3EA2A

Crystal structure of the myo-inositol bound y247s/y251s mutant of phosphatidylinositol-specific phospholipase c from bacillus thuringiensis
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKYKVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYSYASSINPEIANDIKQKNPTRVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Modulation of bacillus thuringiensis phosphatidylinositol-specific phospholipase C activity by mutations in the putative dimerization interface.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Lyase
total genus 116
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ea2A00
2ISDA 1GYMA 3PTDA 4I9MA 2OOGA 1T8QA 2F9RA 1QASA 3NO3A 4RV3A 6PTDA 2ZKMX 1DJHA 3MZ2A 4QJ3B 1ZCCA 3V16A 4QJ5B 2PLCA 4I90A 4I9JA 1YDYA 3V1HA 1V8EA 4PTDA 4RW3A 3KS5A 4I8YA 3QR1A 4R7OA 3H4XA 4I9TA 1O1ZA 5T9BG 3I10A 1DJGA 4F2TA 2PZ0A 3KS6A 1DJIA 3L12A 3H4WA 1T6MA 2OR2A 3CH0A 4QJ4B 2FJUB 3QVQA 3V18A 4F2UA 1QATA 4S3GA 3QR0A 5PTDA 1XX1A 5T91A 7PTDA 5T9CE 1PTDA 4GNKB 4F2BA 2PTDA 1DJYA 2P76A 4Q6XA 3RLGA 1AODA 1VD6A 2O55A 3EA1A 1DJXA 2OTDA 3EA3A 1DJZA 4OECA 3EA2A 1PTGA 4RW5A 3RLHA 1DJWA 3OHMB
chains in the Genus database with same CATH superfamily
3GVVA 3ZJ7A 3WNMA 4QQ3A 1HN1A 4HSHA 1JAKA 1W5OA 4GA8A 2G3JA 1XLIA 3MV01 3GVQA 1CENA 3DBPA 2PWVA 3MV11 2VC7A 3INPA 3USZA 2VDHA 2HROA 4EANA 4C6QA 1QPKA 1LCOA 4IIHA 3LOTA 3M1ZA 5XIMA 4DI9A 3P5ZA 3E2QA 3NQ2A 1UWSA 1XSJA 4Q8QA 1L8PA 2YR1A 2ZC8A 3GNOA 4PMUA 2D3NA 5DXYA 4A8IA 3UD6A 4TV5A 3BLKA 1JVNA 4YHGA 2FMNA 1E5JA 3A4WA 3CV2A 5E09A 3T0TA 4U4MA 4FNSA 4O53A 1XIDA 4IPPA 3G1DA 2EO7A 3PZGA 4XVEA 1FCQA 1R3TA 5D03A 2C1IA 3N2CA 1PTDA 1V3LA 3PZVA 1XH2A 3MMWA 3GFXA 4AD0A 4PUNA 4GBUA 2QF7A 6TIMA 4E6MA 2RFGA 1GNXA 2ZUTA 3S9IA 1EO7A 2L5HA 3BLDA 1KLZA 3EA3A 2NLIA 3T0BA 1NFBA 3W85A 1YBQB 1HKWA 4QNWA 3VVGA 4CN1A 2XG9A 3AIVA 2BHUA 5KTLA 4IWWA 3DI1A 1I60A 4D6EA 4C6MA 3WDRA 4GQBA 4PSRA 3LRMA 1GTEA 1ECEA 3WBAA 1QW8A 2VM8A 2PP3A 5GNZA 2R1KA 3GG7A 4WEVX 3RR4A 3QLDA 2JE8A 2PTYA 3CQ0A 1PZ3A 1T0OA 1TRDA 2E9MA 4H4IA 3NSNA 1J8VA 2FZDA 5HATA 3CWHA 1LL6A 1BSIA 5IM51 1DJIA 1YTDA 3W74A 1L6FA 2Y5EA 3H2AA 4HK5A 1AA1B 3T08A 4Q33A 1O68A 5GJMA 3VX1A 2BVYA 3QOKA 4JKMA 1V08A 3V5CA 2GVEA 4F0LA 3QGVA 2DFAA 1EPVA 3VD7A 1RPXA 2YGYA 1VKFA 4DBUA 3B8VA 4OWGA 4ZSUA 1VFHA 2XTKA 4LBUA 1LUCA 3EEGA 2ONEA 3CAKA 2XIBA 1OHLA 5HWMA 3OG2A 4C6KA 3RLGA 1Q6RA 1VH7A 2Q09A 3DXIA 2O55A 3L4YA 1MEIA 3VU2A 2W9MA 3O9NA 3SADA 1HXJA 1DJZA 1Z89A 4PB3A 1UMYA 4O12A 1UOKA 4JL2A 3FJ6A 4LNCA 1OVDA 5GJPA 1B9ZA 2VGBA 4MAVA 2V8ZA 1ZAJA 2OOGA 2DZWA 2A0NA 2CLPA 2OWXA 5BYWA 4JTJA 1DHPA 1VJZA 4KRTA 1SSDA 1YHTA 3TJ4A 4GUHA 4KWSA 1XSIA 4DWSB 2GDUA 2POTA 4KCVA 5GJNA 3KRBA 3GU9A 5EA9A 3C0LA 4M81A 5IBXC 4JX6A 1RVKA 3VIPA 1S3HA 1FWCC 1FTXA 4H41A 1NJJA 4V2XA 1N8IA 3PWAA 2HNEA 2ATSA 4ZB0A 4C6FA 3AIQA 4LALA 4MHBA 1C3FA 3I3EA 1NM9A 4QLKA 1W31A 3WFAA 2X0SA 1BQCA 3W7EA 3ABQA 2G3NA 2CESA 4B9ZA 4Q4QA 3U2ZA 2F2KA 4LAZA 3MUAA 1DQUA 1R3QA 3ABZA 1UG6A 3LBOA 2PWEA 3LSCA 1EIBA 4ZENA 3NURA 1H1ZA 3C8NA 1ME7A 4O8AA 2X41A 3FFSA 1W3HA 2OLHA 5DLCA 3SCUA 2R1LA 1LOSA 3CPGA 4PMZA 3ENLA 1XLLA 4TVDA 1E40A 1QPNA 1TJ2A 5AC5A 1X6NA 3D47A 4X63A 3TZFA 1Q4WA 4JTGA 4AIBA 3R79A 2E6DA 3K5XA 2VX7A 3B9EA 1XM3A 2JF7A 1YDVA 3GVWA 1S46A 1UPPA 1KBKA 3N6JA 3AMDA 2Z24A 2X16A 1GJPA 2POZA 4EPDC 1V3MA 2TODA 3O15A 8XIAA 3TX9A 3FDGA 2V69A 3AIBA 4MNJA 4MB3A 4IP4A 3R4IA 4RPPA 3NGFA 1XV8A 2CLEA 4JKKA 2XM1A 3B40A 4Z1CA 5I2UA 4S3GA 4CLMA 3FAXA 4B5SA 5BRQA 8XIMA 3IVSA 3W07A 1OG0A 3CUGA 2EG6A 3IGUA 1EEPA 3NNTA 3OLDA 3CUHA 3W82A 3BARA 1X1ZA 2FHFA 2J7CA 1KM5A 2IQTA 1A0EA 1DIOA 1ICQA 5MKGA 4ECLA 3VO0A 4M6UA 1C8XA 4JTRA 3GZ3A 2YCLA 4C1KA 2E1DA 2BS9A 2Y7EA 1BTCA 4WQ6A 3CUIA 3Q58A 3HFYA 3W7DA 1EC8A 4A05A 1TPB1 1DORA 1KM2A 3W7PA 1XW8A 4AVFA 3VCNA 1OX6A 2WVVA 3RNDA 1UD8A 4DM1A 4DYKA 3ES7A 2IKIA 1B3YA 3AYSA 1PYFA 4XG1A 2WOQA 1J11A 1PX4A 5F4SA 4NG3A 5BOOA 3U2CA 1XRFA 3APYA 4JFTA 3GBEA 4ML4A 3HQOA 1E4IA 4Q8OA 3W7LA 2YW4A 4AMCA 2PBGA 5G2WA 3I10A 3UWUA 1LYXA 5LKYA 5AB3A 2BV9A 4XBKA 1F6PA 2NUYA 4KEZA 4C6DA 4DVOA 2YL9A 2FKPA 2Y0FA 3S9YA 5LXEA 1EPXA 2G0WA 4LC6A 4UQDA 2BOEX 3KM8A 1BGAA 3I3BA 1RUSA 3P61A 2VRKA 4O13A 3V35A 3ZT7A 2E9BA 3GM8A 3C6CA 4D9PA 4YS1A 3CWOX 4BQ2A 1DP0A 4NRSA 4UBPC 3BK0A 1Y7VA 3MSYA 3WIJA 4BZYA 2JKPA 2VRQA 4U10A 2XVLA 3BGAA 3RO6A 4B9YA 3KL0A 2R1PA 4WKHA 1ZCOA 1OEPA 1OYAA 3UA3A 4WX2A 4P7NA 3M0JA 4M82A 4F4RA 4KBXA 2TSYA 3H2FA 5A3HA 4FXJA 2DORA 3THAA 3K4AA 1R3WA 3A5FA 1UW9A 3SCQA 3PZ9A 3W9ZA 5HBFA 4DN1A 4JTTA 4N42A 4LVFA 4B3KA 4IT1A 1A3WA 1OCQA 2YBUA 4U28A 3VUSA 3PBMA 3VMNA 4UNLA 2VFHA 2Z1WA 5FAJA 4PRTA 4XSMA 4UTUA 1VGAA 2DQWA 6ENLA 3F5LA 1DJGA 1YIXA 2FDSA 1O95A 1EXPA 3I6TA 3O1NA 3PC0A 2F38A 1Y65A 3DCPA 5LNSA 3BMVA 2VFIA 3U5UA 1GG1A 3MPGA 3M44A 3AMCA 1LRQA 4RNHA 4IHCA 2OVLA 1BYBA 2QCLA 3T40A 2V82A 4NAFA 3OLEA 3FXYA 3CTLA 4S38A 4LCRA 3UERA 4QFUA 3XINA 1FCVA 1E73M 1FKWA 1L2QA 4UUIA 3VK5A 3EOLA 1UZDA 5M2FX 1LL4A 5K9XA 2GDVA 2G8ZA 4BF7A 2B7NA 3ANUA 3M0IA 3S47A 1SO5A 1B9BA 1VZWA 1W54A 1O4UA 1SFLA 1UA7A 1JJKA 1I2OA 4H9VA 4JTQA 3KBVA 5CSSA 3N04A 4IX0A 1ALDA 3APGA 3IARA 5F2GA 3NL2A 1GOIA 1X97A 4I6KA 2WCAA 4J3SA 3B4UA 3EDEA 1LOLA 2MANA 3AWOA 4FA3A 4LUYA 1YMYA 4GIYA 1P0BA 2ZQ0A 1JPDX 1XQKA 4IG2B 5F1UA 4R7OA 2OFJA 3H4XA 1CIUA 3DFQA 1OINA 2J8GA 1VENA 4B3LA 1QU4A 5E9XA 1PX3A 1EDQA 3B05A 4ILSA 3T07A 3RX4A 2YZRA 3MC5A 2XM2A 1O5QA 1EGMA 2D2HA 4O0ZA 4KKXA 3W72A 3BMWA 4LSBA 1R3VA 4PC8A 4E8CA 3A23A 1XLFA 3PBVA 3FKKA 4HU3A 3PFRA 5C0QA 5IDIA 4FNRA 4ATDA 1XYBA 2XFRA 4O1BA 1QAPA 2XVNA 3TROA 4DBSA 4Q8WA 1OG6A 3HMCA 4AEOA 1IGWA 4LUSA 3QKEA 2Y5SA 4O1DA 5I0DA 1YNQA 2NQHA 1XLHA 3RX3A 3TN5A 3N9KA 4XIMA 3SCPA 3LQLA 1V02A 1ZP4A 3MBFA 3II1A 3AZSA 3M9YA 1ZJHA 3VE7A 4AG0A 4GD0A 4X61A 3RPTA 5FJRA 1OD0A 3GNPA 5E0KA 2BY1A 4KIEA 1G4EA 2YCEA 2WMIA 4DO6A 1ZTVA 4ZZ9A 3N17A 3CU2A 1TPDA 4E4PA 3DG7A 4RZ6A 4IXHA 1V3KA 3UXAA 4GYKA 3ANVA 4PR4A 3W7MA 3URAA 4I7WA 4TXEA 3VUPA 4CQ9A 2G3MA 1E6RA 2DZSA 2QDHA 5F1VA 1K70A 4LY4A 1H7RA 2P10A 4JDBA 1M04A 5D30A 4DUOA 2MUCA 5HJYA 4I7UA 1YXDA 1DJNA 5C70A 3WK1A 4V1YA 4FXSA 3SZ8A 2XJ7A 4LVDA 2JBMA 4DPPA 2CLKA 1CGVA 1W3JA 4UFKA 1XX1A 4FOJA 3M6YA 3WLSA 4XTDA 2GSHA 3DHUA 3BC9A 1LL7A 4OVXA 2IMRA 3EMZA 5CGTA 3R7MA 2XGBA 2PCEA 5D04C 2J9XA 4IGMA 4HA0A 4EPBC 3NM1A 3ZXWA 4S3DA 3PPCA 3MHGA 4DWSD 2GGHA 4NNCA 2J77A 3SGGA 2DZTA 3MCNA 3E0VA 4ZL1A 1E6NA 1TELA 1V77A 1IZKA 2QW5A 4YIWA 2ATMA 3CAWA 2OSYA 3IJLA 1WAUA 4KRZA 2QHAA 4D6FA 5EL1A 3AXXA 5A8OA 1UP0A 3EWXA 1G69A 5KZEA 2A5HA 3VKAA 1IEQA 5K9DA 4C6JA 3LRKA 1HJXA 5G1TA 3IACA 1PKMA 4UB9A 5I78A 4LY8A 3GTHA 3SRHA 3TCSA 1WXYA 3HGRA 1ZBKA 4HD5A 4TO8A 5CGMA 4JX5A 3GHRA 2VELA 5FD0A 4LS2A 3UPWA 4WCJA 3KS6A 4QEHA 3UY7A 4C1NA 3GTXA 2C7FA 2OZ3A 1V6YA 3OB8A 1T5AA 3BH4A 1MZRA 3HG5A 4YTUA 1S3TC 3M0YA 3QPZA 1H2JA 2QUNA 2QLYA 2LLEA 3MJMA 3QR0A 1JZ6A 5FJPA 2AMGA 4RDWA 2OWCA 4OUIA 1DIEA 1Q4NX 2GGGA 1UMLA 1W2VA 2GJNA 5ECVA 2RHGA 4JNYA 3WJXA 4L4OA 5HNNA 3GLCA 4W87A 4C90A 1FUYA 3TUUA 1UWRA 2VZUA 5AYZA 1MDRA 3SQMA 4OECA 4B3ZA 3Q94A 3KL3A 4MWAC 1AZ1A 2VDGA 1E6SM 1R9ZA 4AZCA 2DU2A 2Y62A 3T2OA 3IVTA 5K3VA 3PJXA 1VR6A 1R5YA 3DFNA 4K8GA 3U4FA 2VC6A 4HQVA 4QJ3B 1GZ1A 2E5CA 3IK4A 2X7VA 4IF2A 2PGRA 2OOFA 3POHA 1JF5A 3CLMA 3NXFA 4RW3A 2H8XA 4I5UA 4G8TA 1DKWA 1XGZA 4ZQRA 1R30A 1XRSA 1IQ8A 1E9YB 3FXGA 4UFLA 1EF3A 2YA0A 1JFXA 3CQKA 3NYZA 5AECA 5ABGA 2VR2A 7TIMA 1LRNA 1XD0A 3DEQA 1IT0A 5FAGA 1H1NA 3V18A 4FI4A 1WNOA 4LBSA 1XUZA 3GXIA 4MFDA 1W56A 3VGHA 3U9IA 1H60A 3N1AA 4PA8A 1P1XA 2EBNA 1OFQA 1ZALA 1W2PA 3PM6A 2PRLA 2Y8KA 3BE7A 3B8SA 1QT1A 3GK0A 3IUHA 1WQ5A 2WHJA 1VBJA 1PHWA 2XWDA 2HPIA 1XIFA 3W6MA 4O1AA 1QI3A 4QG9A 3PB2A 3HO8A 4XISA 3EKZA 2BVWA 1VRDA 3FNDA 3LLFA 1MFUA 4BKNA 3VNZA 3JR2A 3O2LA 1HTIA 1TTIA 4X9SA 3V0UA 3BMXA 1VFTA 2CBJA 4FNQA 3A4JA 3EYPA 4DQWA 4DEFA 1X8CA 2D2OA 3WCZA 4CN6A 4OOZA 4CU8A 4D6DA 2XWEA 1E9ZB 4J2PA 5BRPA 4B5NA 3RJYA 4AQLA 2OO6A 4Y6GA 1TUFA 4RK8A 4UR7A 1K9EA 2GUYA 2YZ5A 1HKKA 1A4MA 2FZBA 3S83A 2INEA 4JN6A 4QROA 1WKYA 1H5VA 1YDOA 3IAPA 4WZHA 4GXMA 3C52A 3GHSA 4H2HA 2VFDA 5C2CA 3ZM8A 1V6XA 4ZQOA 2G41A 4G1NA 3B0UX 1Q8JA 2VDIA 1R2TA 3W7JA 5AY7A 3SAZA 3K46A 2O56A 4A22A 3T44A 2H8ZA 4IJCA 1UJPA 4FF5A 4BS0A 2CLLA 4GBDA 2ZXAA 4HMDA 2CITA 3JW7A 3W53A 1B3ZA 1B4KA 7REQB 1KFWA 1GW9A 3W7CA 3VGBA 1XUUA 1OFRA 1NQ6A 1W1ZA 2AGTA 4N9DA 1JZ4A 3EA2A 2WKLA 3VABA 4PUMA 4JHZA 1WXJA 1TZ9A 3QYQA 1LQ2A 3PTDA 2JK2A 4ACYA 4AIUA 3PWGA 2FFIA 3E0IA 2BODX 3CBWA 4E3TA 2PDPA 4M80A 2DSUA 4HP5A 1QW7A 3MANA 3COTA 3VD4A 3G22A 4NX0A 2CC0A 3WNNA 4HJFA 3FGCB 4ZO7A 4FX7A 1BVNP 3B9AA 3GHUA 5BWFA 2E68A 1GWJA 1V7YA 2PD9A 5KZDA 4H8UA 5CSUA 3ITXA 4F2TA 1NQKA 4LPCA 5MF5A 4BQ4A 2HTMA 2NQ9A 4AVOA 4Q7NA 1H7PA 3IIZA 1DWIM 2O9PA 1BHGA 4IL0A 1HJSA 1KQZA 4AWEA 4V15A 1KWGA 1EFZA 2HEJA 3TNBA 3M47A 3S1VA 1PZ2A 5C71A 7ODCA 2NXGA 4PUKA 4JD4A 3W86A 3RPDA 4XAYA 1P48A 4FSAA 1S2CA 1ZQ5A 1FXPA 5AYXA 4N6EA 3BJFA 4QDPA 3FW6A 1SZGA 3BUVA 2G50A 4TTGA 2AL2B 4UMBA 2VEGA 5U4NA 1SW0A 5CH9A 1FWWA 1UR4A 1WOBA 4JTUA 4MNLA 4NZ5A 1EGZA 3LLDA 3UEQA 4RL3A 1LP6A 4S2CA 3FKRA 2HS8A 3UW6A 2I57A 2F9RA 3W7RA 1GPFA 2DEPA 1XGDA 1E0WA 1OZQA 1ZLPA 2P3EA 3L9CA 4FR6A 3BSGA 3SW6A 1WE5A 3TVAA 3MQTA 3V1HA 3M0ZA 3A3HA 1R3RA 1MQPA 2CLHA 3GUWA 3MUCA 1TIWA 4GHRA 1I1WA 2WJZA 2PF8A 1O1ZA 1Q13A 3P67A 1JD9A 2YL6A 4HZMA 3G0XA 3W70A 1IEWA 2V0TA 1HFBA 1AFSA 1WZLA 2D2JA 3N13A 1VFSA 3A9IA 3CIXA 3UVAA 4GKTA 2NZLA 2P3ZA 1XQLA 2AAMA 4G2DA 2XU2A 3LHTA 3C4UA 4M1RA 3CWNA 3BXWA 4NF7A 4BWLA 3TN6A 3GSMA 4C7GA 2AQOA 1AD4A 2ZUSA 6REQB 1SM9A 1E55A 2W0UA 1U83A 4M19A 3URBA 4CNPA 4TV6A 2ZXQA 4ADUA 4EPEC 2ZRZA 1GHSA 1KO0A 3GKFA 3KVLA 5FACA 2VCBA 4RW5A 3TOPA 3W2NA 1GQIA 1UD4A 1GYMA 1JRCA 3DKLA 3FS2A 3CT2A 3BAIA 4I9MA 5JIWA 2PFHA 2GSJA 2OSXA 3A12A 4TUFA 1O12A 4GY0A 1W3KA 3L4VA 4MVAA 1UH3A 2OQLA 1VBUA 1PX8A 1AK5A 2X2GA 1PO9A 1H5YA 2WK2A 4ONVA 4DY1A 2QXWA 1A5BA 4PTDA 1HKIA 3D5HA 5IXEA 3LCGA 3XISA 3MJYA 3OEXA 2GGJA 4LVGA 4DHGA 2I5IA 3MO4A 4AD1A 1FH9A 4QCFA 1RJQA 3OGSA 1AD1A 2FZNA 2ZCGA 1TTJA 1FHUA 3QQ0A 3IGXA 5CZJA 4GIAA 1EDGA 4YNGA 5JXQA 1GZGA 4IP5A 3W7GA 3PJWA 1JAEA 5IDZA 4DAIA 5AZ0A 3LDVA 4G7EB 3PAOA 1PIGA 2JGYA 1XYAA 3BQ5A 3VAVA 2GYIA 4PFHA 3BG5A 1XLGA 1MFVA 1R3YA 1XPGA 1XPYA 1H62A 4Q22A 4H9UA 3GX9A 4HYRA 4MB4A 3TC6A 4RNIA 3EXSA 2J75A 4GJIA 3GAYA 3HB9A 4WXYA 3DIPA 2VZSA 3VDBA 3LXBA 2J27A 1HUVA 4J9JA 2E4TA 1K6AA 4MNMA 3LENA 3W27A 2DPEA 3ONBA 3UG5A 2QUVA 2A85A 4CU6A 4RV8A 1WOAA 3UR5A 3HQPA 3MUY1 4J7RA 2GFTA 4E2VA 4ES4A 1QNRA 4WKAA 4MOZA 1EZWA 1HT6A 1HIZA 4GC3A 4XD3A 5M1TA 2NUWA 1US0A 5FEXA 2HQAA 1KGUA 4GJ1A 1FP8A 3W7OA 2C91A 3TJXA 2DH3A 3PBWA 4H1ZA 1YNPA 4OTKA 5I24A 2VX6A 5A6BD 4MGGA 3RLUA 3GFZA 3T09A 3TDFA 4UOQA 3WMCA 4MLRA 1SMDA 3A64A 2CHRA 1UKTA 3WF0A 4ZEPA 2A3CA 1E0VA 2DZXA 3LI0A 4AC7C 2G3IA 2Z1SA 1XIHA 1RQBA 2GJLA 1JGMA 2BG5A 4D72A 1EP3A 1Y0EA 2RDTA 2WNWA 3DFHA 4TMBA 2DSKA 2V81A 4YVPA 4L65A 1V3IA 2C0AA 3U57A 1CZ1A 4IGNA 1Q65A 2ISWA 2Z7GA 4GWEA 3NQEA 4KFPA 3WNLA 1X96A 2VCAA 3NSMA 2A3BA 4LUTB 2IW0A 4XO6A 3VKKA 2WW5A 2ZDRA 4LB4A 3SJNA 9XIMA 4CUCA 1TO3A 3O0KA 3CH9A 1MXGA 4HT3A 2EKCA 5M03A 3UP8A 2IS7A 5LYRA 2ZE3A 1W1TA 3WLMA 1JNDA 3I6RA 2C1HA 3ZT6A 4N7QA 1H1YA 4O1EA 3MA8A 2VKZG 3DHDA 1E3XA 2PWFA 1R87A 4I90A 4LH8A 2CWNA 1PCWA 1M3UA 5IRPA 3ZR6A 4LVBA 1R8LA 5G5IA 3S4TA 3LA4A 4AZ7A 2Y7FA 1PSCA 1QWGA 3RGTA 5T9BG 1QHOA 2XISA 1EJUC 4GVIA 4K7YA 3OA3A 2ON3A 3N18A 5JUVA 2Y7DA 1NWTA 1JYNA 2V38A 3EEZA 4JTCA 1D2KA 2A3LA 4JY8A 4U5IA 2C6QA 1ZENA 2UY2A 4A4AA 1R0MA 3UYIA 2VT0A 1JF6A 4US5D 1YBQA 1DWHM 3BGGA 4IQLA 3O3RA 4D6IA 5I3GA 3W1TA 4X0NA 3O06A 2VFGA 3CK5A 5M17A 4JDYA 3W2JA 5A94A 3VGGA 2V5BA 4UTWA 4NZCA 4JQ4A 3N11A 3WDPP 4O0QA 3P82A 2AQWA 2QCCA 1ONWA 1EC9A 4B2DD 3H2OA 4TQTA 1ESWA 4U3AA 1X38A 4AD3A 2G5WA 1D3GA 1ITUA 1OADA 3REQA 4YXGA 2WCGA 4L7ZA 2CEQA 2ZIDA 1AH3A 3RFAA 3O6DA 2CW6A 3VDCA 5HANA 4O28A 4JGDA 1XIBA 4WY0F 6XIMA 4K37A 4XV0A 1HO1A 4QG8A 4LV9A 1UUOA 4A2RA 4IJBA 4MKSA 4JTLA 1J0IA 2OGJA 2WVVB 3SR7A 5FA5A 2UZ9A 3LHUA 3AIRA 3AS1A 4EXAA 1E4LA 4MWAE 3L4UA 3EZ4A 1O5KA 4KIRA 3IRSA 4KERA 3OVRA 3FVDA 2P8CA 3H7UA 4OV4A 3AS3A 3W1RA 4IPIA 2BGNE 3CGTA 4WGXA 4IICA 1EOKA 1CLVA 4FIQA 2A2IA 3N2XA 3WD0A 3LPGA 4A6GA 3AWNA 2JKAA 3QC3A 2E7FA 1HO4A 3A13A 2XDFA 3FSTA 4AXKA 1VFFA 1E56A 1ZSXA 4NAEB 3EWBX 2NQLA 1TR9A 1JL8A 2BGSA 2YDQA 5HPCA 3L4WA 3C0JA 1F6YA 3LHVA 4L80A 3UWVA 5LIWX 2J6VA 3AOFA 3H2CA 2B0MA 1TMHA 4RE4A 5K9CA 4UTIA 1MI3A 3NJ3A 3VKCA 4DWSA 3ZIZA 3E2VA 4XO7A 4F0MA 3UGRA 3F4VA 1DJXA 4LAKA 3UA4A 4ZBCA 3NPWA 5I09A 3LZ5A 1JQVA 4Y7EA 5ABEA 4GABA 3OVQA 2AL1A 4AX6A 1DIDA 2C8NA 2BSLA 2HK0A 3KBWA 4MSSA 3IRDA 2ZRWA 3I7SA 3SJ3A 1HX0A 5C7VA 2IPJA 1YPXA 1SMAA 3CZEA 4K7VA 1YPIA 3BV7A 4OJYA 1SPQA 4GH3A 3M41A 1I75A 2EQDA 5D02A 1O7AA 4LEFA 2J88A 3TN4A 1ZJBA 3GD6A 2PTZA 3ZSTA 1TPEA 2VEMA 3QJAA 2XHYA 2Z1BA 4RR4A 3UXDA 3H2EA 3GIYA 4B16A 3QVQA 1PIIA 3QTPA 1FCBA 3MU7A 3WK3A 1EJVC 1FVPA 5DRIA 1PHQA 4HTBA 4MIMA 4U2YA 1C90A 4AY8A 2QCMA 2XH2A 4TIMA 3AZRA 3W7QA 3AYTA 1H63A 4ALDA 1R2RA 2HRWA 2W92A 2OYLA 3B97A 2DW7A 4R27A 1K9DA 1V6VA 3UG8A 3BOFA 2FH6A 4PB4A 1D3HA 3BLOA 5FJJA 1DWAM 3Q67A 4ZA0A 3AMKA 2C18A 1J5TA 3F2CA 3G1YA 1EJWC 1EUNA 4LYRA 3G5EA 4Q8VA 3ZO9A 4PMYA 2B4GA 3NO3A 5DX7A 1UWIA 1UC4A 1ME9A 1VLIA 1BD0A 3LYEA 3NPUA 1XYLA 4JIEA 4BI7A 3XIMA 2D3LA 2VL4A 2AKMA 4LF1A 1B3WA 1RD6A 2X0YA 1R6WA 3CZJA 3TLLA 3C2EA 3IAQA 5JVLA 3TYUA 1SVDA 3N3TA 3TQVA 3KTCA 1ADSA 2H3BA 3WEZA 2R8WA 3WMLA 1J9YA 3WLHA 3M7WA 4LS0A 1FH7A 1AL7A 1NF7A 3RYSA 3A6OA 4KFOA 3THDA 4PMQA 2GOKA 5C8BB 1PDYA 1NY1A 3W3OA 3DYPA 5GPRA 2PDCA 1VIZA 2ZX9A 1J01A 3OZOA 3WQOA 3W29A 3RM4A 2V3FA 3T0AA 3AHXA 4JEQA 4DM2A 3L5LA 3GXFA 3RUBL 2I9EA 4EWJA 4RJEA 3A3WA 1XBVA 3MMDA 1F07A 1OT2A 2PDJA 3T0DA 5CCZA 3TONA 1JZ3A 2E0PA 3EXRA 2GVYA 4GOAA 3KP0A 3DGRA 3SCOA 7CGTA 4ZB5A 3G6LA 3RK8A 1VYSX 4E4FA 1WXZA 5BRBA 4XZ9A 4QS5A 1ELSA 3EKLA 1AJ2A 4GISA 2PI6A 1C9DA 2PWDA 2WM1A 4R5EA 1XYCA 3HGJA 1G4PA 2Q8XA 3VE9A 3KAOA 1UZ1A 1RCQA 3HGSA 3R25A 4UR8A 3DG6A 2WM0A 3PP7A 3N2TA 1JR1A 3CEPA 5I77A 3EB4A 3NQ7A 5I7GA 1R38A 3QV7A 1VEMA 3AQUA 4MZ1A 4WDXA 3FY1A 1LROA 3QY7A 2NX3A 2C0HA 3QMTA 3WDJA 2RKXA 4P8XA 4QIUA 4AZ5A 4U5KA 3ITGA 2XZ9A 3KL5A 3GG0A 1XIIA 5E1QA 1JZ8A 1HKMA 4AISA 3CUXA 2WMFA 3AAMA 2V68A 9RUBA 3OZPA 3O7UA 1V02E 4UWMA 5C54A 3NOEA 2QAPA 2EXOA 5BXPA 5IHRA 5KMYA 4JQ3A 3CL7A 3GYEA 3S5OA 3ITTA 1BTMA 3UY8A 5KEZA 2YBVA 2YOCA 4HB7A 4ZMGA 4WDUA 1MEWA 2ZICA 1KTCA 3FAWA 4XZMX 4UQBA 4CD7A 1R46A 3W7KA 2OZ0A 2CHNA 3RCNA 2CKSA 3QZAA 1A5KC 3F4WA 3AUJA 2PC8A 3W71A 4MZ8A 4HK7A 4GVGA 1EWDA 2ZX5A 2ZUUA 2YX0A 1KD0A 3ARZA 4ENLA 3C56A 3V5OA 3H6OA 3VX0A 3VNLA 4P7RA 4W9TA 4LOCA 2W91A 1W32A 1QNQA 3J7HA 3O6YX 5FCZA 1GT8A 1YE6A 5CBJA 1S5MA 2BWGA 1OGSA 1JZ2A 3OJGA 3DUGA 3S1GA 1ICSA 3W87A 3LHWA 3UWWA 1VRXA 1BYDA 4L61A 2PBOA 1K7EA 2QMKA 5M5DA 2ZZ6A 4DO4A 4NY2A 2VWTA 4R33A 3TEVA 2GWGA 1UOZA 3C0QA 1DL3A 4C1NB 1B3XA 1OFEA 2DJLA 4LGXA 4EK7A 3WDIA 2CFFA 4ZQPA 3IGHX 3AUOA 1JZ7A 4NT0A 3U4AA 2PDMA 4O1CA 4UMAA 4CQBA 1GYNA 1UR2A 4XIAA 4HHPA 4Z2GA 1CGWA 1J0ZA 2SFPA 3WYZA 3LV6A 3RM9A 4F3HA 1TWIA 1IR2A 2JIWA 3WFLA 4IG2A 5B80A 4XUGA 4A3RA 3L4ZA 3ABRA 3LMYA 4IPJA 3MS8A 2G95A 4ZTXA 2Y70A 3L2MA 4ZOAA 4PRWA 5DMNA 1RK5A 4WOQA 1I1XA 1R86A 3V0SA 1UIPA 1OFDA 2A1YA 1KFLA 4I9JA 4JN7A 3VCCA 1D3CA 2HXUA 2OLSA 3A4XA 1Z6KA 3NQFA 1ZAHA 3EKGA 2C3ZA 1KM0A 3NFUA 1LLWA 4MWAD 5LHEA 4XUYA 3ZYZA 4R9XA 2C15A 3K4DA 3L12A 1Q66A 4GI9A 4U2ZA 4HN4A 2FZ8A 4QS6A 1P7TA 1MEHA 4LRSA 1WP6A 3CHCA 2R91A 1K03A 4TTUA 4DF2A 1R9YA 4FLSA 3N25A 1TZZA 4N0RA 4JNZA 4KCWA 2VEFA 3LCXA 2QCDA 5A6LA 3MP5A 1K7XA 1PTAA 3QN3A 4JIRA 2BDQA 1UP3A 3L23A 3ANYA 4UFIA 1RALA 1HNYA 4F2BA 2PE4A 1OX5A 3WN6A 3ITYA 2P0IA 1M65A 4G1KA 1S2AA 3T81A 3CLWA 2AAAA 1HGYA 1AUSL 4K3ZA 3W24A 4PTXA 3TYDA 1GVIA 1DEDA 2ZVRA 1JGIA 3PFMA 2ZBTA 5GNXA 1LBFA 1T8QA 1I45A 2DQXA 5TAOA 1OT1A 1E0UA 4Y96A 3GIQA 3ERPA 3QGAC 3BOXA 1IHIA 5CZKA 3GZAA 3WQGA 4HKPA 3W28A 2OODA 5G2IA 3FJLA 2Y24A 4RNFA 2CCRA 1O60A 4D8AA 3UR7A 2DY3A 2I56A 2YW3A 4J27A 3IIVA 1GUVA 3P0XA 4UTLA 4CD8A 1DBTA 3N29A 4FLQA 1CXFA 1NWSA 1VJSA 4GI4A 1VF8A 3ITOA 3QV8A 2YYUA 4W8LA 4CD4A 4C60A 1CT5A 1XCXA 2ZFAA 1J5SA 5A6TC 2GZXA 2XFYA 4GYPA 2C1GA 3AFBA 3UNTA 2XN1A 4K38A 2GVJA 4UFJA 3GKAA 1GW1A 5HMEA 2VX5A 3W1QA 3GH4A 5HA7A 4WJEA 4OBSA 1W9XA 4YL2A 1U5HA 3O05A 2XIMA 1EBHA 3RMEA 2QDDA 4IGHA 2ISVA 2PCQA 3WENA 3SCWA 3P2VA 5LNVA 4RDYA 3PTKA 1XRVA 4O50A 1PBGA 5EBUA 1RA5A 3NZPA 2FMOA 4AY7A 1XH0A 4EWND 4H9YA 4JQAA 1KV5A 1UD3A 4GUFA 3W83A 3P8IA 1VLWA 1KM4A 4BHYA 5A2BA 1SFJA 3ARTA 3H22A 4UQ9A 5EKYA 4US6A 3VGFA 3FVMA 5HNUA 4R3UA 5BOEA 1Q6LA 5D2YA 1OYCA 4JICA 4QGCA 3S1WA 4NZFA 2W27A 1XYZA 1GEHA 2PSNA 5A6BA 4ZVJA 3AYVA 2O92A 3CIWA 4XB3A 1E6ZA 3VOHA 3GR7A 2YPIA 3KHDA 4NNAA 4GZIA 3DH7A 3EOSA 5HDRA 4PMXA 1PDZA 5K7JA 1OIFA 4CCCA 3ABSA 4DJFD 3UZZA 2OEMA 3DECA 2GLKA 1NELA 2RJGA 3LY0A 4M5PA 1HJUA 1E5NA 3TAKA 2YL5A 4V1XA 4AAJA 3MW7A 2VGIA 4OGZA 1VB9A 3CMFA 2QCFA 4HPNA 8RUCA 3B0XA 1TPUA 4UZSA 1XFBA 4B92A 5AC6A 1VD6A 2P1FA 2QJMA 1U1UA 3CPRA 2I9UA 3UWZA 5D32A 1NVMA 3LPFA 3QHMA 3SUWA 3TLQA 3M5XA 2G4JA 3UCCA 4BF5A 3GDRA 1A5OC 2BVTA 4BA0A 2R24A 1DTNA 1LQ0A 4LAUA 5CXPA 3AU2A 3CYVA 4PL1A 1CX9A 4L9YA 3WLQA 1UWUA 3T2PA 3KS5A 3JUGA 2CLOA 1U33A 4GNJA 3KCJA 4YCOA 2QR6A 2YA1A 3NSXA 3HJEA 2PRMA 3LN3A 4DZIA 3BTNA 5EMKA 3EX6A 1EH9A 2GSEA 2WMJA 4GPNA 4GFSA 2OR2A 2E6AA 3VPLA 3FEQA 2VOTA 1IT7A 1QR7A 4NZ4A 3AIEA 3D6NA 5FJOA 2EPKX 1LLZA 4US5A 1SYTA 4IJRA 3EOEA 3MUIA 2J4GA 3KOFA 3KEHA 4Q4OA 1VEPA 3EWDA 1W37A 3NQDA 4G5DA 5DELA 3HU7A 3O63A 3PVFA 4MUZA 3TAOA 1FQ0A 3NXLA 1U5VA 2DUXA 4L56A 7PTDA 4HPJA 4DBEA 3KWXA 3STEA 3QF0A 2VO5A 4B2DA 3VOIA 1KFCA 4TR9A 2F6UA 4AC1X 1X1OA 1F3EA 3MP4A 1FWIC 1O94A 3UFYA 1P6CA 2BY2A 5I23A 3WQ5A 1WDSA 3S0CA 3OIXA 2BP1A 2WKGA 3R6IA 1NIUA 3PUGA 3ORWA 4W7WA 3KRSA 3U8GA 4CEXC 1WKFA 4PEEA 4HCHA 4Y9OA 5A8NA 1IWBA 3VNKA 1VCVA 3RJXA 3WBYA 1CXKA 5TNVA 2J6XA 4KCTA 3B0YA 5A2CA 2RGMA 3W26A 1CXLA 1EXBA 2ZADA 3URQA 3G8EA 3ECQA 2CWXA 1WUEA 3LCIA 3LGDA 4Q6JA 4TX8A 5D2WA 1KGWA 4PUJA 3KX6A 3G1XA 6ALDA 3WNKA 1BAGA 4RLIA 2W79A 4MKNA 3FCPA 3GB6A 2D0GA 3MMUA 1UR3M 3WY1A 1PS9A 3QQWA 3W4RA 1TV2A 4PN2A 5MHBA 1X98A 4JCLA 1L6SA 1AQMA 1DOSA 1AL8A 1ECQA 5PTDA 3R8RA 4IUGA 1EYEA 3WH8A 3G24A 4GVHA 2Q6ZA 2BY0A 3PK7A 4QJ1A 3P5YA 3GH5A 2WZMA 4F0KA 1B31A 4HYVA 4B4HA 3TYCA 1LT8A 4XWUA 4AW7A 3FGCA 1MO0A 2QV4A 2O9RA 1KM1A 4ZSTA 3VIMA 3WD3A 4TX9A 1PV8A 1PKNA 2Z1XA 3BAJA 4QDMA 4JTDA 4W4QA 1A5CA 2J9YA 1J93A 3M5YA 4YVXA 5A8GA 4LUIA 1R9XA 4PMDA 2XN2A 3W6LA 1W9BM 4NVTA 4JCMA 5E93A 3GC4A 2YB1A 4C6IA 3FX4A 4B5TA 1TE6A 1XBXA 5F2LA 1V8EA 3CZ8A 3C5QA 1GJWA 2DP3A 3ARVA 5C9UA 4FB7A 3QR1A 2JEQA 1PJ9A 1XG4A 1ZBVA 5I03A 4OZOA 2E6FA 5HMFA 4ZOEA 4EP8C 5A6AA 4HSOA 2OXNA 2A4AA 3AIUA 1K8ZA 2NXIA 4YTSA 3V1PA 2PDYA 4AXNA 2V5KA 2YLAA 3W75A 3GDKA 3H55A 2XVPA 3BG9A 3T9PA 5D2VA 3SCSA 1IWAA 1OYBA 1VBHA 1RCOB 3IJQA 4E2OA 3UG4A 3QSRA 2WBKA 3ME3A 3UXIA 3PZQA 4CGTA 5EB8A 2VD9A 5GQBA 2QPUA 4OU1A 1GYLA 3ZJKA 1HQTA 2A6LA 3VKJA 4V33A 3ZWTA 3DU0A 2RGLA 4NXKA 4H8HA 2PUZA 2DVXA 1QI2A 3PNZA 4QNEA 1IZCA 2PP0A 2J25A 1JCYA 3OG3A 3G1FA 2PU0A 5G4HC 6XIAA 2I14A 4M56A 4Q7BA 3U7BA 4Y2WA 2ZYFA 2FB3A 1H7OA 1UBSA 3QFWA 4J3TA 2WNQA 4MDPA 2BLEA 4XZWA 1DHKA 3OYXA 2QVNA 4W84A 3WH5A 4KGJA 6REQA 1JCXA 2F8QA 4GX9A 2ZDSA 3PAJA 1XKYA 4AFYA 4H6KA 4ML9A 2J7EA 2GQ8A 3S8HA 3LPPA 1IXNA 2EPHA 2GVLA 3TTOA 3TK7A 2QGHA 4GY1A 1KV8A 2PDWA 2V3GA 3CIVA 2BHYA 1YTKA 3QQ1A 4JN8A 4E38A 1UZHA 4Z2IA 4XZLX 4FMVA 4A8RA 4Z2HA 3I6EA 4O16A 1NOUA 4UTHA 4D71A 1EQPA 2HS6A 3C0SA 1TSIA 1UB3A 2AKZA 1DQWA 3BLPX 1TREA 3YPIA 2QT3A 3TFXA 4O17A 3QC0A 3G2GA 1AQ0A 3VA8A 1IIHA 1UROA 2BASA 1JRBA 1DXFA 1J79A 1LRTA 4JYEA 3OBKA 1UPMB 5DRCA 3BAWA 1DIKA 3NZGA 2NLYA 4GLEA 5FF0A 4D6HA 3T55A 3E0FA 1V3JA 2ACUA 4OQVA 3AO0A 5HAOA 3REQB 3EX4A 3SUVA 3CT7A 1OGBA 4IIBA 1W5QA 4R53A 1EIXA 1EX1A 2CZ5A 3F4CA 5BW6A 1K8CA 4JAWA 4L6OA 4PCTA 1FBAA 1FKXA 4G7EA 1EF2A 1GQNA 3OGRA 4DWDA 2PRHA 4AZ6A 1OJXA 2GDQA 1B5TA 1NDYA 4RDZA 4OV9A 1OC6A 1SW7A 5D05A 3LTPA 1M1BA 2V67A 5HXMA 5FEZA 4A35A 1OC5A 3ARQA 3S6TA 5ABHA 3AHZA 4EXBA 1V6WA 2PTXA 1S5VA 4I9AA 1RH9A 1MXDA 3VDGA 2CZDA 4WDWA 4C65A 1SJAA 4WUIA 5F4XA 1LT7A 2WSYA 5B7YA 3G1VA 3M0XA 4IOTA 1QNPA 3MP3A 4MYAA 4DBDA 3SRDA 3QM3A 2ZZ5A 2Q8LA 4AD5A 1CXIA 2PTDA 4JFSA 5C9XA 4GINA 1U22A 1TE1A 4PCFA 2F6XA 1QBAA 5FIPA 4E0CA 1UD5A 2DVUA 2PDBA 3MKVA 3UCDA 4LVAA 4PEKA 4M6PA 3U48A 3W7HA 2VYOA 1F5ZA 2WSQA 2OWWA 1NEYA 1GPWA 3WQCA 4DXVA 2QGYA 1MW3A 2W3ZA 3CQIA 3O0FA 2JIEA 4HNUA 1TMQA 4WSHA 4KGLA 2BX7A 5T26A 1Y5XA 3S5YA 3WJSA 4YMZA 2ZX7A 3BV4A 2JFEX 1HJWA 1T8XA 1TYGA 4GI8A 4UOZA 4Q8TA 1R7AA 1W9VA 1FFRA 3PUOA 4AZBA 1LTDA 5E0FA 4GXPA 4UTFA 4D8ZA 1ONRA 3U3HA 1PXGA 4WSKA 1GOMA 5E6ZA 3TJIA 1EP2A 1PL9A 4L6HA 3STFA 1IEVA 3E74A 4HPGA 3H7RA 4S3JA 4LUTA 1Z32X 3R8HA 5FEPA 2FJUB 1SR9A 4YU1A 2WVSA 4AX7A 3FJ4A 5BU6A 3OZMA 3NG3A 2OYKA 2Q01A 4GXWA 4GCAA 3WQ8A 3DGBA 4QE4A 3AALA 3S6DA 5CPLA 1ML1A 2ZOXA 1U1HA 2W66A 1W17A 1I0BA 3IPWA 1R7OA 1BWVA 2EAWA 3RILA 1MVYA 4Q4MA 3LMZA 5EMMA 1AVAA 5EGRA 3IJDA 2KAUC 3MSRA 4K8EA 2X1UA 5AC8A 4HCDA 2BTMA 4QM1A 5I5RA 1CEOA 3AMLA 4IMDA 1M7XA 3L0GA 3N6HA 3BCDA 1F7BA 5I3FA 3KVKA 3PNUA 4IIFA 2FZMA 4JY9A 3KVMA 3L2LA 1JYVA 2CPUA 5IHSA 4JHMA 4RE2A 3EWYA 1NOFA 3T78A 4W8AA 2PZNA 1NP2A 2Y6ZA 2ZRXA 4Z2KA 2Y2WA 1WPCA 3E12A 2WJDA 3MWCA 5E6YA 2Y5JA 1E0TA 3ZLGA 3MUXA 3LXAA 3BWWA 1EGVA 3SCVA 3LCFA 4DUXA 4IX2A 4MKVA 1JDCA 2GJXB 3TH6A 4MWAA 1AW5A 3TWAA 4RE0A 4JNMA 3RDKA 4HMEA 5GNYA 5CAHA 2YYTA 3LEPA 2NUXA 4TOQA 4YWIA 1IYXA 3E0LA 2XGIA 4HMNA 3AHVA 3BLIA 3VZYA 5CLWA 1MNSA 4PMNA 4AB4A 2OCZA 5EMLA 8A3HA 1YXYA 3NGJA 1YXCA 2HISA 4D8LA 5FL1A 3TP4A 2YBTA 4H9XA 1TV4A 4CQCA 2E09A 2CXEA 5CG7A 5I3JA 3M0KA 3F5KA 1MNZA 2DT1A 3S5NA 2X8RA 5AHEA 3UR2A 4BY3A 1FWRA 4O1FA 1LG2A 1CECA 3NQBA 3S6OA 3N19B 1QNOA 4GKLA 2XSXA 4GQGA 4H6QA 3M5ZA 2ACQA 2XFWA 1B90A 2WSKA 1EYWA 3PUEA 4O54A 1NTHA 4HPHA 3LD5A 3PPHA 3PULA 2O4QA 1FHLA 1B4EA 3POCA 2ALDA 2ZKMX 5LIXX 3D3AA 2DVTA 3VGEA 4HU4A 1VCFA 1EWEA 1UKQA 3OBEA 4Z1BA 4NAEA 3UU0A 5TF0A 3OODA 1SUXA 3TQ0A 1FWBC 3VKDA 1V7AA 2A3HA 3LS9A 3VXGA 3W25A 1MQRA 1VPYA 1XLEA 2A79A 3PTQA 3QXBA 2BY3A 1KBJA 5D09A 1H51A 4KEUA 4OHQA 3FSUA 2UY3A 5L6UA 1E6XM 2WJFA 5JBDA 4DIAA 5AN7A 3CHDA 1M53A 4Q8MA 2HBVA 1C92A 2VURA 4GH1A 4F48A 3W38A 1J2BA 3OP2A 3OBAA 5DXXA 2NQZA 4P7QA 2VRJA 3GDTA 3DI0A 3G77A 3HV9A 1RBAA 5JH2A 2HXTA 4UCFA 5FI8A 1TX2A 4HOWA 3BLEA 2D20A 3CQJA 3EWZA 3V75A 8CGTA 4BQ3A 2CERA 1BKHA 4H7ZA 4EKJA 3GNRA 3RLVA 6TAAA 3GVRA 1ZJAA 5DY2A 1LOQA 3P60A 1JD7A 5AZ1A 4F66A 4L6DA 1CI1A 2OTDA 3P80A 1ONEA 3FYYA 2WSRA 4GACA 3NEVA 3QLLA 1A5SA 1QVBA 3S2JA 4C7FA 3BGJA 4UTMA 3NQ6A 1CBGA 4KWOA 3Q2DA 1D8CA 4Q4KA 2BOGX 3HM7A 4XAFA 1DXIA 1QI0A 3K13A 4RZ5A 1KGXA 3QYSA 3P0WA 3HURA 1EJTC 2NVAA 2VGGA 2J7BA 3N2MA 3M4HA 3B8DA 3CXOA 3CHVA 3WD4A 2WMKA 2WZIA 2WO5A 1W9DM 1BWLA 2PEVA 3DDMA 4S3CA 2V5DA 4DJDD 3K1GA 3MMTA 3W2MA 1W5NA 2QUUA 1XJBA 4H9MA 1M68A 5AHFA 4ZQMA 3GNNA 3RCYA 4Z2LA 4GQQA 4H8VA 1CWYA 4QQUA 1E15A 3KCLA 2Z00A 2R1NA 1UWTA 5FSDC 1QOQA 4L5ZA 2Z29A 3W2KA 4D1IA 4DJFA 6CGTA 4J3UA 3NOYA 4H04A 4LW7A 4QBXA 4RCXA 5A69A 4AHQA 1VPQA 1TV7A 4MY9A 5FF4A 3BCJA 1ME8A 3OO2A 4DWSC 3VNIA 2P76A 3WMBA 4E2DA 1V79A 3LLXA 3BO9A 3KTSA 3GDMA 1WYIA 3VD9A 2X2YA 4Z1YA 5TD4A 2AQVA 1WDPA 4QX4A 4M0XA 2GPTA 2YDSA 3H53A 4YVVA 3TSMA 3S2LA 4S3EA 3A21A 2ANUA 4L4LA 1EA0A 1E1EA 4Q4SA 1G6CA 2CLMA 1Y5VA 2VC5A 1Z7AA 4OIFA 3VOCA 1LQAA 4O15A 1QNSA 3R11A 4QCEA 1JPIA 3NEHA 3DHPA 4P5UA 3DERA 3JRKA 4O18A 3WH6A 1N8WA 3HPZA 1GHRA 3VIIA 3I4KA 3RM8A 3CAQA 2OMAA 3IEBA 3K30A 3O6AA 5I6SA 1RY0A 4GGBA 1ZHAA 2CBVA 2HV5A 5L9FA 3K1DA 4DLMA 3NWRA 3CHEA 4I5XA 1TJPA 1P5BA 3TNOA 3GS6A 5K4XA 4N2YA 3GY1A 3GQYA 1KCLA 4PE8A 4IFOA 4E8GA 3U6WA 2G4FA 1XWYA 4KCUA 3WLRA 1HZYA 3D0CA 4OBTA 1P7TB 1HKJA 4X3ZA 5CPQA 2PDXA 1XC6A 4O52A 3GTIA 4QAWA 3WLIA 2VUYA 3LHYA 1TV3A 3UZ5A 2W5FA 5DCEA 5H1WA 4TVUA 5T91A 2I7GA 2B7QA 1OFAA 1GOWA 3LGGA 2DSVA 1LG1A 3LCHA 3SRKA 2QCDB 4E4UA 3GHTA 4AIEA 4LWWA 3VD3A 4W88A 1JPKA 4O4VA 1UCWA 1TPFA 1IWPA 4HBKA 5EU9A 3N12A 5LNRA 4DXKA 5CGQA 3DYOA 3F7JA 4NXSA 1QBBA 3VCRA 4B5WA 3BCFA 1UKOA 1SO4A 1J6PA 2X05A 4UQEA 4OE7A 4CQ8A 4TU1A 4HNNA 1VCGA 1XLMA 4UFMA 1H50A 4GC4A 3QZEA 1GQJA 4DAFA 3DESA 4IIDA 6A3HA 1V51A 1ZPTA 3CEUA 1EP1A 3ITCA 3Q65A 4CNSA 3G0UA 1BPLB 4FHAA 2B31A 2WNZA 1J10A 5HK4A 4X2RA 3C8FA 3B0VC 1UASA 4K68A 4X2PA 2ISFA 2ACSA 4MJ2A 3AZTA 2QS8A 3N73A 3O16A 4YTTA 3T42A 3H4WA 3SQLA 4GX8A 1K3UA 2E3ZA 3TW9A 2CHOA 1V93A 2HPMA 4QHRA 5RUBA 4LX4A 1X1NA 3WQPA 1JQXA 1OF6A 5LZLA 2Q8ZA 3LK6A 3AJ7A 3V5FA 4IM4A 3NL5A 2GJPA 4IUOA 4LTSA 4ZODA 4HIBA 1POKA 3H7VA 4AYGA 5CC5A 1MYRA 4IQEA 3UBPC 4KT2A 1GKRA 3WZ0E 2A3AA 2J8FA 5I3DA 3H8AA 1A5NC 3SY5A 1FWSA 1U1JA 1V0LA 4W5UA 2PGWA 3MI3A 2J8TA 1FWNA 1WDDA 2R1MA 1M7PA 2J62A 1VS1A 4XQ6A 1FWAC 2PLMA 3MHUA 4W93A 2DZUA 2J9ZA 1VEOA 2YXGA 3T0CA 4J4KA 4B5VA 5LGZA 2ZC1A 1CYGA 4FOUA 3N4FA 2G96A 4CVUA 1MDLA 1V4YA 4PULA 3VILA 5F7UA 3R13A 5FF2A 4JZ5A 3W22A 3SO7A 1L6YA 4PCPA 1NFGA 4AY1A 2VZOA 4NYUA 2H3DA 1VP5A 3QBUA 3QR3A 2I5GA 3KRUA 2V3EA 1A0CA 3W1AA 5G4EA 4EE9A 3WD2A 3CQHA 4UTJA 5DEZA 3P81A 2YCJA 2CYGA 1W1PA 3CH0A 1QMLA 2OKTA 2PDHA 3TYEA 3DYMA 2VD8A 5B7ZA 4HPXA 2BOFX 3GTFA 2XSAA 5DMMA 3UZWA 3P7YA 4Q4PA 3AU6A 5HWNA 2HE5A 2YDRA 3PZUA 3SCNA 2D0HA 5J5DA 3G6MA 2YKKA 4FLOA 3MI2A 1DJQA 1EZ2A 4S1FA 1I0DA 3RPMA 3RU8X 3VOFA 1OGGA 1X8FA 2B7OA 2HK1A 2AGKA 1TJ1A 3BW2A 1KRBC 3WLLA 5CC6A 4JX4A 2CBUA 2EPLX 2QCEA 4JXCA 1WZAA 5BCAA 2WJEA 3DBNA 3Q45A 1TVLA 3WKZA 4A8NA 1WO2A 1ZZMA 4M3PA 2KX9A 3ZVHB 4AVNA 1VFLA 1OK4A 3KUMA 4DO7A 2HBXA 1XDJA 3LXCA 3PZIA 2OKOA 3USBA 4C6LA 5CPTA 3C2RA 4BR1A 3CUFA 2GQ9A 5KINA 4GZEA 3EMQA 3ID7A 1IGSA 1B3OA 3UQNA 4AYSA 4S2BA 1H0GA 1BYAA 1G7VA 1Q8AA 5EY5A 1GVRA 1QI5A 4CD6A 3DFTA 4CU7A 3OU8A 5KZMA 2Z6JA 1KXHA 3CTTA 1G67A 3GNXA 2FHCA 3GC5A 4UNIA 1Q6CA 1UZ4A 1UQZA 3CO4A 2PDIA 3TTQA 4DXXA 2Y63A 4R85A 4XBJA 3NYDA 2E8ZA 4N9BA 4QLJA 1W3TA 5LXXA 4IZGA 2X1SA 4HOXA 2ZTJA 5CC7A 2XZ7A 1KR0A 1FWDC 3SY8A 4UXDA 1YPFA 2AMXA 3ZLHA 4HK6A 4J40A 3TMLA 3WF1A 3L0NA 4K1WA 1QO5A 4WLCA 2VEPA 1YE4A 3LPOA 1QK2A 3F2DA 1KCZA 3BVJA 1KWKA 4XBSA 3BLFA 4C91A 1XL9A 4LEQA 4U3CA 4JL1A 3LV5A 2PODA 3TU9A 1GVOA 2FGBA 4GO9A 3R0UA 4UTTA 2WWDA 3SECA 1JUKA 1PZ1A 1TG7A 3M43A 2WBGA 2Z26A 4IXXA 3W1MA 1CXHA 4MY8A 3N9SA 4EOUA 1AMYA 3HF3A 4WSJA 2RDWA 4N6FA 3AXIA 4W5ZA 4CVWA 3W2UA 3WK0A 3MSGA 3LNPA 4KFNA 2Z2BA 3DC8A 1GZJA 4GUIA 1DE5A 4JTEA 3VDHA 1XGEA 4ZR8A 4UR9A 3CB8A 3H12A 1J0KA 1NF0A 5EMYA 1F8IA 4POCA 4CKQA 3B3DA 4H7VA 1BWKA 1PIFA 2OELA 1QTWA 1C91A 3V36A 4QE5A 5F2MA 1UR8A 2TMDA 1N2VA 9CGTA 2H9AA 1ITXA 1IEXA 4XKYB 3R43A 1FWEC 5JMUA 5CBIA 1W1A1 2WLZA 3LB0A 3N3MA 2EHHA 3KW3A 3KDNA 4L4PA 4DNHA 3H24A 2X0HA 3KDOA 2XN0A 2GJRA 4MYXA 4AZGA 5CC3A 3OZYA 3A5VA 3W73A 3HG3A 5J8LA 5IOBA 3QEZA 1BQGA 4AD2A 3LX9A 1PEZA 1NDZA 3MY9A 5TIMA 5J04A 3O8AA 1QI4A 4KEVA 2W6RA 1AQHA 3OW1A 1WZMA 2WLYA 3OLGA 1EBGA 5EMUA 2R82A 2Z25A 2ZZ2A 5JU6A 1YRRA 2F61A 1FWFC 4HU0A 3WLOA 4FEZA 3W1PA 1XBZA 4RDVA 3IIXA 2E8YA 4FIRA 4HNLA 1DWGM 3H23A 1KFKA 3S9ZA 4RPQA 3M0LA 2C19A 4JTFA 4TMCA 4DJED 4BCEA 5DMYA 3ZQ9A 4GYPC 4GYJA 3G1RA 4ZTYA 1W3IA 3R12A 4REQB 1WV2A 4OT7A 3EB3A 1EKOA 2ABBA 4NYYA 1TCDA 1XDMA 1YEYA 1ICPA 3RMJA 1DXEA 2V6AA 3IUIA 1AH4A 2WVTA 2Z1VA 2QYGA 4A21A 2UWFA 2IUZA 2CBIA 3TA9A 2J78A 2W62A 4C6NA 3B8WA 1M7JA 3AI0A 2RAGA 4PTNA 1OCBA 4P61A 1JCMP 3PR2A 4NHVA 4NU7A 3WFZA 1BVWA 2NW0A 1UH4A 4ZO9A 1K77A 3U2OA 5FJIA 4QRNA 3WQWA 4KH2A 1TVNA 5EYWA 2HVOA 3CL8A 2DH2A 4ICCX 3PZNA 3ZT5A 3MYOA 3W6YA 4AZHA 1PAMA 2VP8A 3BQ6A 3UF9A 1VPXA 1HGWA 3GUGA 3V16A 4QP0A 4Q3MA 3WJZA 1GG0A 3WUBA 4BFAA 4Y9MA 5FL0A 3L4XA 1H4PA 1MZHA 2CZVA 4M7SA 1V6UA 1LZOA 2PZ0A 3SQSA 4IFRA 1B0IA 4IQJA 1VYPX 1P0NA 2NSOA 2WNNA 4P7OA 1M6JA 2YL8A 5KITA 5CPNA 3KBSA 3THCA 1US3A 3UPMA 3CL6A 3W7NA 1UH2A 4HA4A 1ZAIA 3PBYA 1K9TA 3I68A 4F79A 2PDKA 1NDVA 4ZQNA 4XAPA 1U30A 3A47A 4CQAA 1TX0A 4AIOA 1F3TA 4D2JA 4KWVA 4GNVA 2UY5A 2QJNA 1ISWA 3W88A 3ZMRA 2W61A 2HDJA 4ZB2A 1KNWA 2GUBA 4MUPA 1DYSA 1P6WA 3VFLA 4NKCA 1TCMA 1CDGA 1RJRA 4H2CA 3UGVA 4F0RA 4JQ2A 1G9HA 1V03A 1YYAA 3WDHA 1LDCA 1VC4A 5A1AA 1Q6FA 1XDLA 4O19A 1SZFA 4FP1A 4JIPA 1EQCA 4PMOA 4D6JA 1OFBA 1OD8A 1VYRA 3ABOA 2XIOA 3VTRA 3KBJA 1MRQA 5HUOA 2PLCA 3C61A 2Z4GA 5BU9A 1UQYA 4F9JA 4ORIA 4L9ZA 1PKLA 1F8MA 5LA1A 2DIEA 1L6GA 2X40A 1C8YA 1KKRA 2F84A 3ZS4A 2ZZ7A 2FHBA 1QO2A 2XH7A 2Y7GA 3NVDA 4O14A 1AW2A 3VFCA 3PB0A 1WA3A 1XR2A 1P1MA 1T6MA 2GOUA 4BEUA 2BXZA 3G1AA 3O07A 1F05A 4FXFA 3VZZA 3SN4A 1UBPC 3E9AA 3PSWA 1W5MA 2NT0A 4DUVA 1RPKA 4I7VA 1IF2A 3WBWA 2YA2A 4HNOA 1MUMA 3ZFHA 4XTIA 1FCUA 1MSSA 3RIKA 4M6VA 3PJUA 4HHHA 2Y85A 4HA3A 3EA1A 2WZHA 4JFUA 4PUUA 4W89A 3R10A 1Q6OA 2WHKA 1WCGA 4X60A 5LA2A 1YLVA 1TUXA 2NT1A 3B9NA 2Q3RA 1EOMA 4FNPA 1Y8BA 2YIHA 4W7VA 3OLIA 1SZEA 4KPLA 4QSFA 4IPLA 4JOMA 1W0MA 3RU6A 3U7VA 4GCXA 3KOWA 3MZ2A 4TVCA 2WV8A 1KRAC 1UUQA 2UV8G 4KS0A 3B8IA 4EACA 2QUMA 2Z28A 3B03A 4WIWA 1F3WA 1WUFA 4WGHA 1RQEA 4O11A 3LCWA 4URIA 3T8QA 3M0HA 4JTKA 2OEKA 4M8UA 4B5XA 2ALRA 3UZJA 4K6AA 4LV4A 4ATWA 1B30A 4DJDA 4PCNA 4NZ3A 1NH6A 1EDTA 3VIJA 3FHAA 2ZZ3A 2A7RA 2P8BA 4OOUA 2E40A 1XS2A 1QWKA 1YTEA 1UJQA 3M46A 1A5MC 1MMFA 4QEEA 1SGJA 2WC4A 1CCWB 3PJTA 2A3EA 1WAWA 4Z0SA 1KKOA 1MRAA 1C9WA 1US2A 3T2QA 3TMQA 4LAMA 1AQFA 1Q3NA 1NDWA 3EMCA 1TFVA 5LIYX 1FXQA 4GUGA 3BW4A 3UJEA 4MMWA 3TA6A 1LF1A 3C3NA 3WQDA 3UYCA 3TQKA 4CNTA 1BF6A 4E2BA 4QSHA 2VC9A 5D9PA 5M3WA 1ZGDA 1DPMA 1J0JA 3VZXA 1Z9AA 3NVTA 1E51A 3STCA 1RAKA 4JQ1A 5A6MA 2E28A 4JYDA 3VNMA 1TIMA 2F7FA 1DWFM 4LXFA 1W3LA 3BDKA 3IIPA 2QJHA 2I17A 4YHEA 4A2SA 3OQEA 1LORA 2EPOA 1S39A 3FYOA 1F4AA 4CD5A 2NVCA 4CQDA 2QZRA 3SURA 5ECUA 1X7FA 4I8DA 3MUZ1 3THUA 2X30A 4FNUA 4NL1A 3ATYA 3WBEA 1W1VA 4M1BA 4G9PA 4IGSA 3W1LA 4RE3A 3W37A 3C86A 4HNTA 4GG9A 1D7FA 4MWAB 3NO5A 2QPXA 1F74A 4XKMA 4Z2JA 3GAKA 1KC7A 5C6MA 3QZ6A 3HN3A 5DY3A 4PL2A 2YDAA 3I7QA 2FVKA 3QV9A 3ZJ8A 3CJPA 5JBFA 1CGUA 3GE7A 1O5RA 5AHMA 5CG0A 4ROQA 4AMAA 1SO6A 1Q6DA 4PYSA 3HPAA 4O0KA 3VGDA 3HQNA 3FJNA 3GC2A 1OC7A 1X6LA 3CNYA 5BXTA 1BLIA 2E67A 3L68A 5AVHA 2TYSA 2WAGA 4EPKA 3ISIX 2WVUA 3QMSA 4AWTA 3KCOA 5E0CA 3QPEA 4PODA 3L0KA 4ZQCA 3OHIA 3WL0A 3TR9A 3VIHA 1OM0A 5SWUA 4WY0A 4S3BA 1FFQA 2OB3A 2OPJA 4B91A 3G1SA 3TYBA 1Z8AA 6PTDA 2F6KA 2PD5A 1HKVA 1Q7MA 4GMEA 4HNVA 1W91A 1C8VA 1Q63A 1AW1A 3OTRA 2DZBA 4ACZA 1CLKA 3PPFA 5D8ZA 3NQMA 2A7NA 2O7SA 3TOYA 3NZQA 1RZMA 4MNKA 3TTYA 4BI5A 4O10A 1CW2A 1C8QA 2WZTA 3NQAA 4CCZA 4U31A 4HHMA 1ZS2A 4U33A 5G4WA 3T4WA 3GG1A 1Z3NA 5DFAA 3RO8A 3VI2A 7TAAA 4UQCA 2WZEA 4HMCA 4C1LA 5EBAA 3RITA 4MFEA 3TWBA 4BQ5A 1GK8A 2JKEA 1XIEA 2ASHA 1XCWA 3NR0A 1A80A 3B8UA 1XIGA 2J7DA 2REQB 1Z42A 1Z44A 5A2AA 2WPBA 3GU1A 1OK6A 5H8MA 1VBRA 2WYSA 4Q8NA 5CPOA 2Y89A 1ADDA 4DZAA 3CMGA 4J3XA 1RK6A 4PFMA 1KM6A 3BOLA 4H9TA 3WUGA 1IV8A 1I2PA 1MUCA 2BBFA 3E38A 2WCSA 1JI1A 4XD4A 4PMJA 4UZUA 2DJXA 1NU5A 3VD5A 4NI8A 2Y4SA 4NJIA 4KQNA 2IPFA 5XINA 3C3UA 4HCLA 3L67A 4AF0A 4FZIA 2CZFA 3TSBA 1W1YA 2VQUA 4I3GA 1BFNA 4LBRA 2GVGA 2BGQA 3NDYA 2R94A 5DT7A 2ZUNA 1BGGA 3VNYA 3N4EA 2YLLA 4GRSA 3RX2A 4F40A 1XF0A 3RCMA 2EF9A 1G1YA 3WDQA 3GIPA 3DN5A 3WUFA 3R0DA 2PLKA 1REQB 3GNDA 1XLKA 3BPWA 1XLAA 1QATA 2Z27A 2FGLA 1ISZA 3LI1A 7ENLA 1QPRA 2QMJA 4WK9A 1T41A 4CCEA 2R14A 1OSEA 1EJSC 4JBRA 3URNA 3SSZA 1PCKA 2PDGA 4FX6M 2VUNA 2OX4A 3F03K 3FYPA 3EPOA 3K8KA 1PVNA 3IJ7A 3MI6A 4I6VA 1GKQA 5CKSA 2V2CA 2VTFA 1IT8A 1W9PA 3QTGA 5D33A 5DBTA 4IMEA 2NSXA 1QJWA 5FJUA 1C93A 4FR1A 1DWJM 4Z1DA 4ICMA 5C9ZA 2J66A 4E3VA 4C5ZA 2J7GA 4FO4A 3WQFA 2GJXA 3NCOA 3SRFA 4X22A 4LRTA 1RLCL 4DPQA 4DUWA 1KFJA 1HL8A 1Q5MA 4B90A 1FWGC 5D2TA 3SUSA 3DAQA 2V2HA 1JDDA 1JCLA 5CPMA 5A8PA 3CM4A 4FX8A 1W3NA 3WMSA 2O9OA 3ARUA 1XG3A 2XPKA 4I5RA 5F2IA 4H3DA 1ZCCA 4P8VA 1YDNA 1V0NA 3E2RA 1RXOB 2Y1HA 4HOZA 1I8JA 2WPGA 4OKDA 3PN8A 3LNMA 4Z1AA 3CC1A 1J2WA 1XLJA 1YNYA 3PHAA 4MZYA 4LUJA 5JQ9A 3L66A 2C14A 1VFMA 1K4HA 3V0TA 3LQGA 1IXPA 5HQLA 1Q45A 4XZBA 5F4WA 3SM0A 5IFTA 3I65A 1XYMA 1N55A 2ZUMA 3AYRA 4JKLA 5I02A 1ZL1A 3MBDA 3D3FA 4YTRA 1S2TA 3K8LA 4KRUA 2ZE0A 3N9RA 2DUAA 3P8JA 3E5BA 1EHAA 1UWAA 4YPJA 4G56A 4QXIA 1KFEA 3VINA 3KZPA 2QUTA 4WHBA 5T9CE 5HJLA 3QGKC 1BG9A 3SN1A 3DHFA 1A4LA 4A3UA 2KZHA 4Q6XA 5FF3A 1BRLB 5BNKA 1AODA 1GVSA 3LGEA 5FOOA 4J3ZA 5KETA 3MB9A 4LQ1A 3H70A 1HVQA 4IMFA 4BEQA 5E5CA 3NZRA 2PDLA 2OLAA 4XZNX 5AKQA 1MW0A 2EJAA 2JEPA 2XIQA 1CPUA 2CKRA 3IWPA 1XH1A 2PC4A 3ONCA 3QPYA 1IIGA 3NQCA 4A8LA 2GK1B 2QQ6A 1QUMA 4ERIA 4C5YA 3UWQA 3CHFA 3T1GA 1ZB5A 3WJYA 2VCCA 4UOJA 3SFWA 3EDKA 3IJ9A 2OG9A 1FOBA 3N14A 2JF6A 4GO8A 5CAKA 1FX6A 3H26A 4AEFA 1E1CA 3KOYA 2O9TA 4HU8A 3H4GA 3EBVA 4AZIA 5T8GA 2D1ZA 3B9OA 4F0SA 1O5XA 1PB0A 2QDGA 2V30A 1Q6GA 4C6CA 5D4YA 5BOFA 4L1WA 3DG3A 4PUDA 2PA6A 2E77A 2EJ1A 2IXUA 1GVEA 4S3FA 4LYKA 4JTHA 5CPSA 2X1IA 3KZSA 4PB5A 4GNKB 3C2FA 4CNOA 4NJJA 1L6WA 5E70A 1QW9A 2V63A 1SQ7A 1EJ7L 1WB0A 1U2YA 3W76A 3EB2A 4IIGA 3CMJA 1TWWA 1JYXA 4WJXA 1MQQA 3PZOA 1GORA 3VNJA 1Y5WA 3RLHA 4EAYA 4HSNA 5IFPA 2VZTA 4GZ7A 3R5EA 2D73A 1HL2A 4MJZA 3WELA 2DZAA 3SUTA 2VR5A 2OZ8A 1GCYA 1JDEA 1NFPA 4LCSA 2FQIA 3QHOA 4PMRA 1TWDA 3FIGA 1GVQA 4JTAA 3MVTA 1XHGA 2G37A 4AD4A 2A21A 2HJPA 3R8GA 4Q32A 4DJEA 3F4NA 1ISXA 4YYFA 2I5QA 4C6OA 1VFOA 5DT5A 3HPSA 4L1GA 1KM3A 1KXTA 2WWCA 2ZA1A 3NUKA 2E9LA 3GH7A 4RUBA 1FDJA 1LLOA 1VBGA 3CASA 2FFCA 5CJNA 1OBAA 1EEXA 4XD6A 2A7PA 1YQ2A 2D0FA 2VHLA 1TA3A 1VJIA 3AS2A 1PWMA 3B4YA 1IR1A 3TSDA 2XH4A 2EEXA 5LNWA 2VXNA 4PRRA 3KXQA 1K9FA 3NL3A 3TTSA 5ENLA 1FA2A 3PBGA 2ZUWA 3WQ6A 1MXSA 2BMBA 2YFNA 4YJ5A 1G5AA 4DF1A 3U5YA 1E9IA 4INFA 2OGYA 2PDFA 1RA0A 3EWWA 4H7CA 4UQAA 1EHNA 4DI8A 5DCBA 1E3ZA 2VVSA 4PTVA 4WDTA 2GQ3A 2R6OA 1DJWA 3CZLA 3VM7A 4FPSA 1SJCA 5AYIA 4XX6A 3S46A 2WXDM 4OFCA 2D23A 1HG3A 4H6EA 1TV5A 1GQLA 3LTSA 1IE7C 1ODZA 1FY6A 3CB3A 1KFBA 1ZU8A 2XIIA 1MW2A 1G0CA 3SSJA 4MAZA 1C7SA 3T7VA 2GGEA 1M7OA 2J74A 3L7RA 1WX0A 3TKFA 4QITA 1TJ0A 1OIMA 3N4AA 4YN5A 5DQPA 4XAGA 3GXTA 1QXLA 3UZXA 1OQFA 2GWNA 2AOSA 2FJKA 1QNVA 3LM7A 3M7SA 3NPVA 3JZEA 3NIYA 4DYEA 3TW6A 1XLDA 5GVJA 1F2JA 4S39A 5EMJA 2CIPA 5A8QA 4DJFC 2G3FA 4WOZA 2CZEA 3UPBA 1S2UA 3U2EA 5FSEC 1XC4A 1TPC1 3ALFA 3C2VA 1RR2A 3G3DA 2J47A 4CN4A 1FDYA 4PGLA 3ES8A 3HQ1A 2DT0A 3IS4A 3UNDA 1ODUA 5LNUA 4W7UA 1Q2SA 1FWJC 3GRIA 1Q7QA 2FTWA 3OPSA 1ISYA 3GXNA 3S5ZA 4HJWA 1E43A 2YCIX 2QV5A 2YFOA 3VIOA 3E3HA 4RX0A 1ZY9A 2BB0A 2VI0A 2G97A 3W00A 1FH8A 3QHNA 1GOQA 4A29A 2DT2A 4QR6A 4H8NA 2NV9A 3OHMB 1SZNA 3LRLA 1V0MA 2R9RA 2ZRYA 2PWUA 3EX2A 2Z7KA 1QASA 3BAYA 3BLLA 3AXKA 4IFKB 3DKJA 1PPIA 1OABA 1I9CB 3NO1A 3VMPA 4X9YA 4WR3A 3L21A 2QIIA 5DCDA 2EPMX 2ICSA 1NWUA 1CXEA 2OJPA 4GQ0A 4HYWA 5ABFB 3GXDA 1RP8A 4H19A 4A3HA 3HPXA 1N8FA 3WLJA 2C71A 5AYYA 5H2ZA 1A5AA 4PUWA 3T8LA 3HMJG 3BZJA 4BF9A 3R0KA 4JEJA 3H54A 1J96A 2WHMA 3EWCA 1RY8A 2HVMA 2PGFA 1A5LC 3QRHA 4PCSA 2EPNA 2ZRUA 3U0HA 4NJKA 2H9AB 1THFD 4LS1A 4DYJA 3GBDA 1LWHA 3TFCA 2WKJA 4AWUA 1LBMA 2IPGA 1QCWA 3ELFA 2ZXDA 2INFA 4CEUC 1KRMA 3LM3A 1JI2A 1CB7B 2B7PA 3UXLA 4KEMA 5BMXA 1SZRA 4ZOCA 2QAFA 5H6HA 4NRRA 3M6DA 2NX9A 1JCNA 1B2YA 1TWSA 2PMQA 4XK2A 4WF7A 1J6OA 1GVFA 1Z69A 4X0VA 1GTHA 3ARWA 1QHZA 3W1UA 1GOOA 3KBNA 1R2SA 1V3HA 1YW1A 3VDAA 5BMWA 3GW3A 3S1XA 4RZ4A 4FNTA 5HUPA 2DDXA 5IBXA 5JH1A 4EAMA 1TMLA 2QVHA 4NP7A 3AXHA 1E6PA 5BROA 1V6TA 4DO5A 3M16A 1UKSA 3SCTA 3C2YA 4UNKA 1TPH1 5FJTA 5HNTA 3DOPA 2GGIA 1DV7A 3MO7A 1PE1A 3DFYA 3KP1A 4ADSA 3DENA 3BZGA 4Z17A 3CYJA 4O57A 2ZTKA 2QPSA 4D1JA 3ZVHA 4EF9A 4W86A 2X1RA 4FAMA 1P4CA 3LTYA 1E70M 2YCKX 4OUEA 3G8RA 1JUEA 5C9WA 4NZ1A 2QJJA 1UD2A 1FHVA 1VFUA 1E4NA 5JBEA 2J24A 5KSWA 5D37A 4H6RA 3QSTA 3L2IA 3TZNA 1FDZA 1YKWA 3OGVA 1H0IA 1J0HA 2PB1A 2WC3A 3B9DA 4AWSA 1KCXA 3WEMA 3WG6A 1FRBA 1XD1A 3OVGA 1GQKA 4S3AA 1W1B1 5D38A 3HOJA 3NA8A 1LUCB 4QJ5B 5HINA 4DNMA 1VHCA 5HWJA 5DBUA 1CLXA 3IJIA 1KLYA 1OX4A 1ISVA 2ZRVA 3W1NA 4JIQA 3RHGA 1NWRA 3L4TA 4GFIA 5D2XA 2QJGA 1E6QM 3PPGA 1KCKA 5I06A 1QRQA 1IXQA 4IH3A 5C2GA 1SFTA 1FP9A 3ARSA 1P0KA 1UWQA 3PF3A 3WLTA 4IPNB 3P74A 5A8MA 4JR5A 3P14A 2OZTA 4CNUA 2OX1A 1OFOA 4F2UA 4LT9A 1X39A 1LBLA 2ESCA 4KESA 4AHOA 1TQXA 1ADOA 1EL3A 2NQJA 4RXGA 5REQA 3RG6A 1K02A 4E8DA 1H7XA 1TQJA 3STPA 3UXKA 2Z6IA 1JPHA 1TPVA 2PLJA 1HL9A 1CGTA 1H7WA 4MADA 4K36A 4Y8EA 1VIWA 1BXCA 3HZ3A 5AHNA 1JCJA 1H41A 4K39A 3MKCA 3UZYA 3LCLA 1G01A 1WBHA 4L4MA 3P6LA 3TYZA 2XSBA 2CNCA 2W4XA 3KLLA 1BG4A 4GYFA 3E02A 1FWTA 4ZFMA 5LIKX 4EXQA 3PBUA 2Z2UA 3EDJA 5AOUA 5D9OA 3UR8A 3TE9A 1HP5A 1S5NA 1GOXA 2XVKA 1FWHC 1RVGA 5CSYA 2ZVIA 2QEZA 1OFPA 2V3DA 4R7WA 1QFEA 4XKYA 1XLCA 4J3WA 5AC4A 5DO8A 2PP1A 3EPNA 3M0MA 3S1UA 3VKBA 4ZE5A 3PG8A 7XIMA 2XYLA 2Y88A 1D8WA 3UETA 2UY4A 4H01A 1C7TA 1P6BA 3P93A 1BF2A 5FEWA 3EXTA 5HR7A 3RR1A 1N82A 4LYQA 4DLFA 4RNJA 2P0OA 3M5VA 3WLPA 4RZBA 3SIZA 3UWEA 4B15A 8TIMA 5C7HA 3NAVA 4DZ5A 5J5RA 5D9MA 2OO0A 3SCRA 3S2NA 2NV1A 1PKYA 3WF2A 5FESA 4JS3A 1DQXA 1ZUAX 3PUDA 2FB2A 1EA9C 4PH6A 1Z41A 3KOXA 2FGZA 3WF3A 1KW1A 2J7HA 2VFEA 1A5UA 1I6NA 2O0TA 1E4MM 4YWSA 1QDSA 1NOWA 5G1YA 3G0SA 4UTTC 5HULA 3N15A 3VOJA 4EX4A 4REQA 4RKAA 3BJTA 4CCDA 3FEMA 2C16A 4QE1A 3QV6A 1O66A 4EIVA 5MKGB 2NWSA 3PSVA 4BJHA 4KMQA 3MSDA 1BXBA 1HW6A 2YCLB 5FKYA 4PUEA 3ARPA 2ZX8A 1XCFA 5HQEA 3SEPA 1JG9A 2HZGA 2QIWA 3SDOA 3WQVA 3P62A 3VC6A 1D9EA 2FVMA 1AMKA 1NP0A 3CV7A 1QOXA 3MCMA 3N2BA 5CBBA 1P0DA 1S38A 1E71M 3E0WA 4IMCA 1JYWA 1RJPA 4M51A 4N4PA 3LUTA 3WH9A 2YXOA 1H7NA 4GJJA 2HNHA 1B3VA 2PDUA 1XRTA 3IJ6A 5CZSA 4GQRA 4C6PA 1O6IA 1TB3A 4FXRA 2W63A 1KQYA 3F5JA 3AISA 1SJBA 2BZNA 1X6UA 3V4BA 2UBPC 3TIMA 1QPQA 1BYCA 2EKGA 4AU0A 5BWAA 4Q4RA 2P88A 3ZOAA 1C29A 1RP9A 5AHIA 3ARYA 4MJ4A 1KBIA 2HMCA 4RV3A 2XVGA 1PWLA 5CZ0A 2V5CA 1ZBCA 1F3XA 1DVJA 1T40A 2ADAA 4FLRA 1XIMA 4NIRA 1ZRQA 1PYMA 3EDDA 3WX7A 2PURA 3I4EA 3EX1A 3THQA 3EOUA 3DC0A 4WVXA 1QPOA 4JYFA 4HZ8A 1T96A 3W23A 4I9TA 1KR1A 1GEQA 1RLDA 2D24A 4H9ZA 1KA9F 3R1ZA 2OYMA 4UFHA 1TWZA 4MJMA 2D22A 3MZNA 1NAL1 3IJ8A 1M41A 3QW4B 4ZFCA 4J28A 4WKFA 4NJGA 2PU1A 1DTUA 5TBOA 3RF9A 4DB7A 3OIHA 1O1HA 3BSHA 1W9UA 4ICNA 4WD0A 2NXHA 1K8XA 5CJ5A 2I1OA 5I3KA 4W8BA 3G3MA 1SW3A 3UG3A 3R89A 4K8HA 1DE6A 1G7UA 3UWYA 4MY1A 4FK9A 1WKEA 5HQMA 4UMCA 4K1GA 4O8RA 3ZR5A 4NI3A 1SSGA 1TTQA 3PANA 2CLIA 3OYZA 3CPUA 2CLFA 3ZSSA 2VQTA 4N9EA 2YB4A 3NDZA 1HP4A 3GU2A 5C9RA 5BXSA 5G2HA 1ZBWA 2ZA2A 3MTWA 2YXXA 1Z48A 2RDUA 2DSWA 4WRHA 4N02A 3WH7A 5A5WA 3MHFA 4NAFB 3GTNA 3W02A 2WC7A 3D46A 2DIJA 1Q6EA 1DJHA 3B06A 4WY0B 4PTWA 3AROA 3IGSA 3OA5A 2TPSA 4LB3A 4HN8A 2ZWYA 1XICA 4GGHA 3F4DA 2EG7A 3BANA 3QW3A 1AH0A 3NTYA 4MM1A 4BWLC 3SN0A 3GR8A 3WEOA 1L9WA 1P0EA 3IV3A 4ACZB 3HV8A 5AYBA 1JCTA 1P43A 4WXZA 3AXMA 1H49A 2EGZA 3H21A 1RV8A 1JPMA 3GO2A 2IPWA 2BFGA 3LBCA 5EFDA 4QJ4B 2B81A 4EVZA 2Z2AA 3KBMA 2BXYA 3JU2A 1H09A 2PDNA 1JXJA 1J0YA 3TC7A 4QG6A 3Q37A 3IVUA 4Y9PA 1W8SA 3E96A 4C6EA 1SR0A 3BSMA 4J3VA 3WF4A 4C7DA 4XAZA 2E6YA 1CTNA 3DFPA 1XP3A 2BNJA 2RDXA 3WLKX 3VMOA 2QNEA 5TQLA 4F0HA 3LU2A 4MDOA 4E5TA 1OCNA 3EDFA 2FPVA 2Q02A 2VWSA 2GQAA 2PAJA 2VZVA 1OCJA 3W1XA 3M0VA 4MLJA 5LA0A 4QISA 4QAIA 2VEIA 3WBXA 1K7FA 3EOOA 5LHFA 5AVNA 1I2NA 1XIJA 3HG2A 3SB0A 1JXKA 2ZX6A 1POJA 4LUSB 1A49A 5K4ZA 2O4MA 4GIRA 2BVDA 1MW1A 4L1XA 3TXZA 2XGZA 3HA1A 2ZZ1A 1AJZA 3TN3A 1L8NA 2A6NA 1G4TA 3IUDA 5BZAA 4R34A 3F2BA 4AF0B 3SBFA 4Q8UA 3H2NA 3W01A 1F76A 2QKFA 3MVIA 2WANA 1TV8A 1J18A 3CS2A 3LZ3A 2NX1A 3M07A 3R58A 4GZJA 5HR6A 3ARXA 4ZCWA 1RBLA 2WMIB 3KVJA 2OQHA 2E25A 3ZWSA 3WNPA 3W2LA 3ABXA 3ICJA 3JS3A 4MPQA 3PZMA 3ZVIA 2VJXA 4TX6A 2BHZA 3HTWA 3MDUA 3G1HA 1WBJA 3P84A 4D6CA 1EO5A 1S5WA 3RRXA 4QDWA 3S42A 3LERA 4B4FA 1JDFA 3V7PA 3N2OA 4N4QA 4NILA 4FF7A 3T6CA 1GJUA 7A3HA 3UJ2A 2WSPA 1OF8A 4IP7A 1H61A 3BAKA 3IIOA 2ACRA 1K8YA 1XISA 3H2MA 4IIEA 3W81A 4AEEA 2ISDA 3RXZA 3A22A 1F4HA 3PS7A 1UUMA 5H8UA 1N7KA 4A3YA 4UC5A 2DUZA 3PTMA 2V5JA 3AJXA 3TJLA 2PS2A 3A3XA 3BG3A 2DV0A 3KRZA 1ZNNA 4Z08A 1SJDA 2HCVA 2WMGA 3MWAA 4DJDC 4PZVA 3WO8A 1PUDA 3GR4A 4LJ3A 4HTYA 1ITQA 3L5MA 4RXFA 2QULA 2IKJA 4ORMA 5I3IA 4IISA 1WDWA 4BK9A 4JTIA 1WKDA 3FDKA 4ZGYA 1EJRC 3EPMA 3SUUA 3WD1A 3AIWA 2XFFA 4AUBA 2YSWA 4R7JA 5D9NA 1RQHA 4NX5A 3TQPA 1VQTA 1Q2RA 1I2RA 2IXVA 3ZZ1A 3BURA 3CUZA 4DX3A 1E1FA 2ZA3A 1K1DA 1TRIA 4YTQA 2Y8VA 3TR2A 5AFDA 1F9CA 2OEJA 2YJQA 2FPYA 4ZOBA 4C6BA 2IKGA 3GYCA 4MG4A 1UR0A 1KXVA 1ONXA 1B57A 4GUJA 2ABAA 3FLUA 4FALA 5I00A 1UR1A 3ZLFA 3VYLA 5CQ1A 1GONA 3AS0A 1H11A 3ATZA 2BXVA 2DZPA 3A4AA 1XKJA 5CSRA 4ZXLA 2X09A 3STGA 2P50A 5CJMA 1M9HA 2J13A 1UR9A 1ITCA 1RCXB 5G1MA 5XIAA 3MDWA 1HVXA 3SI9A 2ZXBA 1XINA 1M01A 3GDBA 1IZJA 1MWOA 1AJ0A 3E5PA 4MTVA 5DANA 3SGUA 2REQA 2OT1A 4AZCB 4UTWC 3F1QA 3GDLA 3HIJA 3WJWA 3ZR4A 1EJXC 2PDQA 5E9AA 3RN6A 1B1YA 3PWIA 2D69A 1E1CB 4LANA 4LU0A 4NQ1A 9XIAA 3N6QA 4HA1A 1V0KA 4S3KA 4G7FA 4B5UA 2FTPA 1W8GA 2EG8A 4JFVA 2ODOA 4LAOA 4GIEA 4DELA 5CZTA 3JVAA 1Q6QA 2XUCA 1UIOA 2DZVA 5FF7A 2O7QA 1OY0A 3OOQA 2Z0IA 1WZKA 1VHNA 1DJYA 1E9LA 3MCOA 1K4GA 1A3XA 4LC8A 4PMVA 1JDAA 2ZWZA 4LNYA 4M6QA 3CZGA 1TKKA 1JEZA 3NL6A 4GK8A 4V27A 1TPWA 4UCGA 1R3SA 1KBBA 1YADA 3KFTA 3M64A 5ABTA 3G18A 4O4WA 3V3WA 4DF0A 5C55A 1Q85A 4NZJA 1QHPA 2JQXA