3EA6A

Atomic resolution of crystal structure of sek
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
DIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQCNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin K
publication title Structural Studies of an Emerging Pyrogenic Superantigen, SEK
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ea6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ea6A01
1S5CD 5D3IB 5ELEA 1V1PB 2XN9C 1KLGD 3BVZA 4OHJA 1I4QA 1PYWD 1B1ZA 3BYTB 5FKAC 1UUPA 3MC0B 5ELCA 2O2LD 3V05A 2R61A 3SEBA 1B44D 1CQVA 1FNWA 1LO5D 4L6TB 1TY0A 4UDUC 5ELDA 1SJED 3R8BA 1LTGD 1D5MC 1SE2A 1V1OA 2WV6D 1CHPD 1S5DD 4RGOS 4RGMA 1FNVA 2XRSD 1TY2A 1LTBD 1PRTB 3MFGA 3W2DA 1RDPD 4RFBA 1XTCD 4RHRA 1BCPC 1PTOC 1SE4A 1SEBD 3DWAA 1LT4D 2AQ3B 1EWCA 3OWEB 1HA5A 1FGBD 1LLRD 1SXTA 2ICIA 2QILA 1FD7D 3DWPA 1I4XA 1KLUD 1LT5D 1F77A 1QILA 2NTTA 1EU4A 2RDHA 1JWUD 1M4VA 5ELFA 1FNUA 1EEID 5ELBA 1EEFD 4Z9CB 1LTSD 1PTOH 1D5XC 1SJHD 4RHSA 1TS2A 4RGNA 1SE3A 4RCOA 1STEA 1LTRD 4C56C 2IPKD 4BWGB 1HXYD 1PRTD 1MD2D 1PRTF 1PTOB 2CHBD 3R2TA 3DWQA 1I4HA 2NTSA 2J4XA 2Z8LA 2IJ0A 4O1NA 2AQ2B 1CHQD 1DJRD 4ZYSA 4K6LA 3BYYB 1RF2D 1JQYD 1JR0D 1ENFA 3BZDB 4DXGA 2AQ1B 1KTKA 5FK9C 3GP7A 1BXTA 1UNSA 1DYQA 1I4GA 1CT1D 1AW7A 1D6EC 1JCKB 1SBBB 3EA6A 3O13A 1YN4A 4RH6A 1ET6A 1S5ED 1PZID 1LT6D 5TSSA 4DXFA 3TSSA 3R2IA 1YN5A 1ET9A 1YN3A 1RD9D 1I4PA 1PZKD 1PRTC 3EFXD 1BCPD 1PTOD 1BCPB 3BVMA 3BVGA 1BCPF 1D5ZC 1L0XB 1JWSD 1PTOF 1V1PA 3URYA 1T5XD 1AN8A 1TS5A 3KLSX 4NZLB 1RCVD 1ESFA 2SEBD 1XXGA 2RDGA 1EU3A 1LT3D 1EFID 1CK1A 1HTLD 2TSSA 1S5FD 4RGTA 5D3DA 1I4RA 1G8ZD 1TS3A 1LTAD 4L63B 1S5BD 3CHBD 1JWMD 2G9HD 1HQRD 1GOZA 1TS4A 2QEJC 1L0YB 2XNAC 1LTID 2XRQD 4TSSA 1LTTD 1PZJD 5I4DA
chains in the Genus database with same CATH superfamily
1PGAA 2AMCB 1PXUA 4IUTA 1XPRA 2N0SB 2WB1E 3I3TB 3PSIA 4X62L 1HNWL 4LF9L 4NQLB 1NI3A 1B1ZA 2JN4A 3I3CA 4HROA 3TMPB 2PO4A 4B3SQ 2BS3B 2E5LL 1A3TA 3MC0B 3DBLI 3V05A 2R61A 2M17A 2EPBA 3FKIH 2M2LA 5K36G 1YIWA 4MEMA 2NYZD 1VQ5A 1N61A 3J7YW 2CU1A 1SJED 2HTHA 1NENB 1D5MC 4HEDA 1FNVA 1PQSA 1HJPA 5D65A 2HHHL 1O78A 3WCQA 1MFWA 2KHSA 3S15H 5G2NA 4DV4L 3W1GA 4J6IA 3ZNID 2N1WA 3H7PB 5L83A 4DK0A 1EWCA 2MW5A 3S2DH 3AEAB 1Y14B 1SYGA 5IGGA 5AEKB 4R4TA 4ZKCB 1WGDA 3PRMB 2XK5B 2LUEA 3UE0A 3U52E 5CMDA 2PVGC 1JWUD 3MXUA 3D4WA 2BH2A 3K5MA 4POFA 5JEAJ 4BXXG 1PTOH 2KHJA 4K6DA 4F87A 2PZUA 4FA6A 4XQJA 1STEA 2ZM6L 3S17B 1Y8NB 2F0TA 1RYJA 2QGQA 2INNE 3K9OB 3I56A 2Z1CA 4BBSH 1G2TA 3GV6A 1MD2D 1PRTF 2L11A 3GQBA 2JA7B 4GSWA 4C1NK 4ASWC 1WXVA 1ZDVA 1VQFA 3NUCA 3FMCA 4QQBX 5BN5A 1QQRA 3NS8A 4P7IA 4LF8L 2F4VQ 4YTMB 3DEPA 1XPOA 4HDQA 1Q10A 3M3JA 3OMCA 3R93A 2CW0C 3Q8AA 3NOBA 4W9LA 2R6GA 2Q2TA 1E22A 1UNSA 2OCEA 1DGSA 3NPPA 1LTLA 3EA6A 2W54A 1I6VC 2L9HA 3S1QH 4QUCA 2ASQA 3TEYA 4OIJA 1PZID 2LRUA 3RNAC 2WP8J 1JORA 1VCBA 1A2UA 2EXDA 1K8OA 3AYHB 1K8RB 1K8MA 3CCSA 4JWSC 3RLOA 1WMHA 2KVZA 2PZWA 3OWFA 4LF7Q 1A63A 2WXIA 3OHXC 3PV1A 4WJQA 2XEWA 1EWYC 4XZ4A 4TQ1A 4MN3A 3H7SA 4BZAA 4NAWA 1F2YA 3RUIB 2F0LA 1UWVA 4LK1C 3AE8B 3EUB2 1FGUA 1WSPA 2KTRA 4N59A 3W9CB 2KN4A 2PKOA 2DY8A 2VUMH 2MJDA 5J2RA 1JALA 4KI0A 4DNTB 2WXFA 4Y7NH 3A9JB 2WU2B 2D3GA 1TS3A 4XX5A 5DNFA 3OIPA 3AB5A 1HR0Q 2FJ2A 3GTJB 1J19A 1I6HH 1TS4A 4M8MA 4OZAA 4WAAA 2RGFA 4ITKA 5H92C 3M7NA 1ZYRD 4TSSA 1MHHE 1WTOA 3SHQA 5BYSA 5M5WH 1L0VB 2KXJA 3HOWB 1PFMA 2TMPA 4Q2JA 4X62Q 5C5LA 4LF9Q 1HNWQ 3A9KB 4A20A 4OHJA 3A0JA 2JA7G 2W82A 3PV0A 1XT9B 2KQ4X 1STBA 2E5LQ 1CKNA 3DBRI 4HKZE 4HVBA 2JUOA 1P7FA 1S1QB 2I5MX 1L5PA 1N6ZA 2RSUA 2MQJA 4NY0A 1KOTA 1LO5D 4L6TB 2NWGA 1P98A 3LB8C 4TV3A 3TP6A 3S1NB 4GKJL 2QSDA 4NJCA 1IP9A 1GUTA 3VYTA 1EFWA 3NHEB 4LK0M 2HHHQ 1STHA 1D2BA 4Y7NB 3PO2G 2GI9A 3PGZA 1XTCD 3I4LA 4DK3C 3H1UA 4JBMA 3AI5A 4OELB 3IFDA 4GS3A 4L5RC 4EE2A 1N34L 1HZ5A 2G3QB 4BS9A 1IYUA 4IOCA 1FCLA 4UAIA 5CV6A 4NPSA 3BK2A 1I6HB 1SXTA 2ICIA 4PG3A 3T1YQ 3RULA 3UQAA 1I4XA 2NTTA 4WJNA 3NELA 2H88B 2D11A 2D3BA 2QCPX 1SMXA 3SHLA 1D1KA 1ZP0B 2KDFB 1RIPA 4HJ7A 1GG3A 4B95A 5FLMG 3ALBA 1MJDA 2K3UA 2VS1A 5KYLA 2GA4B 1M90C 4W9FA 3NE5B 2ZM6Q 1WGRA 2QJLA 1S72A 5CGKA 4QCLA 2SNMA 3J81L 4CKBA 4BY7H 2VH2A 1WFYA 1PRTD 5M5YH 2IZVB 3J9CA 1I4HA 2KJXA 4DAVA 3N32A 3K80C 1V5TA 2UYZB 4FJVB 3BINA 1PMRA 3C0RB 1ICWA 1UWMA 3IL8A 1CKOA 4K6LA 4LF8Q 1RL2A 5EGTA 1GJXA 2A6ED 1ACCA 3LYYA 4YY3L 2K04A 1MG8A 2Y0SE 4ZRKA 3D0FA 3FC4A 3VRAB 2L12A 1JR0D 4DKAC 1VJKA 3H3VH 2Z0DB 3HZXA 4KVGB 3HOWG 2EDGA 1GHJA 3E3XA 3SK4A 2DAFA 3QA8A 4DDGD 3U7ZA 1D6EC 4LF6L 1WY8A 2KNBA 1RAXA 4YWLA 2C35B 4LUZA 4A3JH 1SFOB 1GHKA 4PYUA 1BDOA 1BOSA 1IBKQ 2J52A 3OJ3A 1FVIA 1J0GA 4LJZC 3VH4B 1H9RA 4C3IB 1EIFA 5IO9A 5EKLA 2KWUB 1FO4A 1XCTL 1V86A 3M85A 2K03A 2NPTB 3I9V1 2NVYH 4BY7B 3CU7A 3B9JA 4LNQA 1PGXA 1N8RC 5EJWA 3KLSX 2GOWA 1R9TB 3LJ3A 5JJIA 3KLSA 5L95C 1VQLA 2VW9A 4X3UA 4KHZA 2F3IA 4PZ8A 4W9CA 1SF0A 1J9OA 1YBYA 4X6AH 3JSVB 2BDNA 3NZSA 5G5GA 1CFMA 5LMNL 1WX8A 3A8IE 2ZTEA 2Q8IB 3ND8A 5J18A 2KN5A 4DAYA 4A3GH 3FKYA 3IRBA 4MACA 4N58A 2FCMA 1K9MC 2J42A 2A74C 3CCEA 4S0RA 3GTGH 4GN3B 3J81i 3L3OC 1V8CA 2KTFA 1HQRD 3J80c 2L52A 3H7PA 3PSEB 2XNAC 4JLCA 2EY6A 4L2YA 4CBVA 3IFWB 1SYBA 3A4RA 3L0WB 4A3JB 3J7A5 4LNNA 2D07B 4LF5L 3WAMA 1EIYB 2XK5A 4U673 1WJJA 1C79A 2L0CA 3HRDD 2LKVA 2RBMA 2WAQG 3S2HH 4TQ0A 3VRBB 4UPAA 2HCCA 4OO1H 3EN2A 2X6LA 2YU9B 2BQQA 2L0FA 4J3OD 1XJVA 4ULLA 5IP9G 1ZXHA 1BT0A 4GKJQ 1WTXA 1E1OA 5KHOA 2HUGA 2MQHA 5DM73 2E74C 3L13A 3APFA 3K6OA 3U9OA 4DV0L 1QE6A 2MFIA 4GNXB 1VDVA 2KX3A 3ER0A 1IHZA 4E71A 1EIGA 4HCEA 4HMIA 2K5PA 3ERQA 1B7YB 1A62A 1N34Q 2E2DC 5CV7A 4NJ6A 1L1OC 2WB1B 4A3GB 1YJ9A 4W9KA 4HAEA 4C3IG 2FCNA 1UE1A 2A69C 3U4VA 4LDTD 2JA6G 2DHZA 3U9SA 2AEHA 3QK0A 3MAQA 2KDMA 1NR2A 3K8AA 5T1IA 1LQBA 4PMBA 2PZTA 1O80A 4XXEA 4OL7A 4IW0A 1TYGB 2KA7A 2LVPA 3H3VI 1FJGL 2V4IB 2Z9HA 2X8XX 3PZDA 2KOXA 4J6HA 4RCNA 3JVZX 2R7ZH 3ZLZA 1Y8OB 2DBYA 1RWSA 4AYBG 1HZAA 1STGA 4JI4L 2DAJA 2HJ1A 3BDCA 1WI0A 1PFNA 3A55A 2RHQB 1NJIC 1TVXA 2KVMA 3PMFA 2ALYB 1D1IA 3DWQA 3V6CB 2J4XA 5CHWA 1E8XA 2ZXOA 1PFBA 3AM9A 5M3MH 2BW2A 2WX1A 3NVZA 1E0BA 1YHQA 1WRDB 4JL9A 3CPWA 2MP1A 4G7OC 2K25A 1IGCA 1N36L 4NPNA 2MCNB 4YY3Q 1NDDA 4DV2L 5HG2A 1PLFA 2KEEA 3ENEA 4X64L 4EQ5A 3B1LX 3STBC 1MGSA 1HEZE 1E2ZA 2PW5A 5FK9C 2OOBB 1XLOA 3A9JA 2YEPB 3O65B 4L23A 4LF6Q 2NVXB 2QDBA 4ZUJA 2PQEA 1VRAB 1WGHA 2N9KA 3AV8A 3T3OA 5CHVC 1YN4A 2B3GA 2EY1A 1S5ED 1VQDA 3PLVA 2V0GA 4GLAC 2D0OA 2L3ZA 4EVOA 1RD9D 5C0XI 3QWNA 3QWZB 5K5PA 1D5ZC 2N9LA 1EZ8A 1V5OA 4CQNA 2R7ZB 3N6RA 3U58A 3A9KA 4HSVA 3P1HA 1JJGA 4NQKE 1NNXA 1IW7C 3CPFA 1JOQA 3NJTA 1Z5SB 3S24A 4FJYA 4IC7B 1RCVD 3VR8B 4AJYB 3KFUA 2KZRA 5M3MB 5IP7G 3DLLA 3ZYYX 4YCUA 3L16A 3RZFA 4A3EG 2L5TA 4KKTA 4A3BH 4BY1G 3ZQ4A 2W3RA 3ULPA 5LMNQ 1IYJB 1GM5A 1HZBA 3E9SA 3RN2A 2IW3A 4ODGA 3TZUA 3SK5A 3IAM1 2D0PA 3NQTA 1Z7TA 1BUIC 3M63B 3ZXRA 3AMZA 4DR2L 3CCQA 2JYEA 3ERSX 4JI5L 3RMHA 1QNKA 1L0YB 1ZEQX 2LXKA 3PO3B 3E56A 5EE3A 2XRQD 3H6NA 2N7DA 1SAPA 3S16H 5NUCA 4LF5Q 1J7BA 2I1KA 2F0WA 1D3ZA 2N1VA 3GTQH 4XDXA 1B70B 1CZGA 1QJOA 2B2YC 3BYTB 1H8CA 1XNQL 1F2RI 4P71A 3H9DA 4LNOA 4HCSA 3G71A 4CKCA 1V43A 3ZO5B 3BY4B 4RM9A 3K81C 3F2BA 2LGYA 5HI1A 4V0BA 5IYBG 1V9PA 1WI5A 1D4BA 1PRTB 1C7YA 4YHHL 4DV0Q 2EY2A 4A3BB 4JI1L 3KW5B 4X66L 4OX9L 1BCPC 1X6OA 5E6JA 2F0PA 3CQZB 2PJHA 3TQYA 2OTJA 3NENA 2IY1B 1P9DU 2MHVA 2V4LA 4F8MA 1FD7D 1ICFB 4CDFC 1LFDA 2J7QB 1WX9A 2AUJD 1EU4A 2DJGC 1WCMH 3QC8B 1OEYA 4W9EA 1QOBA 1N62A 2MHJA 3OYYA 1PHJA 2ID0A 1Y8RC 1ENCA 1ZUD2 4J15A 1E5WA 4FVMA 3NVWA 1TBEA 1C4AA 1L2FA 2B29A 4M8NA 3LX0A 4C56C 4JI4Q 4KGSA 4IUUA 1HXYD 1Q3LA 3CRLC 2NVTB 5CYUA 4G57A 2MO0A 3UI2A 3ECIA 3NS1A 1EYAA 4LMQD 2MP2B 4B3TL 3A7LA 2WYQA 3R3OA 1I3QB 4C2MH 5I6YA 5JZEB 3LDZE 3DBSA 4P1BC 1N36Q 1YX6B 1Q1EA 3E9IA 4KKSA 2CJOA 4DV2Q 1ASYA 4IG7B 3TS2A 1RF2D 3PO3G 2VRRB 3ZJTA 5JOBA 4X64Q 4QY7A 4G7ZC 3FHWA 4IUQA 4K5VA 2NBUA 1X1MA 2ZCCA 1O7IA 3GP7A 5AUIA 4A3CG 5CBAE 4R9WA 2QF7A 3E5SA 4EZLA 3ZTCA 3Q6BA 3VR9B 1DD2A 2O4XA 1JB7A 2F0IA 5IGBA 2XWJB 1S40A 2IX1A 3P75A 3PF4A 5JJLA 5BR8L 1EL0A 1C78A 3B08A 2Z6KA 1VQAA 3JC66 3M7GA 3HOUH 4IFDH 3ZNHB 2CKZB 5FLXE 1B9RA 5C23A 1L0XB 1RTNA 3WWVA 1BMLC 2MJEA 3N20C 3I90A 2KMMA 1YNND 4C00A 2C7HA 2EJGC 1QOFA 1T9HA 3TN2A 2RPVA 3GB1A 2Y0SB 2I07B 1AFPA 4RNAA 4XT1B 5C44B 4DR7L 3PCOB 2JQRB 3B6YA 1E24A 1KRHA 2SEBD 2YTXA 4ID6A 4K5WA 2DJFC 3TMEA 3OMGA 1C3TA 1R4MB 1TKWB 3Q3OC 4R1JA 1CZWA 3GV3A 2ZT9C 1E9MA 2G9DA 2QDLA 3OOCA 4LF4L 3FPUB 5C3EH 2MBQA 3I4NH 1LTAD 3HOYG 2IX3A 2QDFA 2F0GA 4GNXA 1YITA 3AE4B 4YL8A 3ZW3A 1JWMD 2A4ZA 4QL5A 3VTUA 4DR2Q 3NQIA 1WE6A 1BBXC 4JI5Q 3DBHI 4I7ZC 1LTID 4YSXB 4HJ9A 3PIO3 2HT1A 2WXQA 1MIUA 3NXWA 3E0EA 3Q14C 1YQBA 4ZQ3A 2K9XA 1DONA 2IY0B 2KWVB 4XDCA 3U4EG 2SDFA 2JT4B 1XMOL 1X32A 3Q22A 1JRPA 2KLCA 3CCUA 1KDBA 3M4QA 2L1AA 3AU5A 3NG0A 4ANVA 2JYOA 2BA1A 4ANUA 1I42A 2ZTDA 2E2JB 1HHVA 3ZJYC 3I4OA 1Q1BA 3MZ5A 1AP0A 2GBJA 4YHHQ 4LFAL 1SYCA 2FMCA 4GKKL 4TQUS 4JI1Q 4RFBA 2VZKD 3NWSA 2HTME 3OW7A 2KWDA 4OIKA 4OX9Q 1IYVA 4BAXA 2WGSA 1TWAB 3UDIA 2NR2A 1STYA 2AQ3B 3HP3A 2MJ8A 2GVBA 1EUVB 4FADA 2EY5A 2B2WA 4A3IH 3RZOB 1A8VA 2RDHA 1K73C 4EFOA 1WXQA 4OVZA 1JW9D 4B9WA 3CF5A 3SR6A 1KDCA 5C44G 3JYUA 3ONSA 5GXGB 1JMCA 1SNDA 1XPUA 4RGNA 4IUVA 3I57A 4ICVA 4JYAL 3NVVA 1TU2B 1PH4A 2CCZA 1VD2A 3PO0A 2MBEA 4LFBL 3J81c 2IJ0A 4B3TQ 3M4OH 2B76B 5A35A 2DNCA 1N5WA 1GC6A 3P4SB 1NBWA 1L6UA 3Q2AC 4JG2A 5BN3A 3WDNA 4FNFA 1ZYRC 2WAQE 4QF4A 4HDOA 3JAMc 2INCC 4R4OA 4A3LH 3D31A 2L4NA 2BS2B 1STAA 2ZPNA 3S14B 2E8GA 2EVBA 3NZ3A 2O6VD 3VYSA 2M56B 1HQMC 2IL8A 3CCLA 2PPBC 4EEWA 1ZKOA 3RN5A 3SDZA 4KSKC 2IY5B 4REZA 1FPYA 4YXDB 1MSHA 1B3QA 1WJ6A 5BYRA 2ON8A 5EQ0A 3D8GA 4R4CA 1YMHE 2D5GA 1EQRA 1YJNA 4BXXH 1A0IA 2BYEA 2WS3B 2ZJDA 1SIJA 1V81A 3MEFA 5JVG3 2JXXA 2KJ6A 4IOAA 2CHXA 2N3SA 4GN4B 4JBKA 3HK0A 1LGRA 1E3PA 3H09A 1YEZA 2A5HA 1FR3A 1OXVA 3J80E 4DR7Q 1NVID 3W5UB 4CDEC 1ESFA 3M4OB 3HG9A 1LYLA 4JBWA 5A2QL 4GOCA 1FD6A 2TSSA 1MBYA 1WR1A 1Z2MA 4MHEA 1YHAA 4AYBE 4LJPB 1RM6C 4LF4Q 1JE4A 4K3CA 3HEJA 3WANA 5KNCA 3WOFA 2XVSA 2IGHA 2RCNA 1L6VA 3T51B 2X6GA 1C4CA 2KDEB 1QF6A 2B39A 5G3LF 2DYBA 3NP8A 3AFQA 4C7YA 4B3ML 2AX5A 2G5DA 3VR6A 1U4MA 4BKTA 2RHSB 4MIUA 5FKAC 4HMJA 1JMLA 3KUZA 5I4DA 1Q12A 4IJHA 5D3IB 2XN9C 4GLXA 3BZCA 2CWAA 1VQ7A 5C1ZA 4KDIC 4ZUIA 1XMOQ 1I4QA 2A6EC 2CJNA 2LUMA 1IL8A 2MNAA 4EGVA 3GTOH 3DBLB 1E8ZA 1SROA 3UDFA 2JP1A 4ZRJA 2GB1A 3EJIA 2C9WB 4H7BA 5CV8A 4E6IA 2BB6A 2CHWA 4KKJA 1XCQL 3PUVA 3IXSA 2BKFA 4LFAQ 4KSLC 4XTCS 4GKKQ 3ITPA 4KTAA 3TP8A 2D2QA 2MP2A 2ZJPA 1HFGA 3BG3A 1SE4A 4IOIE 1SEBD 4A3KB 5AZHA 3E9HA 2B2VC 3NRZA 3WAOA 4KHPL 4KZ0A 1WGGA 1WF9A 2KECA 2LASA 3S17H 3F2DA 5JVH3 1ILPA 4RF0A 1VQEA 4MZ9A 4K5XA 1P0RA 2LVQA 1XX8A 4FF4A 4E3CA 1QZGA 1H4RA 4JI6L 1V80A 4N9F4 2EIFA 3C1FA 1TS2A 3L0OA 3HOZB 2LI5A 4JYAQ 2JA7H 1Q1OA 1LTRD 4IWPA 1DGJA 3GTOB 2AWNA 2JA8G 1FMAD 2JYTA 3GS2A 3N1YC 4HWIB 4XWTA 1ZDXA 1QOHA 4WORA 4KY6A 1HRJA 3KUDB 4Y52H 2B2UC 4LFBQ 1HZ6A 4O1NA 1X55A 5CX3A 5KNDA 3ONAB 3CMAA 3QOLA 1EWHA 2M0AA 2Y5CA 1GUSA 1FXAA 4ZLTF 4ZRPA 3RZWC 1F2LA 4CDDC 1B4OA 1UE5A 3PO2H 3J7AV 1DXMA 3T1YL 4K2KA 4DUZL 2LJIA 3F2CA 4PV1C 1T0YA 1NR4A 1N63A 4DV3L 2K75A 1W3SA 2I5HA 2JQOA 3HM3A 3GZNB 5CR3A 4FN2A 2KHWB 4I6NB 1E7UA 1UELA 2AWOA 4POGA 2D62A 2L55A 3K7AB 3IAYA 3I5JC 2WFWA 1SYEA 2NN6I 5FLMH 1XF5L 4LNFA 4IO9A 4FYDA 2IGDA 1L1OB 4MM3B 1EYGA 1QVCA 2LXJA 1EO6A 1K52A 2ASBA 2LRWA 2PI2E 3VAWA 5C3JB 4M00A 1VQ9A 4IM2A 1Q5WB 3QJYA 3KVFB 3QHTA 4GGQA 1WWTA 2CU3A 3HHMA 4NZLB 2REXA 2XBBC 3NY5A 2PE9A 4A3KG 4A3DG 3GTLB 1PDQA 1EFID 4RGTA 2DZIA 4A3PA 3GTJH 2BS4B 3QAQA 1Q7YC 1WTRA 1SSNA 3Q0AA 5HFYA 1HTPA 1G8ZD 4FF1A 1VQKA 2PPHA 2WX0A 3QIJA 4DXAB 3PO2B 1IPGA 2JSOA 3HOWH 5G3LD 2Z0EB 4A3FB 1IBKL 1U5KA 1XO3A 4IUPA 1KD1C 2VZKB 3B0AA 4B3MQ 3H15A 2O2VB 3HOZG 1ESRA 1L4DB 3HVDA 3FVQA 3M9BA 5F2DA 2OTLA 4USAA 1TZOA 2N7EA 2HJ8A 4X3TA 4F8CB 4KJNA 4C3JG 1XD3B 3HM6X 4YCVA 3S1NH 4DK6C 3DBRB 3UIPB 4WRDA 3RD4A 1OXUA 3SEBA 1I50B 3K59A 3CCRA 2KC1A 2MBBB 3KDFB 3K5LA 1Y8PB 5IGDA 1KF6B 2MLBA 3QJZA 1WGKA 2WXNA 1WZ0A 1VQ4A 2RD0A 2N55A 3E6ZX 2NZ1D 4AS1A 1JT8A 5FR6A 3TJPA 2DYMA 5E6NA 2K8BA 2KQ7A 5M5XB 4L8JA 3VR3A 3U7DA 4TKOB 4KIKB 3MWYW 2F0OA 4ZKBB 5IWAL 1UZXB 2MWSB 1Z9FA 3EHVA 4PZ7A 3KYCD 2QKIC 3CCMA 3OWEB 4KHPQ 1KHIA 1EF1A 1X3GA 2QEXA 3ZTDA 1QILA 3BJUA 3FAHA 4QJFA 5LXIB 1X54A 2O6VB 1KRTA 4JI6Q 1SJHD 5EBDA 3RD2A 3A74A 3FILB 5KGUA 2WXRA 3FRPB 4RCOA 5D6JB 2WDRB 2KDBA 1VQHA 1E8YA 3MVVA 3ZRFA 1BBWA 1EWIA 2LY7A 5IP9H 2EOTA 2WIIB 4M1UB 4TVAB 2VQEL 3SK8A 4BKSA 3MJWA 1QOGA 1LXDA 3F2UA 1WYDA 4PYZA 2ZW1A 4IFDJ 4A3FG 3N1XC 5HGTA 1VQNA 1WM3A 2IDYA 3PUWA 4M8AA 5GQOA 5I9PA 3H8HA 3DVNU 5EE1A 1SFOH 4KK7A 4PMCA 4DUZQ 3ZRCA 5DLQE 1EQTA 4AWJA 2M4NA 4DV3Q 1BXTA 3RUZA 3O13A 2N78A 2BOSA 2C9OA 2OEOA 4C3IH 1OFFA 3V2TA 2JA6H 1RFKA 1VQOA 3UGBB 2J0KA 1RLFA 4XIGS 2ACZB 2K5HA 1WZ3A 1WTQA 3DHGC 2WKDA 3NHHA 5FR3A 1BCPB 3UF8A 3BVGA 2EYPA 2EXZA 1R9TH 2HDMA 1OQQA 1OXXK 2WAQB 1ZPSA 2F52A 4JQWC 1NBFC 4IQZA 3PIOA 3SE0A 2E6XA 3KYDD 4DK5A 3F8TA 3V6EB 1OXSC 3APDA 1HCZA 1R4NI 4F7XA 2BBCA 3JW0X 3R3MA 3IFTA 4JK1C 3RCZA 1OXTA 4MSMB 1Z47A 1CZPA 1VR9A 4A90A 1RJTA 2K7VA 4A76A 1RFAA 1VF5C 1BKBA 1PH9A 1LM0A 1WTVA 4ZYNA 4B3RL 3W1BA 2V4DA 1E8WA 3V60A 4DHJD 2L15A 2WACA 4WJ4A 2BH8A 4DN4M 2AL6A 4K0KL 1QB5D 1IXRA 4S3SA 4RMAA 2K6QA 1GPXA 2JA6B 4PQXA 1ZE3D 1KL9A 2GBNA 1NY4A 2ZZPB 3L10B 1JQ4A 4MTNA 2YU9H 2H89B 4LCDE 2K28A 4K1RB 5D94A 3I63C 2F3VA 3CMMB 3AEFB 4LTUA 4LW1A 3TCAA 2HIXA 3DCGA 2NZHA 2K1FA 2K5VA 2LGXA 4AYBB 1GUOA 1S3SG 5JAVA 4RAUC 3CAMA 2VB3X 2EE1A 1YD8U 4B9XA 5IGFA 3T53B 1SE2A 1M94A 1CHPD 3KOJA 1R4PB 2MA9B 4GU2A 3MJ5A 5IP7H 2IX0A 2BKRB 1FXIA 1B53A 1SYDA 4A3EH 2FAZA 3Q24A 3AU4A 2XGTA 3PZ7A 4WIPA 4BY1H 4EZJA 4XDDA 1FRDA 4RHRA 5IWAQ 5C6AA 1ENAA 2K4KA 4G7HC 1FIQA 5MPOA 1YNNC 3EQLC 1BNZA 1IBML 2KLGA 2I46A 2O5IC 3K9PB 1Q46A 1BR9A 4R4QA 1U4RA 5IT9c 1C8CA 1QKZA 3VTVA 5BMIA 2I0QA 4GMVA 2L00B 5DPWA 1NUCA 1F9QA 3JAME 2NVUI 5ELFA 1WVLA 3P2BA 5KRUA 1U0LA 4EQOA 4UP9A 3I91A 1Q81C 3OLMD 1BUVT 4K14A 4K7WA 3TP5A 2PW7A 2JXMB 2L0TA 1KQSA 4PK1A 5I2XA 1FRRA 3TDQA 2UUCQ 1SRUA 1KH0A 2L76A 4KV6A 4RA8A 3E0JA 4AIMA 2RDFA 1QZEA 1L1OA 3MHBA 5KIXA 4MM3A 2VQEQ 1PH2A 4WWMA 2CFMA 2PQAB 3UIOB 5DCNA 3DOWA 1IKLA 2FMMA 3IVFA 3K0XA 2JRIB 1CHQD 4RG1A 5IYBH 3IHPC 1PDXA 1DOYA 1SMYC 2NVXH 2J0MA 4A3EB 3PLUA 4F7ZA 4BY1B 1PUTA 2ZXPA 2A73B 2G4SA 1HUMA 3HOVG 4DXGA 1QLBB 2JA5G 2MBOA 4J8QA 1I4GA 1H9SB 2DENB 3WA0A 2BGFA 5JPNC 3I70A 3PTFC 3QARA 3CMEA 3PRPB 4ACFA 3PPAA 5CHFA 2L8JA 3R2IA 1J7AA 2JE6I 3G7LA 1YN3A 2O2VA 2OF1A 3A33B 1AZPA 3BVMA 1WYWB 1LUZA 1N32L 2R2QA 1UBIA 1SYFA 3OPOA 1K28A 2A68C 4FULA 5C4JB 4OVUA 4XYCA 5KEEA 1KXLA 1G291 2VY3A 4NDXA 1V9JA 2DY7A 1NCVA 1N5XA 1KRSA 1W2BA 1XXGA 1OQRA 2Y5PA 2HDEA 3S9WA 2KJRA 1KAAA 4BBNF 3MEHA 1WJNA 4HPMB 3VA7A 2Q5WD 1EY6A 4JC0A 1G6JA 3PO3H 2Q2HA 2UU9L 4HPPA 4B3RQ 1SE9A 3DPDA 1UGJA 2RKSA 4K0KQ 3HUIA 1A3VA 4A3CH 2X38A 4KIKA 1DOKA 1NMGA 1I7HA 4OGQC 2ZPYA 4R3DA 2BYTA 2X69A 5LLIA 4JPSA 4JV5L 4AP4C 1GUWA 4RMFA 1KDAA 3DMUA 1H9KA 2KC2A 2M1MA 3LGJA 5IYCG 3RPFC 3J7AF 3QX1A 4MJSB 4XWWA 1E2WA 1TT5B 4FDBA 1H9JA 1WM2A 2QCZA 3ZNZB 3QIAA 4C3HB 4AQYQ 1II3A 2NBWB 3GOEA 3MXPA 1SLJA 1JE5A 1FM0D 1J6QA 3QQ8B 4DHZE 2F1MA 2YTVA 3FILA 3VDYA 5AJ3L 1STNA 2NVQB 3M62B 4KGRA 3R8BA 3PF5A 4RGOS 1A15A 1A3UA 2QA4A 4OO1I 4OZCA 2EYMA 3CQZH 3MFGA 5E1FA 4MT5A 4JX1C 3T13A 3TEXA 5FJ8G 3VR2A 2E2IB 3A4SC 2R3ZA 5IIFA 1EIHA 2LEKA 1SB3C 2K8CA 2RSNA 4HSPA 5L37A 4DR4L 3TBIB 4OZBA 2B2YA 3HOYH 1SR3A 4O42A 1IBMQ 5C0XG 2BE5D 1RTOA 5T8IA 1SIFA 4CJ0B 4DGZA 1P16A 1YX5B 2WP9B 2C7NB 1KLUD 1GJZA 1J8CA 2KKCA 2LFNA 2FE8A 3DHQA 2NVTH 1Q90A 2WXMA 1GB1A 4JWUC 1Y1WG 2R2OA 1JB3A 3GE8C 1GB4A 4W9GA 4US9A 1I3QH 5BYQA 5D14A 1WJ4A 4BWGB 5LL6X 5IOCA 3CCVA 2KANA 3R2TA 2A1AA 2NTSA 3H0GG 1QCBD 1J5EL 2UXCL 2FUG1 2G1EA 5C4ZA 2OEDA 1YJ1A 4K7SA 4WURA 2RSOA 4ZYSA 1P8LA 5J3BA 3RN9C 4A6QA 2NBVB 3FPPA 4W9HA 2KQSA 5EKIA 1HNZL 3TUOA 5LXHA 5FLXL 4UY8C 3P63A 2NBFA 2W55A 3HOYB 3OJ4B 2QW7A 2GBRA 1J7CA 1G6PA 4FJZA 4HRSA 2IT1A 2NZOA 1TWCB 4C3HG 5IODA 3EC8A 4I65A 4M0WB 4DBGA 4EZKA 2JRHA 4HIMA 1KABA 1CKMA 1I4PA 3T3NA 2Q2IA 2VZAA 4AQ7A 5C44H 3CW2C 1PTOF 1VQCA 1N32Q 3CCJA 4BA2I 1PVOA 2NPTA 2UXDQ 3HOXB 2M19A 3URYA 1T5XD 1TS5A 2C7MB 3AEVA 1Q86C 2R92B 4R8IA 2BWFA 2PYKA 5J1ZA 5BO4B 4YWMA 2RQXA 4FP5D 1SNOA 2BB5A 4PS7A 5C4HA 4LNIA 3JSVA 2P5ZX 4OWTB 4DK1A 3TIXA 1S5FD 2ATWA 1EF5A 1NAPA 4CJ1B 2FCSA 2RA4A 3D4DA 4KLKA 5J22A 5EBCA 2UU9Q 3N3KB 3DVNV 3A56A 3UINB 2YYZA 2I1JA 3X23A 4NW2A 3A8JE 5JH5C 2SAKA 1YJWA 4KD3A 3OTOL 1GOZA 2OHFA 5IP4D 2BYFA 1ML0D 2VNUD 4JV5Q 3QB3A 3L08A 2N9EB 2LVOA 3U8ZA 2WXOA 1WR6E 2WINB 1KNEA 5CC4A 3MFYA 2LMCB 5IYDG 3AE3B 4ZCKA 1WRIA 2N7JA 3SR1A 2PNRC 4KDLB 2J0TD 3EIVA 4ZHPA 2E2JH 4ICUA 1UUPA 5LMUL 2F0QA 2BT6A 2JK8A 3MA2B 5E4XA 1B44D 3KJPA 5AJ3Q 1KFYB 2V1CC 4RKBA 1MG4A 2K14A 3RLFA 5AZFA 1F0ZA 2WXLA 1VDZA 4UDUC 3D6CA 2HD3A 2I38A 1WH3A 1N33L 1SNPA 1TWAH 2IYDB 3H3VC 2FHTA 2K6AA 2MUYA 1ISNA 5JEAG 2F0DA 4G3XB 2YVCA 3TBLD 2DX5B 4W9IA 1CA5A 1HE8A 1FFVA 2Y5BB 3HVZA 4JOIC 5IA7A 3RZOH 4DR4Q 3DWAA 1LT4D 2HQLA 4DV1L 3BWUD 1SMYD 1WXMA 3CSFA 3DM3A 4LDTB 4K81A 3AEGB 3DWPA 4NNJB 3HOXG 1V49A 1LT5D 1H9SA 1RHPA 4CDCC 1UBQA 4WJPA 3VHTC 4WJWA 1M4VA 2VQFL 2R92G 1LV9A 2KK8A 1FNUA 1EEID 3AE5B 5IGEA 1OEYJ 2MX2A 5COYA 1CM9A 3PUYA 4RHSA 2LJ5A 3DWGC 3BU2A 4HCPB 1YHBA 4X3KA 2IO0B 4K8JA 1W6KA 2DNFA 4FLHA 1SSOA 2E2HH 1K53A 2JU6X 4HCNB 3VYUA 2CHBD 1R4QB 1J5EQ 2UXCQ 3OAWA 4P16A 2A68D 2IHFA 1QZHA 1N60A 1WTHA 4CO7A 1VQ8A 5DPTA 2EQSA 2LS01 3S14H 3AULA 3PT2B 2D2CC 2R7FA 3BYYB 4XT3B 1WIAA 2LGSA 2WWZA 4G4KA 3CKIB 1HNZQ 4A4IA 4FXCA 3K7UC 1K8AC 3RR5A 1VF7A 3ULLA 1R4MI 1EY4A 1V6EA 3I73A 3VDZA 3CP0A 1F52A 2KCTA 2F0FA 3H6MA 1QWYA 1WGYA 4C1NI 4LFCL 3J80L 1HPCA 4P6VF 4RH6A 2KCMA 4ZRIA 1VQPA 4L5SA 2KBNA 4F1SA 5H1SE 3AQQA 3W1SC 1X56A 3EFXD 3CC2A 3Q8DA 2OXPA 1PTOD 1VQGA 2PI2A 5K36H 1AARA 2N9PC 1AH9A 3C46A 1EQVA 3RZDH 3TL5A 2FXQA 4DDID 2M0XA 4MJSA 1PH1A 2KHIA 3EBEA 1ZOYB 4IFDI 2JA8H 2E2HB 5JJZA 4DR6L 3M3YB 4NAWB 4IDIA 4GOPC 1SGHA 5GADC 2R93B 2Q8RE 1LT3D 4K8IA 4M02A 1F2RC 1Y1VB 2CH4W 2KENA 2KMAA 2G4DB 5LL6S 1TTNA 1QUQB 2MJ3A 4P73A 1NSNS 2JSVX 2Z59B 4BBRB 2AWTA 5GAEC 4JI0L 3A5UA 4IM0A 2G9HD 3OTOQ 3WAPA 4GDKB 5IKCM 1YVCA 2BF8B 4L5QA 2F3WA 4IM3A 4A93B 3HKZE 4A55A 1TKEA 1IZ6A 2KO3A 1ZW7A 3BVZA 4C7ZA 3Q6SA 3I55A 1K83B 3PUZA 2B63G 2R7DA 3G6JB 1DOLA 1YZ6A 5LMUQ 3RZDB 4CHTB 2JZPA 1PGBA 4LUVA 2FCQA 3HKSA 2BA0A 4A3MG 3A1QB 2JA8B 3AU7A 5IT9E 1N33Q 3D6WA 1YIJA 4A3KH 3J80i 2XRSD 1C77A 1JC7A 1RDPD 1CI3M 1V1QA 3I72A 4NXML 4QUFA 3AE9B 2HCIA 3QCAA 4JCVE 5FO8B 2EYOA 4IUMB 1TWGH 5EAYA 4DV1Q 4G50A 4KV2A 4AJWA 3ND9A 1T0QC 4UHVA 1LLRD 3NTHA 5DEHA 1Y56A 3AN1A 2XTIA 5M3FG 3HOZH 2KFKB 4DHZB 3R7QA 1GKHA 3M4PA 3U50C 2VQFQ 3NBHB 4KY5A 1Q8KA 2MRPA 3V3XA 1EEFD 4P2CB 3VA5A 4C3JH 2WU5B 4ZHOA 2KT7A 4IPHA 4JE3B 4M0WA 4US8A 2R93G 1E10A 2LFIA 3RNFC 3BDLA 2AL3A 2FBWB 2K22A 1NEKB 5KYIA 1TWHB 3DXJC 1Y1VG 1VZ7A 3P4PB 2YTYA 2JZ3B 3R66C 4M01A 3S1RB 3EROA 4NJ7A 2HQEA 5IGCA 3DVGY 2B2VA 4IUNA 1YQ4B 2Z6BA 3I4MG 4BBRG 3VYRA 1O7LA 2OT2A 4A3DB 2JPHA 2LHEA 3OG5A 2D10A 3WIMA 4JI7L 3AXCA 1AEXA 1ASZA 4H44C 4GB9A 5EDSA 2HE7A 1CQFA 1VMPA 4ILWA 2YLMA 3EGRA 4A93G 5CBEE 2E76C 3K7AH 1TWGB 1VQMA 3MHSD 2YEPF 1JCKB 3KYHC 1AE3A 3KBXA 4NXNL 1HNXL 4APVA 2VB2X 2ZEQA 5AUKA 4JI3L 2Q2UA 3RNCC 4LFCQ 2Z0SA 3C3LA 1C1YB 4KX6B 5TSSA 2B2UA 2B2TC 1VQBA 3UDXA 3MP9A 4B6WA 3W5VB 4JIOU 3GDEA 3I8ZA 3UI3A 3Q8BA 2V1YA 4C3JB 4GLVB 2LMCA 3MC9A 4DQOC 1I35A 1MJEA 3GTLH 2ZJRA 5KHQA 1Y69U 4DR6Q 1YJIA 2BYVE 2EKEC 3L7ZC 4NAMA 2HDLA 4JW0A 3S1MB 5JJKA 4DV7L 3PIP3 3ZVVA 2RF4A 4DA2A 5C4XB 4FHJA 5E7NA 4K7UA 3GO5A 1MJCA 3OSOA 5I2YA 3KUCB 4A3FH 4FXGC 1IKMA 1QVFA 4X3SA 2SOBA 3LWEA 5BMHA 3KWLA 1ZGUB 3CHBD 2PIAA 1HFNA 4OVVA 4JI0Q 2Z4HA 4IURA 4DAYB 4A3LG 2D9UA 3EFUA 4HK2A 4DUYL 1VCIA 2EYJA 4XQQA 1KIXA 1CMXB 1JWAD 4W9JA 1DOMA 4JGHB 4MTKA 3T1HL 2V3PA 2UUAL 4KJOA 1V1PB 4BOZB 4PZ6A 3VXWA 1I50H 3RI7C 2WDTB 3AE7B 1D7QA 4AH6A 1G51A 1F2MA 5D7GA 1UH6A 4FXDA 3SXHA 2VH1A 3CC4A 4C80A 2J53A 4LNKA 1BO0A 2Y3AA 1FNWA 2JVCA 2EELA 5M5XH 5E3FA 1GAQB 4ANWA 2B8GA 4B0EA 1M8AA 1M1KC 2K01A 2WV6D 2GRIA 3OIQA 2CQAA 1FL0A 1HH2P 2DGYA 3BIID 3W2DA 3FKIB 2W3SA 3SDLC 1C4QA 4NXMQ 2A5UA 5HY6A 2JF5A 3RNUA 4AOFA 3NTIA 1WTPA 3ZXVA 4GDLB 1F9JA 1H95A 2L05A 2NN6G 1VLBA 1HA5A 3GTPH 1FGBD 3S15B 2LZ6A 3Q3NC 4XE0A 2QILA 3APCA 1XLPA 2GBMA 4WH4A 3ZKJC 3AH7A 1CSPA 3FEWX 3KBGA 3S2DB 1YNJD 2KQ3A 5ELBA 3KWVA 3GZNI 4KKIA 1LTSD 1X9NA 5C4XG 5ELOA 3ZIMA 3VQIA 2PNHA 2JXTA 3B2GA 3C2PA 3PRZA 2GBKA 3PS6A 1EY9A 4TKNA 2PCFB 5D2MB 1C76A 1QNUA 4MGZE 1KC8C 1C9OA 1JICA 1PTOB 3M95A 3IKJA 4IPGA 3T9LA 1UE6A 3CXCA 4B9KA 1FCCC 1O7ZA 2M00A 1YNTE 2JWUA 1DJRD 2KCCA 1XEEA 3B2FA 2DZJA 4JI7Q 4BBSB 2KUMA 3RFZB 4BOSC 2CR5A 1K3BC 4YIJA 4WJ3M 2K8HA 3CF6E 3LXFA 1PYBA 3KLRA 1UEBA 1QUQA 4NXNQ 1HNXQ 2ZJQA 5FLXc 1RKNA 4JI3Q 4OWXB 2ICEC 4CKEA 2K5NA 3GTPB 5IAAC 2CVRA 4DR1L 1F1HA 4YWGG 1ET6A 3GE3C 4I7AA 4DXFA 3V62A 3W1YA 1VQJA 2DUDA 4GDKA 2K32A 4A75A 4DV6L 1QVGA 2UUCL 1F9SA 3S1QB 5M9OA 4QIWB 3DWMA 4A3OA 4K2LA 4GLSC 2AYOB 1T5EA 4PS3A 4CJ2C 3FKIG 4RKLA 3H94A 5C3WA 2UXBL 2BPSA 2N4FA 3Q8CA 1WD1A 3PVLA 3DEOA 2WXKA 4DV7Q 1R4NB 2BE5C 4PNYA 3NEMA 5I9OA 1FYCA 1NMFA 3Q3JA 1QG7A 3A1QA 5GAHC 3DUZA 3P4QB 3D32A 4HR7B 1MHXA 3PQIA 1QT9A 2BDOA 2FNJB 1HTQA 2PVOD 1I4RA 3L17A 1JROA 2UUBL 5C2TB 2ONQA 1E7VA 3QG1A 2UWQA 1IBLL 1Z6HA 3NZUA 2VUMB 1XLQA 1X3QA 3HOVH 2JA5H 4DUYQ 3L54A 1SNQA 4DV4Q 2FFKB 2CH4A 1F9PA 3AEBB 1NTGA 2L7RA 3GTKB 3T1HQ 2UUAQ 2PTLA 1K3RA 1AWDA 5JHAA 4KN7C 2KFKA 2JJQA 3G6EA 4U68A 3T8MA 4IN3A 2FIFA 1F2ZA 4IZ8A 4O2DA 2H5XA 3HRZC 1SDFA 3NBHA 4Q0FA 3IG3A 4FBJB 5M5WB 1X65A 1B9MA 4BBSG 4HIOA 1NI2A 3BZKA 1XNRL 1DM0B 2I5LX 2RMMA 3HFZB 2CS4A 4H0LC 3TEWA 1V2YA 3RNGC 2DN8A 2AHOB 3L4PA 3TRZA 1DZ1A 4FHKA 2N9XA 4EUTA 4V190 1VZ6A 3JAML 2WQYB 2A6HD 1WFQA 3MXNB 4ME3A 2RDBC 1L7YA 3HKZB 2OQ0A 3CRKC 3SVMA 1EY5A 1MPEA 2ZNVC 2YV5A 2E3TA 1PV4A 3HOVB 4KHVA 4UP7A 4KN4C 2JA5B 5LNK1 3C19A 3SK6A 3QOJA 1EY8A 4ZK9B 2WNMA 4MGIE 4Q5VA 4AQYL 1P1AA 4NP5A 4MGKE 4P74A 5IYCH 4BBNC 1D5XC 1ILQA 4KKUA 2IHEA 1SE3A 1KJTA 2G45B 4IALA 1T3QA 4IKGA 5EPLA 1C9FA 5C3XA 2DNEA 4ALPA 1E2VA 2M8SA 3SFEB 3KLWA 5HURA 1PH5A 2VUMG 5JHBA 1GVPA 5EPJA 2XWBB 1MI2A 4HN7A 5M5YB 3CD6A 3IAS1 4MDKE 5FJ8H 4C4VB 1HA6A 1ENFA 2EYFA 3X3NA 3J81E 3ZUNA 3FP9A 3ZDTA 2J7ZA 2PEAA 2AQ1B 1KTKA 2SNSA 2INPE 1TJEA 2XSCA 1DYQA 1AW7A 4OWWB 5C0XH 2DLBA 2FUHB 2L32A 1MSGA 2IGGA 4N9TA 4DR1Q 4IJLA 3VR5A 2HIVA 3KF8B 2ZCBA 5T1GA 5C4JH 4HTHA 5C5MA 1CSQA 1VZ8A 4BKGA 3AB9A 4DV6Q 1SE8A 4DR5L 4QMGA 1E6EB 2K5QA 4FF2A 2KYWA 3DHIC 3JAMi 1V1PA 1Y1WH 2LGDA 3K0YA 3CSTA 1EQQA 3DDCB 3AEEB 2UXBQ 1B3AA 3OW2A 2LGIA 3CIRB 2JY6A 4OEMB 3LWUA 2K0PA 1P3QU 2MH7A 5J17A 2BVCA 1TR5A 1TZ1A 3Q3MC 3H0GH 3HKZG 4DR3L 1WX7A 3T56B 2F0NA 1OGWA 2IO1B 3RT3B 2M9VA 2NVYB 1CK1A 4N8X1 4X65L 1TXYA 2JEAI 4IPDA 2CHZA 5D3DA 1BBUA 2NMQA 2E75C 4WWNA 2LXAA 2ES2A 2UUBQ 4DNIA 1IBLQ 1HR0W 2LSSA 1BQQT 3ZGZA 4JVZA 4HJGE 5ISRA 2DZKA 4CGYB 5J39A 1U4AA 3KF6B 1WE7A 1WTWA 1E90A 4OXPA 3QO2A 2K52A 4GDLA 4MELA 3W3AA 2OJRA 4ZDVA 4C3HH 2EMTA 2UXDL 4H2AA 4HIDA 3GTGB 1G91A 1L4ZB 3U30A 1VMCA 2NVQH 2FIDA 1K50A 2K1BA 5E4WC 2CW0D 3SGIA 3J81j 2PLPA 2WXJA 4DF7A 3BS1A 2EZVA 1MHWC 1Q0WB 4RF1A 4BY7G 1Y1WB 1ONLA 4P1CC 5ELCA 1E0ZA 1XNRQ 4AUQC 3KDFA 1GNUA 2QC8A 4KGTA 5CV4A 3VTWA 2QMTA 2E2IH 1DOIA 4J1MA 3TP7A 3Q8EA 3A8KE 4EX5A 3H0GB 1S5DD 4RGMA 3S2HB 1P7EA 2O5JC 5HHDG 2GLSA 1TY2A 3P20A 3AECB 2JZZA 4FXKC 4ZAIA 1T6BX 2PMZE 2F0UA 3V96A 5HGQA 1YI2A 2KACA 5CTRC 1FXTB 1PTOC 3ICEA 4N9PA 1PH8A 2N88A 1XTDA 3ZNGC 2WHIA 4GOPB 4YT0B 5CV9A 2MO1A 4A3JG 4WJOA 3VFKA 2ENBA 1WD0A 1XLNA 1UGMA 1A70A 1F77A 4N6EB 3W5OA 1IBXB 4HIKA 2O6VA 2ZW0A 1FFUA 4WQOB 1CA6A 3RNEC 4DU9A 3NSWA 3DHHC 4DNRB 5IYDH 1X3EA 1E7ZA 2QHOA 4I6PA 4YSZB 1RODA 2INDC 1GUAB 3U4ZA 2V3NA 1MI0A 2V9HA 1RRBA 1H9MA 3KH0A 1Q82C 3Q69A 1T0RC 4OW0A 4JI2L 2OJWA 3RYTA 2NUCA 3ZJUA 1TGZB 3WOEA 2PE6B 2EJFC 3P4RB 2C5CA 3D3RA 3I7FA 1CUKA 3C8YA 5JEAH 1JQYD 2EJMA 4YSYB 2WLBA 1TWCH 3VVWB 2WB1G 5FO7B 4A3GG 1OQYA 3PIPA 1F9RA 1EYCA 3M4YA 4BVUC 1S4ZA 4ANXA 4JI8L 4HJAA 5IOIA 2L1BA 1TKGA 3HOXH 3KJOA 3C1EA 1YN5A 2DWQA 2R92H 1U9RA 2DYOA 4DR5Q 1I94L 2JX5A 2EKIA 3A5ZB 1JOKA 3UQBA 3DM1A 5IN7A 5TR5A 2AUKA 5KNBA 4OO1G 3ABVB 4BKSD 1AN8A 1WOCA 3K58A 1XWEA 2CWPA 2CKHB 3TS0A 1A5RA 2KAJA 3X3MA 2NCNA 1UEAB 2KD0A 2K6DB 3P1MA 4XC2A 3K5NA 2F0KA 1ZKHA 4O0AA 4MH0E 4DR3Q 2A8VA 4ZRZA 2HD5B 1MKHA 4X65Q 3AE6B 3K5OA 3VR4A 3PREA 3MTSA 2KVRA 1U4LA 3N9YC 4HLEA 3UE1A 4DHJB 1X3PA 1IL2A 1A6XA 1IGDA 1L2NA 5CV5A 4YCWA 1MVKA 3MXNA 4I6LB 4P72A 4JPBW 4LUOA 1K8GA 5AFWA 5DPRA 4DWFA 2F4IA 2QEJC 3CC7A 4H13C 4QB4A 3EFCA 5DAUA 5BN4A 4II2B 1NE3A 3T16A 1S5CD 5ELEA 4KMUC 4XGAB 4GXBA 3RMKC 3G48A 4DAMA 1KLGD 3TEZA 3IBEA 1CJEA 1UAPA 1PYWD 1EY0A 2R7ZG 1EOTA 2VXWA 3S16B 2F0VA 1C48A 4IPCA 2J0JA 5BMGA 2NS5A 3AFPA 2VL6A 1B8AA 1FJGQ 3GTQB 4LLGM 1D8LA 3TREA 3G4SA 1WXSA 5HKHA 2N8NA 5ELDA 5M3MG 1K0SA 1IUEA 4HJKA 2WDVB 1V1OA 3NUHB 1TQOA 1VS0A 4G0NB 4LJOB 1PFDA 4D2KA 2K50A 5IY0A 4E74A 3NVYA 4MGYE 1GD7A 5DM63 2KJHB 4YTNB 4HJ8A 1KNAA 1SNCA 3DBHB 3AE1B 4W9DA 1V8QA 1T0SC 2C60A 1EM7A 1EYDA 3BDOA 2CQOA 2IBIB 3ML8A 4C4VA 5DPSA 1ROEA 2IO3B 3N1ZC 1BF4A 4CHKA 4QAYA 1YQ3B 1YNXA 1PA6A 1W6JA 1KAWA 1R7SA 2BCOA 2WDQB 3LNNA 3IT6B 4ARCA 2A19A 2FINB 3QR8A 2KDIA 3MHZA 4A8XC 3KF8A 1ZXTA 2B8FA 1HZCA 2K5DA 2NB0A 3AEDB 1OO9B 2C5LC 2OQKA 2JWZA 2B63H 1WCMB 3N30A 5FOBB 3HIZA 4MH8A 4JOIA 4GZYC 1TIID 4R8NA 1KM7A 2LD9A 3I2ZA 2MSED 2PQAA 4A3MH 3F1ZA 4JI2Q 3GTMH 5EE9A 2KMCA 2Z6KC 4H02A 2AQ2B 1KLVA 3TEHB 2F0JA 4F88A 4A3BG 4B0MA 4IWOA 1A2TA 2GN5A 1AYFA 4GIVA 5EKKA 4MNOA 4B08A 4C2MB 1G6ZA 2I2YA 4DV5L 1SNMA 2ZVOA 1CT1D 3TZDA 4A9AA 3A54A 2F0EA 4LWCA 4JI8Q 5LHY1 3X0WA 2JEBI 1OTRB 1K51A 1YJJA 1PYSB 1LT6D 5EPKA 5M3FH 3TSSA 2WKCA 3KF6A 4DPGA 1L0WA 2H1EA 4PMWA 1I94Q 1PZKD 3M3YH 1NYQA 1E7PB 4LAAA 4XYOA 4GNXC 1BCPF 4KD4A 5GROA 1JWSD 4TRDA 3KQ4A 1WYGA 3P7JA 1N9WA 2R93H 1JJCB 4QIWE 4BFRA 1TT2A 1U4PA 2B63B 1PH6A 2A69D 5GAGC 1O7YA 1Y1VH 3HOUB 4UP8A 1XNQQ 2WXGA 3IT4B 4A3MB 3GTMB 3T4AC 2DZMA 1GC7A 2OWOA 2RDGA 1EU3A 3I4MH 4BBRH 1HTLD 3HGBA 3CWIA 3SD5A 3MXGA 3ULJA 5LMNW 4ZRQA 1EOVA 1YNJC 5CORA 1LM8B 4WQMA 3W1SA 4II3B 4QGUA 4WFN3 1VQIA 4L63B 1S5BD 1XMQL 3RNBC 4XYQA 1EUJA 4A93H 2QIEB 3VUXA 3R7RA 2F0SA 3A7AB 4X66Q 1C4PA 2WXHA 4HEA1 2B3AA 1GO3E 4PS8A 4HKQA 3VUWA 5C3EB 1K83H 4DFAA 1WCMG 5IT9L 1LTTD 3I4NB 1WMHB 4GOPA 2PW9A 4RM8A 2H4OA 5M3FB 3MC8A 3U2SC 3EVQA 3DVGX 2W9NA 1QOAA 2K05A 1JJ2A 2RR9A 4DAPA 1XYIA 1IBXA 2BWES 3STBD 3NTKA 4S17A 1HTOA 4EKUA 2D5DA 1TWFH 2F0HA 2Y0SG 4B3SL 2KTRB 3PGEA 2O2LD 4EOYA 4PT5A 1ZXIA 1C0AA 2B2WC 1JRUA 1CQVA 1B50A 2ZVNA 3ML9A 1WJUA 1LACA 1TY0A 3SU8X 1LTGD 5I6WA 2EYHA 3S2AA 3PHXB 1CTMA 2KOLA 4OONA 4ABNA 3I4MB 1LTBD 4URKA 1S3OA 4K3BA 1J8IA 2JA9A 5FO9B 2PMVA 1GXDC 4TMAB 4TUUA 2ZXRA 4FF3A 1OTCA 3NK9A 1PH3A 1IW7D 3D4RA 1GUGA 3L2PA 2IWHA 4GN1A 3J7ZC 1SN8A 4KZCA 2LXCA 4IFDG 1TWHH 3SFDB 3HOUG 4IWQA 1G2SA 4RWSC 5EE0A 1CKNB 1JOOA 4BA1I 4ZOHC 4Z9CB 4R4IA 3S1RH 4A3IB 2K5WA 5BR8Q 3WALA 3GD7A 1IYFA 2IPKD 1AZQA 1TWFB 4A3DH 5C0XJ 3NBIA 2PMZB 4KY7A 3KK7A 2WXPA 4WWOA 1BVSA 1WXAA 2V3SA 2Q8TA 2Z8LA 4EQNA 4XQNA 2LWPA 1HZ9A 5IE8A 2KWCA 1EZ6A 2LHDA 2KX0A 3BK1A 4G11A 4NKLA 1X3FA 3H91A 4WWPA 2MGSA 2F4VL 3EECA 4GN5A 2D3CA 5E6OA 3Q8FA 5JXVA 3ZJVA 2KFJA 5C3EG 1VQ6A 3BZDB 3I4NG 4JBJA 5ELNA 1FEHA 3AE2B 5G5HA 3UDGA 1GUNA 5JPMC 4DV5Q 1EY7A 1E1TA 1XQQA 3AMUA 2IO2B 4NB3A 3RLNA 3PUXA 2D3AA 4L1BA 1SBBB 2MBHA 1UF0A 2RVLA 2NN6H 3ETRA 2N49A 4X57B 3Q23A 4EQPA 2EYLA 2KEDA 3GTKH 1NYRA 1TKYA 5AZGA 2GVAA 4ME5A 2AKWB 4HJ5A 1ET9A 1UWXA 1PRTC 4YWKA 1BCPD 2MPMA 3S1MH 3DQVA 4MSQB 2L83A 3V61A 2RPQA 4LF7L 5C4XH 4YTPB 2ZNVB 5G55A 2A6HC 2XIWA 2EMSA 2GMIC 3Q3FA 2KCNA 1UD7A 5H8YE 1PFSA 1DCZA 1V97A 4ARIA 4NMZA 4FO2A 2MEKA 4P75A 3PHWB 1Q8IA 2K39A 4HPLB 3K57A 1I5FA 1PH7A 2BTEA 3N52A 1AE2A 3VUYA 1K0RA 5GMVA 4HXDA 2B2TA 2RCFA 2K33A 3HS0C 3KUPA 4CYEA 5E6PA 1YOVB 1JWBD 1TIFA 2Z4IA 4N8FA 1XMQQ 1B9NA 1B2TA 1HR0L 3FDTA 3PZ8A 2F03A 3MTNB 2UU7A 3P42A 3VH3B 3NWTA 4A3IG 1UE7A 2ZTCA 1HUNA 5A2QE 3ZDMC 4WAFA 4L5TA 1DOXA 1LABA 1PZJD 2F0MA 3L9AX
chains in the Genus database with same CATH topology
1PGAA 1PXUA 4IUTA 2N0SB 1NI3A 1B1ZA 3I3CA 4HROA 2PO4A 2BS3B 1A3TA 3MC0B 3V05A 2R61A 2EPBA 5K36G 2M2LA 2NYZD 1N61A 3J7YW 1SJED 1NENB 1D5MC 4HEDA 1FNVA 5D65A 1O78A 3WCQA 2KHSA 4DK0A 1EWCA 3AEAB 1SYGA 5IGGA 4ZKCB 3U52E 5CMDA 2PVGC 1JWUD 3MXUA 3D4WA 3K5MA 5JEAJ 1PTOH 4K6DA 4F87A 2PZUA 4XQJA 1STEA 3S17B 1Y8NB 2F0TA 1RYJA 2INNE 2Z1CA 1G2TA 3GV6A 1MD2D 1PRTF 2L11A 3GQBA 2JA7B 4C1NK 1ZDVA 3NUCA 1QQRA 3FMCA 4YTMB 5BN5A 3DEPA 1Q10A 3OMCA 3R93A 2CW0C 3Q8AA 2R6GA 1UNSA 3NPPA 3EA6A 2W54A 1I6VC 2L9HA 4QUCA 3TEYA 4OIJA 1PZID 2WP8J 1JORA 1A2UA 1K8OA 1K8MA 4JWSC 2PZWA 3OWFA 2WXIA 3OHXC 1EWYC 4TQ1A 4MN3A 1F2YA 2F0LA 4LK1C 3AE8B 3EUB2 1WSPA 4N59A 3W9CB 2KN4A 2PKOA 2DY8A 2MJDA 1JALA 4KI0A 4DNTB 2WXFA 2WU2B 1TS3A 5DNFA 3OIPA 3AB5A 2FJ2A 3GTJB 1TS4A 4OZAA 4ITKA 5H92C 3M7NA 1ZYRD 4TSSA 1MHHE 1WTOA 5BYSA 1L0VB 3HOWB 1PFMA 2TMPA 4Q2JA 5C5LA 4OHJA 2W82A 3PV0A 2KQ4X 1STBA 4HKZE 1P7FA 1L5PA 1LO5D 4L6TB 2NWGA 3LB8C 3TP6A 3S1NB 2QSDA 4NJCA 1GUTA 3VYTA 4LK0M 1STHA 1D2BA 4Y7NB 2GI9A 1XTCD 3I4LA 4EE2A 3IFDA 1HZ5A 4BS9A 1IYUA 1FCLA 4UAIA 5CV6A 3BK2A 1I6HB 1SXTA 2ICIA 1I4XA 2NTTA 2H88B 2QCPX 3SHLA 1D1KA 1ZP0B 2K3UA 5KYLA 2GA4B 3NE5B 2QJLA 5CGKA 4QCLA 2SNMA 3J81L 4CKBA 1PRTD 3J9CA 1I4HA 2KJXA 4DAVA 1PMRA 1ICWA 1UWMA 3IL8A 4K6LA 3LYYA 5EGTA 1GJXA 2A6ED 1ACCA 3VRAB 2K04A 3FC4A 2L12A 1JR0D 1VJKA 3HZXA 2EDGA 1GHJA 3SK4A 3U7ZA 1D6EC 1SFOB 1GHKA 1BDOA 1BOSA 2J52A 4LJZC 1H9RA 4C3IB 5EKLA 1FO4A 1XCTL 3M85A 2K03A 3I9V1 4BY7B 3CU7A 3B9JA 1PGXA 5EJWA 3KLSX 1R9TB 3KLSA 4X3UA 4KHZA 1SF0A 1J9OA 2BDNA 5G5GA 1CFMA 3A8IE 2Q8IB 3ND8A 4DAYA 4MACA 4N58A 2J42A 2A74C 3L3OC 1V8CA 1HQRD 2L52A 2XNAC 2EY6A 4L2YA 4CBVA 1SYBA 4A3JB 4U673 1C79A 2L0CA 3HRDD 2LKVA 2RBMA 4TQ0A 3VRBB 4OO1H 2HCCA 4J3OD 2X6LA 2YU9B 4ULLA 1ZXHA 1WTXA 2HUGA 5DM73 2E74C 3K6OA 3U9OA 1VDVA 1QE6A 1IHZA 1EIGA 4HCEA 4HMIA 2K5PA 3ERQA 2E2DC 5CV7A 2WB1B 4A3GB 4HAEA 4C3IG 2A69C 3U9SA 3MAQA 2KDMA 1NR2A 5T1IA 4PMBA 2PZTA 1O80A 4XXEA 4OL7A 1TYGB 2KA7A 2V4IB 4J6HA 4RCNA 1Y8OB 2DBYA 1RWSA 1STGA 3BDCA 1PFNA 3A55A 1TVXA 2KVMA 3PMFA 1D1IA 3DWQA 2J4XA 3AM9A 2ZXOA 1PFBA 3NVZA 2BW2A 1E0BA 2MP1A 4G7OC 1IGCA 5HG2A 1PLFA 2KEEA 1MGSA 1HEZE 1E2ZA 2PW5A 5FK9C 4L23A 1XLOA 2YEPB 2NVXB 2QDBA 4ZUJA 2PQEA 1VRAB 3AV8A 2N9KA 3T3OA 1YN4A 2EY1A 1S5ED 2V0GA 4EVOA 1RD9D 5C0XI 3QWNA 5K5PA 1D5ZC 2N9LA 1EZ8A 4CQNA 2R7ZB 3N6RA 4HSVA 3P1HA 1IW7C 1JOQA 1RCVD 3VR8B 5M3MB 3ZYYX 2L5TA 4KKTA 3ZQ4A 2W3RA 3E9SA 2IW3A 4ODGA 3TZUA 3SK5A 3IAM1 3NQTA 1Z7TA 1BUIC 3AMZA 2JYEA 4YSZB 3RMHA 5EE3A 1QNKA 1L0YB 1ZEQX 3PO3B 3E56A 2XRQD 1SAPA 5NUCA 1J7BA 2F0WA 4XDXA 1CZGA 1QJOA 2B2YC 3BYTB 1F2RI 4HCSA 4CKCA 1V43A 5HI1A 4V0BA 1D4BA 1PRTB 2EY2A 4A3BB 1BCPC 5E6JA 2F0PA 3CQZB 2MHVA 4F8MA 1FD7D 2AUJD 1EU4A 1QOBA 1N62A 2ID0A 1ENCA 1ZUD2 4FVMA 3NVWA 1C4AA 3LX0A 4C56C 4KGSA 4IUUA 1HXYD 1Q3LA 3CRLC 2NVTB 5CYUA 4G57A 3UI2A 3NS1A 1EYAA 4LMQD 3A7LA 3R3OA 1I3QB 5I6YA 1Q1EA 4KKSA 2CJOA 1RF2D 3ZJTA 5JOBA 4G7ZC 4IUQA 4K5VA 3GP7A 5AUIA 5CBAE 4R9WA 2QF7A 3E5SA 3VR9B 1DD2A 2O4XA 2F0IA 5IGBA 2XWJB 2IX1A 1EL0A 3P75A 1C78A 3M7GA 4IFDH 5FLXE 1B9RA 1L0XB 1RTNA 1BMLC 2MJEA 3I90A 2KMMA 1YNND 2EJGC 1QOFA 3TN2A 3GB1A 2RPVA 2Y0SB 2I07B 1AFPA 4RNAA 4XT1B 5C44B 2JQRB 1KRHA 2SEBD 4ID6A 4K5WA 3TMEA 3OMGA 1TKWB 1CZWA 3GV3A 2ZT9C 1E9MA 2G9DA 3OOCA 4A9AA 3FPUB 1LTAD 3AE4B 2IX3A 2F0GA 1JWMD 3NQIA 1BBXC 4I7ZC 1LTID 4YSXB 3PIO3 2WXQA 3NXWA 4ZQ3A 2K9XA 1DONA 4XDCA 3U4EG 2SDFA 1X32A 3Q22A 1JRPA 1KDBA 2L1AA 2JYOA 2BA1A 2E2JB 1HHVA 1Q1BA 3MZ5A 1AP0A 1SYCA 2FMCA 4TQUS 4RFBA 2VZKD 3NWSA 2HTME 3OW7A 2KWDA 4OIKA 1IYVA 1TWAB 1STYA 2AQ3B 3HP3A 2MJ8A 2EY5A 2B2WA 3RZOB 2RDHA 1WXQA 4OVZA 1JW9D 4B9WA 3SR6A 1KDCA 5GXGB 1SNDA 4RGNA 4IUVA 3I57A 3NVVA 1TU2B 3PO0A 2B76B 2IJ0A 5A35A 2DNCA 1N5WA 3P4SB 1L6UA 5BN3A 3WDNA 4FNFA 1ZYRC 4QF4A 3D31A 2L4NA 2BS2B 1STAA 3S14B 2EVBA 3NZ3A 3VYSA 2M56B 1HQMC 2IL8A 2PPBC 1ZKOA 3SDZA 4REZA 4YXDB 1MSHA 5BYRA 2ON8A 5EQ0A 3D8GA 1YMHE 2D5GA 2WS3B 1SIJA 5JVG3 3H09A 2A5HA 3J80E 1FR3A 1OXVA 1NVID 3W5UB 1ESFA 3M4OB 3HG9A 5A2QL 4JBWA 1FD6A 2TSSA 1MBYA 4MHEA 1RM6C 1JE4A 3HEJA 5KNCA 3WOFA 2XVSA 2IGHA 1L6VA 3T51B 2X6GA 1C4CA 1QF6A 2B39A 5G3LF 3NP8A 4C7YA 2AX5A 3VR6A 1U4MA 4MIUA 5FKAC 4HMJA 1JMLA 5I4DA 1Q12A 5D3IB 2XN9C 4ZUIA 1I4QA 2A6EC 2CJNA 2LUMA 1IL8A 4EGVA 2JP1A 2GB1A 3EJIA 4H7BA 5CV8A 4E6IA 2BB6A 4KKJA 1XCQL 3PUVA 3IXSA 4XTCS 3ITPA 4KTAA 3TP8A 1HFGA 3BG3A 1SE4A 4IOIE 1SEBD 4A3KB 2B2VC 3NRZA 2KECA 5JVH3 1ILPA 4RF0A 4K5XA 1XX8A 4FF4A 3C1FA 1TS2A 3HOZB 1LTRD 1DGJA 3GTOB 2AWNA 1FMAD 2JYTA 3GS2A 4XWTA 1ZDXA 1QOHA 4WORA 4KY6A 1HRJA 2B2UC 1HZ6A 4O1NA 5KNDA 3ONAB 1EWHA 3QOLA 2M0AA 2Y5CA 1GUSA 1FXAA 4ZLTF 4ZRPA 1F2LA 1B4OA 3J7AV 1DXMA 2LJIA 4K2KA 4PV1C 1NR4A 1N63A 5CR3A 2AWOA 2D62A 2L55A 3K7AB 3IAYA 1SYEA 2NN6I 1XF5L 4FYDA 2IGDA 4MM3B 1K52A 5C3JB 3QJYA 1WWTA 2CU3A 4NZLB 3GTLB 1PDQA 1EFID 4RGTA 2BS4B 1WTRA 1SSNA 3Q0AA 5HFYA 1HTPA 1G8ZD 4FF1A 3PO2B 2JSOA 5G3LD 4A3FB 1XO3A 2VZKB 4IUPA 3HVDA 1ESRA 1L4DB 3FVQA 5F2DA 4USAA 1TZOA 4X3TA 4KJNA 4C3JG 4WRDA 3RD4A 1OXUA 3SEBA 1I50B 3K59A 3K5LA 1Y8PB 5IGDA 1KF6B 1WGKA 2WXNA 2N55A 3E6ZX 2NZ1D 4AS1A 2DYMA 5M5XB 4L8JA 3VR3A 4TKOB 3MWYW 2F0OA 4ZKBB 2QKIC 3OWEB 1QILA 3FAHA 1SJHD 5EBDA 3FILB 5KGUA 2WXRA 3FRPB 4RCOA 2WDRB 3MVVA 2LY7A 2EOTA 2WIIB 4M1UB 3SK8A 1QOGA 3F2UA 2ZW1A 4IFDJ 5HGTA 2IDYA 3PUWA 4M8AA 5I9PA 3H8HA 5EE1A 4KK7A 4PMCA 1EQTA 1BXTA 3RUZA 3O13A 2BOSA 2C9OA 2OEOA 1OFFA 3V2TA 1RFKA 4XIGS 2ACZB 1WTQA 2WKDA 3NHHA 5FR3A 1BCPB 3BVGA 2EYPA 2EXZA 2HDMA 1OQQA 1OXXK 2WAQB 1ZPSA 4IQZA 3SE0A 2E6XA 1OXSC 1HCZA 4F7XA 2BBCA 3IFTA 4JK1C 1OXTA 1Z47A 1CZPA 1VR9A 4A90A 1RJTA 2K7VA 1VF5C 1WTVA 2V4DA 2WACA 4DN4M 1QB5D 4S3SA 1GPXA 2JA6B 4PQXA 1ZE3D 1JQ4A 2H89B 2K28A 2F3VA 3AEFB 4LTUA 4AYBB 1GUOA 5JAVA 4RAUC 2VB3X 2EE1A 4B9XA 5IGFA 3T53B 1SE2A 1CHPD 1R4PB 3MJ5A 4KX6B 2IX0A 1FXIA 1B53A 1SYDA 3PZ7A 3Q24A 4WIPA 4XDDA 1FRDA 4RHRA 5C6AA 1ENAA 4G7HC 1FIQA 5MPOA 1YNNC 3EQLC 1BNZA 2I46A 2O5IC 1BR9A 1U4RA 1C8CA 1QKZA 5BMIA 1NUCA 1F9QA 3JAME 5ELFA 1WVLA 5KRUA 4EQOA 3I91A 1BUVT 4K14A 3TP5A 2PW7A 2JXMB 5I2XA 1FRRA 3TDQA 1KH0A 4KV6A 4RA8A 3E0JA 2RDFA 3MHBA 5KIXA 4WWMA 1IKLA 2FMMA 1CHQD 1PDXA 1DOYA 1SMYC 4A3EB 4BY1B 1PUTA 2ZXPA 2A73B 1HUMA 4DXGA 1QLBB 4J8QA 1I4GA 1H9SB 5JPNC 3I70A 3R2IA 1J7AA 2JE6I 3G7LA 1YN3A 2OF1A 1AZPA 3BVMA 1SYFA 3OPOA 2A68C 5C4JB 5KEEA 1G291 4NDXA 2DY7A 1NCVA 1N5XA 1XXGA 1OQRA 2Y5PA 2HDEA 3S9WA 1KAAA 3MEHA 3VA7A 2Q5WD 1EY6A 1UGJA 2RKSA 3HUIA 1A3VA 2X38A 1DOKA 1I7HA 4OGQC 4R3DA 2BYTA 2X69A 4JPSA 1GUWA 1KDAA 3DMUA 1H9KA 3RPFC 3J7AF 4XWWA 1E2WA 1H9JA 3QIAA 4C3HB 1II3A 3MXPA 1FM0D 2F1MA 3FILA 2NVQB 1STNA 4KGRA 3R8BA 4RGOS 1A15A 1A3UA 4OO1I 4OZCA 2EYMA 5E1FA 3MFGA 3TEXA 4MT5A 4JX1C 3T13A 3VR2A 2E2IB 2R3ZA 5IIFA 1EIHA 2LEKA 1SB3C 2RSNA 4HSPA 3TBIB 4OZBA 2B2YA 4O42A 5C0XG 2BE5D 1RTOA 5T8IA 4CJ0B 4DGZA 2WP9B 1KLUD 2LFNA 2FE8A 3DHQA 1Q90A 2WXMA 1GB1A 4JWUC 1JB3A 1GB4A 4US9A 5BYQA 5D14A 4BWGB 5LL6X 5IOCA 3R2TA 2NTSA 1QCBD 2FUG1 2G1EA 2OEDA 5C4ZA 4WURA 2RSOA 4ZYSA 4A6QA 3FPPA 5EKIA 3TUOA 5FLXL 3P63A 2NBFA 2W55A 3HOYB 1J7CA 4HRSA 2IT1A 1TWCB 4C3HG 5IODA 4I65A 1KABA 1I4PA 3T3NA 4AQ7A 1PTOF 4BA2I 3HOXB 2M19A 3URYA 1T5XD 1TS5A 2R92B 4R8IA 2PYKA 5J1ZA 2RQXA 4FP5D 1SNOA 2BB5A 5C4HA 4DK1A 1S5FD 1NAPA 4CJ1B 2RA4A 3D4DA 5J22A 5EBCA 3A56A 2YYZA 4NW2A 3A8JE 2SAKA 4KD3A 2OHFA 1GOZA 1ML0D 2VNUD 3QB3A 2WXOA 2WINB 1KNEA 5CC4A 3MFYA 2LMCB 3AE3B 1WRIA 2N7JA 3SR1A 2PNRC 2J0TD 4ZHPA 1UUPA 2F0QA 2BT6A 5E4XA 3MA2B 1KFYB 1B44D 2MEKA 4IDIA 4RKBA 3RLFA 1F0ZA 2WXLA 1VDZA 4UDUC 3D6CA 2I38A 1SNPA 3H3VC 2FHTA 2K6AA 2MUYA 5JEAG 2F0DA 1CA5A 3HVZA 1FFVA 3DWAA 1LT4D 3BWUD 1SMYD 3AEGB 3DWPA 1LT5D 1H9SA 1RHPA 4WJWA 1M4VA 3AE5B 1LV9A 1FNUA 1EEID 5IGEA 5COYA 1CM9A 3PUYA 4RHSA 3DWGC 4X3KA 4K8JA 1W6KA 1SSOA 1K53A 2JU6X 3VYUA 2CHBD 1R4QB 4P16A 2A68D 1N60A 2LS01 2D2CC 3BYYB 4XT3B 4G4KA 3CKIB 4FXCA 1VF7A 1EY4A 3I73A 2F0FA 3H6MA 1QWYA 4C1NI 3J80L 4P6VF 1HPCA 4RH6A 3EFXD 2OXPA 1PTOD 5K36H 3C46A 1EQVA 1ZOYB 4IFDI 2E2HB 4NAWB 5JJZA 3M3YB 2R93B 2Q8RE 1LT3D 4K8IA 1F2RC 1Y1VB 5LL6S 2MJ3A 1NSNS 4BBRB 2G9HD 4GDKB 2F3WA 4A93B 4A55A 1TKEA 3BVZA 4C7ZA 3Q6SA 1K83B 3PUZA 3RZDB 3G6JB 1DOLA 4CHTB 2JZPA 1PGBA 2BA0A 2JA8B 3AU7A 5IT9E 3D6WA 2XRSD 1C77A 1JC7A 1RDPD 1CI3M 3I72A 3AE9B 4QUFA 2HCIA 5FO8B 2EYOA 3ND9A 1LLRD 3NTHA 5DEHA 1Y56A 3AN1A 4KY5A 3V3XA 1EEFD 4P2CB 3VA5A 2WU5B 4ZHOA 4M0WA 4JE3B 4US8A 1E10A 2LFIA 3BDLA 2FBWB 2K22A 1NEKB 5KYIA 1TWHB 3DXJC 1VZ7A 3P4PB 3S1RB 3EROA 2HQEA 5IGCA 2B2VA 4IUNA 1YQ4B 3VYRA 1O7LA 2OT2A 4A3DB 2LHEA 1AEXA 4H44C 1CQFA 1VMPA 4ILWA 3EGRA 5CBEE 2E76C 1TWGB 2YEPF 1JCKB 3KBXA 5AUKA 2VB2X 3C3LA 5TSSA 2B2UA 2B2TC 3MP9A 3W5VB 3I8ZA 3UI3A 3Q8BA 4C3JB 2LMCA 4DQOC 1Y69U 1YJIA 4NAMA 3L7ZC 2HDLA 3S1MB 3PIP3 4DA2A 5C4XB 3GO5A 3OSOA 5I2YA 4FXGC 1IKMA 4X3SA 2SOBA 3LWEA 5BMHA 3KWLA 3CHBD 2PIAA 1HFNA 2Z4HA 4IURA 2D9UA 1VCIA 2EYJA 4XQQA 1JWAD 1DOMA 2V3PA 4KJOA 1V1PB 3AE7B 1F2MA 5D7GA 4FXDA 3SXHA 4C80A 2J53A 1BO0A 2Y3AA 1FNWA 2EELA 5E3FA 1GAQB 2B8GA 4B0EA 1M8AA 2K01A 2WV6D 2GRIA 3OIQA 2CQAA 3BIID 3W2DA 3FKIB 2W3SA 1C4QA 3NTIA 1WTPA 4GDLB 2NN6G 1VLBA 1HA5A 3S15B 1FGBD 4XE0A 2QILA 1XLPA 4WH4A 3AH7A 3FEWX 3KBGA 3S2DB 1YNJD 2KQ3A 5ELBA 3KWVA 4KKIA 1LTSD 3VQIA 2JXTA 3B2GA 3C2PA 1EY9A 2PCFB 1C76A 1QNUA 1JICA 1PTOB 3IKJA 1FCCC 1O7ZA 2M00A 1YNTE 2JWUA 1DJRD 2KCCA 1XEEA 3B2FA 4BBSB 2KUMA 3RFZB 4YIJA 3LXFA 3KLRA 1RKNA 4CKEA 2ICEC 3GTPB 2CVRA 4YWGG 1ET6A 4DXFA 2K32A 1F9SA 3S1QB 5M9OA 4QIWB 3DWMA 4K2LA 4GLSC 1T5EA 4CJ2C 4RKLA 3H94A 5C3WA 3Q8CA 1WD1A 3DEOA 2WXKA 2BE5C 4PNYA 5I9OA 1FYCA 1QG7A 3DUZA 3P4QB 4HR7B 1MHXA 1QT9A 2BDOA 2PVOD 1I4RA 1JROA 5C2TB 2ONQA 3QG1A 1Z6HA 2VUMB 1XLQA 1X3QA 1SNQA 2FFKB 1F9PA 3AEBB 3GTKB 2PTLA 1AWDA 4KN7C 4U68A 4IN3A 1F2ZA 4IZ8A 4Q0FA 3NBHA 3HRZC 1SDFA 5M5WB 1B9MA 1DM0B 2RMMA 3TEWA 4H0LC 2DN8A 3L4PA 1DZ1A 4V190 1VZ6A 3JAML 2WQYB 2A6HD 3HKZB 3SVMA 3CRKC 1MPEA 1EY5A 2E3TA 3HOVB 4KHVA 4KN4C 2JA5B 5LNK1 3SK6A 3QOJA 1EY8A 4ZK9B 2WNMA 4Q5VA 4NP5A 1D5XC 1ILQA 4KKUA 1SE3A 4IALA 1T3QA 4IKGA 5EPLA 1C9FA 5C3XA 2DNEA 1E2VA 3SFEB 5HURA 5EPJA 2XWBB 1MI2A 4HN7A 5M5YB 3IAS1 1HA6A 1ENFA 2EYFA 3X3NA 3J81E 2J7ZA 2AQ1B 1KTKA 2SNSA 2INPE 1TJEA 2XSCA 1DYQA 1AW7A 5C0XH 2DLBA 2L32A 1MSGA 2IGGA 4N9TA 3VR5A 5T1GA 4HTHA 5C5MA 1VZ8A 3AB9A 4QMGA 1E6EB 2K5QA 4FF2A 1V1PA 3K0YA 3AEEB 1B3AA 2LGIA 3CIRB 3LWUA 2K0PA 2MH7A 1TR5A 3T56B 2F0NA 2M9VA 2NVYB 1CK1A 2JEAI 5D3DA 2NMQA 2E75C 1BQQT 3ZGZA 4HJGE 5ISRA 4CGYB 5J39A 1WTWA 3QO2A 3W3AA 4H2AA 3GTGB 1G91A 1L4ZB 1VMCA 1K50A 2K1BA 5E4WC 2CW0D 2PLPA 2WXJA 4DF7A 3BS1A 2EZVA 4RF1A 1Y1WB 1ONLA 5ELCA 1E0ZA 4KGTA 5CV4A 2QMTA 1DOIA 4J1MA 3TP7A 3Q8EA 3A8KE 3S2HB 3H0GB 1S5DD 4RGMA 1P7EA 5HHDG 2O5JC 1TY2A 3P20A 3AECB 4FXKC 4ZAIA 1T6BX 2F0UA 3V96A 2KACA 1PTOC 4N9PA 2N88A 4YT0B 5CV9A 2ENBA 1WD0A 1XLNA 1A70A 1F77A 4N6EB 1IBXB 2ZW0A 1FFUA 1CA6A 4DU9A 3NSWA 4DNRB 1RODA 2V3NA 1MI0A 1H9MA 3Q69A 4OW0A 2NUCA 3ZJUA 3WOEA 2EJFC 3P4RB 2C5CA 3D3RA 3C8YA 5JEAH 1JQYD 2EJMA 4YSYB 2WLBA 5FO7B 1F9RA 1EYCA 3M4YA 1S4ZA 2L1BA 1TKGA 3C1EA 1YN5A 2DWQA 1U9RA 2DYOA 2JX5A 2EKIA 1JOKA 3DM1A 2AUKA 5KNBA 4OO1G 3ABVB 1AN8A 3K58A 1XWEA 2KAJA 3X3MA 1UEAB 3P1MA 3K5NA 2F0KA 4ZRZA 3AE6B 3K5OA 3VR4A 3MTSA 1U4LA 3N9YC 1X3PA 1A6XA 1IGDA 5CV5A 1MVKA 3MXNA 5AFWA 2F4IA 2QEJC 4H13C 4QB4A 5DAUA 5BN4A 3T16A 1S5CD 5ELEA 4KMUC 3TEZA 1KLGD 1CJEA 1UAPA 1PYWD 1EY0A 1EOTA 2VXWA 3S16B 2F0VA 1C48A 5BMGA 3GTQB 4LLGM 5ELDA 1IUEA 2WDVB 1V1OA 3NUHB 1TQOA 1PFDA 4D2KA 3NVYA 5DM63 4YTNB 1KNAA 1SNCA 3AE1B 1V8QA 1EM7A 1EYDA 3BDOA 1ROEA 1BF4A 1YQ3B 1W6JA 2WDQB 1R7SA 2BCOA 3LNNA 3IT6B 4ARCA 2FINB 4A8XC 3KF8A 1ZXTA 2B8FA 2K5DA 2NB0A 3AEDB 1OO9B 1WCMB 5FOBB 4MH8A 4GZYC 1TIID 4R8NA 5EE9A 2AQ2B 2F0JA 4F88A 4B0MA 1A2TA 1AYFA 5EKKA 4B08A 4C2MB 1G6ZA 2I2YA 1SNMA 1CT1D 3TZDA 3A54A 2F0EA 5LHY1 2JEBI 1K51A 1YJJA 1LT6D 5EPKA 3TSSA 2WKCA 2H1EA 4PMWA 1NYQA 1PZKD 1E7PB 4LAAA 4XYOA 1BCPF 4KD4A 1JWSD 4TRDA 3KQ4A 1WYGA 3P7JA 1TT2A 1U4PA 2B63B 2A69D 1O7YA 3HOUB 2WXGA 3IT4B 4A3MB 3GTMB 3T4AC 2RDGA 1EU3A 1HTLD 3HGBA 3CWIA 3MXGA 4ZRQA 1YNJC 5CORA 4WQMA 3W1SA 4WFN3 4L63B 1S5BD 4XYQA 2QIEB 2F0SA 3A7AB 1C4PA 2WXHA 4HEA1 4HKQA 5C3EB 3MHZA 4DFAA 5IT9L 3I4NB 1LTTD 2PW9A 3U2SC 2H4OA 5M3FB 3EVQA 1QOAA 2K05A 4DAPA 1XYIA 1IBXA 3NTKA 2D5DA 2F0HA 2O2LD 4PT5A 1ZXIA 2B2WC 1CQVA 1B50A 1LACA 1TY0A 1LTGD 5I6WA 2EYHA 1CTMA 2KOLA 4ABNA 3I4MB 1LTBD 1J8IA 5FO9B 2PMVA 1GXDC 4TMAB 2ZXRA 4FF3A 3NK9A 1IW7D 3D4RA 1GUGA 2IWHA 4IFDG 3SFDB 5EE0A 1G2SA 4RWSC 1JOOA 4BA1I 4ZOHC 4Z9CB 4A3IB 2K5WA 3GD7A 2IPKD 1AZQA 1TWFB 5C0XJ 3NBIA 2PMZB 4KY7A 3KK7A 2WXPA 2Q8TA 2Z8LA 4EQNA 4XQNA 1EZ6A 2LHDA 3BK1A 4NKLA 3H91A 2MGSA 3Q8FA