE 2E9WA 4UT9L 4ADGA 5I9QC 3L54A 5FYLH 1MNUH 1NPNA 5DUBB 3PU7A 4L48A 4C4UA 2CQVA 1DBMH 1KJ3L 1BF8A 4MXWL 3VDCA 2XWRA 1S2EA 2VUKA 4FNUA 4ZXBC 3QPQC 1BF5A 1GC1C 2X4PB 5KYUB 2BRQA 4NQED 4PGCA 3ESUF 1XFPA 5IB2B 1RKRA 4LCWE 4RFOL 3NA4A 5C0AA 4JZOB 1FVDB 4FFWC 4GRLC 3TNNB 3T65A 1BVOA 3O3BA 3G08B 1GIGL 4HEPA 4A7VA 5JMOC 1AOZA 4Y2OA 2J88L 4MJID 1NCCL 3DMMB 1ZLVH 1XF3A 1FIEA 3B8SA 5AVWB 1BPLB 4FYSA 4XMWA 1SXCA 3SE4A 4C54A 2R4SH 4UUJA 4ZG1A 1LO4L 3QUGA 3FW6A 3ES6B 5HJBA 3RTLA 5KVDE 1X4XA 3DETC 3VB9A 5DT1H 3LCYA 1QMUA 3BZ5A 2DBLH 2K0RA 3EYFA 4FFYH 4LDOB 2X87A 5E2TL 2I85A 1TDQA 1G9ML 2NNCA 1DDHA 3MRMB 1DSFL 3CNKA 2BFGA 3N06B 3SYAA 3CBRA 1DVFC 4PVMA 2QVTA 2HVKA 1NGYB 1F56A 1CCZA 4AY0A 1XF2A 2FQEA 2YEVB 5EO0B 1BQLH 4DTGH 5HYQB 2MQCA 1GZQA 4QAWA 4JL1A 2F8IA 1UM5H 3W39B 4YBQD 1H3VA 2C26A 2FNBA 1I7TB 4KH9A 5HJ3B 4HU8A 3SQBB 3GBNH 4N8VG 3DBXA 3QJHA 4RLDA 2EO1A 2NY1D 4P5TD 1I8LA 3OXSA 1ZE3H 5IBUB 4DNLA 5HHQA 3ULUH 4KTEH 4QRRA 4BM7A 1T5XA 4GXVH 5C0EA 5KVFL 1SF5A 1WEJL 1T1XA 3N55A 4UTAH 2J21A 3TPUB 5KYYA 3QH3A 4CA4A 4N9GB 2ICCA 3QIBD 4L3EB 2VDMH 1NAKL 5AKSA 3OLDA 3C6LC 1U36A 3L3GB 4ZMLA 4ZO8A 1FL5B 1FNEB 3B7SA 1QTYT 1R3KA 2P5EE 3L5HA 4JFPB 1O7VA 3FZUC 5IUSA 1FF5A 3VGGA 1K8IA 2DM2A 1KCVL 3T8XA 3BAIA 5EU5B 1NEZG 1BWWA 2RQEA 4FYQA 1E2ZA 1EAPB 3GSRB 3IXTA 3KHQA 3MCKB 1F2QA 4MFHA 3EFOB 2H47C 1OP3K 1OQOA 2XPYA 1OEZW 1IZKA 3EGSA 4NXKA 4WFEE 4DP2X 4NENA 3PWLA 5DK3A 1AH1A 2OCCB 3FB5A 3IWUA 1PFOA 3GIZL 4KXDA 1T5WB 1W2KT 4FS0A 4Q9BA 1TQBC 4ELKB 3PIQB 4HUMB 1ZEAL 4HSQA 4KKZA 3AMKA 4W6WB 4MMXB 1EEZB 3N2JA 1G6RB 2VAJA 3ARBC 3LHPL 3VWKA 2L4OA 5HHOD 3EH4B 1L7IL 1EZSA 4R4NC 4JFHE 4L05A 1WGVA 4KVCH 5L0QB 3MUY1 3ROLA 2B5IB 4JY6A 5BJTB 2P5WB 4JLRA 2NW3B 1TQUA 5DQJB 2QHLA 2VL4A 3UYRL 4KQ0A 3HZKA 4HK3N 5D7IE 1UXLA 4PGEB 4OCWL 5SWZD 3N1QC 4LARL 5KAQF 5HGHA 5CBEA 2OJ1A 1AI1H 4UILL 1PG7W 4QTHB 5D72L 2AJXL 2I07A 4OZGF 1V27A 2ZUXA 1HIML 4Y16B 4G70B 4PRBA 1M7DB 4DW2L 3FQYA 1SY6H 3EJTA 5F1NB 1BPVA 1ZHNB 1WUZA 1F3JB 2B4CH 3F6JA 4ABQA 1YJDL 4ODXA 2ZJSL 3UJIL 4U1KA 2NX5D 5LXGH 3TBTB 2R7EA 4FXGA 4K3HA 4KC3B 5EN2B 1E6JL 2JTYA 5BV7B 4F80A 2N7BA 3L4WA 1YQ2A 5JXEC 5J1TC 4Y19B 1CYWA 1R46A 1RU9H 2XIDA 1S7SA 4K94H 1B6DA 1A4KA 4KFZC 3WIIL 1Y1UA 3CC5A 1CF8L 4OCYL 4G8GB 3QJXA 1SMDA 1NC4B 4Y88A 4FQHA 1KTKE 3LEYH 4G7YH 3AG4B 3RGVB 1KB9J 2WXJA 1J1PL 2GABA 3ZBMA 1MHCA 5A3ID 3S34L 1F1DA 3BISA 2R29L 4EOWL 1XEDA 2BNQD 5B4MC 4N2LA 3MJ9A 1UH3A 4U1SB 1A4BA 3DX6A 8PAZA 3QQ3B 3L95A 3GBML 4NO5A 5BRZA 1HYSD 1NUDA 2XVBA 5E4IA 3RWCB 2VT0A 3ZKXB 4G6FD 4WK4B 3BT2H 5J89A 3F7PC 3CK0L 1CT8B 3O3EA 2JI2A 2NY3B 1JK8A 3C6EA 3O2VH 2GSGB 5F7DA 5I73C 1JXJA 2F54E 4YHPA 3CH1A 5LBSL 4OVVA 5E8NA 4Y1SA 4KKRA 3UADA 1GJIA 4K3GA 1AXIB 1YN7A 5I1CL 2Y7LA 4Z0BL 3QHZL 3PP4H 4MBRA 3U1SL 4P2RB 4X8CA 2Y1ZA 4HKXB 2ZF9A 1NUNB 3KPPB 1SOKA 2AK4D 3TZVD 3QJFA 2CRYA 2CO3A 3OGOE 2IPTH 1KDJA 1TJIL 3ENEA 4ORZC 4ZX6A 1I1RA 2H8PB 4XMPL 4F7CA 2E56A 3V0VB 5DZVA 3VFRA 3UMNA 3O3EB 2P47B 2XNAB 3MRDB 4TS6A 2FWSA 3IGUA 2AV1A 3FTZA 2XWZA 3L13A 1IKFL 4WV1B 1MRCL 4TNGA 3B1UA 1IL1B 1WCBA 4JL2A 4NZJA 2Q8BH 3IB4A 5FCUL 2ED6A 3HB3B 1WISA 2JJTC 1ZANH 3QIBC 4WU5A 4OTXH 1QBML 4OGAC 3D3VE 3UEQA 4XWGH 2ESVE 2YD3A 5IJKC 2X7LA 2Z93B 2HVBA 2J71A 4HKBB 5FW6A 1YEJL 3HR5A 2BIPA 1HOEA 4NM8H 3SDCB 4FHKA 1XB6A 3T0XA 1EA9C 4KMTH 2JJWA 2DWXA 2R51A 4P57B 4YN3A 5GZOA 4MAYD 5AW1B 3PQYD 5CP3A 2EH8L 3C5ZA 4HOXA 1WAPA 4B9KC 3IJSB 3MC0A 2Y06H 3BPOB 1MWAB 1CIDA 5IB3B 4S1RL 2PN5A 5B8CB 3NSXA 1U8KB 3EZJB 2GK0A 2NY2B 3HFML 3MNWA 3PWVA 4P59H 3CN3A 2QKSA 1IGFL 3ZYIA 3WNMA 5DRWA 3BUIA 1KUMA 4TQPA 1ZLEA 1RERA 2NLJA 2W0FA 4R8WH 4AGLA 1DQML 2DM4A 2VJ8A 2OL3B 5LWYL 3VXUD 1J9TA 2WWKT 3W38A 4QRUA 4ODUB 1EJOL 1AP2A 1YN6A 1SVZA 4J23A 5TGBA 2VKXA 4Y2DB 3SDXB 2ZOTA 3BKJL 4LKCB 3SKNA 4JRFA 3LIZL 4S1DC 3OAYH 2Q76A 5IP4A 4WU7B 2QBWA 4X0KA 3M07A 2P5EB 3OL2A 1ZK9A 4JREB 5DEGA 5EIIB 3KEHA 3PL6A 3QC6X 4F33A 4PJCF 2KZKA 4O2CB 3ROLB 3WY2A 5CN3A 2ICEB 2L04A 1F45A 1WDAA 2Y0SA 4P4KC 3D9AH 2X89A 3RVWC 5FO8B 5D7IA 1BQHA 4IGBB 4PRHE 1TYEB 1EO7A 4NC1E 2Q7YB 1X5LA 3SYQA 4YFLI 4OZHF 2OLDA 7TAAA 2XG4A 4Q2ZB 4A7QA 3CWGA 1XF1A 4Y2LA 5CP7A 1G9MC 1FYTE 4Y4FB 4FNPA 3GMMA 1V54B 3H9SE 4PP2A 2YRBA 3CUPA 4AK1A 4L8BA 3QEGH 2AEPH 4NWUH 1MRFL 2YO3A 1Z3GL 5DS2A 3VXNA 1JP5A 4HUXA 1KOAA 1R24B 1NC2D 2IPUG 4J8RB 3PWUB 5K33A 4H8WC 4H1LH 4PREA 2RCSL 3LV3A 2R9HD 2FWOB 2YAOA 3TP4A 3SYCA 3QUYD 4WZ9A 2XWJB 1KTLA 2VR9A 3PHSA 3QXUA 4JG1L 4I3GA 2WKGA 4QYAA 4WW2B 5D2NA 3GIVA 3PP3H 2G60H 5HYJD 3RX8A 1VDGA 2JELL 3RVUD 1OAZL 1ZS8B 2XV2A 3I6GB 2WXLA 1F1GA 2O6FA 1CTNA 1GW6A 5IJDC 5JOPE 1IQWL 2PTUA 4KKLC 1A25A 1AS7A 2XQBH 4LGRB 5IMKA 5KYYB 4K2UL 4FTVD 1QW8A 3AU1A 2QPDB 1A7BA 1KBKA 3ZKSD 4AEIH 3ARWA 2CCVA 3FULA 2AF2A 5C0BE 4IRZA 4N0UE 2OXGB 1WBXA 3MCLL 3MNVA 4P2OC 3WUWA 3CZFA 3EO0B 4U1LB 5F1KC 2F7PA 1BXVA 3MV7E 4AZUA 3LH2H 1V3KA 2IC2A 3L3DB 5CGTA 3PV6A 1TZIB 1SUJA 3LRKA 3V0EA 5I15H 2YPVH 3PHAA 4X7DC 1KIRA 5DTFB 2GTZA 5K1JA 1DQDL 1Z5YD 2HT4D 2VITB 1YPZF 4GRWH 1CDCA 4G1EB 4HDIA 5D96C 2PCXA 1W0VB 2VB5A 5ESVB 4F7EA 1TENA 4ZTOH 5I1HH 4F7PB 3MMEA 5I5MA 1WAAE 2Z4QA 1DVFA 5HI4C 5HXMA 4BRVA 3KLAB 5D5MB 4FXKB 4CMMA 4IRZH 1R0AL 3NH7L 1A9BA 5BS0E 3SKMA 2YMOA 4WGWB 2D9CA 4U6HA 3CZGA 1WRFA 3ZKMD 3FU7A 1FVDA 5GIRB 1DP0A 1GGBL 4B9FA 3DVGA 4AKPA 4JFXA 1T7VA 1GAFL 1PJ9A 1W16A 3HNTH 5H37A 2KBGA 1T0NA 4K23L 4LVNB 2FEJA 1BGXL 3WNLA 4KXCA 3I2CL 2A83A 4FTVB 1UM4H 4TQHA 1NFDF 4MRCA 1MWOA 4XVJH 5TQ0H 4BZ2A 1NL0H 4MKMA 3W1ZA 3W82A 4OGXL 4R84A 3FBKA 5ITFA 3AUWB 5HY9A 2L8AA 4FXTA 5DS1A 3UDWC 5ID1B 1HILA 2IBBA 3F7YB 3MOQA 4LLYA 5FKAB 4ZMOA 4KK9C 4PRAA 2FX8H 4JQIA 3UACA 2PETA 1SJMA 3VFRB 3TIEB 1DQQB 3FO2B 1VCBC 4NQDB 1V5JA 4DQOH 2VSCA 4O2EB 2Z35A 1NFAA 1XF4A 2DN7A 1JWMA 5KANG 2M2DA 4HCGA 2H1PH 2DZEA 2W80C 4N20A 3WJJC 1H6TA 4GO6B 2H3XC 3FUIA 5C71A 3QG7H 1T0NB 4NWTL 4XVOA 1RFDL 1UJTA 3MLVH 1DVZA 5E5MB 5DQ9A 3PJLA 4GMTL 4P2RA 2IDTA 3L4YA 1OP9A 1SUHA 4DP1X 3OSKA 4QHLB 1OB0A 3PY9A 5E2WL 4JO1L 5FYJD 1O7DE 4Z7QB 4J3OH 5IF0A 1JNLL 3PG2A 3VD3A 1MW3A 2BY3A 1EZVY 2PW1B 3HG3A 2CBPA 1GA2A 3FB8A 4HJGA 4WWKA 3RWJB 3SO3C 2VLRA 3K6DA 4Y5YC 2Z3FA 4WQOA 2JH2A 5JPMB 1SF3A 1NCOA 4PRHA 5F3FA 5FK9B 1DLFH 1QLFA 1P7KB 3US1A 1O5PA 4C59B 4AVKA 1OTSD 2EIMB 1ID2A 2LAAA 3OKNB 4YHLH 4ZFZA 2ESVA 3VG9B 4UNVA 1AZBA 4UDTB 3BUQA 1OSYA 1XTMA 3HPJA 1JCKA 5E51A 3C2AH 5F88B 3AQXA 1YA5A 3VFNB 1FZKB 3G5VB 5E6RB 3IK2A 4UTAA 1SDYA 2DV6A 3GSVA 1Q9LB 3MJ7A 4TTGA 3QZWA 3D4ZA 4GIAA 4URTB 1YO4A 2LT9A 1KJMA 4S10A 3QUYC 1XH2A 5KBDA 5D1ZC 3AVEA 3LNEA 1QLEH 3FCSB 5FFGA 1ZJAA 4M5YL 5IREA 4N2FA 3X12A 2VDPH 4AL8H 3I50L 3QIWC 2QQLH 3MFFA 4DVBA 5EFIA 3HZ3A 1U95A 2VGLM 1TVDA 1VZHA 3DX4A 1LDPL 3SCMB 2QVFB 1NGQH 3UG4A 1XQ4A 1C08B 1YVLA 1PZDA 4LPCA 2SEBA 2XWJA 3D39D 3SDAA 1KJVA 5BZDB 2ERJC 1P7QD 3GHBH 1SEQH 3CE1A 3GHPA 2D03H 4QD2E 4L1TA 3BKCL 3EHBD 1B9ZA 3M45A 1A3RL 4G6FB 1NM9A 4JLRB 2V0AA 5DJ2B 3TBYA 3W2DH 5SWSD 3ZE1F 5B38B 2YQ3A 4PBXA 4XXDB 4PP2B 2O5XH 3PGCA 2YA2A 4YDKH 2EDFA 4A6YA 4MMZA 1FFNB 1K6QH 2Z6FA 2OMWA 4HIPA 2OR9H 3VSUA 3P9LA 5ACZA 4E41D 1KY7A 4XMXA 3ULUC 1IU1A 1TQSA 2UWEE 4RMUA 3FCTB 4MJJA 4P2OA 3GXPA 3MA9L 3TNMA 1D9KB 4XWOD 1U3HD 1ACXA 3VXQA 5I0DA 1CO1A 3MACH 5DO2C 2XZAL 1FNGB 2NRDA 4N5UA 3UMTA 4AT6A 3QBTB 4NUMA 3BIKB 1HK6A 4MXQD 4RGND 1DQVA 4N0UB 3G6JF 3IETA 4IMLA 4AIZB 5JQIB 2AEIT 3BGFB 5D1ZI 2QQKL 4GSDH 2Z31C 4PJ8B 5BRZE 3KGUA 3IFLL 4YEEA 1P4IL 3G5XB 4IGBC 3GSNA 4PRHD 1N5AA 4MA1C 4PJEF 2MTAA 1FLRL 5IBLD 1WJ3A 2NDFA 4ETQA 4M9PA 1KB3A 4D3CH 1DQKA 2Z91B 3G5WA 1HE7A 4H7VA 4PCTA 1KTCA 1FYTD 3HE6B 3H4HA 3MBXH 3BSHA 3E38A 3GMOA 4W9ZA 1RP9A 4HOMA 1G6RL 4G72B 4WHDA 5I6MA 2B0SH 2GHZA 5LB1A 4L4TB 1W72L 2BP0B 4JQIL 3LPFA 4RAHA 4W70A 3QNZB 5GGTH 2D3LA 3T3PE 1AC6A 1F3DJ 2EACA 1FNSH 3QJHB 2AI0H 4AVHA 4L1BA 4YDZA 5AOKA 2WZ5A 3HBZA 2WKOA 1AZRA 4JQVC 4K71B 5EO9B 5MI0C 2P48B 2XZQL 5KSVA 4U3SA 1GZQB 4O4YH 3L3KB 4AE1A 4JFSA 1AR1B 1QRNA 2CLRA 3CX5K 3OX8B 5GRJL 4HPHA 5CEZD 4XCNB 3VE0A 3QFJD 4KXZI 5H4YA 1K6QL 2ZF8A 1MFEH 2NY2C 3RY4A 3E0GA 3K0WA 4P4KA 3UP1A 1VEMA 3FOLA 2YBGA 3SIKA 4BK8A 4DUXA 5CF3A 3K80A 3MJWA 1U8JA 4NZUH 1WP6A 4ZS7H 1OSEA 4ES9A 1CL7L 2XVLA 2H2PC 4YOKA 3WU1A 1K4CA 3ES6A 3NIFF 4M61B 1CG9B 3HZYA 1T21B 2OMTB 3JYBA 4RMRA 3BX7C 4NPJA 3ECQA 1SEQL 2CSPA 4JJOA 5AZ2L 4WTWA 5DD6A 4GH7B 3JWDC 2IADB 3V95A 3W9DB 3FO9B 5EU3B 5EN3A 4UYPA 5ICYB 1DJXA 1E43A 5HVGB 4IQHA 1RZKC 1SY6A 3KZ8A 5FYJH 3PGFL 4RMTA 5KSBF 5IB1B 3GSXB 5KJRH 3P0VH 2VW7A 4TL5A 2GJ6B 3RAJH 2HFEB 2XG5B 3B4NA 3DTXB 4A38A 5IB1A 3R4DA 3WGUB 3BKMH 1EZVX 1NIBA 5JYLA 1IAII 1ZHLB 1W8NA 2OULB 3OKLB 4P46C 5KVDH 3FO9A 4LP8A 2VQTA 3IPEA 1F4WH 3DUHA 4O2EA 1A2YA 1VFUA 4KY1L 2DLHA 3B2MA 1VERA 2LTQC 4AMKH 4LF3B 2EC9U 3AM8C 3HNSL 1AR2A 4EAEA 5E1AA 1U91B 3C2AL 3RY6A 1JXGA 3KPRA 1U8NB 1J1OH 4WHTA 2ZCZA 4HGWA 3U0PB 4LNRA 4I0PB 2OZNA 2X9YA 1ZV5A 4LIQL 4BH7B 3M6DA 3FRUB 4W4NA 3QFDA 5AL8A 4FKHA 5JUEL 1KPRA 2VLMD 1D5BB 4DP5X 3OD3A 1HEJC 2X4UB 2J1WA 2YQGA 3D2UD 4OI9A 5ICUA 4LMQE 4UZSA 4JFOA 3QNYA 3QNXA 7FABH 2F5BL 1TCRB 4OZFG 1FDLH 3RTQA 2X09A 3FTXA 3OB0H 4XB3A 1UATA 2V7HA 3PDOA 3RVXC 1UZ6F 3WKPA 2R0KL 4KZ0A 4WKXA 1GGYA 2VN7A 3EJQA 3DROA 3KWTA 2VDLH 3VXPB 4Y5VB 1WZ1H 1OTUD 4JJ5B 4RNRB 1HXMB 4K8RH 4FMKA 4KKCD 2B4CC 8CGTA 3E6HA 4WEUD 3ASWA 1EGJA 3VCLA 2R4RH 1UXSA 3K46A 3QNFA 3MMEB 4KPHL 1ES0B 2ZWSA 2XWTA 4A67A 4JG9A 5IKCA 2VE6A 3BQUB 3T2NL 1ZHNA 3CJJA 4M7JL 4EI5A 2BO0A 3BLPX 3CHSA 3FT4A 2LU5A 5PCYA 2YGVA 4ABVA 4AITA 4NRZB 2NSQA 3QXAA 5ANHA 2V3EA 2I07B 2IIJA 3GK8L 2MRYA 1QW9A 4IKNA 3U4EB 4KHXH 3FB7B 1BD2E 3PFUA 3JYCA 4GQZA 3JUZA 3NT0A 1RUMH 4YSUA 4ILDA 1KIUB 4OF5A 1IBZA 2IOMA 3HOGA 3HZKB 4KTDH 5D7SH 4BELD 2NY7H 3OMIB 4MSWB 2Y3AA 3HS9A 5HDBF 2IG2L 4LGPB 3RHWK 2WBXA 5DHVA 3OZ9L 3PWJB 1J10A 2XA8H 1U2CA 2DKSA 2W38A 3MUGA 1HINH 1VGKA 3PHOB 1YNLL 4TUJA 1UA3A 3PL6D 2VN6A 3R8QA 4B27A 1I1YB 3UIYA 2ARJQ 2QZQA 4YHMH 1KBGH 3HG5A 2OMWB 3A4DA 3LN4A 3KLLA 1J5OH 1WWCA 3EDKA 5E4AA 2P7TB 4MMYA 5C0BA 3VI3B 1T7ZA 2BZCA 4NO0B 4KXZH 1A6WL 4KRNA 4PWKA 4JK0D 1PL3A 2WY3B 3WDHA 4IBWA 1MCNA 1TEFA 3D4YA 4D2NA 2EZ0C 4NKDA 5IHWA 5JW4R 2NX5B 5D7HA 2O5YH 3FU9A 1VEOA 2J1XA 4L2YA 3OZ9H 4RRPG 1ORSB 1X9RA 1OM3H 5B39G 4OD1L 3H2QA 5C0BB 3VI3A 1AD9A 1DQDH 1MCSA 4FQJL 2AJ3B 1UHVA 5DZJA 3NCYS 2NY6B 4QJ5B 4M6OH 5IB5B 2DWSA 4DP6X 4BZ1A 5KBMA 1BZDA 4KUCD 2I60L 3A4FA 3HN5A 4JCLA 2XCMC 2YQ2A 3EFDH 2BIMA 3MLUH 4HBQA 3K8LA 4O51A 4XX5A 5ILTH 3BQVA 4N1HB 1DJZA 1T1XB 2WB1A 3GUFA 2WQSA 4RWYL 3MCLH 3MRRA 2B16A 4TKWA 4ZD3L 3DECA 5DHXB 2F6AA 3AMLA 4DP9X 1U3HA 3CPLA 4JY5H 1L9TA 4RWYH 4PTUA 1UKQA 4UT7L 5IMMA 3NPZB 2FQGA 3HC3H 1E5AA 1NJ9A 1I1AA 2KH2B 2HFFA 2IH1B 3HG2A 4K8RL 5E56A 5F1SA 2BHZA 1OARH 3OZKA 4Q58C 3E6FA 3AXLB 5TGBB 2OL3H 3O8XC 4ADJA 2BIHA 4OH2A 3T5WA 1J87A 3U4EA 1RUAH 3CDZA 3NUKA 4U6XB 4MNHA 2R0KH 4NRZA 3EO9L 1IM9A 4P3WA 1X5HA 4YHIB 3V6OC 1JDCA 3AS3A 1EZUA 4YL4A 4Z6AT 2MIZA 3UTTE 3MRCB 7FABL 2H9GB 1QEWA 4TSBH 4W9IC 4W9HC 1BF2A 3GBEA 1CXEA 1P6FA 3L81A 5DLMH 5IIEB 3GO1L 2X6VA 2CKBA 4Y4HA 4N2CA 3FXIC 4Q6IC 4X6DF 5EEVA 1E6OH 1D5MA 4Z1PA 4KJYB 2BVQB 4WO0A 1ADQH 4HUWB 5E8PA 5AQ0A 3WE6B 3J07A 1A9EB 2IQ9L 5EBLA 2Y24A 4O58L 1ET8A 3BH4A 5BRZD 4R7DA 3NSYA 2W07B 3FHAA 1PY0A 5CWSA 2G2PA 4ZDHB 3D9AL 3KYNA 2PF6A 3PQYE 4UIKL 3QUXC 5BW7A 2IG2H 2DQFB 4EI5C 2K6YA 4YC2B 5EIIG 3KLQA 4NQCE 1JRHI 1KLFA 5AOIA 1SM3H 2FD6H 1FO0H 5EF0A 4UTCA 2D3JA 3BVWA 1XWVA 2Z31D 3L5XH 3MOAH 4MQXC 4QGTA 1G7PB 3P2TA 4LSUH 5EZIH 3LY6A 1MJJA 3QQNA 3WFHB 3OKLA 4HWBA 5FR3A 3RPIB 1MLCA 5F9OH 3ULVF 1ZCRA 1DQMH 3ARBA 2D7TL 1SPDA 4YXKL 3VDBA 2FE0A 2R4RL 1BOYA 5I6NA 1MCPL 1MPAL 2WK2A 4OLVH 4MS8C 4LU5H 1Z66A 4HBCL 5D70L 2OK0L 5EOQL 4AV4A 2J1YA 2IBGA 4JFUA 3FTWA 4LRIC 4P3DB 3P3YA 5JHDB 3WHXA 5EV7A 4B5ZA 4CSTA 2WYZA 4J3UA 3CFEA 2GIXA 3WNKA 5D6CB 2XZQH 1DQLL 3IFNH 3CVHL 4GKSA 3L3IB 3WJMB 5IESL 3A6CL 1BW8A 1CG9A 1DLHA 4UANA 5EBWA 4L8DA 3NCJL 3D85B 4FFZH 3MROA 3ARDC 4FMFA 1ND0B 4RISH 4WFFD 3ISRA 3O4LE 1IJNA 3V5KA 3QXWA 1HX0A 1U92A 1VJSA 4OLWH 5EUOE 3U6XA 2VJXA 5CMAB 1HHIA 5CJOH 1KIRB 1AIFA 1QPKA 1U8HB 4XPBL 5BRPA 2H3NB 4J7RA 1GTFA 4PGDB 4YE4H 2K70A 3AADB 4KK5D 4U6TA 3VA6A 1S7VB 3WO3B 2VDKL 2XSKA 1PZSA 1E5CA 1BJMA 2I27N 2OA9A 3CZFB 4FI8A 4JM2D 4JPVH 4NQVB 3APCA 1GJWA 1P4IH 2XLLA 2N0MA 1HOCA 3N40P 3THML 3CDCA 2NR6A 2X70A 4NI3A 3V5DB 1SBSL 4BQCA 5AAPA 1KGUA 2EQDA 4JFZH 4OBRA 3V0WL 1AXSB 4ANWA 4BBWA 3POCA 1JNHA 3T0VA 2AXHA 4NKMA 1XHHA 3M7FB 1RZJL 1XAKA 1YSOA 4XNQA 4KNTA 1D5IL 4H8UA 5D71L 4KK9D 1JF1B 1J5HA 4EDWL 1B0WA 3QHZH 2LGNA 2FYYB 3U7YH 5FC9A 4K7PY 3MRPB 4LAJH 3OKEA 5IEKB 3N9GH 4TSCL 3H85A 5AKVA 5FGBC 3KWUA 4HPOL 3CZUB 1B90A 2FLRT 5GJSH 3MLRL 2EABA 1KIPA 4OM1L 4XZ4A 4HUVA 3KL3A 1CL7H 1WIOA 5G55A 3SGEI 1NKRA 3IJ8A 2X6AA 1ZSDA 4AW7A 4PB0L 2GTWB 4MWFB 3EYVA 2R0ZH 3UZVA 4NJ9L 5DZAA 2F7OA 4Q7DA 2JE8A 2Z92A 1KACB 5IQLA 2BNRA 2VZOA 3GMMB 4CVZA 4NX0A 4JHAH 3QDGE 4L4VB 4HLZG 4BA0A 4P2OB 4GUCA 2D7MA 3BOVA 4X4ME 4IBQA 1V3JA 1CF8H 1Z5HA 3PIQA 4LP5A 4LPUA 2VDNH 3GXMA 4QHPA 2B77A 1RQ5A 2W9EL 2DOCA 3N04A 4YDNA 2K4WA 3QXDA 5B3JF 1DQJB 5IOPA 2BSRB 5AW6B 3T0WA 3K6SB 3QJQB 3KPOA 4DERA 3MODH 2CKNA 1DJYA 4AL8L 4OCNC 5JZ7D 3D39B 1R3LB 4BFGA 5F0JB 1CLYL 1INQB 4D0BB 5DJ2A 3PL6B 5KOVC 3KBHE 3RLSA 1E8XA 2EVJA 2J43A 3ZE1B 5HHPB 4KK6D 4RFEB 3UCRA 3TO4D 3QRGL 3C75A 3SKOB 2F58L 2RH0A 1ZHKB 1B3IA 1CS6A 3PPSA 1NBCA 4RGMC 4G42B 5D2NC 2H6UA 4KZEL 2EUWA 5JA9A 3HRPA 5HPOA 3HRZA 4E9YA 4PH8A 3UIZA 2BIIA 2YKKA 5C0JA 3VACA 2PCPA 1T4KA 4KKPA 2MKWA 2ADYA 3BUDA 5AB9A 3L3GA 1IQDA 3FQ2A 3GMQA 4PBWD 5FHAL 3ECVA 3QUXD 3L3OA 1RK1A 1R3JB 2AK4B 4E0RA 3ZK0A 1A4CA 1U8KA 1LD9B 3OR7B 3GSQA 3MRJB 3KNBB 1H6UA 1HXMA 4E5XG 5DLLA 3LRSA 2VM9A 2X70B 2DWTA 5BUAA 5D6DC 1PCXA 1QD0A 3DYPA 4I9WE 3DIFA 4UOW0 3FCGA 4U3XA 5BVJB 3A21A 3MV7B 5J13C 5JW3L 3SE6A 3QPXL 1WO2A 2CA3A 4GMSH 5EZOH 3WUZA 2G3XA 1ZEAH 4LCUA 5DJXB 2XRAH 3I6KA 1NGYA 2E9IA 2GYSA 1NIFA 3RU8L 5DC4B 1A1OA 1HZHH 2AXGA 2BHYA 2JCCF 5E5UB 3TYGL 4L5FE 1CVSC 3EYFB 1RJLB 2AV7B 4ECNA 4LNRB 4XCYA 1BMGA 5D6DA 3IXAB 1IKNC 4J3BA 1J8RA 2FJFB 4XPAL 3RWJA 2GUYA 2XNAA 3NACL 5D5ME 2PXYD 5C0FA 4QTIH 2IMNA 4S11A 5L2JB 2XXFA 1IBGL 5T8IA 3GDBA 4GXUN 2P8PA 4I0PD 5J11C 3JV4A 2I7SA 4OZIA 1I8KB 4M7LL 4QHLA 2NXYC 3L4VA 4JCMA 4LSRL 1YY9C 4POYA 3S2AA 4GW1A 3GJFH 2MCAA 1AIZA 5F1IB 2C9QA 4IKLA 4JZJC 2HKHH 1CU4H 4PU2A 5D93C 1J05B 4HK0A 1ROWA 3QSKB 4S1SH 1NWPA 1W0WB 3FQTA 3ZE2E 4ZW3A 1MJJB 1ZVSA 2IADA 2WCPA 4ZSOB 3CLEH 2H26B 3K7UA 3W9DA 1K5WA 2A6DA 2BVYA 3HNTL 3BESR 3JTTB 1KZQA 2VMJA 4H26A 3PQYA 5HGBA 3HVNA 2O6EA 4G1MB 2UXFA 1S3KH 3QQ4B 1U42A 4ZT1A 1HI6B 5C0CE 4JM2F 2VZ1A 3EIFA 2CO4A 3QI9A 3H42L 1C16A 4RCAA 3JZ7A 1GH7A 4OZGB 4EEEA 5AYTA 5JXED 4OI7A 2OFQA 3AJ7A 1MHEB 1KEMH 4YIQA 5CEZH 4LXFA 1NCAL 4BSWB 4ISVB 3QG6B 2J6EH 3H3BC 2I24N 2QGCA 3LZRA 5FEBA 3D4CA 2FAUA 3II3A 2HN7A 1UUNA 4UV7H 4ZJ9A 1GMEA 4GRWF 3NFPA 5FWQA 5BZXA 5GIRA 5F8QC 1BJ1H 1ZT4A 1R75A 1T04B 1MJUH 3BMWA 3QZMA 3ARVA 2IFGA 1NCCH 5J12C 4KJYA 5EO1B 4NQCD 4O02B 4PV8B 4NN7B 1UZ6E 3KLAA 3SBRA 5E94B 1RK1B 2AK4A 5JORB 4JZJA 4HUUB 5AOJA 5IVZA 5T1DL 1MCQA 1FGNL 2H1PL 2AEOA 2XYCA 3AQZA 5F1NA 3QDAA 1AO7B 3VWJB 4Z7VF 2FGWL 2KLRA 4LSSH 2ZXWB 1EVTC 3HG1B 2ZSVA 1YMHA 3QC5X 1MJ8L 1MREL 4XN1A 2HJKB 5JMRA 1RUPH 4GO9A 3DUSB 3AGVA 3S4SG 3VSVA 4M4PA 1L9RA 1D5ZA 3V79C 1HH9B 1WAAA 4HVBA 3DJTA 3BIKA 3MBWB 4X8GA 3OB0K 3KYKH 4JG1H 4QHMA 3LKRB 1CDYA 1NMCC 4WNJA 3U4BL 4NC1C 5LGHH 3O6KL 4EQ2A 1UM4L 1NEUA 2FIKA 1SXBA 2UZYB 3WGVB 3TNMB 2RCSH 1FE8H 2K8MA 1KGYE 4XP4H 2GSMB 4YXLH 1U2YA 1ZIBA 3BN9C 3ESNA 4X6BA 43C9A 4NSKB 1N9PA 1H6EA 2NXZD 1A21A 4YAQA 2O93L 1DUZB 3BQUD 2YPLE 4WIQA 3RWFB 3SJVB 2E9JA 2EJ1A 4K8RC 3OJVC 4YHYB 4X5WB 1T2JA 3PGCB 1EO8H 5IV2B 4DCQA 1YYCA 1J9SA 1QRKA 3V4PH 5D2NB 1FV1A 4MWFA 4PRNB 4QWWC 4FXKC 3V8CA 3DV4B 4KKNA 1CE6B 3FTUA 2L7QA 1KXQE 4MRBA 4JFWA 3ZX1A 2B14A 3OKOA 3EOTH 1CD8A 5FOBA 3RNQB 4KGJA 1A5FL 5EF3A 5BV7H 3TM6A 4PJGA 4XGZA 3T6WA 5IV2A 3MRPA 1NDMA 4BFKA 1Y6NR 4AEFA 2OZ4H 5KYXA 1ROCA 4KK8D 4APQB 1D3CA 4ZFOA 1AQ8A 3KVDD 2E0PA 3R0MA 1MKFA 3QUMB 4Z7UF 2GSIA 3CN2A 1FA4A 3T0AA 3G7TA 2MNUA 3QH3B 4PB0H 5BV7C 2OR7A 3QUZA 1CLCA 5E8DL 2WLLA 5IG7B 1OP3H 2LW3A 4NT6B 2GHWB 5J3HD 1OAUL 2UZYA 2KLSA 2WN3A 5AAMA 3FAXA 4HXAL 4O2FA 4I4WA 4FJZA 1HSBB 4P59L 1N0XH 4P5KB 1A65A 2ALWA 2JFCA 1OAZH 2AKRB 2R1WA 4EDWH 4C56B 2JELH 3VH8G 2LU3A 2R0LH 4JANA 4PRPB 1EV2E 5TH2A 3SPGA 3FN3A 4OBSA 4OCRL 1AP2B 3DUSA 5G2NA 4JDEA 4OCSH 1AFVH 1BQRA 2O5NA 4LO9A 1J5IA 4LEOB 4ZFGL 2QKIB 4ALAH 4HIEB 4UQCA 5KVGH 3VD2A 4IIQB 3C9NA 4AXWB 2ZG2A 3HE6C 4GLRH 4MA7H 2PXYB 1L6PA 5EBWB 4AE0A 3PWPD 4EZLA 1G4MA 1TZGH 3DOSA 4X50A 1QZ1A 5HDLA 5SWSB 3K6NA 3VRLF 5C3IA 1KCRL 4AIXA 1H8SA 1W0YT 2DQTH 4IRSB 1DBKL 3HI6L 3NRFA 3CFEB 2CAKA 4GW5B 2ROXA 5FGBA 5AKRA 1M2OA 3EOYG 5HHME 3HJ0A 3KGSA 4MB1A 1PCSA 5HSFA 1OGAE 5HYFA 5I23A 4UT6A 4P5MA 4A55A 2AMGA 4D8PA 2J2ZA 2XWCA 4OLWL 2CGRH 3IE9A 4OT1L 2XZZA 2W65B 1SN5A 3KW8A 5D5MF 5I1LB 3WY4A 2TRYA 5GZND 2XY2A 4M5ZL 1KMGA 3GLAA 3UYOD 4KRLB 4ISVA 5C09D 1EANA 5E4EB 2FJSA 4RBPK 1WCBB 3VM5A 4AM0B 3B9KC 1AHKA 3VXOA 1JYWA 1PD1A 1GHFL 3OAWA 1KDIA 2CBTA 3ILPB 4JRYA 4PLJD 5D70H 2ROYA 5E1AB 4LLYB 1INDL 4G59C 3S0PA 3ILPA 5C97A 3ZO0A 2PTTA 5LBSH 4XN5A 2R1XB 5T3XL 1X5JA 4FTDA 4AYMC 1JYNA 1LP9F 2JSFA 5EU6E 4XAKE 2D7TH 3CFBA 2VL5A 5F9JB 3TF7C 2W07A 2E7HA 5GS0D 3FU5A 3B43A 3QP3A 5I1LA 1UH2A 4PVLA 5BUPA 4OJCA 4TQ8A 3L4XA 1DVSA 2FJHB 3LXUX 1EHKB 2KDGA 3L5XL 4QTFA 3RWIB 1RZIA 4PW9A 3BP4B 4ZMAT 1VRSA 1V3MA 4AWJC 1NEPA 3EH1A 5E8OA 2EEAA 1KV7A 2HT4C 5ICYA 2E76C 4U6HB 1E3FA 2F15A 4MJIA 5F7BA 1JTOA 3KYOA 1WWWX 5DEJA 4KJPD 5HI5D 2V5RA 4EJ1C 3ZIMA 4HWZA 4N6RA 3VQMA 4EN3A 3EXLA 1DVFB 4K94L 5I8OL 1TU2B 3U2SA 3THMH 2XA3A 4GIOA 1IEAA 4FNQA 4PJDF 3CHQA 3RWCA 3IXAA 3ALWA 2P80D 2W9DL 3F7RA 3FTGB 1LK3H 4XWGL 6PAZA 1WSST 5TF1H 5EDSA 4O58H 1IC7H 1OAYL 3GYRA 2E7CA 3QWQB 4YBHA 2AXGB 5D8JL 3C08L 4HV8A 2OSWA 4AYFA 4EZJA 3B9KB 4U1GB 3BP7B 2DQIH 1T5KA 5DJAB 2CK0H 3ARGC 2X0VA 2YHGA 2HFFB 2IH1A 2LE9A 4EUPH 5G4MA 4I3SH 1GGIH 4XMKH 1P1ZA 2E6QA 2IDFA 4RISL 3CU1A 1DQIA 1HIMH 3SE8L 2ZOUA 2OMVB 1MZZA 4QOKB 5JQ6L 4M3KB 5DLML 2NQCA 3ZRCC 4NHCL 2I9LB 3ZZ1A 3S2CA 3P30H 1YY9D 4HIHA 2H1LM 2N4IA 4L4TA 1SYSB 2WLLB 1T6BX 4PJBE 5C0ND 2APFA 1LD9A 4OKVB 4UIMB 3UXFA 5IG7A 4N28A 1GOHA 1M7IA 1SVBA 1F41A 4U1KB 4BFOA 2ZP9A 1SJEB 5EZLB 2COQA 2D3VA 4IBZA 2YN3A 3IBOA 3Q2NA 4KV5E 4LKXB 3CXHJ 3GGWB 4LU5L 3OAZK 5F70A 1JI1A 5FUOH 3MLPA 2OW6A 1TVBA 4OLVL 2APTA 3MV11 1JK9B 4Y16A 2NY6D 5KVEH 1XR9A 2WXMA 1X9LA 3HVDA 3ARDA 3I74A 3L7EB 3SDCD 4ZD3H 4P23B 1FNLA 1VADB 2ZUWA 3EXJA 4WO4D 4KI5F 5J56B 2QSCH 3TBWB 3BD3A 1JGLL 2O72A 2E74C 2HT3C 4YBLC 4PGBA 4V1DD 1XCQB 2WKLA 4LK4A 1QQDB 2BOLA 4WRLA 5BRQA 3ZTNL 2ZUTA 2BW5A 5FV2A 3WNPA 2P7TA 5DMGC 1M3JA 1MEXH 4HHWA 4KGLA 3FYEB 1BFVL 4NZRL 1NIDA 4PCKA 3MBEB 3I6LD 3O6ML 3BW9A 4BUQA 4MMXA 3PJSB 1ORQA 4XN4A 5GRXG 1PYWA 1H3XA 4H88H 5AW3B 5K9QI 3DX7B 4CBZA 2O5YL 2YPKA 1AO7D 1MN4A 4IRSC 4M1GH 2KZ1B 4IGBA 3RY5A 4KZDH 2DQUL 3DA0A 1WIUA 4OU3A 4P0DA 3TONA 2WQ8A 3MLTB 1AQDA 5KEZA 3KDPB 2ATKB 5DEZA 5FW7A 5LO7A 3WJJA 3EYOA 4NHUA 1MCBA 2YD5A 5CGMA 3EGSB 2GTWA 4TTDD 1YJDH 4MSWA 3HHSA 3CN4A 2QKIC 1J9CT 3NJFA 2CRMA 1MI5A 2JKIS 4KTEL 5AB1A 2WYHA 4MCNA 1I3RB 4PQXA 2VERA 2FEDC 2BSSA 2X1XR 4YDJA 3CCHB 2JCCA 2XN9D 5EWIH 3MSPA 1KPUB 1BQLL 3OKMB 3IGFA 1SEBA 2G4EA 3C6SB 1O6SB 1T66D 4HUUA 1ZXKA 4M6NH 2V17H 1UJ3A 1W8EA 3T4AA 2ZKMX 4YHYC 2X4RB 1A6TB 3PGDA 4ZMVA 4N85A 3BAYA 5C08A 1SYSA 2HJFB 1BREA 4P2AA 5BOPA 4NNPL 1J8HE 4HHAB 3G9AB 5AB2A 5DHDA 3OR6A 5ISZD 5IQ7H 1S8DA 2Y22A 4GBXC 1INEH 4JKMA 4V33A 1P9MC 5C0GB 4UMSA 4LLDA 4UINL 5JR1H 2OMUB 1TG8A 4NAJA 1A47A 4K9EH 3GRWH 4XOAA 4DUVA 4KKAD 4XP9L 1E9OA 4ZFOL 1U3YA 2A4CA 2E9GA 4PMFA 4KPHH 1HHJA 3RZCA 4G6AD 3P69A 3WG7B 1DL7L 1XO8A 1D7BA 2AP2A 3MV9B 3QIWA 1BLIA 1FFPB 5ETUA 2EDRA 5JPMA 5HDBE 1G4RA 1ZA6B 1IGML 4QCIB 4XX1G 2AV1B 4YHKL 3VO0A 4Y9CA 4I3RL 3ZSTA 4PRIA 2KMWA 4IKKA 1PZUB 3NABH 3WL9A 1HHKA 4HZLB 2JLPA 5C6WH 4ICXA 5IF0B 4F9LC 4JFYA 1XF3B 4XBMA 4J3VA 3VMPA 3WAJA 5BZZA 3O4LD 4K7PL 4R4BA 2F54A 2FDBP 5GXBB 5D7LD 1E27B 5IHUL 1QBAA 2QPFA 2W0KA 3U0WL 4H0IA 1Z9OA 3QJUB 1WTGT 4OZHE 4LIQH 1JWUA 4D0DA 1Q9OB 1XGRB 2X2JA 4GXVL 1A1NB 4MTMA 1KG0B 2LU4A 4YHML 3VYOA 4I2XA 2ADIA 4JO3H 1UXMA 2CO7A 3CQQA 1NMBH 3D34A 4NQDA 5ISZA 4NQCB 4ODTL 1CFQB 1F4WL 3RVUC 1GS8A 1WBYB 4AQEA 4W4OC 3KJ4B 2CXGA 2DEWX 4H2CA 1U8MA 1LEKB 2RFXB 4L9LC 1BM7A 3G6JB 3D25B 4XRCA 1IV8A 1N5YL 2F53E 3KYMB 1LILA 2RB8A 4JGMA 1TF4A 5E99L 3CBKB 1DE4A 4AYBA 4KHXL 1LO3H 5F6IC 1OB1B 5L4FA 3TVMD 2F8VA 4W9DC 3JWNG 1ED3B 5TFSL 1FO0A 4J1UA 2W65A 4ZAKD 3EO1A 4DESA 3RFZC 4WUKH 1F00I 4D8PB 4HIXH 5A40E 1I3VA 4OFQA 1BYPA 4PY8I 4HW6A 2J88H 3B7RL 4E9WA 1C9SA 1CDHA 3OR6B 1KXHA 3F00A 4PUBH 3F7KA 4S1QH 3RP1A 1MIEH 1MIMH 1UASA 4UTBA 2CKBB 4Y4HB 3EJUA 1WZ1L 4M93C 1NFKA 4GIPD 1MFEL 1ID5I 1T1YA 5DJCB 1BXUA 4XNUH 3Q5TA 3L4ZA 3QAZB 4NI6A 1CURA 4MJ2A 2PCPB 5EU6D 1BDYA 4LEXH 3BPOC 3D30A 3FFDB 1F11B 4G6JL 3WE1A 1FYHB 1K3ZA 2YUWA 1OP5K 4LPVA 2X44D 3UZQB 3HAEA 3MUUA 4CMHB 1ZK5A 4HUKB 5LHDA 4FQPA 3E6FB 1IAKB 1JPST 3L3DA 3CZKA 3T0EA 5I9QB 1LNUB 3L9RB 2FB4L 5T1LD 1U8CA 2H6PB 4U2YA 1B0RB 3FONA 2DMBA 4D0CA 3DRQA 2IGFL 5D7KD 3WSQL 5DD1H 4KNSA 1PX8A 3QK0A 4R7NB 4Z7UB 5E4EC 1N3NB 2RIKA 1CI3M 1HFUA 3FRPG 2P5WE 3WI9A 2HLEB 2FEDD 4NQUA 3GRBA 4J12A 4AJVA 1BZOA 3U0TA 5F0MB 4DGVH 4NAMA 3VFPB 3M8OH 2H1XA 4NQXA 1CGSH 3MR9A 2D7NA 3M86A 4XXWA 1SQ2N 2ZNWA 3A23A 3D05A 4PJ9A 3STLB 1LEGB 4AOFA 1XB8A 4GUPA 4FXLA 4NQSA 1T66C 3X17A 2J6EA 1AD9B 2I26N 2VR4A 5I66A 3OF6A 1FLTX 5KJRL 3VWKC 3IDGB 5MEOB 1HU8A 2X2YA 4PJ8C 5B38A 4PGBB 4YNYA 3RA7L 1AHMA 4JO3L 1EAPA 1Q1PA 2YD4A 3QI9D 4I9WD 1QTPA 4DO6A 1B4JL 1T3FB 5F7YC 5C0DA 3T4YB 1GZHC 1L5GA 2WLKA 2DQHL 1PKQE 3LB6C 2DYRB 5AYQA 3DX9A 3UO1H 3DUUB 3UC0H 2XFGB 4KUZL 4FN0A 3QZBA 1DBJH 1XDTT 5B1BB 5ERWB 3SPVB 3W2DL 1I7ZB 1CPUA 4BEIA 4XOBA 2OMXA 3KH3A 1M7IB 4IS6A 3D1MC 3P4OA 4N25A 1YNKL 4XNZC 1GCFA 4N0YL 1OD9A 5D7IB 4QRRB 1TQCB 3KPNA 3D39E 3NIFB 3PF2A 5IM7A 2FL5A 1NFDA 1TJHH 3C6LA 3CZLA 3G5VA 4AUYA 1XF5B 4CC0A 5JOFB 1CLZH 4O2CA 2AI0L 4YH6A 2C8NA 5HJ3A 3J8F7 1IFGA 1FUNA 3CIAA 3QHFL 1W72H 5SWSE 1OTTD 2DQCL 1FNHA 5DMIL 4M5YH 5FW8A 2ZX7A 2HPTA 4JR9L 4D3CL 5B3SB 2E6JA 3SGJA 1Z1WA 4JCWA 4P2RE 4XNDA 2XBTA 1MAKA 3SY0A 3UTQB 2HT2D 1X7TA 2P8LA 5L8KB 2A3TA 4QY8B 1BWMA 3TLRA 2BX5A 3PWVB 1P6WA 3GNML 3OQRA 3U9PL 2P1YA 2ZXGA 4NJAL 4JVUA 5C2BH 3KBFA 3MV8A 5A7EA 5E6IC 2XN9B 3O11A 4PS4H 4DPCX 3O41A 1IZJA 2PYED 4PLOB 4R5VA 1QR1B 4ENZA 5C09A 4RA0C 1DVTA 4AQ1A 4IEFB 5ALCL 4JO5A 4RSVA 1IVLA 4F8PA 2R2EA 3JWDH 3FT3A 1K8DB 3BMVA 4N8PA 2EKJA 3FSZA 1DE4B 3QS2A 2ITCB 3GI9L 5DZNA 3H9HB 3VI3F 1XF4B 3KXFA 4MJHA 1ZAGA 4A1RA 5HGAA 4R26H 3UAJC 5DUML 1UUSA 3ZDZB 2E59A 4OLYL 1YNTF 3BCFA 2J57A 3TEUA 1KLFB 1Q94A 3PV7A 4WK2B 1N6QL 3PWPA 1AXTL 4K5LA 1NANI 3HMWH 5CLTA 2EVGA 3TO4A 4UQ3A 3IU3B 3M88A 3WAKA 3QWRD 1U8OA 4MCYA 3D51A 1E9PB 1OHZA 1A3RH 1B2WH 4XPGL 2G0LA 3SBPA 4I2XB 3GHBL 1I75A 3H4FA 5HHVL 2VLJD 3O6MH 3ZW3A 3OMZA 2APXA 4TQEH 2Q0ZX 3HHMA 4KROD 1NCWH 1BFVH 4NZRH 5F3BA 4MZ2A 1K72A 2HP4A 1OAXH 2QMKA 4DF9A 2YEZA 5DFTA 3EJYC 3HC0B 3B3IA 3HBQA 4FG6D 3FU7B 3P73B 1JGLH 1C7TA 1XGQA 3O11B 5E6YA 3ISYA 4KMQA 1D9KD 4GW5A 1CFSB 1J0YA 1QOKA 1M71B 2MCPH 2K45A 1LEIA 2CIIB 2WWOA 2ZXDA 3Q8AA 2HRGA 4MLIA 4KI5C 4XVJL 4LVNC 4F3FA 3QYMA 4TUKL 4JDZA 3ZYOA 4P8QA 4FKEA 4I0CC 4E42A 4H0GA 4AXWA 1PZCA 3B1TA 1DN0A 2VXTH 2Y1VA 4HQQL 4N0FB 5ABAA 3UTOA 5D7LE 4GAAA 3A5VA 1MCJA 2YGOA 1U8PB 2H0JA 1OF2A 2ENQA 1PY4A 2WXRA 4HZ1A 4YHNB 5D1QB 4QLRA 4TLUA 3VM7A 5I0WA 4Z77B 4G5AA 2RACA 4P5KA 4LP4A 3DIFB 3EGDA 3GTVA 5FB8B 1JPSH 1RIHL 3DVNB 4PI2A 1M1SA 4ELDA 3KAAA 1YUKB 4M8QB 1YYMH 4J6RL 4ODHH 4MCZA 1CMOA 3EUUA 4MVBD 3SGKC 4AQ8C 3N0PB 4JM4L 3S35H 3VFSA 4EI6A 3VQLA 4NUGH 3T4AB 3L16A 3QUMA 2IALA 5IT2L 2OAAA 3C2SA 5BS0B 5DU7A 4EUPB 2R1YA 4XN7A 1EJ8A 4LSTL 1IGCH 5AENA 5IB5A 4QPEA 1N59A 5GGRB 3E3QC 4WNQA 3QXVA 1WVZA 1MDTA 2WNGA 1RFDH 3RQ3A 5GISL 3I3EA 5J6GA 1G9EA 2VIRA 2D2OA 2HX8A 3KCPA 4IBLT 2OS7A 4RIRA 5F7EL 5IBUG 5MEQA 2JQAA 1GPOH 2AQ1A 3QUKA 3WUWG 1U6AH 5BQ7A 4RFEA 1GW0A 5HD8D 2X53A 3HHSB 4DPRA 1HKLL 4WEBH 5ITBL 4GQQA 5L2KB 4QDGA 1P0SE 4PS8A 2BP8A 4YLQT 5F3HA 2WLHA 2QDVA 4NPYB 1NCDL 4TLTA 2OTUB 3UAJA 4BQ9A 3HPLA 4X83A 4WHCA 4AYEC 1ASPA 1HAWA 3EF4A 2P28B 5JIDA 3EYQD 4C56D 3M1BB 1CR9L 3LXCA 5GGVL 1OK0A 3DGCR 4Q6IB 4TUJB 1MF2L 2PWDA 3TJPA 2JKJA 4J3WA 4A6YB 1DSYA 3O6FA 2HT2C 5GGSB 1COBA 3FH8A 1KJ2L 4D7PA 2CM5A 1QQDA 3UBGA 4TVUA 1EEYA 5JW5B 1U8QA 1GHFH 3TBYB 3QEGL 5B7FA 4F93B 3DSFL 1J86A 1QPPA 4D9RD 4A7TA 1Z0MA 3CMGA 2W8CA 2BFVL 1UQSB 4EE2A 4U1MA 1OCWH 1FL6B 3KM1A 3L7EA 3T8XB 4V11A 5DMJB 4QRUB 2CKBH 2HJKA 5FFOA 5JO5B 4ZTOL 5I1HL 1JK9A 3SO5A 5I0XA 2ZKHL 4Y4FC 3LKQB 1CICD 4EI0A 3EFFA 5FYKU 5T3ZL 2W0FB 3SGJC 3SGEH 4JQXA 4HYTB 4WWKD 4KVPA 1OCWL 4GBXD 3CDGB 5DJCA 4PM1A 3RI5F 1CDBA 4L8SB 4KROB 4ES8A 4JREC 3K74B 3VCLB 4BKLB 4PLKC 3REVA 1CFBA 1XZ0A 3C60D 1FC2D 4Y2DC 1HL8A 4DT2A 5L2KD 3BE1L 1LK2B 5DC0A 5EEUA 4KRPC 1Q9LA 2UUDH 4U2ZA 5F7UA 4MASA 2XV3A 3H0TA 3SD2A 4YSSA 4HETA 5GGQH 4HH9B 3HR6A 2WTRA 4WW2F 2V7HB 4ALAL 4PRPE 1G7IB 1ZS2A 4CDGC 3BIAX 2ESVB 5CXPA 5IVXB 4F7MA 3D85D 1JHLL 25C8L 2XQBL 2X7LB 2Z93A 4OFYA 1MVUB 3WKMH 4LQFH 3WKNA 3VDAA 3TWCH 2A7BA 1KPRB 3HG0A 4K5MA 4Z3TA 4PJ8D 1YUHB 3O9WC 4PBDA 1WBZB 1QVOA 4FGMA 3VGAB 5FYJE 4LQFL 5AW8B 4WV1A 2ZYIA 3ULAB 3E7JA 5L88L 2G60L 1KCSL 3KPRB 4E42B 3GLDA 2Z8SA 4GSQA 2DF3A 2VLRB 4GRMA 3ULUE 1QWHA 2BSEA 3HE7B 3HC4L 4X7SH 3GXDA 3GQFA 4PJ6A 4HJJL 4PIRF 2B1HH 1KZYA 2A1WL 1F42A 3OAUL 4LHJB 5K9OB