3EA2A

Crystal structure of the myo-inositol bound y247s/y251s mutant of phosphatidylinositol-specific phospholipase c from bacillus thuringiensis
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
296
structure length
296
Chain Sequence
b'ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKYKVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYSYASSINPEIANDIKQKNPTRVGWVIQDYINEKWSPLLYQEVIRANKSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Modulation of bacillus thuringiensis phosphatidylinositol-specific phospholipase C activity by mutations in the putative dimerization interface.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Lyase
total genus 116
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ea2A00
1QATA 3CH0A 5T91A 7PTDA 1VD6A 1DJGA 1DJWA 2OR2A 3EA1A 3EA3A 4I9TA 3EA2A 1DJZA 4I90A 3NO3A 4GNKB 1DJYA 1ZCCA 2OOGA 1DJXA 4RV3A 4F2TA 5T9BG 1PTGA 4RW5A 3KS6A 4F2BA 4QJ5B 3H4WA 3V18A 1O1ZA 4R7OA 3RLHA 4F2UA 3QR0A 1DJIA 2PZ0A 3V1HA 5PTDA 2F9RA 3RLGA 2O55A 2ZKMX 1PTDA 3PTDA 4I9JA 1T8QA 2ISDA 2PLCA 1XX1A 4OECA 4I8YA 3H4XA 5T9CE 3QR1A 1AODA 3V16A 2P76A 4QJ4B 1DJHA 1YDYA 4S3GA 4QJ3B 2FJUB 4Q6XA 3I10A 3OHMB 1T6MA 3QVQA 2OTDA 6PTDA 3L12A 1QASA 1V8EA 1GYMA 4I9MA 4PTDA 3MZ2A 4RW3A 3KS5A 2PTDA
chains in the Genus database with same CATH superfamily
2G3MA 3FA5A 1ZAJA 1S2UA 3IIXA 1CXKA 4GWEA 5CC7A 2EJAA 1FWHC 2DUXA 3P7YA 1XYMA 4PMDA 5BYWA 3QH2A 4L1GA 1VBHA 2CITA 1FH7A 2V2DA 4GI8A 3SJ3A 4KS0A 1B90A 4GO8A 3W28A 1RVKA 2AAAA 4MB5A 2HBVA 4I7WA 4AEOA 3GU1A 3VMOA 4HPXA 2P53A 3DYMA 2DVUA 2FIQA 1Z8AA 1R3RA 1XH1A 1QOQA 1FXQA 3QR3A 3WD1A 3HV8A 5C9XA 4B5VA 4ZSUA 1ZRQA 2DT2A 1A5NC 3WNPA 4FNPA 3EPMA 1LWJA 5IFTA 3PSVA 3QC3A 3BMVA 4QLKA 2PZ0A 2QAPA 3K1GA 3H7RA 4AVNA 3KUMA 4C6LA 2WYSA 1A0DA 1DV7A 2HNEA 4J28A 2BSLA 3MW7A 1KRBC 1VRDA 1W17A 2Y88A 4N7QA 1OFBA 3F4DA 4W85A 3BLIA 3U7BA 2W61A 4C6MA 4PCPA 2INZA 1Y7VA 1BG4A 3BE7A 4ENLA 1JZ2A 2IMRA 3BK0A 1E4MM 3QGAC 2DZSA 3U4FA 5I3GA 1TJ0A 4P7LA 5CPSA 3TNOA 5D30A 2OGJA 1DWJM 4F0RA 4S1FA 4J7RA 3KRSA 1KBJA 2PSNA 4AVFA 1Q8JA 3FCPA 4OIFA 4N9BA 2W66A 3T55A 2XFRA 1OB0A 4LU0A 3TR9A 3OB8A 2GPTA 1J0ZA 5HWJA 1EC9A 4JTEA 3MSDA 1K3UA 2PDWA 3IIOA 5LZLA 3G1HA 2G95A 3IIVA 4OOZA 3GVRA 2PTXA 2PD5A 4QE5A 1Q7MA 1OC5A 1P1XA 2I1OA 2QXWA 3DFOA 2VDGA 3WQPA 1TTPA 3AZSA 3TSMA 3C0LA 5DT5A 1JD9A 5E70A 3MI3A 2QCCA 1EKOA 3T2QA 1SMAA 2PE4A 4GVGA 4ORIA 1BEUA 1TPEA 2G5WA 2ISWA 2D2HA 5LA0A 1P6CA 3D3AA 4W87A 1XCXA 3IWPA 3MCMA 4GACA 1V02A 4OVXA 4IWWA 4B5NA 2WMKA 4I7UA 1VFHA 3GIYA 2DIKA 2PLCA 1WNOA 4D9PA 4AWTA 1X1OA 1MQQA 4IPJA 1EEPA 4Z42C 2BVWA 3BOXA 2CNCA 2C19A 3RM8A 4KBXA 2ZXQA 4WEVX 2YLAA 2ZDRA 1F8MA 4YJ5A 3HV9A 4ATDA 4OFCA 2VZSA 4GBUA 2NWSA 1IXOA 4PUNA 3U4AA 3VILA 4PB5A 2WCGA 4P8WA 1JCTA 4NKCA 3VM5A 3ANYA 1K6WA 3G1XA 5IRPA 5I77A 4ROQA 5E5CA 2V2HA 1PIFA 1WUEA 2I7GA 5A2BA 1WUFA 2VXNA 3GDMA 1ITXA 3S46A 4KWWA 4KQNA 2XVGA 3DIPA 2TODA 1FDZA 3MSYA 2A2IA 3DFHA 3O0FA 3G6MA 4B5SA 3W1UA 3T4CA 3IGSA 3T44A 2NX9A 2DZBA 5HNRA 2CWXA 3UJEA 4YTRA 1VYSX 2WLYA 1GCYA 1PYMA 1C92A 2FMNA 3QQ1A 4NJGA 2PDMA 3T0DA 4G56A 1TUXA 5BWAA 3WNNA 2O9TA 1JCNA 3LXAA 4HPHA 1GOQA 5BNKA 4JFUA 3PBVA 1X6LA 3JZEA 3GR8A 3R8GA 3S2LA 3SO7A 1F6YA 1ZFJA 1PDYA 5J04A 3QHNA 2ZA3A 1CGWA 1XKJA 2YDAA 4MFDA 4J40A 3UCDA 3W84A 4GJIA 1VAHA 4U4MA 4PE8A 3GFXA 4UNIA 1RLCL 3HG4A 1TX0A 3BPWA 4LS1A 4CKQA 2OTDA 2EF9A 3GWQA 3W1NA 4NL1A 1ZSXA 2GVJA 3QQWA 3ME3A 4UB9A 5D32A 2VWTA 5LIKX 1MW0A 3O6AA 1LOQA 1F5ZA 3GW3A 3F2CA 1TTJA 2ZA1A 1TE1A 1VD6A 3G1SA 1XJBA 3G0XA 4MVAA 1K9DA 3U2ZA 3NQEA 1A0EA 5JQ9A 1RA0A 5RUBA 1LTDA 4DAFA 4RNJA 4BHYA 3R0DA 3W2UA 3MJMA 3UG5A 1PCKA 4MAVA 3W1LA 3CO8A 3DAQA 3L21A 3E5BA 1FDYA 3BGAA 2RDTA 3K13A 4NG3A 4MSSA 3C56A 4P7QA 3UZJA 1E0XA 1PV8A 3QTPA 3SCUA 4UMAA 3UA4A 1SFJA 1PAMA 4Q4KA 3TYBA 4RDWA 1DWIM 1Q7ZA 4HNNA 4ES4A 1EJWC 5CSRA 3R79A 1ISYA 5EMUA 4PYSA 1EB3A 3WUEA 4IZGA 4DJFA 2Y1HA 3IAQA 1IF2A 1C8QA 2VKZG 4E4PA 2ZC8A 3LRMA 4FNQA 2X7VA 2ZZ5A 1DL3A 3W7EA 3RDKA 2E8YA 1UUOA 4O4VA 1BQCA 1TRIA 1QFEA 2WLZA 2ICSA 2YIHA 2V5CA 4IJRA 2WC3A 1YTDA 1UQZA 1TJ1A 1P1MA 1UOKA 2WB5A 4AYSA 1UWSA 4K6AA 3O06A 4ZQMA 1AQFA 3EMQA 4K3ZA 2D0GA 1J0YA 2JF7A 4W89A 1K7FA 1UA7A 1A3WA 4KCVA 4CCCA 4IG2A 4JL1A 3WUFA 1B31A 1WKFA 1E51A 1JQVA 3AU2A 1RALA 1ITQA 2R94A 5BCAA 1HXJA 5CPNA 3B9OA 5D9NA 1QW8A 3CMJA 1LM1A 4KWUA 1NH6A 4FAMA 3H21A 3SCQA 3P0WA 2B4GA 3OJGA 4MB4A 3SI9A 2PAJA 1R3TA 3CNYA 3OA3A 4GVFA 1TPC1 1W1A1 4GO9A 3A4AA 4Z2KA 1H4PA 1VJSA 1OFPA 3M47A 3PBYA 5B80A 4MNLA 4I3GA 5BXTA 3BAKA 3I68A 3L2IA 3ES7A 4ATWA 3O07A 2A5HA 1CI1A 3HURA 3C0SA 2YPIA 1O94A 1X98A 1D3CA 2PRMA 1OC7A 2JE8A 3MJYA 4H8NA 4UOZA 2D0FA 2FHCA 1DXFA 1W2PA 2NLIA 3TJXA 3A4XA 1ZP4A 1MXSA 3I3BA 4MFEA 4AHOA 2QMJA 5C7HA 3UXAA 1AK5A 1QNSA 1BG9A 3OP2A 2BS9A 4N9CA 2E9MA 2ZWZA 3LHWA 4H9MA 1KGUA 3P80A 5BRBA 3E96A 5BRQA 1LORA 2OCZA 1R3WA 2QF8A 3DBPA 4NI3A 3M46A 1CYGA 4GQ0A 4XG1A 2PGWA 1J0KA 2A1YA 3EB3A 5CJNA 3CHCA 4HOZA 5C2CA 3MP4A 4W93A 2F2HA 4MZ8A 3IRSA 2E6AA 2WQPA 2PF0A 4C6FA 3K1DA 3ITGA 3C6CA 1UG6A 3FAXA 3S1GA 5CG0A 4LNCA 3LBMA 3AMKA 1L2QA 1RCXB 3RU6A 4YNGA 5HK4A 3FJ4A 2IQDA 2W92A 3S6TA 5FJPA 1JAKA 4QS5A 2IPWA 4FP1A 2CLLA 4UTWA 4M6QA 3VCNA 1F07A 3QKEA 2ZICA 1ADOA 2V38A 4QP0A 4GXWA 5TD4A 4Y9MA 3W6LA 3D0CA 3LK6A 3OTRA 3FJLA 5DMYA 2NQJA 3E02A 4AQLA 2PLJA 1W8GA 1E4NA 3GXFA 3C3UA 3U5YA 1KNWA 4B5XA 1SO5A 3LTSA 3S6DA 1KRMA 2OSWA 1V8EA 2QGHA 5A6AA 3VX0A 4JOMA 2QLYA 4HA1A 3W1AA 4HYWA 4PMVA 4C6KA 2J47A 4GNJA 2VC6A 2YXGA 3OLEA 4IFKB 3WDJA 3CBWA 1JL8A 3WBXA 2VGGA 4L4PA 4GZEA 2OO6A 2VZUA 3WBAA 1JZ3A 4AYGA 3E3HA 2AL2B 3IUDA 1C8YA 1EOMA 3M0IA 1W9VA 3AMDA 3EOOA 1W32A 3PZOA 1FWBC 4GPNA 4R85A 5DRCA 3D5HA 3R12A 3BG5A 5A2AA 2I57A 3EDJA 3MUCA 2XFFA 3VVGA 4WD0A 4BQ2A 1CPUA 4E2BA 3OQ8A 3W38A 4JTQA 3CV2A 1R30A 4OZOA 4M82A 3V75A 1AVAA 2ZCGA 1TMQA 3WLOA 2EEXA 1DQXA 3GH5A 4PTWA 1Q8AA 1UPMB 2D0HA 2GVLA 3LGGA 3RJXA 3RM9A 2J24A 3V5FA 3HO8A 4C5ZA 4UFMA 2I56A 3E2SA 3M44A 4ZO9A 2DZAA 3W7JA 1OFAA 4EXQA 4EE9A 1YDOA 3N9SA 4I8DA 2G3JA 4QJ1A 4A6GA 1SJBA 3B8SA 4HCHA 2PTDA 3EDDA 2AMXA 2BY2A 2R1LA 3N11A 5DFAA 4DJED 3LSCA 4WOZA 4LTSA 1GORA 1W1VA 3QY8A 4MJ4A 4UTTC 4KH2A 4MKNA 4D8AA 3AMGA 4JTUA 3GO2A 4MOZA 2HROA 2WVVB 3LQLA 5FJJA 1BPLB 2GJLA 4X2PA 3E9AA 1VBRA 1GEQA 1PHQA 3T0TA 4J3TA 3ZXWA 4QHRA 1YPIA 4IGNA 6REQB 4TO8A 3I4KA 4NXSA 4AWSA 5T8GA 4R88A 3MT1A 2DT0A 3BAXA 2YL6A 4M7SA 4HBKA 4PSPA 1RBOB 3AZRA 1BD0A 1RPKA 1GOIA 1UKTA 3LEPA 3A12A 1JPHA 3G5EA 4WY0B 3BJFA 1UP2A 4QG8A 5FAGA 3M0YA 1EDGA 4RDYA 4HZ8A 4L6DA 2EG8A 4TVCA 3EWXA 3VFCA 3S1WA 4AX7A 1HL9A 4FXJA 2RAGA 3U8GA 5K9XA 4E8GA 2QPSA 3QLLA 5EBUA 2DSKA 3NZRA 1Q6FA 3UESA 5CZJA 3SW6A 3LD5A 1KA9F 3AIQA 3WFAA 3EDEA 3PUOA 2QIWA 3I10A 4Q7IA 3ZT6A 1WYIA 4CCDA 2J13A 4P7NA 4UQDA 1ZUAX 1K8XA 2VDHA 3D3FA 1XI3A 4HMCA 2WVSA 3KLKA 3W72A 2DZUA 1FBAA 5LSMA 3FGCB 2INEA 1DJQA 1OF8A 3SN0A 3ATYA 3DFNA 1TX2A 2J8GA 4Y9NA 4WGXA 4D6JA 3CUIA 2QGYA 4PTMA 1O5RA 2VR2A 2HCVA 3U7VA 4Q8PA 4EAYA 3JS3A 1E5NA 4XZIA 3TC3A 1EHAA 3WIJA 3QMTA 2HZGA 3UP8A 3VKAA 1E43A 3JR2A 5HMSA 4E8DA 3MVIA 4XWUA 3RX2A 5A2CA 1SR0A 1SO6A 3Q2DA 1TIWA 5E6YA 3OLDA 2EXOA 3AICA 2GJPA 3IUHA 3HPAA 4GYPC 1X7FA 5EL1A 3GC4A 3XISA 4D6DA 3KTSA 1TV3A 2Q8XA 4AH7A 4PUDA 1RJRA 2H8ZA 5FJTA 2ZA2A 1O4UA 2PUZA 2DW6A 2ZVIA 4MNJA 3UJFA 3PJTA 1VFLA 3CZLA 3QPZA 4Q22A 1TMLA 1J11A 3EOEA 1XIIA 1EX5A 4C90A 3CB3A 1G4SA 4XAFA 2VYOA 1Q3NA 3LM7A 1QW9A 1SJCA 4X60A 1L8NA 3PK7A 1PEZA 2ZTJA 4B4HA 3TN5A 1REQA 4WDWA 3P8JA 3GG0A 5LIWX 3OVGA 3P8IA 3PBGA 1M53A 3KEHA 5CSSA 1D3HA 3E74A 5CGTA 1NOUA 1E0WA 1VFOA 5AHFA 3NUKA 3VKKA 2CZEA 1MXDA 3PVFA 1Q45A 5HJLA 1XYBA 1QW7A 2ALDA 3FYPA 2DZVA 5T9BG 2FPTA 1UYQA 9RUBA 3KRZA 4O1DA 3HIJA 2ACUA 2QJNA 3BSHA 2ZUSA 4PMRA 5CPQA 4K7VA 1Y65A 3LXCA 3KX6A 3WLPA 3IVSA 3L68A 1HKWA 1HQTA 4MB1A 3NGFA 4XX6A 4K2SA 3D46A 5XIMA 3QRHA 4I6VA 4JIHA 4QIUA 5L9FA 5ABEA 5A6MA 3AJ7A 5I3HA 1RR2A 4WKHA 4H8UA 3CPGA 1EPXA 2NT0A 1FRBA 1UPPA 2VR5A 4H4IA 2QJJA 1KV5A 4UXDA 3TYZA 3GR7A 3LLXA 2UY3A 3V5OA 3PN8A 2QUVA 3DH7A 3SB0A 5FJOA 3WD4A 1GOKA 3OW1A 3RITA 2O92A 1C29A 1RCOB 3S4TA 3IANA 2Q8LA 1EGZA 2PCQA 2FZ8A 3W88A 3DI0A 5DF0A 4Y90A 3E0FA 1NQ6A 3KBWA 1M6JA 1Y8BA 3SN1A 1RCQA 4J4KA 2P5NA 1CB7B 4HA3A 3B8DA 2GVGA 3UNDA 1EJUC 1FWDC 2WKGA 3F7JA 1JI2A 2Z1BA 1XDJA 4LANA 1RA5A 1A5UA 4BFAA 1IV8A 3GH7A 4L64A 5M3WA 3B9NA 1FKXA 3P5YA 2XU2A 1KM2A 2YL9A 4GKTA 1Q6LA 1AMKA 5EY5A 2ZUTA 2CXGA 4XISA 3PM6A 4US6A 2PZNA 1KO0A 4XAGA 4AZ7A 1JCMP 1X8FA 3LXBA 2V63A 3AAMA 4GH3A 2C7FA 2GVYA 2R24A 3FDGA 4R53A 2E4TA 4MMWA 3WYZA 3M9YA 4IFKA 4C6JA 3MUZ1 4AX6A 4JYDA 1IXQA 1ZBVA 1I2QA 1W56A 1X6NA 3BV7A 2OQHA 3R6IA 3W24A 2D24A 2IS7A 4HU3A 2WO5A 4EX4A 3XINA 3WCZA 2AL2A 3B8VA 4JPGA 4RK8A 3BH4A 2WXDM 3G18A 1PE1A 1FY6A 3MYPA 3QOKA 5U7SA 3L4TA 4RDVA 2DUZA 5CEWA 2A3BA 1W9BM 3HJZA 2HE8A 2QCMA 3WNOA 2BLEA 3GC5A 1EWDA 3MUAA 3AS1A 2C79A 3R11A 1WE5A 4Z2LA 1YNQA 1I75A 3T0AA 5IBXA 3UZYA 4D6HA 2PTYA 5GNZA 4AD2A 3KDOA 4DM1A 4US5A 2DIEA 1GG0A 1JQXA 1UR8A 4GNVA 3VDGA 5ABHA 3DFYA 3UW6A 3DECA 4QTGA 3V3WA 1ISVA 3PBUA 3BW4A 4F2UA 1PBGA 2PMQA 3DU0A 4G7EB 3IRDA 5IFPA 2VX5A 1XIBA 3JUGA 4JNMA 3AXXA 3APYA 4L6OA 3UJRA 4UCFA 4H19A 3GHUA 2WVVA 3ZQ9A 3EWZA 3RPDA 3LCXA 4QAIA 2MANA 4ZBCA 1Q6CA 4MPQA 4XUYA 3SQLA 2OKOA 4MAZA 1MMFA 6REQA 4GA8A 4BF5A 2WMIB 1CWYA 2FYMA 4N9DA 4WLCA 1N2VA 1Q6OA 1XG4A 1E15A 1QATA 4WZHA 3KOFA 4MNKA 5BOOA 4WSHA 4ERGA 5I2UA 3QMSA 1AD1A 3OPSA 1W3LA 1WDSA 1DJZA 4MJ2A 1R86A 3H70A 4S3EA 1V08A 5FCZA 3GNNA 1THFD 1ZGDA 3UG3A 1FVPA 1UKOA 2BOGX 1EEXA 1OK4A 3AMLA 5FF0A 1HT6A 1K4HA 1EYWA 2PDCA 1G4TA 3U5UA 4M24A 1A5SA 5H91A 1HF6A 5DCEA 2WM0A 3W70A 3R89A 4DVOA 4JICA 1B3OA 3K8MA 3FGCA 2ZRZA 3VC6A 2PB1A 3W9ZA 3AUOA 3NSNA 4JFWA 5A6BA 1CTNA 1B30A 3CASA 4QAWA 1CGUA 4L4MA 4PMUA 2OOFA 5FEPA 2BWGA 5GPRA 1RJQA 3B0UX 2BNJA 3CL8A 4LJ3A 4AXKA 4X9SA 1G01A 3GKFA 3LTYA 1OYCA 2P0IA 3IJIA 4UFIA 4IXXA 4FNTA 5CPOA 1FCBA 1P7TB 1R87A 1XISA 4MY8A 1GZGA 1G0CA 4N6EA 3BZJA 3GR4A 1Q66A 1SJDA 2WM1A 1TV5A 3T09A 3VZZA 1NOWA 1AQ0A 1S2VA 2AGKA 3REQB 4F8XA 2OT0A 3GTHA 1F8IA 3W82A 4XZLX 5M1TA 4ZXLA 1EQCA 4FEZA 1NSJA 1R46A 2MUCA 1JYNA 1AW5A 4ZQOA 3S2CA 2VFFA 3R8RA 2C1HA 3C3NA 1CW2A 5AKQA 4AZ6A 4DUOA 2R9RA 1FA2A 1R38A 4M1BA 3B0YA 3KP1A 3R58A 4WY0F 5JU6A 2PDYA 4TMCA 3CM4A 3N3MA 3H8AA 4F2TA 1JVNA 5AHMA 3QF0A 3TYUA 1PSCA 4XKMA 5AYBA 3APGA 3VKBA 1JPMA 3SEPA 1EYEA 3I6RA 3TN4A 1OD8A 1E40A 3GKAA 1HP5A 1TPDA 3QSRA 4TMBA 4CCZA 1ONRA 3ARPA 4GHRA 3UR5A 4DLMA 1VCGA 2EPNA 4S23A 1X6UA 2WZHA 1SSDA 4DF2A 4INFA 4L80A 3OLGA 1E6PA 3C86A 1T7LA 4NILA 2OZ8A 4P61A 5EMKA 4PMZA 3A13A 5KZDA 4JTHA 4IQDA 3BLDA 1TTIA 5XIAA 3GLCA 2GQAA 4QE1A 2WMJA 1HJUA 1C91A 3FX4A 3NNTA 5G2HA 2B81A 3K8KA 5AHNA 5AYXA 2NQHA 4KMQA 1K8ZA 1GQNA 3Q94A 2D2GA 2LLEA 2Z0IA 3BAYA 3M0MA 5CGQA 2QCFA 1KRAC 4DO4A 1UUMA 1GVFA 4Q4PA 1EA9C 5HNNA 5A69A 3PY2A 3VGEA 1GG1A 3HPXA 2WZTA 2AQVA 1SZGA 3M0KA 1BYBA 1G4EA 1XLKA 2CXEA 1OCBA 3HPSA 4NZ3A 3GG7A 2PDXA 1R6WA 3KTCA 4CU6A 3MBDA 3GRIA 2ATMA 3G1VA 3L5LA 1NFGA 4UTUA 2R91A 3L4VA 3RLHA 2CHRA 3QY7A 4NZ1A 4AC7C 4H2HA 1E9LA 3V1HA 3ZJ6A 4P8VA 3UNTA 3SECA 4Q7NA 4ZO6A 5I02A 5LXEA 3UXDA 4GYJA 3W07A 2X09A 3BJSA 4W5UA 2BHZA 3WDHA 3TAKA 3E49A 3ANUA 1DKWA 2GOKA 2J7FA 3UETA 4JDYA 1R0MA 3VINA 4C5YA 5HR6A 3LHYA 1SW7A 1VB9A 4KFOA 4LS0A 2EO7A 2WV8A 2ZX9A 4EXBA 2Y5SA 4AIOA 1H1NA 3M6DA 1OIFA 4Z17A 1VZWA 1XSIA 1ME7A 4X2RA 3BLLA 3SURA 1Q5MA 1F61A 1V0MA 1NWSA 2RJGA 5E9AA 4PL1A 4A22A 1R8LA 3NTYA 9XIAA 4B9YA 1DJGA 3AALA 4J3WA 3DFPA 2G96A 4C1KA 3NQBA 3MV01 3WBYA 3VCCA 3GE7A 3AO0A 3B8TA 4PMXA 5JBDA 4NZCA 3LRKA 4YWIA 2PLKA 4AF0B 1RY0A 3BGGA 4AMCA 4L1XA 4QRNA 1KM1A 3SIZA 3BZGA 3H24A 4O0QA 3WL1A 4QQ3A 2W5FA 3NO5A 5AVNA 1YE6A 2BG5A 3WFZA 1WKEA 1J6OA 4ZVJA 1ZU8A 1BQGA 2DU2A 3QMRA 3H2MA 4JFVA 1P0BA 4UNLA 1LBMA 3ZO9A 4KIEA 2X42A 2RFGA 4MGGA 5DN1A 4RL3A 1T8QA 3GNRA 3N2XA 1BXCA 2VCBA 2CLOA 1M9HA 1UKQA 3E0LA 1VEPA 2Y2WA 1KB3A 4IGMA 4C60A 1LUCB 4W7UA 2FGZA 5BWFA 4HJWA 3T2PA 3OOQA 3R2GA 1QNVA 3WLIA 2WJZA 3AS2A 3EWDA 1CZ1A 1PIIA 3EKLA 4G7EA 2W27A 1J79A 4ZO7A 5T91A 2GUUA 3GDKA 1HP4A 1NP2A 4IIEA 2H90A 3TXVA 1WV2A 2XWDA 3BW2A 3MMTA 3VA8A 5LYRA 1FWWA 3EX4A 4IX0A 4GI6A 3TCSA 1FX6A 1S2CA 5A8QA 4A05A 2OLHA 4KERA 2QDEA 5GQBA 3N2OA 4TUFA 1K77A 2E6YA 3TZFA 1GZJA 2VQUA 3K4DA 3KHDA 2V68A 3GBEA 2WMIA 3GSMA 4PEKA 2A4AA 1QWGA 6A3HA 2DZTA 2AGTA 1KFKA 4F0KA 2ACRA 1K70A 2NXGA 2GJXB 3PPHA 1MDRA 1R47A 4UTLA 3AHTA 1K02A 3FN9A 4TTUA 3P74A 3URAA 1KBLA 1O6IA 1W3HA 3VDHA 3LPPA 2ZDSA 4JTFA 2WZEA 2V5KA 5FESA 4O12A 4S3CA 8CGTA 2D73A 1X38A 4IMAA 3LX9A 5IXEA 3VABA 4EK7A 1E9YB 3G0UA 3T0BA 3ES8A 2DVTA 2WSQA 3MKVA 1NJJA 2Z1KA 3I6EA 1OBAA 1QHOA 4GLEA 3NQ2A 3CK5A 2FVKA 2RDXA 3DN5A 3O0KA 2GFTA 4NJJA 1EC7A 4L6HA 1UH4A 1IGWA 4ZQCA 1KCXA 2BY3A 2QJHA 2XFWA 2B7PA 5FL1A 1QAPA 1P7TA 2ZUMA 2PP1A 4P5UA 1RY8A 2XIBA 5LXXA 4PGLA 3UR2A 2A21A 4Q7BA 4GIYA 3REQA 2QUUA 1G5AA 3HTWA 3TYAA 3QOMA 3DESA 3RAOA 5EMMA 5LNUA 4MJMA 5JH2A 1JDCA 4H6QA 5EFFA 2VVSA 4M6UA 3GFYA 3O05A 5B7ZA 2ISDA 1RLDA 1H2JA 3EGJA 1ONEA 3S5YA 4NXKA 5H1WA 1MNZA 5M17A 1X97A 1SMDA 1HJQA 2I9EA 4JY9A 1G1YA 1DEDA 4QJ3B 4IM4A 3N19B 1F3WA 3ZR5A 1SYTA 2PWHA 4HTYA 2J66A 1LWHA 1ZCOA 1TJ2A 1W5NA 2GK1B 3QV7A 3EAUA 3S3GA 2PRHA 1TKKA 1U33A 3T40A 5G2IA 2OSYA 4JNZA 2EAWA 2QYGA 1S1RA 4UMCA 4YMZA 1OG0A 4GMEA 3FDKA 1W5PA 3ARUA 2G3FA 3STFA 3TSBA 4WIWA 1US2A 3C2YA 4ZOAA 5KSWA 1WAWA 2A7PA 2NQLA 3AIEA 1J0IA 5FACA 3DFSA 4PTVA 2PEVA 1QCWA 4LGXA 3W7IA 3EB2A 2HJPA 2XGZA 5I3FA 3V0UA 3SM0A 3LNPA 5DEZA 1LQAA 1W1YA 5FSDC 1EX1A 2PWUA 3CGTA 3E38A 1K7XA 1XBYA 1LQ2A 2FH6A 4K8EA 2CFFA 1B0IA 4NI8A 2NV2A 2O56A 3PZ9A 1W5MA 3HGSA 5D2XA 3RJYA 1O7AA 4Q6JA 3SFWA 3A5FA 4HNTA 1IGSA 2EPKX 1UASA 4P7RA 4QROA 4AD3A 2GDVA 3FKRA 2DZWA 5HJXA 4GC3A 3M0LA 1OYAA 4QJ4B 2IPJA 3M1ZA 3N4AA 3OIHA 2NT1A 3UJSA 4LF1A 5I6SA 3SN4A 1V6YA 1IT7A 2G4JA 4X63A 3W7HA 4OBTA 2CLPA 2JBMA 4XZWA 3W1TA 3GU9A 1UIPA 1R3VA 1V77A 4RZ5A 4B4FA 5K4XA 3W7NA 3LCWA 4ZB2A 4AHQA 3EA1A 1WA3A 1E72M 3EDKA 3GU2A 1I9CB 2O9PA 4GUFA 2Y24A 1UZ4A 1UROA 1BGAA 3E2QA 2J9ZA 3AFBA 2GDUA 4GJ1A 3DHUA 4K36A 1XIGA 2CU0A 4KPLA 3H2OA 2C15A 3ORWA 1GONA 4DX3A 2CCRA 3SRKA 4LSBA 2Q71A 1JCLA 3VNZA 4NX0A 4S3FA 4DJEC 1GHRA 3ZVHB 1CT5A 1FWNA 4REQB 4GQGA 2I5GA 2PURA 3SFKA 2KX9A 4RJEA 2ZUUA 2BHUA 2V2CA 1POJA 1GVQA 1XIFA 2ONEA 4AHPA 2ZX5A 3M16A 5C9ZA 2A3HA 4DF0A 2O4QA 4PCTA 3WLKX 1TYGA 1V3LA 4FLQA 3IS4A 1BKHA 3KBVA 4L4LA 2XJ7A 2VQTA 4WGHA 1TSIA 3TMQA 3TJIA 1F4HA 4ADTA 1UJPA 1M41A 1E1EA 2KAUC 4QNWA 4DQWA 4ZB0A 4HOXA 3WLNA 5KZ6A 1G94A 1LLZA 2J62A 1TJRA 3T2OA 1FP8A 4EWJA 3PB2A 4HNUA 1VLWA 1RUSA 1SVDA 2JK2A 4JIIX 4OV9A 5HWNA 3Q65A 1DWFM 1POKA 3W1XA 1JULA 3BAIA 3WQ8A 4BKNA 2JEQA 3PG9A 4DZHA 1JNEA 1Q2SA 3CIXA 2W3ZA 4AZCB 4POCA 1NFPA 1UP3A 1WOBA 2TRSA 1LOSA 3AS0A 4XAZA 1YRRA 1FHLA 1GVRA 5CC3A 5FF4A 2UV8G 1A5KC 1KW1A 3SUTA 3U0HA 3B0PA 2A79A 2E8ZA 1DOSA 1EBGA 2ZZ3A 1QVBA 3QFWA 5A95A 1HGYA 2IW0A 4ZEPA 3C2VA 4LYQA 7ENLA 3LHUA 2QJGA 1V5XA 4GXPA 2EHHA 1S1PA 4F0HA 2WJDA 2P1FA 2Z1SA 4JHZA 3RCMA 3RG6A 1HKMA 4YTSA 1VH7A 4H9TA 1C93A 3EWYA 5EGRA 4UC5A 3VOGA 1NVMA 1TMHA 2Y61A 5C70A 3NPUA 1KXVA 1BWVA 2FJUB 4GVHA 1Z3NA 1HKVA 4S3DA 3CZGA 4M51A 2GQ3A 2C16A 4AW7A 1JJKA 4Q8UA 1DE6A 2ABAA 6PTDA 1DHPA 3MUXA 2FHBA 1TB3A 4ADSA 5D38A 4CNOA 3LTPA 5A8OA 2GJXA 1VCVA 2JKPA 3OG3A 4JQAA 3WF2A 2NWRA 1R2SA 4DM2A 1GGOA 3B8WA 3PWIA 4ML9A 4EWND 2VURA 2NQZA 3VD3A 4I5XA 3W74A 3WLJA 4FNRA 3LENA 4NP7A 1HKJA 2PDUA 4A29A 1OGGA 2J7DA 2OSXA 1I4NA 2QNEA 2G50A 1CLXA 4C6DA 1DXIA 2IQTA 3NIYA 3EXRA 4W7VA 4PEEA 3G6LA 4G5DA 3G1AA 3NVTA 2FZBA 1XBVA 2CLMA 3QYQA 3VGHA 2CESA 5K2ZA 2CWNA 4PUUA 5IOBA 4MDOA 3H2NA 4RXFA 3C4UA 3ENLA 2ZZ1A 4RLIA 4Q33A 1V6UA 2WC4A 2WSRA 4IJBA 1DXEA 3MU7A 3W01A 3II1A 5KETA 3M0JA 1GJWA 3SY8A 4Q8VA 1BYCA 1FH9A 5T9CE 1S2TA 2IUZA 1SUXA 1JI1A 4F9DA 1VFSA 3APTA 1YDYA 2GYIA 1XSKA 5G1TA 3S9ZA 4E0CA 4ERAA 3H4GA 1RP8A 2XVLA 4C6CA 1TELA 4OV4A 1ME8A 1XH0A 2C18A 1U22A 3CTLA 2XDFA 5I78A 4LV9A 2HWGA 4ROPA 5I0DA 3VNDA 3ALGA 4YLWA 4B3LA 1RPXA 1FKWA 1BYDA 1GJPA 4LY4A 4QDWA 4C1LA 3NDYA 5I09A 5F1UA 5GJNA 1GUVA 3U2EA 4MTVA 4C1NB 3USZA 3MA8A 3RCYA 4QS6A 1XFCA 2FTWA 4H01A 2QF7A 3A24A 1M04A 1YYAA 4GZ7A 2Q01A 2ZRXA 2DORA 3L67A 1UR3M 1Z32X 1EZWA 5IHRA 3CO4A 3VX1A 1R5YA 2OG9A 4NZFA 1B9ZA 1NQKA 3MC5A 4OHQA 3KS6A 5D8WA 3ITYA 4AXNA 4H6KA 2GK1A 4IQJA 3QC0A 4RCXA 2X05A 3UR8A 1J5TA 3L0KA 3CIVA 1GVEA 4IHCA 3ABXA 2W62A 4MWAE 1HNYA 2WPBA 4X61A 1IXNA 2OMAA 1BSIA 3PTDA 1JCXA 4IP7A 1KXQA 3N6JA 4XD6A 4LAMA 2ZUNA 2WQDA 3SZ8A 1EIBA 1W31A 2XN1A 1A5OC 3CEUA 3R43A 5CAKA 2E67A 2PA6A 2ZOXA 3L4YA 3ARWA 1R3QA 5TIMA 4DJFD 3KWSA 3NGJA 1QU4A 3PZGA 1GKPA 4H6RA 4UFKA 4WDUA 4C6NA 2J9YA 4S38A 5DBTA 4JTTA 1GYMA 1SJAA 3O6CA 3TLLA 5JMUA 1Z69A 2OEJA 1IYXA 4IMGA 3MP5A 2QCEA 2F7FA 3KRBA 4HPNA 3AISA 1OVDA 4J3UA 1O60A 1UBPC 3PULA 4LPCA 4PMNA 4Q8NA 2PF8A 3WFLA 3EX6A 3IGXA 2HK1A 2PDPA 2J88A 1HGWA 3NL2A 2WSKA 4MZYA 4L65A 1QDSA 4XZNX 2NVCA 4M81A 3ZVIA 1XPGA 3IJ6A 3TIMA 2O9OA 4JR5A 2UY5A 2B7NA 4Z1DA 2TAAA 3KOWA 4JHMA 4AD5A 1KM4A 2QCNA 2RGMA 4E5TA 1BRLB 3EXTA 1LRTA 3SY5A 4K68A 2POZA 2YA0A 3LI0A 3WG6A 4HYVA 3LMZA 4LV4A 5DX7A 1KCKA 2F2KA 3SSZA 3WMBA 4Z2JA 2YBVA 4GQRA 1XGDA 3P82A 3WJWA 1A5BA 3HQPA 3GVWA 1SO4A 2OX1A 2G0WA 4K1WA 4KCTA 4RKAA 5AC8A 3L4UA 3VNKA 3WH7A 2B7OA 2HISA 2CBIA 4FB7A 2E9BA 3EX1A 4GGBA 1MRAA 2H8XA 3BMWA 4KESA 1PX3A 5I3JA 4FF7A 3VOHA 4K39A 1GYLA 3THUA 3W6MA 1QJWA 4GCAA 4AZIA 3OO2A 3NOEA 2EPOA 1HFBA 1OFEA 3TOYA 4DPPA 3KVMA 3CL7A 2ZZ6A 3PZTA 4JX5A 2OVLA 4PH6A 2WBGA 5BU6A 7PTDA 2VGIA 5BROA 3ZMRA 4IMDA 2ZADA 4YCPA 2OT1A 4R7WA 4CD4A 3M0HA 3QV8A 4I9TA 1MXGA 1XIDA 2KZHA 2WK2A 1VKFA 3RO6A 5I79A 1EDQA 1H5VA 2W4XA 5D09A 4Z1BA 3W23A 1AH0A 1O5QA 4JQ3A 7CGTA 2QV4A 1FFQA 2VJXA 5HINA 1DPMA 2V67A 3SUSA 4J3XA 5IDIA 1PJ9A 2OQLA 4AG0A 3VNYA 2YCLB 4M0XA 3RR1A 1ZNNA 2Z6IA 3TH6A 1JF5A 3A47A 4F2BA 4UUIA 1L6GA 2X1SA 1TZ9A 3T42A 2XHYA 1E4LA 3BLKA 2C1IA 3TKFA 3WEOA 1A3XA 1X8CA 3H53A 2DT3A 4FR1A 4U5KA 4LVBA 5JUVA 2DFAA 5HQEA 1Z89A 2XH4A 3M5XA 4YXGA 4B5TA 1HVQA 1Z9AA 5HOSA 1K9EA 3WUGA 3KLLA 2V5DA 3R94A 1SU5A 3F5JA 2GWNA 3PUEA 3WBWA 2XSXA 4GIEA 2ZE3A 3VOFA 4QXIA 4TR9A 1QASA 2FGBA 4LS2A 2QHAA 1M5WA 4LF2A 1RBAA 2NUXA 1P4CA 1WZLA 3KL5A 1XICA 2VUNA 2H9AB 1XPYA 4IGSA 1UKPA 1VIWA 2NUWA 5I07A 2Z4GA 3GYCA 4Y9OA 2WC7A 3WO8A 5CBBA 1MO0A 3C8FA 3GIPA 3C2EA 2EJ1A 4WRHA 4NZ4A 1XLMA 2VUYA 4GK8A 4RZ4A 3LHZA 5CC5A 2CBJA 5C9WA 1O12A 4UFLA 4FSAA 1GWJA 3FSUA 4AZHA 4IX2A 1RBLA 5DO8A 1QO5A 1D8WA 3PUDA 1JZ8A 8XIAA 2GLKA 4I5RA 1XS2A 1CIUA 2E7FA 2XIQA 4XV0A 3VGBA 3ZJ8A 3RCNA 1E9ZB 1UD3A 3G0SA 2WHJA 1XLDA 4TVUA 2EPMX 2BODX 4ZCWA 3PB0A 3ZFHA 3M41A 1JF6A 3HG3A 1LF1A 2RUSA 3EB4A 1JFHA 3W29A 1JZ6A 4IIBA 4O8RA 1PO9A 1JCJA 3GTIA 4DXKA 3TOPA 4M80A 3C5QA 3SSJA 3VDBA 4OU1A 1DIEA 2PDNA 4HNVA 4LBRA 2B7QA 2J7CA 3PTQA 4Z1YA 3HPFA 2HDJA 1J10A 4C91A 4I9AA 3SGGA 1KBIA 3UT0A 1CX9A 1RK5A 3NL6A 5HWMA 4IMEA 2GSEA 2IKHA 4LAZA 3HU7A 3WD0A 1UQYA 2WNNA 4BI5A 1LLOA 3WF3A 3N4FA 2I16A 1J01A 2GGGA 1UKSA 2PU0A 3O3RA 1C9DA 1CECA 3SY1A 4YCOA 2ZZ4A 1V51A 1OQFA 2E6DA 3EWWA 3GXNA 1FDJA 3ZR6A 1AZ1A 4MZ1A 1UZDA 5AYIA 4BWLC 1Z6KA 2XM1A 5EB8A 3WD3A 3TU9A 4NZJA 3KE0A 4RR4A 4UCGA 1TO3A 2A0NA 3AI0A 1HKIA 1GOXA 1PS9A 4FK9A 2FHFA 1MW1A 3S1UA 3VIGA 3B4UA 4IOTA 4OT7A 1XLAA 1WKDA 3V18A 4AU0A 5D2VA 3TW6A 4HP5A 3F4WA 4ZSTA 3DX5A 4PODA 1KLYA 1V7AA 2OB3A 1U2YA 2CETA 4TX8A 1TV4A 1ICSA 1RP9A 4GUGA 2RKXA 4S39A 4DXXA 4C1NA 4L9XA 3PBWA 1W8SA 1BWKA 2GUYA 4HVXA 1JDFA 1O5KA 3BQ6A 4QSHA 3WQCA 1FTXA 1BVZA 2Z2UA 2E28A 2GSHA 1FWIC 4HMDA 1A80A 4O10A 4C6EA 6TIMA 3Q58A 2BB0A 1XDMA 3QVQA 1ZLPA 3AIVA 2BGNE 3W7GA 1H0IA 2GGJA 5I5RA 4RXGA 3V1PA 1GOOA 5M03A 2YZRA 2BBFA 4O14A 3L4XA 2E9LA 1CGXA 3HG2A 2YZ5A 3DYOA 2P50A 1A4MA 3SGZA 5TBOA 2QS8A 3GX9A 4HKPA 1J18A 1R7OA 2DT1A 1UUQA 1LT7A 1WDWA 3BW3A 3EPNA 4OUEA 1VJIA 2HVOA 3PFRA 2YW3A 4GYFA 1VBUA 3CPRA 3LLFA 3QN3A 4A4AA 1NWTA 3UJ2A 1KM0A 3NAVA 2UY4A 3HFTA 3LDVA 2DZPA 5CSUA 1XUUA 3WK0A 1OEPA 4E2VA 3ZLGA 1PUDA 4WXZA 2O55A 4TXEA 4ILSA 5C71A 5J5RA 2PWEA 5A8PA 4L7ZA 3UCCA 3GD6A 4AMAA 2PPGA 1P6WA 1F3TA 3W83A 3QHOA 2Z29A 3R10A 5HMFA 3IEBA 3VO0A 5J8LA 2VRKA 3TTEA 5F2MA 3VXGA 1D9EA 4NNBA 3TQPA 3HBLA 3FVMA 1AG1O 3VC5A 3BL3A 3P6LA 2PP0A 4QEHA 1JD7A 1BRLA 1K8YA 1Q65A 1X1NA 4RUBA 3W7CA 1XLIA 3WLHA 1GKRA 1E55A 2XH2A 4IXHA 1AJ0A 3PJXA 5A6KA 1XFBA 2VELA 3DUGA 1IT8A 1EJTC 3N13A 2WMFA 1CLVA 4QGCA 3DG6A 4J5NA 7TAAA 4J3SA 5FF7A 2I14A 1AQMA 3EX3A 1J4EA 4M56A 4WJEA 3WLMA 3A3WA 4X22A 2VFGA 1J0JA 3UFYA 2PS2A 2QUMA 3TTSA 2VO5A 4XTDA 4O18A 3CYJA 4NNCA 1XLCA 3ITXA 2BP1A 2J9XA 3R0UA 3S5NA 3AQUA 4ZR8A 1OYBA 2PDIA 3PTKA 4HSHA 5AYYA 1JG9A 2OXNA 2Z6JA 3SR7A 4GG9A 2VCAA 3THCA 4D2JA 4DYKA 1SPQA 2Y62A 4XIAA 3KCJA 4H41A 3MV11 2HS6A 5EA9A 2ZXBA 3AXHA 2C71A 3PJUA 1HJWA 1JUKA 4K8GA 3BVJA 3PFMA 2XH0A 1CGVA 1XX1A 1DYSA 3N12A 1B54A 2ASHA 3V36A 1QK2A 3T0CA 3ANVA 1PZ2A 4AD1A 1GVIA 3HOJA 1ICPA 3UPWA 4C6IA 2YCLA 4U3AA 4PFHA 1KWGA 5LIUX 4YTUA 5ABGA 4CVUA 5GJPA 5F7UA 2Z28A 4LQ1A 3QEZA 4F48A 4A8IA 4PTDA 3O2LA 1J0HA 1EZ2A 2CLFA 4WVXA 1UIOA 5D2YA 3CHEA 1XRTA 4NY2A 4JTCA 1E9IA 1NP0A 2PWFA 5CJMA 3LU2A 4BY3A 3PZMA 4CN4A 2P8CA 4LUTB 5I3IA 4JN7A 1OINA 4FMVA 1B3YA 1UC4A 3OVPA 2HEJA 2BXVA 4WUIA 2OZ3A 2JIEA 2ANUA 1M65A 2IPGA 4V28A 1HL2A 5EU9A 4CN6A 3MMDA 1BYAA 1GZ1A 3CTTA 1JIBA 3D47A 4R27A 3W2MA 3ZWTA 4WQ6A 1N8WA 2OYKA 1A5CA 5EPDA 3EMCA 3K2GA 1E1CB 4LCRA 5LNRA 1N55A 3AXMA 1IZKA 1XGZA 2H9AA 2XWEA 4KT2A 2Q6ZA 1LWIA 1KCLA 3P84A 1DTNA 1YDVA 2YFOA 4LVFA 2ZE0A 4JTDA 1UR4A 2EQDA 3EEZA 4JFTA 4GY0A 1V6VA 2WOQA 4KWVA 3R1ZA 5FJRA 1C9WA 4WDXA 5TNVA 1W91A 3WNLA 1Y5WA 3KOXA 2FFCA 5LHFA 4C6OA 1T40A 4ADUA 5EBAA 4B5WA 1UMLA 2RGLA 3ID7A 2GJRA 4D8ZA 3CHVA 3WN6A 1I2PA 1D2KA 1T5AA 1XGEA 2BY1A 3LUTA 1UR1A 3VU2A 4IUOA 1ADSA 5AC5A 3ABOA 1PDZA 1RXOB 3O63A 3B05A 1JNDA 2W9MA 4YU1A 1TWDA 4D1JA 1WO2A 1V6TA 2PDQA 3ABZA 3BGJA 5F2LA 1DORA 1F3EA 4JQ2A 1J9YA 2XINA 1PTGA 4MLRA 2DW7A 3ZSTA 3A9BA 2BTMA 3OU8A 4NHVA 2IPFA 1EF2A 1QHZA 4FO4A 1VYPX 1ZQ5A 4L61A 5REQB 1XP3A 1ZAIA 3LPGA 1KM5A 3AIBA 3GG1A 2QJIA 3LBCA 4C6BA 4M1RA 4YIWA 1ODZA 5FJUA 3ZSSA 2OPJA 3GY1A 4QCEA 5CGMA 2CZDA 1Z42A 1TA3B 1YQ2A 2VNCA 2NQ9A 3NEVA 4RE4A 1KKRA 3TROA 1F7BA 1PKMA 2DV0A 5DELA 5KZEA 3ARZA 5SWUA 2H3BA 3FAWA 4HA0A 3U9IA 3BO9A 3LNMA 3TLQA 3L12A 5FF2A 3CC1A 4RW3A 1RK6A 4LBSA 2VZVA 1VEOA 1VRXA 5KMYA 1VHCA 3W25A 3HB9A 3M64A 1L6YA 1EJ7L 4HIBA 1ONWA 3OVRA 4UTKA 3BSGA 3UZ5A 3H7VA 5DANA 1KFCA 3TE9A 4Q4RA 4R5EA 3QQ0A 2V5BA 3Q45A 1UOZA 3QBUA 4IP4A 4ECLA 4N42A 1XUZA 3FJ6A 3P0XA 3MSRA 1UWTA 1WXZA 5K9CA 2OEKA 1EL3A 2UBPC 1LCOA 2NXIA 4QX4A 1CB2A 3LV6A 4HZMA 1A47A 4IPIA 1TVPA 4XZ9A 4P7OA 2EKGA 1S39A 4JX6A 2VM8A 4KGJA 1R2TA 3UEQA 3SCNA 1Z41A 2X1RA 5D9MA 1YE4A 1V3JA 5CJ5A 4LAKA 1D3GA 4NSBA 4OKDA 1JEZA 4AWEA 1ECQA 4DJDC 1MEWA 1AODA 4ZL1A 1RHCA 1KTCA 5A6BD 1WZAA 4QCFA 4PULA 4V33A 3UZZA 3WQEA 2DP3A 3RILA 4D1IA 3GNDA 1OGBA 5LKYA 1GKQA 4KEZA 4DWSD 2GZXA 2XISA 2BVYA 3MO4A 1MWOA 1W54A 2D20A 2VTFA 3M07A 1EUNA 4S2BA 3PS7A 3VIPA 4AZBA 3QZAA 3QPYA 1TUFA 4QM1A 3VM7A 1G69A 3AJXA 4PZVA 2C14A 1AFSA 2JQXA 1LG1A 3QTGA 5CPTA 1PKYA 1P0NA 2YFNA 3GDTA 2GWGA 1NTHA 4LYPA 3N18A 4O1CA 5A1AA 2VC5A 3MSGA 2Y8KA 3GNOA 3AIWA 1I1XA 2ADAA 4HT3A 1F6KA 1L9WA 3RO8A 1XH2A 1LZOA 1XLEA 3H4WA 2C6QA 3PZVA 1JRBA 3B97A 1E6RA 2FZDA 1GPFA 3OGRA 1UC5A 2Y7FA 3F03K 3VIHA 1ICQA 4R33A 4GJJA 3M0ZA 2YCJA 3V7PA 1DJNA 4O54A 2WHKA 3N04A 2GDQA 4KW2A 3HF3A 3WJXA 3MWAA 3WL0A 1I60A 1ZY9A 4O28A 4MJZA 5D9OA 4E8CA 3N17A 4GUJA 4S3KA 1V6WA 4QE4A 1WQ5A 4ZE4A 4U5IA 4DEFA 1T99A 3EDFA 3EOSA 3GDBA 1YXDA 1I1WA 5FKYA 3GS6A 4HHMA 1PX8A 1US0A 2WJEA 5HULA 2ZTKA 1IIHA 1DIKA 4UWMA 4M8UA 4CQDA 2QUNA 1KM3A 3ZJ7A 3N3TA 2ZVRA 3S5ZA 3ZLFA 1UD2A 1J2WA 4JKKA 3GIQA 5C55A 1O66A 3MI6A 3LCLA 4AIEA 1QT1A 1QHPA 3TNBA 4V27A 1S3HA 2P3EA 2XN0A 1CLKA 1JZ7A 1DQUA 2IKIA 4DUXA 2DJLA 2BY0A 3RMJA 2E0PA 3F5KA 5HJYA 3F4NA 1VPQA 1EGVA 3W73A 4UQEA 1NF0A 3UZXA 4GZIA 1P0EA 2QMKA 2E09A 1OK6A 4PB4A 5CZKA 4LUTA 3QXBA 2Y85A 3DC0A 1QBAA 3MBFA 1EH9A 3TXZA 4FR6A 5A94A 4DB7A 1G9HA 1FWGC 5LNWA 1FHVA 1U30A 4QNEA 4Q8TA 3VGGA 4RPPA 2QCGA 3URBA 4E38A 1FCQA 2FQIA 3PF3A 3TWAA 3AHYA 5JIWA 2VX6A 2NVDA 1E6XM 5EMYA 3H55A 5AC7A 4KCWA 1AMYA 4LOCA 3NR0A 4RE2A 1FWSA 4JN8A 1ISZA 1LRNA 1OY0A 4UQCA 4MY9A 5CSYA 2OR2A 4MWAD 2YBUA 3H23A 1SZNA 5AZ1A 3BCJA 1M3UA 2HXUA 3B3DA 4KEMA 3CQIA 2I9UA 2WCAA 3WQVA 1BVWA 2H6RA 3G24A 1WPCA 3SCRA 1HG3A 1EBHA 3JRKA 3EKGA 4B92A 1M7JA 4JTSA 2ABBA 3TP4A 4RV3A 2V5LA 3EYPA 3F2BA 2WJFA 4GRSA 4FLSA 2VFDA 4Y8FA 4M5PA 3PZQA 1DP0A 1PZ0A 3RPMA 2Y89A 2OYMA 1WX0A 3RRXA 3VOJA 1ZJIA 1V3IA 4Y96A 1N8FA 3DCPA 3U2CA 3UZWA 1FP9A 3MANA 4CQBA 1XYZA 3M5ZA 1MEHA 1C3FA 3AHVA 1J2BA 2CYGA 1S3TC 3B0XA 3W7DA 1L2UA 3FOKA 2VEIA 3NDOA 4HHHA 4RNIA 2Z1VA 3WDQA 3OZOA 1SZEA 2JGQA 3R7MA 5LIXX 4OGZA 3NG3A 2PCEA 3FJNA 1U5JA 1J93A 5D03A 2AQWA 3LLDA 4Q32A 3WENA 5I3KA 2WVUA 4DBUA 3ZWSA 4WOQA 4ZO8A 1F3XA 2AOSA 4X0VA 2EPHA 3WQ4A 1WKYA 3QFEA 3O6DA 4UIOA 5L6UA 1EXBA 4U2YA 3VIFA 4TOQA 4F4RA 2ZZ2A 5CG7A 3QGKC 4DJFC 3NQFA 2PDFA 1UJQA 4XBKA 1UA3A 1X1ZA 3L4ZA 4O1FA 2CEQA 1I0BA 2CERA 3OQEA 4JKMA 3QV6A 4TX6A 4F66A 2D22A 3C0QA 4JY8A 4KF1A 4PR4A 4ICMA 1BWLA 1Q13A 2WHLA 4W88A 2WBKA 1XHGA 3SRDA 3LN3A 1NOFA 3BV4A 1OT2A 3IAPA 2WANA 1ADDA 2VC9A 3ZM8A 4OE7A 2XVNA 1TJPA 1LT8A 4H2CA 2V3DA 1IEXA 3O15A 3T1GA 1QNQA 2YJQA 4M3PA 3ZIZA 1QPRA 1K8CA 1KFWA 1OIMA 1C90A 1ISWA 4AFYA 3DI1A 2BMBA 4GOAA 2BGQA 1IQ8A 3KVLA 3WQWA 3MI2A 2ZXDA 3CAQA 2X2GA 3WSUA 3MUIA 1XD0A 1A3HA 1ZJAA 4YVPA 3LCHA 1V02E 3QYSA 4XSLA 1UB3A 3GZ3A 2QT3A 3P2VA 3G1RA 4LW7A 4DO7A 1RD5A 4NNAA 5MKGB 3PAJA 3A64A 3CUZA 4IGHA 5BU9A 1D8CA 3RIKA 4DBWA 4FLOA 4OJYA 3FKKA 3P60A 5AHIA 1WAUA 3WZ0E 4D72A 3L0GA 2SFPA 3LB0A 5DMNA 3V0TA 4XK2A 1EC8A 4AY7A 4BF9A 1LYXA 4PUMA 2PTWA 3NSMA 1IWBA 4H7ZA 4B3KA 1O1ZA 3N2MA 1V4YA 1O95A 4C7GA 4J3VA 5FSEC 4JDBA 4TVDA 4U10A 2W63A 3W1PA 1R9ZA 3SCPA 3CL6A 2V81A 5D33A 1V0NA 3HMCA 1NM9A 5D2TA 1E0TA 4A8NA 4HB7A 5H2ZA 1XRVA 3VZYA 3C2OA 1M7PA 2VZOA 2Z25A 3SADA 2CC0A 5GNYA 4GIAA 5F4WA 3T8QA 2OO0A 1Q6GA 4M29A 5J5DA 4W84A 5B7YA 1OD0A 3ITLA 1CGYA 1A49A 1L6FA 4XVEA 1H7OA 3NSXA 3PC0A 5TAOA 1LRQA 3SRFA 3AROA 1KFEA 1XV8A 5CZSA 2OFJA 4ZB5A 2Y4SA 3WUBA 4L1WA 3CAKA 4O1AA 1TQJA 4OOUA 3B03A 1DJWA 2Q8ZA 3KZPA 1M7OA 1GVOA 2VT0A 4JTJA 2OYLA 4HCLA 1T0OA 4KFNA 4UTWC 5HPCA 1MQPA 1S38A 3K46A 3NYDA 3SCOA 1NELA 4O1EA 3SCSA 3DFQA 1PHWA 2PDKA 3GG8A 1I2RA 2XM2A 2XGIA 3DENA 1YX1A 1B3VA 1QMLA 3WMCA 4IISA 3S0CA 4PUWA 3VKJA 3QLDA 3NQDA 4DJDA 4NJHA 3CV1A 2OZTA 1M7XA 4JAWA 5I3DA 1XIHA 3NFUA 3V0SA 4NX5A 3BUVA 4HK6A 2FDSA 4FOJA 4MUPA 2XVKA 2WAGA 1AH4A 2DIJA 2A3CA 3LI1A 3OGVA 1YDNA 4GBDA 3USBA 1BKSA 2WHMA 1S5MA 3SGUA 4KKXA 3M7WA 3W4RA 1Q4NX 1WZMA 4BEUA 1FWEC 4TV5A 1H7PA 5CLTA 1NDVA 3OZYA 3VIMA 4UTMA 3UWWA 4LRSA 2HQAA 5FOOA 1C8VA 3TAOA 4DI9A 1EPVA 1BF6A 1ZS2A 2GGIA 4UTFA 1XLHA 3F1QA 3OHIA 5HDRA 4ZE5A 4Y9PA 3GNXA 3VD7A 3BARA 4GD0A 2C0AA 5K7JA 1UCWA 1EIXA 3DBNA 4NF7A 1G7UA 3GDLA 4ERIA 3R5EA 3BANA 3FSTA 1Q6QA 3GB6A 3C8NA 1NWRA 1US3A 3IV8A 4N02A 2XG9A 4PB3A 3W7PA 3BAJA 3HQOA 5JBEA 1YBQB 2EG6A 2HBXA 2W91A 4IL2A 1LL7A 1DBTA 2VC7A 1VFMA 1XYLA 3KBMA 4ZOEA 4JS3A 1XWYA 1B5TA 4QSFA 2IQ0A 2PDHA 3FS2A 3M4HA 4AY1A 4LVAA 2ZZ7A 1W5OA 1RQBA 2C8NA 4LUSB 3P67A 2F6XA 3A4JA 3WNKA 2GUBA 3W2JA 2J25A 3DKLA 3FXGA 1EF3A 2GL5A 1NDYA 1L6WA 4IJCA 1LL4A 1BTCA 1E0VA 2Z2BA 1DWHM 1HO4A 3OBAA 1UH2A 3MPGA 4FNUA 1BSLA 1K4GA 3C61A 4B2DD 2C1GA 3PTMA 4HGXA 1UP0A 5HNUA 2V8ZA 1R2RA 4EP8C 3AWNA 2EG7A 1V6XA 3MKCA 2YA2A 3W7KA 1KM6A 1KQZA 1EHNA 1GVYA 3CWHA 1YPXA 3DGBA 3VE7A 1XLBA 4WY0A 3GXTA 3GXMA 1H61A 5LNVA 5FAJA 4JZ5A 3GUGA 1AJ2A 2R1NA 3RLVA 3E2RA 3UXIA 3VNLA 1GJUA 1SR9A 3MKKA 1XDLA 3TDFA 5CLWA 2YL5A 4S2CA 3ZR4A 2F6KA 3PP7A 5FI8A 1JZ4A 2A3EA 1R9YA 3ICJA 2TPSA 3N6QA 2QR6A 3GNPA 1JPIA 4B3ZA 1TRDA 1AZ2A 3MHUA 1EP3A 4YYFA 3TA6A 4XBJA 3W7MA 3EA2A 2PTZA 1WBJA 1HW6A 1R7AA 3VNIA 1J96A 3SQMA 3QSTA 3S2JA 1O1HA 2ODOA 2BVDA 2QVNA 1F05A 1W1IE 4MUZA 3A3HA 4PC8A 1IZCA 1QWKA 1JYVA 2C91A 3NQ7A 4W7WA 5HQLA 4EVZA 4HTBA 4R9OA 3WJZA 2E25A 5G2WA 2V5JA 3ABSA 3A21A 4ZXOA 4UTTA 4PA8A 5LGZA 4IT1A 4UFHA 3VIKA 3PR2A 1IZJA 1TPFA 4DZIA 1SSGA 3PHAA 5DY2A 2G3IA 4PMOA 1WB0A 3QW3A 3WQDA 2BXZA 4BS0A 1ZBCA 1TPUA 1QK0A 1E6ZA 4O53A 2AL1A 2QVHA 3OHMB 1ITCA 1EO7A 1ESWA 1UH3A 4UR8A 4YWSA 3HZ3A 3MMUA 4PUKA 3S47A 5DMMA 4CEUC 3L65A 3DKJA 1R3SA 3LM3A 3WLSA 5A3HA 3KFTA 2FTPA 2Y8UA 3W86A 3FEQA 4GQBA 1G67A 1XCFA 3DZ1A 1TTQA 3LHTA 1ZP3A 3WK1A 3CH9A 3W02A 2D2OA 2A6NA 2NUYA 4DBDA 3KZSA 3W75A 3NM3A 1ZBKA 3NM1A 2PODA 3I3DA 2W79A 5H8PA 4BZYA 4X0NA 4RX0A 2X8RA 5MKGA 4BR1A 2WWCA 2YLLA 3DHFA 4IQEA 3EWCA 1PVNA 2F8QA 1QR7A 3F4VA 4DIAA 1HIZA 1VYRA 1JZ5A 4U2ZA 3NQ6A 1TCDA 3UWEA 3VNMA 2ALRA 3STEA 3K30A 4IUGA 3W2NA 5KITA 1KXHA 1EFZA 3O7UA 5K4ZA 4D6IA 3TA9A 2HK0A 2BXYA 4GYPA 3COTA 3VK5A 4H6EA 1K6AA 3E12A 4J3ZA 1N8IA 3IJQA 4ZA0A 1RJPA 3MO7A 1GHSA 2JF6A 3F2DA 3UU0A 3BOLA 3L0NA 3G77A 1ISXA 4TV6A 3IJLA 3WF4A 3CZEA 4HK5A 4KEUA 2RDUA 1FWRA 4X3ZA 4ACZB 3UWQA 1JGMA 1VCFA 4XBSA 3HGJA 1ZCCA 4JIRA 5HATA 3B8IA 3AC0A 4H04A 3ZZ1A 1C7TA 3CQHA 1TFVA 1XRFA 3CWOX 2CIPA 5A6TC 1VR6A 1QBBA 1JRCA 3B4YA 4RE0A 3V5CA 4IP5A 3MTWA 3MUY1 3KW3A 4LUYA 1S46A 1D7KA 2YCEA 3AUJA 2XIMA 3CQKA 2V82A 4H7CA 5MF5A 2HPMA 3FXYA 5I00A 2HV5A 1FWJC 1H41A 2WSPA 2QCLA 3FEMA 3FHAA 2UWFA 1QPKA 3NQ8A 1CCWB 1BGGA 3OGSA 1P0KA 1RH9A 2D1ZA 3BSMA 3BJTA 5FIPA 3ARTA 3EOUA 1J6PA 1REQB 2QCDB 1IWPA 1JAEA 1B4EA 3P61A 4GXMA 4GQQA 2CLKA 3KRUA 2XIJA 2ACSA 1FFRA 5F1VA 4WK9A 3GH4A 3T81A 5E6ZA 1UWQA 1XD1A 1A5LC 1ECEA 2J6VA 2HPIA 4OUIA 1XLFA 2MNRA 1MZHA 5KZMA 4BQ5A 3H26A 3ELFA 3W0KA 4LH8A 2YL8A 1X7IA 1OF6A 1TPVA 3AZTA 4HMNA 4ZMGA 4NJKA 1H63A 2XH7A 2FH8A 2YXOA 5HAOA 4PSRA 2E6FA 2VDIA 3SRHA 1VP5A 2D23A 4NAFB 3LZ3A 1S5WA 4CNUA 1OT1A 4UQ9A 3DHDA 1XF0A 3Q37A 4MADA 1GPWA 2VD9A 3LY0A 1GTEA 1VFUA 3MVTA 2FFIA 1XYCA 4H00A 2ON3A 4CQ9A 2QAFA 3HFYA 1HX0A 3AOFA 3KTXA 1CDGA 1YBQA 2PGFA 3S9IA 3E5PA 3BURA 1OFQA 2EPLX 2E40A 3N9KA 2B0MA 5JIPA 2CZ5A 2QDGA 4C7FA 3OYXA 3H4XA 3RUBL 4O15A 3W26A 5IBXC 3TJLA 4Y6GA 4EPDC 3THDA 1QNOA 3BAWA 1VPYA 2XTKA 4FI4A 4YL2A 3C2RA 4V2XA 2PWDA 3KHJA 3PJWA 2V3FA 4LUSA 3UXKA 1W5QA 2O7QA 4IL0A 4MLJA 4IIDA 3N73A 1W3JA 1KKOA 1ZBWA 3KP0A 2OJPA 3AYVA 1VS1A 3KS5A 1DVJA 2WNWA 1HN1A 4IH3A 4H9VA 1K03A 2VI0A 4F3HA 3NL5A 3A3XA 3STPA 4AIUA 1W2VA 1BTMA 1DTUA 4LVGA 5HUOA 2W0UA 3W1QA 1KQYA 3EZ4A 1F4AA 3NA8A 4LUJA 3GDRA 1YEYA 4U33A 3S83A 1QI2A 1EA0A 3ABQA 4JCMA 4TIMA 2AKZA 4HNCA 3FK4A 1KBKA 3DFTA 1BHGA 4PMQA 2V9DA 2NW0A 3MDUA 1RQHA 2CHOA 3LSBA 4WX2A 3ITCA 4IIFA 3URNA 2HSAA 1I2OA 4KEVA 1YKWA 4D8LA 2F9RA 1ZZMA 1IR2A 5CBJA 4BI6A 3NQGA 5EKYA 1B1YA 4B15A 1TWIA 3NXLA 3RM4A 4FNSA 3MCNA 5GNXA 1CBGA 1VHNA 1CEOA 1YMYA 3W76A 4LEQA 3WELA 3BCDA 4AVOA 4HSOA 3EWUA 4JKLA 2Z24A 4LVDA 4HU8A 2Y7EA 1F76A 3CZKA 3YPIA 3QR1A 3CWNA 3MP3A 3TMLA 4LY8A 4WSKA 2I17A 4JHOA 1HVXA 4U3CA 1JDDA 3SCWA 1XQLA 3I7RA 2Z27A 4AUBA 1U5HA 4HU0A 4JL2A 1TPH1 4LFYA 3WQOA 3WJYA 1UZHA 2WCSA 1K7EA 2WWDA 3M0VA 4AEEA 4NASA 3LG3A 1FUYA 4RDZA 1WP6A 4LAUA 1TR9A 3TW9A 4UTJA 4WJ8A 5EMJA 4IIHA 3POHA 3THAA 4AB4A 3GW0A 2B31A 3N34A 3O6YX 2HVMA 5AVHA 2QKFA 4RNHA 1BXNA 5IM51 3UYCA 4IQLA 5BXSA 3CT7A 1ZAHA 4O17A 2XFYA 4ZQRA 4XUGA 4E3VA 4WKFA 4DWSC 2XSBA 3FYYA 2DSZA 5AZ0A 3WX7A 3CQ0A 3VDCA 1CGTA 4HPJA 1SZFA 1RAKA 8RUCA 5F2GA 1PPIA 4EPBC 2P0OA 2VZTA 3M5YA 2YR1A 2RDWA 2CLHA 3UWUA 4JTLA 5C54A 3QR0A 2NSOA 3L23A 1EP1A 3HJEA 2VEGA 3BLPX 2INFA 4UZUA 1BAGA 1YIXA 3BICA 2XIIA 4O16A 3PZIA 3DOPA 2ZYFA 3DC8A 1IXPA 4ALDA 3IVUA 1QO2A 2WNZA 4K38A 3VCRA 7ODCA 2QEZA 2AAMA 1KTNA 1QPQA 3KXQA 4HN4A 2DQXA 4S3GA 2D3LA 5D02A 5XINA 2R14A 5E0FA 4LNYA 1R85A 4ICCX 5G5IA 2A3LA 3GM8A 1H7NA 4Q8WA 1UD5A 1IR1A 2C0HA 3GAYA 1GQJA 3RMEA 1Q7QA 3GTFA 2VEKA 4H8HA 3WF0A 3W6YA 2O0TA 3MMWA 5HNTA 1GOMA 3TN6A 2OLAA 3MZNA 2JKEA 3TK7A 3VIOA 1T96A 3TQ0A 1WOAA 4DO6A 2CHNA 3GHRA 2Y6ZA 3FVDA 1J5SA 4DELA 4Q3MA 1SFLA 4YS1A 5D04C 3NEHA 4UOQA 2WSYA 3CHFA 3GXPA 3AYTA 5ECVA 3WH8A 4XO7A 4HCDA 4R34A 1AJZA 3IK4A 3WMSA 4CLMA 2W6RA 1TZ7A 3CLMA 4DWSB 3ZT7A 4F0LA 2VHLA 3SAZA 3S5OA 2VCCA 2ZX8A 4QDMA 2DPEA 3KVKA 1QNPA 3IJ8A 3N1AA 1TG7A 2PBOA 4CQ8A 4UBPC 4ACZA 4OECA 4JTIA 3NPVA 1AUSL 4HK7A 2CKRA 4YHEA 4F9JA 4IPPA 3WQFA 3LS9A 1GQKA 3ZJKA 2JEPA 2PP3A 2V3EA 4DF1A 2G97A 2E5BA 1B2YA 3GHSA 4CQCA 1EJVC 3VYLA 3HA1A 3S5SA 4TU1A 4ZENA 4WXYA 3WF1A 1W3KA 3BC9A 4FS9A 4ZQNA 4DBEA 2PLMA 5DXYA 1H0GA 1N82A 2J7EA 7XIMA 1XINA 2X0HA 4UQBA 3UA3A 3RHGA 1CENA 4S3AA 4D71A 3PSWA 1TV7A 2QCDA 2DZXA 3KWXA 5DQPA 1SW0A 4A35A 1FCUA 2J4GA 2GOUA 4JIQA 2YCKX 1DE5A 1E1FA 1U5VA 4GINA 3CLWA 3NZPA 2Y7DA 4I7VA 3B40A 3KAOA 1V79A 1V03A 3C52A 4OBSA 4MWAC 3G2GA 2O9RA 1EJXC 4AF0A 4FOKA 5H8UA 4R9XA 1RV8A 3M43A 5JXQA 3WH9A 1U1JA 3TSDA 3S1VA 3NPWA 2QULA 3CMFA 2YB4A 4ACYA 3VIJA 6XIMA 1GEHA 3MWCA 1YADA 2RH9A 1AD4A 3CJPA 4JN6A 2E1DA 3A4WA 1B3XA 1UWUA 2QZRA 3EPOA 4GISA 4PTNA 1TPWA 4B16A 1LROA 2GQ9A 5A8MA 4RZBA 2CKSA 4NAFA 2CLEA 4FX6M 3VGDA 1TZZA 2XYLA 3GVVA 2Q09A 1E4IA 3URQA 3L66A 2YKKA 3ARVA 2CBUA 1UMYA 3UGRA 1NEYA 2BX7A 4G1KA 4LX4A 1T8XA 2YX0A 4WDTA 2WW5A 1XKYA 5D37A 4PBFA 1OZQA 4MYAA 1KV8A 4N0RA 3W22A 1LUCA 4C6QA 4KCUA 4LALA 4H3DA 3PPGA 5HANA 1CXLA 4MNMA 5I7GA 3AHZA 2OWXA 1PCWA 4AEFA 5CAHA 4JX4A 3LV5A 3UVIA 3OYZA 3NQMA 4HMEA 4ATLA 5KEZA 2DH2A 3N2BA 3WJSA 2BHYA 1HZYA 4HHPA 4O0KA 4NQ1A 2AQOA 1L6SA 3MHFA 3WKZA 1TVLA 4NVTA 3KCOA 3F5LA 4EF9A 2JALA 3VKCA 1TPB1 1OX4B 1UWIA 4KRUA 3CAVA 3VOCA 1VEMA 5PTDA 4MKVA 3WQ5A 2WMGA 3PANA 3LA4A 2X16A 2OWWA 4FHAA 1VBGA 3A5VA 4HNLA 2VEFA 2A7RA 3W37A 3INPA 5AYZA 3W53A 1W6TA 4ONVA 3NYZA 4MWAB 2Y5JA 1GK8A 4RE3A 1PZ1A 3E0VA 2J27A 4JD4A 1OX5A 3M7SA 1EGMA 1KRCC 4X9YA 3GVGA 3DYPA 1N7KA 1MSSA 3UD6A 1PKNA 3TEVA 2ZUWA 3AMCA 3QZ6A 4Q6XA 8TIMA 2Y0FA 1WDQA 3CV7A 1WXYA 1XIMA 2ZWYA 1VC4A 4QQUA 3DXIA 3DERA 4N6FA 4C6PA 4FIRA 4AAJA 2F61A 3D6NA 1OFOA 1E71M 1TCMA 5BOEA 3CZ8A 2XGBA 3G22A 1H1YA 2HTMA 1XCWA 4O4WA 3MYOA 3LHVA 4LAOA 5ABTA 4IIGA 3NO3A 1O5XA 2OOGA 3UG8A 1XC6A 1H51A 4LUIA 4CU8A 4EPEC 3U3HA 1GQIA 3EXSA 1OZMA 2NVAA 1R3YA 1V0KA 3B04A 5HUPA 1JR1A 1VJZA 2QPXA 1XXXA 3UWVA 5BMXA 4B9ZA 3JW7A 4OBRA 5K3VA 1SZRA 2FB3A 4NU7A 4B91A 4YVXA 2FJKA 3CS2A 5AB3A 2BGSA 1EP2A 4A3RA 3KCLA 3S42A 2PU1A 4YVVA 2X1UA 2X1TA 2P76A 5TF0A 4FLRA 4LWWA 4PL2A 4XAPA 3CU2A 2DGAA 1AA1B 3S8HA 1NDZA 2DUAA 1TREA 4P8XA 1W3NA 6ALDA 5MHBA 4WJXA 5GJMA 4JTGA 4PCNA 3TFXA 2BDQA 5LIYX 3THQA 4LC6A 4AD0A 1ZL1A 1AH3A 2IKGA 2R1KA 1OCJA 3W2KA 1KR0A 3WH6A 1P0DA 2J8TA 2ZUVA 3NQCA 4PCFA 3EWBX 5LNSA 2VP8A 5A8NA 2FZMA 3VIIA 3LPFA 1LJYA 4ICNA 1J8VA 3CUGA 4GIRA 3ECQA 4O8AA 3PG8A 4EIVA 4TTGA 2QCHA 4NRRA 3N15A 3U2OA 3WMLA 1JFXA 5HMEA 4B5UA 4ZFCA 9CGTA 1ENUA 2Q3RA 4GY1A 1VENA 1KGXA 4ZZ9A 1OJXA 4DI8A 1HJSA 2QPUA 1EUAA 3PPCA 3WH5A 4AISA 1IIGA 4O57A 3W3OA 1YLVA 1IHIA 5AC4A 5K9DA 4XVDA 3OIXA 4K1GA 4W5ZA 3BCFA 1MFVA 4DLFA 2YB1A 1Q4WA 1S2WA 1W1ZA 3WQ6A 1LP6A 3FHQA 3IACA 5C0QA 2G4FA 3GUWA 5HPOA 3VDAA 1FWCC 2NV9A 2ESCA 1S5VA 2OGYA 2P3ZA 4HHLA 3DG3A 4U28A 4FXRA 1KR1A 1XG3A 3PBMA 5FEZA 5CZ0A 1QPNA 2PGRA 2HMCA 1PB0A 3SUVA 5C9RA 2D2JA 3RGTA 1FQ0A 3WK3A 1W9UA 4HU4A 4KRZA 4DWSA 2GSJA 1E73M 4JTRA 4ZOBA 4PTXA 2XVPA 4CQAA 3VD9A 4XIMA 2YYUA 4JEJA 3B06A 3AHXA 4AY8A 5IDZA 1VQTA 4P8UA 4A2RA 1ALDA 3POCA 3RX4A 4D6GA 4Q4MA 3OVQA 2OX4A 3G3DA 4AZGA 1FH8A 1O68A 4XKYB 3OBEA 3ISIX 4Q8MA 5DXXA 1PL9A 4CEXC 2V69A 3FA3A 4RW5A 4UTHA 3RR4A 3R0KA 5E0CA 4QR6A 4ZFMA 2E5DA 2QJMA 4BA0A 3OZPA 1G7VA 4NZ5A 3P81A 3TYCA 4WF7A 3PWAA 6ENLA 3ONBA 5E93A 3ATZA 1IEQA 2BOEX 2GGEA 4N9EA 3ZLHA 5JVLA 1NWUA 1TWZA 1DQWA 1HUVA 1W9PA 3UERA 2J7BA 3ZVHA 2IXVA 1ZALA 4REQA 2BOFX 2YSWA 1MDLA 2E77A 4F0MA 3JVAA 2X0SA 5D4YA 4GGHA 5T26A 3V16A 3WDIA 3IJ7A 1FWFC 1YW1A 2X0YA 3NQVA 1GYNA 3BXWA 3E2VA 1IEWA 3L7RA 1KBBA 1UWRA 3GTNA 1UD4A 2NV1A 2OEMA 2PDGA 3L2LA 3GK0A 1JYXA 1F74A 2VFHA 3CAWA 3AIUA 1QRQA 5G4HC 3VKDA 4ASTA 4IICA 2JFEX 5BMWA 2V0TA 4S3BA 5M5DA 1WXJA 2J79A 3CPUA 5BOFA 1DWGM 1K1DA 4Z1CA 4MF4A 4BEQA 1KWKA 4GUHA 4QLLA 3RLUA 3BG9A 3T6CA 4ZGYA 3T07A 4GNKB 5CKSA 3OG2A 2YDRA 5CBIA 4W4QA 4WR3A 2CZFA 5DT7A 1H11A 1C7SA 3GC2A 3KM8A 3QJAA 1KFJA 4E2DA 1Y5XA 3NQAA 1UBSA 1UZ1A 4AZCA 4KGLA 4GFSA 3ARQA 3TCEA 2OLSA 2Z00A 3E6EA 3SUWA 3VAVA 1Z7AA 3DDMA 5IHSA 4WCJA 4TQTA 3W7RA 1KFLA 1OGSA 1QI0A 4PMYA 3UR7A 5I24A 2HXTA 3NWRA 6TAAA 1H60A 4JYFA 3AU6A 1XLJA 3PNUA 2BV9A 1XYFA 4LT9A 4J2PA 2H3DA 4HQVA 1PX4A 4HZ7A 1WDDA 3LCGA 2O7SA 4URIA 4GH1A 3TVAA 3TWBA 2EKCA 3WDPP 1T41A 4DJEA 3SCVA 5E9XA 4EXAA 2PC4A 2VEMA 2HE5A 4XZMX 3S9YA 2WKLA 3M5VA 4AWUA 4PRWA 1OX4A 4J9JA 3VMNA 4FIQA 4N4QA 3NZGA 3O16A 1Q63A 2GVEA 2FPVA 3WQGA 4D6EA 4Q8QA 4DNHA 3W85A 3LPOA 4CD8A 2G8ZA 2ZQ0A 4BQ3A 4DRSA 1V3KA 4MWAA 2NX3A 3LCIA 4C7DA 2YYTA 4D6FA 3G8EA 3JZUA 3N6HA 3GHTA 2FVMA 4J2MA 1W0MA 3VGFA 3A22A 2FB2A 4JFSA 3IVTA 3KDNA 1B3ZA 1GW9A 1NARA 5C2GA 3H2EA 2ZRWA 3MS8A 3ITTA 3GXIA 5EYWA 3T8LA 4XD3A 2VRJA 3TONA 3QHMA 1NIUA 2DSUA 4R7OA 2D3NA 4Z2GA 4CD6A 3FW6A 5F4XA 3RLGA 4GVIA 4YTQA 2VFEA 4GFIA 1G6CA 3W87A 2X7WA 1YXCA 4EF8A 8A3HA 7REQB 4QISA 1DIDA 1UR2A 4DWDA 1HTIA 3P93A 4LCSA 2F6UA 1H7WA 3VMPA 4PCSA 1PWLA 4CCEA 4O50A 4HA4A 2VX4A 2VGFA 3IPWA 1J12A 4BCEA 2X2YA 4AC1X 1OABA 1AL7A 3MZ2A 4B90A 3AYRA 2VFIA 5D8ZA 3RFAA 3CZJA 1Z44A 4XQ6A 4ORMA 1JDEA 4BI7A 2OQYA 4EANA 3LRLA 1UWAA 4J27A 5CXPA 4HOWA 2YBTA 3H54A 4BF7A 1ONXA 4CVWA 3VFLA 5FF3A 3FFSA 1XR2A 4R7JA 3WLTA 4CU7A 4HN8A 5EMLA 1VGAA 5TQLA 4M6VA 3G1DA 3HPZA 3LCFA 1F2JA 1I2NA 1FOBA 5CPLA 1PXGA 4DUVA 4NRSA 4DBSA 3IIPA 2VEPA 4O0ZA 3C0JA 3UXLA 1S5TA 1P43A 3EX2A 4DAIA 4N2YA 3VNJA 4JQ1A 1RD6A 1H49A 3ABRA 5LA1A 3KOZA 3TFCA 1FWTA 9XIMA 5AECA 3TJ4A 3WDRA 2F38A 4YYCA 2NX1A 1G4PA 4L56A 2VOTA 1E56A 1V3HA 2VD8A 4EAMA 1MUMA 3UCQA 4W8BA 4QBXA 1UR0A 2IKJA 3P62A 3GBDA 1JXKA 1ZTVA 3I3EA 5G4WA 3IJ9A 4GX8A 1PIGA 4DZ5A 1XIJA 1JXJA 2OZ0A 4NAEB 4FZIA 3RK8A 1OM0A 1GT8A 2NSXA 3TC7A 4E2OA 2XPKA 4PUEA 1E5JA 1MVYA 3EBVA 3GVQA 1JGIA 5C5YA 4JQ4A 2PGEA 3SIMA 3M0XA 1ML1A 2J6XA 3LMYA 4W9TA 4FX8A 3ARSA 4YHGA 2FZNA 1OHLA 4F40A 1AW2A 3TYEA 2O4MA 5BRPA 3PAOA 3C2FA 3BTNA 4UR7A 2VX7A 3BLEA 2A3AA 2X40A 3VOIA 1QOPA 3N25A 3PPFA 5C6MA 4HPGA 3IGHX 4E4FA 5EFDA 5DBUA 3WD2A 3BWWA 1X39A 5FEWA 4W8AA 3VUSA 4Y7EA 1H1ZA 2X41A 3AXIA 3NDZA 4FA3A 3CHDA 2IXUA 1QNRA 3W1RA 1M1BA 3TTQA 4GC4A 4V15A 4LYRA 1BVNP 1TIMA 4Y2WA 3NPXA 4UR9A 3DHPA 3S2NA 1XIEA 4Z08A 5C8BB 1EJRC 5LGXA 1W1TA 1XBXA 1CXEA 1JYWA 1H7RA 2CPUA 1P48A 4GUIA 3G3MA 4GCXA 3A6OA 3L2MA 2AKMA 1AL8A 4XKYA 3N9RA 4A3UA 4S3JA 2GJNA 5A8GA 2AMGA 3VE9A 3UGVA 2QQ6A 3R8HA 2R1MA 1QI4A 1QTWA 3OA5A 1XM3A 5H6HA 2FMOA 2Z1XA 3HQ1A 3TYDA 3B9DA 1TV2A 3SUUA 3WLQA 2Y63A 2XIOA 4E6MA 1HO1A 3EA3A 5AHEA 2DSVA 2Q3OA 1L8PA 4O11A 3RX3A 3H7UA 8XIMA 2V3GA 4G7FA 1AQHA 1I6NA 2VGBA 1W9DM 3W1MA 3I65A 3VI2A 4PRRA 4H1ZA 4XO6A 3AXKA 2R6OA 1ZHAA 1E3ZA 3WLLA 4NIRA 3MQTA 3UF9A 4EKJA 2Y70A 4IPNB 2DSWA 3TTOA 1OSEA 1MRQA 5BXRA 1LLWA 3PNZA 3GYEA 1LL6A 1UD8A 2A7NA 3BLOA 3PZUA 3WEMA 4GZJA 4L9ZA 5FL0A 4MPKA 1VFTA 4RNFA 4P2VA 1EDTA 3W7OA 3SJNA 3SQSA 6XIAA 3PUGA 3QKZA 3VUPA 3L5MA 2ZRVA 1TV8A 4HZ6A 3EEGA 3ONCA 4HJFA 1ZENA 5D05A 1OFDA 4L4OA 3QV9A 3W7QA 3TQKA 1MUCA 1Y5VA 5CH9A 4GABA 2PRLA 3G1FA 1T6MA 1PTAA 3IGUA 4A8RA 1JPDX 3E0IA 3WNMA 1XC4A 5A6JA 1U83A 3PWGA 2FKPA 3STCA 1UR9A 3RRAA 3LGDA 3T78A 1LOLA 4BK9A 4J35A 4K37A 1B57A 3TW7A 5DCDA 4A3QA 3CB8A 2NLYA 5AOUA 1NF7A 1ME9A 2J75A 1FHDA 3E0WA 4WHBA 1VLIA 1HL8A 4MB3A 2PC8A 4Q4SA 3LERA 4FXSA 3WY1A 4KRTA 3EOLA 4QDPA 2ISVA 2G41A 3P14A 4LXFA 1LG2A 4M7TA 2JKAA 2X1IA 1ZJHA 4CUCA 4Y9AA 2TYSA 1Q6EA 3JU2A 3U6WA 3GTXA 2Z1WA 3J7HA 4WSJA 4FF5A 3IUIA 1DHKA 3H2FA 3QM3A 4UZSA 4LC8A 2QW5A 1YHTA 4MY1A 4QEEA 3CUHA 4TX9A 2W67A 1OCQA 4DJDD 4I9JA 3EKZA 1RQEA 5ABFB 3TUUA 1V0LA 1QI3A 3ERPA 1BLIA 3TQVA 4XSMA 1A0CA 4B2DA 3NJ3A 1EQPA 1B3WA 3O8AA 5C7VA 3L5AA 2XSAA 2DH3A 2YA1A 4O13A 1V7YA 4A3HA 4LRTA 1GOWA 3TN3A 1OCNA 3QPEA 2QV5A 1YPFA 1VIZA 4QFUA 5HBFA 2VL4A 1A4LA 4JNYA 3MHGA 3AYSA 2PI6A 3W2LA 4G9PA 4Z1AA 1NY1A 1YTEA 2R82A 4F0SA 1QI5A 1SFTA 3SCTA 1EWEA 3E1F1 4FALA 3F4CA 5JH1A 4W8LA 1OADA 4DY1A 4GYKA 1A50A 7REQA 3KBNA 1B4KA 4IF2A 1E6NA 4ZOCA 4V1YA 4US5D 3UWZA 3I7QA 1F73A 2OKTA 3K8LA 4O19A 3QGVA 2Y8VA 2DJXA 3ZYZA 1IT0A 1C8XA 1H62A 3BLFA 3W00A 5FD0A 2JGYA 1YNYA 1UD6A 3DG7A 1EJSC 1GVSA 4JGDA 1V93A 3MDWA 2DVXA 1H3GA 1TWSA 2ZX7A 3N29A 3SDOA 1F6PA 1WZKA 4XD4A 4KFPA 4NUWA 3XIMA 1BFNA 4Z2IA 5KINA 5U4NA 4LEFA 1IEIA 2ZKMX 4FXFA 1KLZA 3H12A 4CGTA 2ZX6A 3KL0A 4FX7A 4AZ5A 5GVJA 3PZNA 1S2AA 1Q6DA 1XLGA 2X30A 2XZ7A 4QG9A 3NO1A 3N14A 1JUEA 3VZXA 3B8UA 2XUCA 1CXIA 1KTBA 4A8LA 5CC6A 2JIWA 1XRSA 4DYJA 3BOFA 1WCGA 2VWSA 2ZBTA 3HG5A 2ZXAA 1CXFA 2GQ8A 4H9ZA 3CIWA 3IJDA 4HD5A 2NQ5A 2J7GA 2REQB 4CNSA 5DY3A 1WBHA 1PKLA 4DN1A 4CNTA 3LOTA 4CNNA 3CQJA 5A6LA 4H8VA 1W9XA 4XZBA 4M19A 1VF8A 1H7XA 3ITOA 4LBUA 5E09A 2QDHA 5CPMA 2VENA 3LBOA 4JEQA 4ZQPA 2CW6A 1W3TA 1HJVA 2FGLA 2F84A 5ECUA 5AN7A 5HA7A 4V1XA 3NZQA 4IMFA 2Z7KA 1XQKA 4H9XA 2QUTA 4NAEA 3L4WA 3RYSA 2NXHA 1OFRA 4UNKA 1SO3A 3TV8A 3TC6A 1YNPA 1MI3A 3TTYA 5DLCA 3OLIA 1KFBA 3BDKA 4ZODA 4M6PA 1GW1A 1KD0A 1W1PA 3CMGA 4G1NA 4IFOA 4KIRA 2Y7GA 2FDMA 1TVNA 1TR1A 4QITA 5I03A 1KC7A 3M6YA 5ENLA 4BWLA 3HM7A 1FHUA 4GX9A 4CD5A 3VD5A 1PWMA 4RV8A 1MW3A 2J77A 3FNDA 3O9NA 1I0DA 1LBFA 1H5YA 1U1UA 1DJHA 3BQ5A 2OELA 3KVJA 3NL3A 5I06A 1OC6A 1E3XA 3UPMA 1ITUA 1LDCA 4R3UA