3EA6A

Atomic resolution of crystal structure of sek
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
b'DIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQCNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin K
publication title Structural Studies of an Emerging Pyrogenic Superantigen, SEK
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ea6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ea6A01
1FNVA 2XNAC 4K6LA 3URYA 1SXTA 4RGNA 1GOZA 5FKAC 2AQ1B 2XRSD 1CQVA 1PRTF 1FGBD 2QEJC 2NTTA 1LTBD 1SJED 2G9HD 5TSSA 1BXTA 1MD2D 1PRTC 1PTOC 3KLSX 3BVGA 1B44D 3TSSA 1YN5A 1SEBD 4ZYSA 1PZJD 1JWSD 1D6EC 1ET9A 1HTLD 1I4HA 3R2TA 1DJRD 2QILA 5I4DA 1D5XC 1TY0A 1JQYD 3BZDB 3DWAA 3DWPA 1I4GA 3OWEB 4L6TB 4TSSA 1XTCD 1HXYD 1LTSD 1S5BD 1SE3A 1T5XD 1SBBB 1LTRD 1YN3A 2CHBD 2NTSA 1JCKB 1JR0D 1LTAD 4RHSA 1KTKA 1PZKD 1L0XB 1CK1A 2IPKD 1RDPD 1CT1D 1F77A 1FNUA 5D3IB 1V1OA 1EFID 3MC0B 3BVMA 1RF2D 2O2LD 1LT5D 1BCPB 1RCVD 1AW7A 5ELDA 4RCOA 3MFGA 1TY2A 4NZLB 1LT6D 4Z9CB 4OHJA 3R2IA 1UNSA 1KLUD 4L63B 1S5DD 1LT4D 1M4VA 1V1PB 1QILA 1I4RA 1LTID 1SE4A 1L0YB 2AQ2B 1LTGD 3BYTB 1I4PA 1TS3A 3EA6A 4RGTA 5D3DA 2Z8LA 4RGMA 1HA5A 1G8ZD 1JWUD 1TS5A 1CHPD 4RHRA 1BCPF 1I4XA 1B1ZA 1DYQA 4UDUC 5ELBA 1PRTB 1PTOB 4DXFA 1ESFA 1BCPC 2R61A 1CHQD 3BYYB 1EU4A 2IJ0A 1UUPA 3R8BA 1HQRD 5ELEA 3SEBA 3V05A 1JWMD 4RGOS 1FNWA 1I4QA 1BCPD 1EEFD 1TS2A 1STEA 1PYWD 3W2DA 1PZID 2XRQD 1TS4A 1LLRD 1S5FD 4RH6A 1ENFA 1PTOF 1S5ED 3O13A 2WV6D 3BVZA 4O1NA 1ET6A 4BWGB 1SJHD 1S5CD 4DXGA 5ELFA 2RDHA 2XN9C 1XXGA 1AN8A 5ELCA 2SEBD 1RD9D 2RDGA 1EWCA 2ICIA 3CHBD 1EU3A 1D5ZC 1PTOH 4C56C 1YN4A 1V1PA 2AQ3B 1PRTD 1PTOD 1EEID 1KLGD 3DWQA 3EFXD 3GP7A 1LTTD 2J4XA 1FD7D 2TSSA 5FK9C 1SE2A 1LT3D 1D5MC 4RFBA 1LO5D
chains in the Genus database with same CATH superfamily
3P75A 1EQVA 4JYAL 3NEMA 3DBLI 3CMAA 1QQRA 2H4OA 1EWHA 2K6AA 1QNKA 2VL6A 4C3JG 3SVMA 2QC8A 1GC7A 2CJNA 4KVGB 1Q7YC 2BH2A 3OJ3A 1KDBA 2E5LQ 1ZEQX 3PUZA 1FGBD 2E2IH 1SNDA 4OXPA 1NMFA 1LGRA 2DYOA 2FBWB 4MSMB 3R3MA 1K51A 3FKIB 1ILPA 4IG7B 5BO4B 1KIXA 2E2JB 2BS3B 2EOTA 2WDVB 1WD1A 2D3CA 1FJGL 2HIXA 4Y7NH 3LB8C 2KEDA 3MEHA 1QZEA 1WJUA 4X3KA 1I4HA 1TWFB 2MHVA 4LK1C 4NJ7A 4FF3A 1MHWC 2F4VQ 4M8MA 2QILA 3PUYA 2L8JA 4EVOA 3OMCA 4JI8L 1XPUA 1SDFA 2FXQA 2X38A 3CWIA 1IZ6A 2DY7A 1AYFA 3NBHB 4NP5A 5LXHA 2UU9L 1SR3A 1VLBA 2CR5A 1KTKA 3N6RA 1TU2B 2KNBA 4OX9Q 4DPGA 4AOFA 4TQ1A 4BKTA 4BAXA 2AL6A 1FNUA 1W6JA 1AZQA 2PVOD 3QCAA 1JMCA 3GD7A 5EGTA 1PYBA 1D2BA 2YTYA 3Q2AC 4MM3A 1I94Q 5M9OA 2GA4B 4LFBL 3KBXA 5FLXE 2RSOA 4HAEA 1N60A 3B0AA 3FC4A 2MPMA 3D6WA 2KVMA 3WA0A 4V0BA 2GBJA 2INNE 3RI7C 1GVPA 1VQIA 5FR3A 2MP1A 4EZLA 3PUWA 1MIUA 4JI1L 4NXML 1FXAA 4PS7A 1S5DD 2EZVA 2K39A 2JA8B 5D6JB 1EFWA 3TN2A 4WWMA 5CV4A 1QVCA 1LTGD 5GROA 3ZNGC 4XQNA 5C3EH 3U7DA 2AKWB 2REXA 3LJ3A 3M3YH 1DOYA 1G2SA 3HOYB 5CHVC 1LUZA 4I65A 1KQSA 4JW0A 1EIYB 3Q8BA 4KGRA 2ZTEA 1ENCA 2IYDB 1QVGA 3L4PA 1OXTA 3BIID 4JI0L 3BYYB 5GXGB 1FD6A 5M5WB 4K5WA 2NVYH 3K0YA 3J9CA 1YVCA 4DV3L 1N34L 3MXNA 2KA7A 4WURA 1H9KA 1UGJA 2VUMH 3HKSA 3MHBA 4M8AA 4A3DB 4A3FB 1E7UA 3R66C 4LWCA 3PREA 3QIJA 3EJIA 1WOCA 1B8AA 2R2OA 4FLHA 4P71A 3KH0A 3APDA 3DVGY 4LFAQ 5J22A 4KZCA 3N52A 2HCCA 2KD0A 2YV5A 3KUCB 3MHSD 4US8A 3KYCD 1ET6A 2XVSA 1BT0A 2VH1A 4FJYA 4BBRB 1S4ZA 4DKAC 1X3QA 5L37A 4XX5A 5E6NA 4WAAA 3DHGC 1VQJA 3S15B 5JH5C 2L0TA 4LJOB 2ES2A 1MKHA 4TKOB 1H4RA 2NN6H 4HPPA 1H8CA 4LFBQ 1KRHA 2JA6B 4C56C 1G91A 3U30A 1V86A 1F9RA 3JSVB 3I4LA 3CRKC 1I6HB 2J4XA 3LXFA 1X3FA 2RKSA 3RCZA 5FK9C 2QDBA 2R92H 1KRTA 4LF9L 2HTHA 2KQ4X 1PGXA 1N5WA 1A3VA 3CMEA 2KMMA 2V4LA 2QEXA 4KGTA 4B9WA 3CCSA 2AEHA 3MXPA 3ZTDA 1GOZA 1VCIA 4R1JA 2XRSD 4XQQA 2CVRA 3QG1A 3PQIA 3MFYA 4F87A 1B9RA 1YQBA 2WLBA 5C3EG 3CW2C 4K14A 1TWAH 3T1HQ 5KNCA 4A3EH 3S2DB 3GTOB 2N7JA 2IT1A 2MX2A 3L0OA 5LMNW 1TKWB 1JALA 4X66Q 2BT6A 5EE0A 4DV3Q 1N34Q 1BNZA 3UIOB 3QAQA 1M94A 5BMIA 2CH4A 4C1NI 5C4JB 2R93H 4L23A 1JE5A 3KYHC 4X64Q 3P4PB 4IURA 4Q0FA 4DK5A 1SBBB 2VUMG 1S3OA 3FPPA 2KOLA 2EYFA 3KDFB 1IBLQ 2MSED 2LRUA 3UI3A 1IUEA 2WAQE 4R4OA 5JPMC 5J3BA 3H6NA 4LFCL 1B7YB 4IM2A 4R3DA 3ZNHB 4HMIA 5AZFA 5J1ZA 3MC9A 3UE0A 1WE7A 1A70A 3K80C 3EBEA 3K58A 5C1ZA 3I57A 4ME3A 5AJ3L 5FLMH 2K32A 1WCMH 4RMFA 5LMUL 1JRUA 3J7ZC 1H9SA 2CW0C 2A6HC 3PCOB 1WD0A 2JZZA 4NZLB 4CHTB 2KCCA 4LF6L 4NPNA 1S3SG 4XDCA 2O2VA 2L7RA 2NN6G 3CCUA 1VZ7A 3CCRA 4LF7L 2KJHB 1NJIC 2KTFA 2C7NB 3ZNID 1CM9A 1KLUD 1D3ZA 4LF9Q 4A3JH 4MZ9A 4K5VA 1LT4D 1Q1OA 3UGBB 4AUQC 4FULA 2R92G 2QGQA 2DWQA 4ANUA 1KM7A 1EWYC 1EL0A 2L32A 3PSIA 2VB2X 2Z8LA 4IPCA 3GTLH 4B3RL 1F9JA 3NTKA 2LMCA 2EXZA 3ZKJC 3CCEA 3Q23A 2CKZB 4E71A 1OEYA 3ABVB 1C4CA 2V1YA 3AEGB 1WJNA 4P1CC 2RF4A 3S16H 5DNFA 5JJLA 4A3EG 4RWSC 4DR4L 1FL0A 4XXEA 4M02A 1GJZA 4GN3B 2RGFA 1YJ9A 4LJZC 3A33B 3EC8A 4GOCA 3WWVA 1IGCA 4O42A 1K8AC 2EY5A 3BY4B 1B4OA 1ASYA 4PYUA 2ZJQA 1CSPA 3R93A 2R93G 2PTLA 1PHJA 2FE8A 4WIPA 5DEHA 4DV7Q 1VQDA 3HP3A 1EIHA 2WS3B 4XDDA 4RH6A 1CKOA 4KN7C 2OEOA 3CQZB 4FXDA 2ZXRA 1TZ1A 1Y8RC 2KLCA 3DVGX 1ZDXA 3P42A 5D2MB 1AARA 3M95A 4H0LC 4NXNQ 1SYFA 4DXGA 4AP4C 3PO3H 1V49A 4CGYB 1AN8A 2D9UA 1YEZA 2LGIA 4P6VF 4JI4L 1IL8A 5CV5A 5DM73 1NYRA 1EWCA 1GC6A 1RFKA 3E9SA 5FLMG 1WCMG 4DR2L 1HZ9A 3M9BA 4C3HB 4CJ0B 3Q8EA 3NBHA 2ZTCA 4LNNA 4LF7Q 4B0MA 4K6DA 3N1ZC 2IO2B 4CDCC 2VW9A 1YNNC 1FNVA 2ID0A 4F8MA 4M8NA 5IAAC 4FNFA 1T0RC 2HHHL 2JA5H 4A3JG 1X56A 4IM0A 3A5ZB 2KBNA 4YTPB 4IQZA 3ULPA 4ZLTF 1P1AA 2UWQA 4ZRPA 2PZWA 3OAWA 4ZUIA 5GQOA 4HXDA 4MJSA 1Q3LA 4IN3A 1WM3A 1WSPA 3D8GA 1LTBD 3T4AC 1TQOA 5TSSA 1BXTA 1VQEA 4OELB 3HOZB 1XCQL 3EFUA 4OVZA 3CAMA 3OW7A 3AEBB 3A9KA 3FAHA 4ME5A 4G50A 1E10A 2WB1E 4FVMA 1ML0D 1GUNA 2Y0SG 3M4QA 4M01A 1ET9A 4PK1A 3T51B 3GTKH 4WWNA 4BBNF 1DJRD 1MI2A 5CR3A 1VD2A 2WWZA 4USAA 2FCQA 3TQYA 3KF6B 2PEAA 3CC4A 3I3CA 2KOXA 2KN5A 4W9FA 3Q3OC 3KOJA 1PXUA 1VMPA 1L0XB 1BKBA 2WU5B 4BA1I 3AB9A 1N9WA 1HZCA 3VRAB 2F0QA 3RYTA 5KRUA 3AE9B 2OF1A 5JEAH 4JI4Q 1JB7A 4HJ9A 2ON8A 4CYEA 3PO3G 4NAWA 1LYLA 3D3RA 3FMCA 1STAA 3CPFA 4GLAC 5C4XB 3PIP3 4IOCA 3A1QA 5K5PA 2ICEC 2A5HA 4HIOA 2K5WA 5AEKB 4IUNA 1RYJA 4YWLA 2K5NA 2JRIB 5EE3A 4QY7A 5E7NA 4KSLC 1CMXB 3DQVA 1ZKOA 4RKBA 2EELA 3GTMB 4YCWA 2EKEC 1T9HA 1DM0B 2JA5G 1TIID 3NTHA 3S1MB 2F0EA 2MP2B 4DXFA 5D94A 2KXJA 3Q3FA 3PO0A 1ZXHA 5FOBB 2XBBC 3U9SA 4A3MB 1K9MC 2KMCA 3RZFA 3TP8A 3ZXRA 2K9XA 2HQEA 2HCIA 2J7QB 4H44C 1E2VA 1VZ8A 2KX0A 1E8ZA 3EHVA 4GLXA 1IP9A 4B3TL 4EGVA 3B2GA 1TS4A 1EOVA 3KK7A 1Z7TA 2NCNA 2D10A 1E1TA 3A8KE 1E8XA 3FVQA 2LUMA 4KMUC 4KJOA 3Q22A 3WANA 4JI6L 2GRIA 3FPUB 1VDZA 3TCAA 1IBMQ 3E56A 5E3FA 1BF4A 2UYZB 2IBIB 1NE3A 2NB0A 3H0GB 5EE1A 3HFZB 1DOLA 3VA7A 1D7QA 3HKZE 1YN4A 2C9WB 2Z0SA 4KGSA 3MHZA 1IXRA 3J80c 3E0EA 3RZOH 1EM7A 5IP9H 1N62A 4AS1A 3PHWB 1NTGA 1PLFA 2LSSA 1TTNA 1OO9B 1V1PB 3A9JB 5F2DA 3N3KB 4GB9A 5EJWA 1LO5D 1QCBD 2LKVA 4M0WA 2KWUB 3B08A 1YNTE 1WTXA 4IUVA 1QVFA 1E0ZA 2MLBA 1XX8A 3Q8FA 3RNEC 2AQ1B 1Q90A 2YTVA 2N88A 4GLVB 3B9JA 4DQOC 4EEWA 1R9TB 2NVQH 4KV6A 1C9FA 4K81A 3RR5A 4PMWA 1NR4A 4W9GA 1VQGA 3CPWA 2R7ZB 3AULA 3CD6A 2ZPYA 2VQFL 3KLSA 2KDIA 2KQSA 1GD7A 2CKHB 2K1FA 3DEOA 3UF8A 1IYFA 4JI5Q 2Q8IB 1L1OC 2C5LC 1AFPA 3DWAA 3OG5A 3S1NH 2JXXA 4TSSA 2M17A 1LTSD 1KF6B 1C3TA 2CHBD 2J0TD 1RJTA 4HMJA 3L9AX 1Z9FA 3HOUH 2N1VA 3E3XA 3NS1A 3SGIA 2DUDA 2OTJA 1YJJA 1F2ZA 5E6PA 2UXBL 4GSWA 1U4RA 4DDGD 4YSZB 2PNHA 3V6EB 3PRMB 4DAYB 1VQ5A 1C78A 1N32L 2DYBA 3JC66 1AW7A 5H8YE 4II3B 5I2YA 5GAHC 1SFOH 5JVH3 3H3VC 2J52A 5E1FA 4ZHOA 1STHA 4K0KQ 4Z9CB 4YTMB 4HLEA 4CQNA 4IKGA 4DWFA 1WE6A 1XLQA 5BN5A 1QUQA 3E9HA 5IP9G 1Y56A 4HJAA 3AEVA 1XMOL 2PE9A 3PT2B 2CU1A 1SNPA 3W1GA 4DV0L 2E2IB 4HIDA 4CKEA 1V5OA 2WHIA 3VYSA 3V61A 1O7YA 2QCZA 1PFSA 2ZPNA 2VQEQ 4A76A 2D07B 4IWQA 1OEYJ 2YU9B 2OT2A 4D2KA 2Z6BA 2Z6KC 4Y7NB 4OWWB 2GMIC 1TWCB 3RPFC 4R4TA 2R3ZA 1RM6C 1L1OA 1VQBA 1JICA 2FMCA 4DA2A 1Y14B 3A7LA 3RULA 3AFQA 3A5UA 4I7ZC 3RNUA 1MJCA 1HQRD 2NVTH 4WJWA 1SE8A 1JWMD 1K73C 1F2YA 3CCJA 1HNZL 2PLPA 2N1WA 3QOJA 5KIXA 2KZRA 3WAPA 1WVLA 1YI2A 1EYCA 4NQKE 1DD2A 1I35A 5IT9c 2N9KA 3HM6X 1W6KA 4APVA 2BYVE 1C9OA 1F2LA 4KLKA 1JJ2A 3PV0A 1QT9A 3HHMA 2EJGC 2UUCQ 4GOPB 3HOUG 1PDQA 2A68D 1SJHD 3ULLA 2INPE 4HPLB 1UELA 3PZDA 5ELCA 2INDC 2NZ1D 3J80E 1L0WA 4MT5A 1NBWA 4HWIB 3NWSA 3D0FA 1VJKA 4KKIA 1GPXA 3D4DA 2TMPA 3G6EA 1X6OA 2L83A 1YD8U 2N8NA 5FLXL 2F52A 2CWPA 2BQQA 2LXCA 3K7UC 5HY6A 5BYQA 4FYDA 2WAQG 2XNAC 1WZ3A 2FNJB 2Z6KA 3KYDD 3C1FA 4PV1C 4YCVA 4WORA 1IKMA 2BYTA 3T13A 4WAFA 3IT6B 1YOVB 2JSVX 1AE3A 3EIVA 4JLCA 4KTAA 3U8ZA 3NZUA 1E22A 1RKNA 1A5RA 1E1OA 3PZ8A 2F4IA 1HNWQ 2BKFA 3S14H 1PTOC 4DR7L 3TSSA 1M90C 2VUMB 3K9PB 1F9PA 2KVZA 2JXTA 3ZO5B 1NY4A 4EQPA 1QG7A 4PMBA 2CCZA 1C1YB 4DV4Q 3GTGH 4A3IH 1D5XC 3BZDB 1MJDA 5LNK1 3J7YW 1H95A 1HA6A 1A3UA 2ZT9C 2KHSA 4GN4B 4ARCA 2HJ8A 3BJUA 1G6JA 1GKHA 3P4SB 2DN8A 2KWCA 1XT9B 3HRZC 2QW7A 1Y1WB 1OQQA 2KFKB 4RF1A 4YWMA 1EUVB 4LK0M 1UE6A 3QR8A 3KQ4A 3CU7A 4RKLA 1A63A 5D3IB 1E6EB 2KK8A 4GNXB 3H7PB 4C3IH 1RF2D 3DBHB 5HG2A 4FP5D 2KTRA 1GUTA 1TY2A 1SE9A 2CQOA 4L5RC 4XYCA 4F88A 1N36L 2B63B 2UXCL 1KFYB 3I70A 4BXXH 4GDKB 1F2MA 2ZXPA 4LTUA 3MTSA 1M1KC 1C79A 2LEKA 1BO0A 4YHHQ 2L00B 4X3UA 1K83B 2ZZPB 3AU4A 4XE0A 1NENB 2MJEA 4HCNB 1Q5WB 4IUMB 1E5WA 1LXDA 4C4VB 2D2QA 4B0EA 3BYTB 5IO9A 5T8IA 3PUXA 3I9V1 3X23A 1XTDA 3DM3A 5M3FB 4A3EB 2BGFA 1HA5A 1B9NA 4KY6A 4ZUJA 1OQRA 2L15A 3ZJTA 5C2TB 2JWUA 4ACFA 3RFZB 2FCNA 2EY2A 5CHFA 1BBWA 2VXWA 2WP8J 4ZKCB 5KEEA 1C4PA 1ESFA 4F8CB 5C3JB 2KO3A 3PSEB 3RT3B 2CWAA 5G5HA 2KJRA 1UUPA 5JHBA 1C48A 2AWOA 1SNOA 5M3MB 4K8JA 2A69C 1E8YA 2PMVA 3EECA 2D2CC 4P75A 1IPGA 4YSXB 5FLXc 3A8JE 4BOZB 4J3OD 2Y0SE 1XMQQ 4YY3L 3A7AB 2ZTDA 1KAAA 5IT9E 3W5VB 4M00A 2NVXH 4A3IG 1STEA 2KHIA 2KQ3A 4GLSC 5C0XJ 2HDEA 4XT1B 4NQLB 4JCVE 1QOGA 2GB1A 4C2MB 4II2B 2H1EA 1S5ED 1ZYRC 2NPTB 4L5QA 2E5LL 2F03A 2LZ6A 5CX3A 2ATWA 4K7SA 4R4IA 2RSNA 2RHSB 2LXAA 1PH4A 3LNNA 5EKLA 2D3GA 4J6IA 4NJ6A 2SEBD 5IWAQ 1D8LA 1N61A 3KUZA 1PTOH 1YNJC 2PQAB 4C3IG 3ZJVA 1X65A 2PCFB 4OONA 4W9EA 1EEID 1HQMC 1N36Q 1FD7D 2I07B 2F4VL 1RHPA 3F2UA 2TSSA 1LM8B 3NVWA 1BBUA 3NK9A 1VQOA 4ZRKA 5KHQA 2Q8TA 1GB1A 1YHBA 3DWGC 4BFRA 3APCA 2H89B 2JSOA 3CCQA 3FILB 3QC8B 4BXXG 3VTUA 4K7UA 1GUGA 3R7QA 3H15A 2LVPA 1CQVA 5EBDA 2O4XA 1AZPA 2IGGA 3N1YC 4DHZE 1IBXA 1IBKQ 4NAMA 4GOPC 1GM5A 3GO5A 3HS0C 1K53A 2RSUA 3KWVA 2JQOA 3BZCA 4ZYSA 1I94L 2PW7A 3N32A 2P5ZX 2J7ZA 4KIKB 4EQOA 2M2LA 2Q2UA 1WGGA 3DUZA 4XDXA 3D4RA 2XSCA 3DHHC 1VQLA 3ZXVA 1MBYA 3DWPA 2DZIA 2WDRB 3HVZA 3AEFB 4N9F4 3ZVVA 5M5YH 4OL7A 1EF5A 2KUMA 3S1QH 2MGSA 1WWTA 4W9JA 1R4NB 1WYDA 3I4NB 4DR6Q 1SRUA 4HIKA 4DNTB 1GG3A 1YN3A 4CDEC 3NHEB 3VUWA 4DXAB 3ZTCA 4G4KA 2W54A 4RM8A 3UDIA 2B3AA 4XT3B 5CTRC 3ML9A 1R4QB 3SK8A 4XYOA 1L0VB 3FEWX 1PUTA 2R2QA 4LLGM 4IOAA 3J81E 2ZW0A 3WIMA 3X0WA 2B2YC 1A0IA 1QLBB 1K28A 1WXMA 3NRZA 4MDKE 2C35B 4DAPA 4A3BB 2IZVB 1IW7C 5KGUA 2I2YA 1SYGA 5LLIA 1PYSB 4OHJA 2YVCA 1UNSA 3FKYA 3BG3A 2F0PA 1KABA 3F2BA 3C3LA 2M8SA 4GOPA 1EY9A 1L0YB 4JI2Q 4A3CH 4P72A 1SMXA 4LFAL 1YQ4B 5D3DA 1XNRQ 2DZKA 5IGGA 2B8FA 1TS5A 1F52A 1XLOA 4BVUC 4ZAIA 1J6QA 4HRSA 4AYBG 3ERQA 1LACA 4OIJA 3RMKC 1HH2P 4GNXC 5C44H 4LNIA 5JJZA 3T9LA 1E7VA 3HKZG 5EDSA 5FJ8H 2JQRB 3IAM1 4NMZA 5BN4A 2LJIA 1B9MA 4RG1A 3CC7A 1F2RI 1HE8A 4KV2A 5IOCA 4E3CA 4HCEA 1STYA 2LHEA 4C80A 1V80A 1QZGA 2F3VA 4HKZE 4ANWA 4ID6A 3M3JA 4AQYL 1UWVA 3LYYA 2D0PA 3IFDA 1VF5C 1PYWD 4EKUA 1GNUA 2KAJA 2PQEA 2OQKA 2B2YA 4AQ7A 1SIFA 4ABNA 3BVZA 2RPQA 4CDFC 3AH7A 4GS3A 4A93G 1WXAA 4WQOB 5BYSA 4A55A 5AZGA 1LQBA 2K52A 3JW0X 1JOKA 3T1HL 3M62B 1PH8A 4XGAB 4AIMA 4PQXA 2K75A 2KCMA 4OZBA 1BVSA 1OXVA 2I5MX 1AE2A 4X66L 2O6VD 1D1IA 4PT5A 3EROA 2WXKA 1CUKA 4R8IA 1U4PA 3BU2A 4X64L 1WI5A 1HTOA 3KF8A 1MSHA 3VR2A 2KLGA 4TVAB 3QHTA 3EN2A 2K28A 4YCUA 2K5DA 4X62Q 1IBLL 4B3ML 4IO9A 1FMAD 3L08A 5LXIB 5HKHA 1FRRA 2WU2B 3IT4B 3IXSA 3J7AV 1EWIA 1Q8IA 4A3CG 4L8JA 2QEJC 1I3QB 4NDXA 4DFAA 4OGQC 3DPDA 3IHPC 1Y1VH 4IZ8A 2F0UA 3RNCC 3AE2B 3N9YC 3BVGA 4FO2A 3NELA 1EOTA 4V190 4S17A 2HUGA 3VH3B 5C44G 5JZEB 2AWTA 1HTLD 1ZKHA 5FJ8G 1DCZA 3R2TA 4B9XA 1SYCA 2GVBA 2XIWA 5LL6S 2EYPA 5I9PA 1TY0A 5IGBA 4DV1Q 5M5XB 2D5GA 1EQTA 1VQ4A 1XTCD 3N20C 4AQYQ 1TWHH 1WMHB 4BBNC 3W5OA 2ZNVB 3KW5B 5C23A 3H09A 2YEPF 4R4QA 3L2PA 3APFA 2N9LA 4N9TA 4DV6L 1VR9A 1BUVT 2A6ED 1CK1A 2ZJPA 1KNEA 3RD2A 3CMMB 3AE3B 4KY7A 1CT1D 5I6YA 4G7OC 2KMAA 5D65A 1GXDC 3LGJA 3MC0B 1O7IA 1JT8A 1WYGA 1JWAD 1WJ4A 3FHWA 3RZOB 1WXVA 4G7HC 2MA9B 3DVNU 5L83A 1GJXA 1WXQA 3M63B 1VZ6A 5CV7A 1UZXB 1SROA 3NP8A 2IO3B 3DMUA 1V8CA 3HOWH 4K3BA 1TZOA 2MJ8A 4B3SQ 3DBRI 1XNQQ 4S0RA 4GKJQ 1E2WA 2BYFA 1EQRA 1CQFA 4HTHA 4AH6A 3TZDA 1DGJA 3A4RA 3CIRB 1KLVA 1WRIA 1HR0W 5CBAE 2GLSA 3TP5A 2A74C 2KC2A 2WFWA 3TZUA 2WX1A 2HDMA 4DV7L 3Q3MC 4P2CB 3CCVA 4B3MQ 4JBMA 1VCBA 3VHTC 2WGSA 3MA2B 4FJZA 1D4BA 4GU2A 2QHOA 1RTOA 1K8GA 2V4DA 4W9LA 1CHPD 4RHRA 3AE8B 3PTFC 4Y52H 3NE5B 4NXNL 1T5EA 1J8CA 2INCC 3I5JC 1EZ6A 2O6VB 1CZWA 5C0XI 2ZW1A 5BMHA 3H91A 5E4XA 2CHWA 1Y1VG 2XGTA 3QQ8B 1STBA 2Q8RE 3R8BA 2BE5C 4JBWA 1UE1A 2M00A 1F2RC 1TYGB 2NS5A 3NVVA 1HTQA 4WJ4A 2E6XA 3PUVA 3HOUB 3ITPA 1MHXA 2LS01 4DN4M 5L95C 3JAMc 1BOSA 4RCNA 2LFIA 1RLFA 4PG3A 2PMZE 1J5EQ 3B6YA 2ZCBA 4HSVA 2DY8A 2LGXA 2Y5PA 2WP9B 1XD3B 2OOBB 2VB3X 3WCQA 4DV6Q 1GUOA 1KOTA 1SIJA 5IYBH 3GTQB 1X1MA 2RBMA 2Z1CA 2PJHA 4GN5A 1YHAA 1SFOB 1HZ6A 5FO7B 3P2BA 4CJ2C 4QCLA 5DM63 4A9AA 5COYA 3I4MH 1WTRA 2Z9HA 3PLVA 3VR8B 2AQ3B 1LM0A 2PZUA 3KBGA 3TEYA 4DUZL 1KLGD 4BY1B 2WINB 3MXGA 2HD5B 2WACA 4JV5L 4GKKQ 1PH6A 3HOWG 5E6JA 1B53A 4QJFA 3T8MA 1D5MC 3J80i 4BZAA 3CSTA 2R6GA 2X6GA 3AI5A 4LF5Q 5G2NA 1VQFA 4KKTA 3KJPA 4KHZA 3S2HH 1PFBA 4KD3A 2X6LA 2A1AA 1G6ZA 1RIPA 2L1AA 3NENA 3AE5B 3N30A 2FCSA 2KDBA 4X3SA 5EKKA 1Q0WB 1EY8A 3OHXC 3VR4A 4HJ8A 1WTWA 1PQSA 2PVGC 3ZDMC 4JOIC 3A56A 3KLWA 4ZRZA 4W9KA 3STBC 1YN5A 3PMFA 5IA7A 4A3KB 5BR8Q 3QWNA 2JJQA 1D6EC 1JW9D 1TIFA 5DPRA 1FIQA 4PZ6A 2JE6I 1ICFB 2K7VA 1JQYD 1L6UA 4C4VA 1PH3A 3DEPA 1G2TA 1E24A 4JVZA 3K8AA 3I3TB 1RODA 4WFN3 3M85A 5EPLA 1PVOA 3MC8A 4EZJA 4P7IA 3ETRA 1IYVA 1EY4A 4BY7B 1GUWA 1XWEA 4HIMA 2K8HA 4X65L 4ZRIA 3SR1A 4O2DA 3AE4B 5IYBG 1I5FA 3I56A 3ZGZA 3BDCA 1SN8A 1RCVD 3RMHA 4JBKA 4O0AA 3FKIH 3NHHA 2SNMA 4HR7B 3P20A 2E2JH 3I4MG 4K5XA 4DUZQ 2M0XA 3AMZA 3Q8DA 4WJNA 2MFIA 3J80L 3CKIB 1WTVA 1EO6A 2K6QA 4JV5Q 2RQXA 4BKSD 1TWFH 4A3GH 4XQJA 2XK5B 1ENAA 4CKCA 1I4RA 1Q10A 3NY5A 2ASBA 2EYLA 4A90A 2AQ2B 1ZXIA 2HQLA 3EA6A 4JOIA 2F0GA 1S72A 4Q5VA 3S14B 1HFNA 3JVZX 1BCPF 1JORA 2EXDA 4ODGA 1IBML 2JA7B 2F0VA 3TREA 4DAMA 2JXMB 1HTPA 4QL5A 4RA8A 3GTGB 4HK2A 4A3IB 1C4AA 2R61A 4MELA 3OW2A 2LHDA 3H3VI 4LF4Q 1SAPA 3M4YA 5CC4A 3JAME 3SHQA 1B3QA 4MACA 3QARA 4MH8A 2WB1B 1KHIA 1L2FA 3T3NA 4CDDC 2YYZA 3IAS1 1LLRD 1S5FD 2LXJA 3K0XA 5DLQE 4DU9A 2JA8H 3QO2A 5IN7A 2VS1A 5EQ0A 4TKNA 2IX1A 4X65Q 1WTQA 1P98A 2QMTA 4LCDE 4KZ0A 1FR3A 2JA9A 4N58A 4K8IA 4IPHA 2FHTA 2B2WC 3OIQA 3J81j 2KQ7A 3JSVA 2E2DC 2IY0B 3MEFA 4N9PA 4FADA 1S1QB 1P9DU 3UIPB 4HJKA 1EQQA 1ESRA 1C76A 1Z2MA 1M8AA 1G291 1PRTD 2E76C 3F1ZA 4XWWA 2W3SA 1X9NA 3GP7A 4JI5L 2MCNB 2F0OA 3DXJC 3FKIG 4B9KA 2JN4A 4KDIC 1SE2A 3E0JA 1WGHA 4PMCA 3KUPA 2DYMA 2L55A 4JI3Q 4A3DH 3VFKA 1I50H 4K3CA 3W1YA 3AECB 4A3FH 1YQ3B 1QZHA 5E6OA 4A3GG 3PGEA 3TS2A 3BZKA 2JEBI 3NJTA 4YWKA 3DLLA 1C8CA 2G9DA 1CZPA 1SSNA 4KKSA 3NOBA 2MUYA 1MSGA 3FP9A 2NTTA 4BOSC 2DX5B 5IKCM 4Q2JA 2LWPA 2AHOB 1WX9A 4BBRH 4AYBE 4YXDB 3T56B 1DONA 4K2LA 2L4NA 2DBYA 1PZJD 3S15H 1K8RB 1JWSD 3V62A 4C3JB 3G7LA 3VYTA 3HOXH 4DR5Q 2NVXB 2N9EB 4WH4A 3GE8C 2UUAL 3ZJUA 4K0KL 2F3IA 2JA6H 4MH0E 3KDFA 2K5PA 1N6ZA 1EUJA 1I42A 3L7ZC 2D3AA 3GZNB 4DDID 3NQTA 1T0YA 4DV5Q 1CJEA 2B2WA 1B2TA 5IT9L 3GDEA 4POFA 4F7XA 1C77A 2K8BA 2NZOA 2VQEL 3OIPA 4GMVA 1PH9A 2L12A 5CHWA 2F3WA 2JA8G 3VR9B 5C6AA 4OWTB 3H6MA 1WI0A 3LWUA 3S17H 3BVMA 2BW2A 1LT5D 1UF0A 2WDTB 4URKA 3RZDH 2O5JC 4R9WA 1U4LA 5C0XH 4P73A 4IW0A 3CF5A 3BK1A 2HJ1A 1DZ1A 3OOCA 3GTOH 1R4MB 1JQ4A 3PPAA 1L2NA 1KDCA 3D31A 3PO2H 5DPSA 3PRPB 2FFKB 1PDXA 1EYAA 2NYZD 4YWGG 5C4JH 1O80A 3HKZB 1OXSC 1XEEA 4RGTA 4A3DG 3NBIA 1E7ZA 3DHIC 4A3FG 1L7YA 1G8ZD 3NG0A 2MO1A 2KWDA 3NS8A 4YTNB 3WAOA 2UUCL 1DYQA 1P7EA 3WALA 2EMTA 1TGZB 1PRTB 3M7NA 1DOXA 3AYHB 2JEAI 1UBQA 2NBUA 1XYIA 5M5YB 3I4OA 4L5TA 4BBRG 4DGZA 2ZM6Q 4FF4A 1QOBA 4RGOS 2F0TA 4FHJA 3TMPB 2UUAQ 4DV2Q 3WOFA 1ZE3D 2G4SA 3ALBA 5H92C 3HOXG 4EOYA 2N7EA 2B2UC 3S24A 1SMYD 2H5XA 2JA6G 2B3GA 1NVID 1PMRA 3UE1A 1TWGH 1V97A 5KYIA 3P1HA 2KWVB 1K52A 2A73B 1PH7A 2HIVA 1CKNB 2RR9A 4DK3C 5AFWA 2DJGC 4IC7B 1HNWL 5G3LD 5ELOA 3IFTA 4QIWE 2ICIA 1UWMA 1EU3A 1NMGA 4I6PA 4WWOA 5EAYA 3J81L 2ZJRA 3L17A 3RN9C 4RMAA 4TQ0A 2AUJD 3OLMD 1SNQA 2J53A 3EFXD 1DOIA 2HT1A 4DV4L 3AE1B 2ZJDA 4L1BA 1PH2A 4A3PA 5C0XG 4JC0A 2M4NA 4P74A 3W1BA 1DXMA 1YNXA 4DK1A 3Q14C 1T3QA 3NZ3A 1XLNA 1FM0D 2AX5A 1JMLA 3A54A 3PO2G 5ISRA 1P3QU 5FKAC 3ONSA 4ICVA 4KY5A 3VYUA 3PV1A 2YEPB 2DLBA 2Q2IA 1C4QA 3D4WA 2K5HA 1V8QA 3PGZA 3C19A 2JU6X 1MD2D 3CQZH 3OWFA 1JRPA 2N9PC 2HE7A 3WOEA 1B44D 2FINB 2KDFB 3ENEA 2QJLA 3Q69A 5IYDH 2D3BA 3BDOA 3F8TA 3KF6A 5IE8A 2E2HH 3VA5A 5BN3A 2HTME 2V3PA 2PYKA 1QOAA 2L0FA 3SFEB 2G4DB 4YL8A 5C3XA 1NUCA 3C1EA 1I4GA 3VR6A 4C3HH 1YIWA 3MJ5A 1S5BD 3Q3JA 5C3EB 4YHHL 3SHLA 1ROEA 5EPJA 4PZ7A 5HURA 3M3YB 3A4SC 4FXCA 4IWPA 4K7WA 2N0SB 1JCKB 1JR0D 1GB4A 2YTXA 1NBFC 2DZMA 2PPBC 2JX5A 2F0DA 3U9OA 3LWEA 1RDPD 1BBXC 1VQCA 1ZUD2 4YSYB 4GDLB 1SB3C 1HNXQ 3VTVA 2EVBA 3KUDB 1V1OA 4F7ZA 2NVYB 3Q8AA 4PS8A 1QJOA 1S40A 4ZRJA 4RCOA 5DPWA 4UHVA 4W9DA 5FR6A 2M56B 2NBWB 2AUKA 2EQSA 3VH4B 3W9CB 4MM3B 3I72A 2WKDA 1K0SA 4NKLA 1TT5B 2F0HA 3H3VH 1B50A 1VRAB 1XMQL 2VNUD 4RM9A 2GOWA 1J7AA 1SE4A 1Q1EA 1KDAA 2PI2A 1A2UA 1GUAB 1CTMA 3PRZA 1WZ0A 2OCEA 2GBKA 5IP4D 2LUEA 1UGMA 2MP2A 5IP7H 1MG4A 1I4XA 3EGRA 2K6DB 3L16A 1U4MA 4G7ZC 3TBLD 3MJWA 3EVQA 2LVOA 1HPCA 1YBYA 5IWAL 3J81c 4OWXB 3QOLA 4LF8Q 3ZQ4A 2R92B 1KXLA 3SEBA 5IGCA 1JWBD 2CHXA 5IYDG 1FNWA 4J6HA 3I2ZA 2I5HA 2IX0A 4UAIA 1BCPD 1FXIA 2KYWA 2M0AA 2WXFA 4B6WA 4JL9A 4OIKA 3MZ5A 3UDXA 4ZK9B 3BWUD 2IHEA 2WQYB 1DOKA 1N63A 4C3HG 5IGDA 4OEMB 5JVG3 1LFDA 2KN4A 3U7ZA 5LMNL 1WH3A 1ENFA 1X32A 4JK1C 1TWAB 2VRRB 1Q12A 3K5LA 1IBKL 2JYTA 1FVIA 1WIAA 4G3XB 2N78A 1P16A 2IO0B 4L5SA 3GTMH 5GADC 3HOWB 2MRPA 5DPTA 4XYQA 3DBHI 4TQUS 4L2YA 2F0LA 3S1MH 2R93B 1F9QA 1V1PA 2BVCA 1UEBA 2MQHA 3ND8A 2Z4HA 4IJLA 1FPYA 1L5PA 3A9JA 3DWQA 4G0NB 4NY0A 1LTTD 4GZYC 1FFUA 1QNUA 1RAXA 1LT3D 4A3MH 3B2FA 2RMMA 3QJYA 4FXKC 1ZOYB 3HVDA 4DR6L 2PNRC 1SXTA 4DBGA 2BB6A 3UDFA 2PW5A 3I7FA 4F1SA 4KI0A 4M1UB 3UDGA 1WCMB 1QKZA 1EY7A 3AE7B 2IY1B 3VR5A 1SJED 4UP9A 1JB3A 5IP7G 3K81C 1JROA 3PF4A 3AQQA 2WXLA 3G71A 4PNYA 1FRDA 3H0GH 4A3JB 1T0SC 2RDBC 2CW0D 3V3XA 2A6HD 2JZ3B 4EFOA 3AN1A 1E0BA 2EIFA 2C9OA 2CU3A 4ITKA 3ZW3A 3GTLB 2DJFC 3IG3A 2MJ3A 3SXHA 1ISNA 4JI2L 1OGWA 3AEAB 2FJ2A 5CV8A 1PH5A 2LY7A 4HEDA 1PZKD 5LMNQ 4OO1I 4DAYA 1XNRL 4MTNA 4HJ5A 1AP0A 3N1XC 2ZVOA 2F0NA 2I1KA 4QAYA 5J18A 2Y0SB 1STGA 2CH4W 3S16B 4KHPQ 1YJ1A 1EFID 1Q82C 3K7AH 3W5UB 1TJEA 5T1GA 1R9TH 2SAKA 3OJ4B 1BCPB 2RCFA 3MFGA 4KD4A 5CYUA 2JF5A 4HCSA 5CV9A 3C46A 2R7ZH 1NSNS 5IODA 3KVFB 4FBJB 1H9SB 2KHJA 2Z4IA 4FA6A 4ZKBB 3S2HB 4A20A 4ICUA 1TBEA 5C5LA 4JQWC 2LFNA 3L0WB 4U68A 2O2VB 3MVVA 3KWLA 2BCOA 3DBLB 3RNBC 2NUCA 2UXDL 4QMGA 3DOWA 4A3MG 2MEKA 1I4PA 1JC7A 1VS0A 1VQHA 5C4ZA 3ONAB 1EZ8A 2SOBA 3ECIA 3PO3B 2L5TA 4A93H 1J7BA 3TEWA 1OXUA 1G6PA 3D32A 2JT4B 4A6QA 3X3MA 5C5MA 1RL2A 1HCZA 4DR3Q 3HOVH 2LMCB 3K5MA 5FO9B 5AUKA 4FHKA 2MJDA 1NDDA 5IY0A 3HZXA 4A8XC 2EYHA 4A4IA 2JVCA 4DHZB 1PFMA 2K4KA 2ASQA 2AYOB 1K3BC 1U5KA 2D62A 3NUCA 4ASWC 3H0GG 2JA5B 1EEFD 2EYOA 4TUUA 1R4NI 4EUTA 1E3PA 2L52A 3L54A 1UEAB 4X62L 3GQBA 3H1UA 1WY8A 1PTOF 4OVVA 2M1MA 3JAMi 1YNND 2WV6D 2OEDA 4W9CA 3TDQA 1H9JA 1GAQB 5J17A 1KH0A 1WYWB 5ELFA 1UH6A 2NBVB 2YU9H 1VQAA 5FO8B 3GTKB 3S1RH 1TWCH 3Q0AA 1XCTL 3T1YQ 2ONQA 2QA4A 2WDQB 4C7ZA 2F0KA 2XEWA 4A3GB 1YX6B 2ZXOA 4LUOA 3PIO3 4BKGA 4DV1L 3I55A 3AEEB 1FGUA 2QCPX 4ZQ3A 2R7ZG 1WTHA 1HEZE 4DUYL 1XO3A 1XQQA 2R7DA 3A55A 3RUZA 1CA6A 2BWES 2LVQA 4TMAB 1WF9A 2BKRB 4GDLA 3AU5A 2UXDQ 5G55A 4EQNA 2A68C 3A8IE 2L0CA 1MPEA 5I9OA 2LD9A 1TKGA 1PRTF 3P4QB 3TIXA 3T3OA 1ONLA 1A15A 5D7GA 3OPOA 3ZJYC 1GHKA 3QX1A 2IL8A 4MJSB 2OTLA 1PA6A 2KCTA 1Q46A 1OXXK 2J0KA 4KHVA 3HOVG 2VY3A 1C7YA 2UUBQ 4JE3B 3NQIA 3L13A 1KJTA 4B3SL 1XNQL 3TUOA 2FUG1 3A9KB 2JYEA 2LRWA 2MHJA 1VF7A 2E74C 4GKJL 4FJVB 4PS3A 4FF2A 3QIAA 2KFKA 4OZAA 2EY1A 4J15A 4JYAQ 1BMLC 1WGRA 3JAML 4KJNA 4E6IA 1P7FA 4RHSA 3QA8A 3U4VA 3HG9A 4GNXA 2DZJA 5A2QE 2PO4A 3VDYA 4DR1L 3H7PA 2EE1A 1K0RA 2IPKD 1HZAA 2I46A 2CS4A 2I1JA 1XPOA 1FCLA 3EUB2 2K04A 3K5NA 2D0OA 1KRSA 3RUIB 4I6LB 2O2LD 4HEA1 3RLFA 1V2YA 5JAVA 2MH7A 4EZKA 1FJGQ 5CBEE 2N9XA 4GDKA 3R7RA 4ZOHC 4ALPA 3GE3C 3CSFA 2I38A 1I50B 1LT6D 2QDFA 4NAWB 4JI8Q 4YT0B 5KNBA 2MW5A 3H9DA 1V9JA 1X54A 4DUYQ 1M4VA 1PV4A 4P16A 1LTID 3A1QB 2UU9Q 1VQ6A 1J5EL 1WGDA 1BQQT 2Q2TA 2MBBB 5J2RA 4A3OA 1DOMA 3I90A 4K2KA 1B1ZA 2VZKD 1Y1WH 2K50A 2WKCA 5ELBA 2K01A 1U9RA 3J7AF 3K59A 2DGYA 3HOXB 2JWZA 1JOQA 2UU7A 1QB5D 5JOBA 5T1IA 1BCPC 5HGTA 1PH1A 3ULJA 4IFDJ 5BMGA 5H1SE 4OZCA 2BBCA 1QF6A 3DBRB 4CHKA 3OYYA 1IYUA 1T6BX 3V05A 2M9VA 4JI1Q 2BTEA 4BBSH 1ASZA 4NXMQ 4GKKL 1EY6A 4GGQA 1UAPA 2QF7A 2NPTA 3O65B 2B63H 1OTRB 4MTKA 4LF5L 1VDVA 3GTPH 4LNKA 5EE9A 1V43A 2NVQB 3RN5A 1I6VC 1K83H 2FUHB 3S17B 3C8YA 4DR1Q 3CP0A 2WNMA 3RZDB 2PQAA 5KHOA 5J39A 5M3FH 2F0MA 1WRDB 2VH2A 5A35A 4JI0Q 3C0RB 3MP9A 2WXGA 2RCNA 2GBMA 1AH9A 1D5ZC 3S1NB 5GAGC 3PLUA 3PO2B 4FF1A 5BR8L 3SFDB 3FILA 1QOHA 4ZCKA 4GXBA 3ZRFA 1RWSA 1STNA 5M3MH 3NSWA 5G3LF 2SNSA 4QGUA 3P4RB 1R7SA 1KAWA 3URYA 1PGBA 4CO7A 3ERSX 4M0WB 3L3OC 2CQAA 3Q6SA 4LAAA 4S3SA 5DCNA 4C2MH 3PIPA 4H2AA 4OO1H 4E74A 2G9HD 1PFDA 1TT2A 3LDZE 2QIEB 1E9MA 1EYDA 2WXJA 3PS6A 4KIKA 2LI5A 5HFYA 5IGFA 2JYOA 3SE0A 3RNGC 1Y1WG 4I7AA 5IGEA 3CC2A 3IFWB 2WAQB 1J0GA 4UP7A 2BPSA 2L76A 4XWTA 1JJCB 4IALA 3J7A5 1WFYA 1Y8PB 1TWGB 2QSDA 4AJYB 3NUHB 2BS2B 4L6TB 1V6EA 1IKLA 3HUIA 3U58A 1SE3A 2RDFA 3V6CB 1FEHA 1F1HA 4LMQD 4BBSG 2NTSA 2VZKB 5HHDG 2J0JA 2V4IB 1LTAD 1UD7A 1Q86C 2B63G 1HRJA 1X55A 2BOSA 3SK4A 2OWOA 4WRDA 2MBHA 1NCVA 2O5IC 1Y8OB 3HM3A 2BDNA 1EY5A 1RFAA 1H9MA 1TKEA 2IY5B 1K8MA 2NVTB 2PMZB 3GB1A 4KKUA 2B2VC 5M3FG 4OW0A 1BDOA 4A3LH 2NVUI 4LF4L 1A6XA 1X3GA 3GTJH 2V3NA 3QB3A 4UPAA 2MBQA 3HEJA 2OXPA 1SLJA 2FCMA 4N6EB 3CRLC 2F0SA 1LTLA 3VXWA 3M4OH 3G6JB 5LL6X 4UY8C 2ZVNA 2L9HA 4H7BA 2DNFA 3P63A 1IYJB 1WX8A 1YX5B 5M3MG 2C7MB 3DM1A 1MI0A 4LFCQ 4ZHPA 1QUQB 1X3EA 2KFJA 3OTOL 3I4NH 3MXUA 1XLPA 2IGDA 4IDIA 3CCMA 5AJ3Q 2E2HB 2KJ6A 5LMUQ 2W9NA 1VQ9A 1SYBA 4DNIA 1MVKA 4OO1G 2WIIB 5LHY1 4HSPA 1U4AA 4AWJA 1NAPA 4LF6Q 2V1CC 2XWBB 5ELEA 3ZYYX 3I63C 1L1OB 4WWPA 4JX1C 3V96A 4A3BH 4UP8A 1GUSA 2PKOA 2RHQB 1FXTB 4ZYNA 2DHZA 2E3TA 1FYCA 2G45B 5HI1A 3VRBB 1A2TA 4JI3L 3DWMA 1EIGA 3A0JA 2KKCA 2ZNVC 3ZRCA 2B29A 1WJ6A 3T53B 4AJWA 4I6NB 1E2ZA 1O78A 3O13A 3KFUA 4B3RQ 4EE2A 2B2VA 4WJPA 2NZHA 1S5CD 4HJGE 4LNFA 2K05A 4W9IA 2XN9C 3ER0A 3S9WA 3CXCA 1N8RC 1OTCA 1OFFA 2JUOA 4X57B 4CBVA 5GMVA 2C5CA 1FCCC 3CHBD 4NB3A 3E9IA 2KCNA 3DHQA 2EPBA 3SDZA 4DR4Q 1XF5L 1PTOD 2OJRA 1V81A 4KKJA 1W3SA 4DR5L 1YJWA 1NEKB 4H13C 3CCLA 3QWZB 2D11A 4A3LG 1HZBA 4HDOA 2PZTA 2PW9A 2B8GA 2PI2E 3AMUA 1O7LA 1J7CA 5DAUA 1LV9A 3VYRA 5BYRA 2BWFA 4R4CA 3H94A 1Q8KA 1WFQA 4DV5L 1VQPA 3AEDB 4WQMA 3IAYA 1UWXA 1CSQA 1E90A 1P0RA 2RA4A 2DAFA 4C3IB 3OTOQ 3VR3A 4NNJB 2GBNA 1L4DB 2F0JA 4C7YA 3IL8A 3RLNA 4JWSC 4ANVA 2R7FA 4G11A 3FDTA 5G5GA 3I4NG 3GS2A 2I5LX 1YJIA 3KLSX 1AWDA 5D14A 2BS4B 3V60A 3HOYH 5ELNA 2BYEA 3NWTA 4DR2Q 4LUZA 3VUYA 5NUCA 1X3PA 4IPGA 4FDBA 1Y69U 1WMHA 1WX7A 4IJHA 1NYQA 1ZDVA 2K0PA 2KANA 3ZLZA 1I7HA 2WYQA 3OWEB 3P7JA 3AXCA 5M5WH 2LJ5A 3VDZA 2ENBA 5EPKA 1YMHE 4YIJA 4HPMB 4QB4A 2GVAA 1AEXA 4A3BG 2JZPA 3MTNB 2HHHQ 1ZXTA 2KHWB 2EMSA 4JPSA 2MBOA 1KD1C 1VMCA 4CJ1B 1SNCA 4MGKE 4DNRB 4XZ4A 1F77A 4PYZA 3RN2A 1WTPA 1J9OA 2Y3AA 2AL3A 4GIVA 3VAWA 3DVNV 2B2TC 1I3QH 2K5QA 1PGAA 4HKQA 1SYEA 2Y5BB 1Q1BA 2N49A 1YZ6A 3NPPA 2RPVA 2ZM6L 1CKMA 5CORA 3K9OB 1V9PA 3NZSA 2ZEQA 2KTRB 4PZ8A 4DV2L 1XPRA 2IGHA 2K1BA 2LASA 4NW2A 1L6VA 3SR6A 2FAZA 1E7PB 2A69D 2A6EC 1QILA 5M5XH 1I6HH 1WTOA 3SDLC 5EKIA 4IFDI 2HDLA 2WXNA 3Q8CA 3GV6A 2O6VA 3U4ZA 4RGMA 1EIFA 5JJKA 1MGSA 3VVWB 1BUIC 4UDUC 3TMEA 2KVRA 2PPHA 2J42A 1PTOB 1ZYRD 2K25A 2L05A 4MSQB 5KNDA 4MN3A 3A74A 1EF1A 2DENB 2IJ0A 4EX5A 5JEAG 3E5SA 5K36H 3X3NA 3HOYG 4JWUC 3S2DH 5IYCH 2EJMA 3J81i 1YJNA 1YNJD 4LNQA 1EY0A 2EY6A 3ND9A 5EBCA 1N33L 1BR9A 4AYBB 1TS2A 4POGA 1OQYA 3GZNI 3R3OA 4GN1A 2G3QB 2EYMA 2XRQD 2G1EA 4WJ3M 4QUFA 2OQ0A 3K7AB 2B2TA 3QK0A 2QDLA 4BWGB 3PZ7A 5JXVA 3TEHB 5KYLA 2GN5A 1XXGA 1HFGA 3W3AA 3RLOA 2N4FA 1A3TA 4XIGS 1J19A 5C4HA 1T0QC 3UQAA 3IRBA 1NNXA 1R4MI 3S1QB 2E75C 1RRBA 1V5TA 2K33A 4HCPB 1SNMA 4ULLA 4K1RB 1VQ8A 4RF0A 1FO4A 3OSOA 2YLMA 1HHVA 4KN4C 4JGHB 4A93B 5AZHA 3D6CA 4K6LA 3T16A 4B3TQ 3HRDD 3K6OA 1ICWA 1JOOA 3HOVB 3AM9A 2IX3A 5AUIA 4ILWA 1IHZA 3F2DA 4JI6Q 1WXSA 1HNXL 2V0GA 1L4ZB 3GTQH 4IUPA 4LUVA 4XC2A 3TS0A 1IBXB 1SEBD 3C2PA 2W55A 5MPOA 4C00A 2DNCA 1CZGA 5E4WC 4DK0A 2F0FA 2MNAA 1K50A 2C60A 4KK7A 3PHXB 5I4DA 2KEEA 4JIOU 3I73A 1TKYA 3SK6A 2KACA 4RNAA 2KJXA 1J8IA 4FXGC 4REZA 5K36G 2AMCB 4BY1H 1IW7D 1T5XD 1N33Q 5IYCG 4KSKC 4DF7A 2L1BA 1SYDA 2IWHA 2ACZB 2NBFA 4N8FA 3B1LX 5I2XA 2M19A 5C44B 4G57A 2KX3A 1O7ZA 1SSOA 3VTWA 2KENA 2OJWA 3ZNZB 3S1RB 2A8VA 4LNOA 1K3RA 3RD4A 4MGIE 1F0ZA 2PE6B 3M7GA 2WX0A 2CJOA 3Q3NC 1Z5SB 2MO0A 2V3SA 2VQFQ 3ML8A 4IUTA 1MFWA 1Z47A 2CFMA 3MWYW 3TBIB 1G51A 2LXKA 4LF8L 1VQNA 2GBRA 2B2UA 2K03A 1VQMA 3PVLA 2XK5A 2F1MA 1YHQA 1KL9A 4KDLB 3H8HA 1C0AA 3IVFA 4A3KH 1WGYA 3U50C 3SK5A 2A4ZA 2H88B 2Z59B 3AE6B 4DHJD 4IOIE 4QIWB 3G48A 4C1NK 2Q5WD 2B76B 3IBEA 3TEXA 1JE4A 2BH8A 5CMDA 4HJ7A 3EFCA 3G4SA 2EYJA 2UXBQ 4US9A 3SU8X 2J0MA 1QWYA 4EQ5A 3NVZA 4MHEA 3I8ZA 4BY7H 4IM3A 2IDYA 1N32Q 1HUNA 3LX0A 2ALYB 2Q2HA 1SF0A 1CI3M 1EU4A 4W9HA 3RNFC 2RD0A 1HJPA 3HOZH 5GAEC 1ZGUB 1WGKA 2N7DA 4B08A 3WAMA 4HROA 4IWOA 1Y8NB 2CHZA 2X69A 1MG8A 2BA0A 3SD5A 5JEAJ 1GO3E 4U673 4BA2I 2NR2A 1XMOQ 3JYUA 4LW1A 1ZP0B 4DV0Q 3AFPA 2FMMA 2B39A 3UI2A 4RAUC 4BY1G 3NXWA 1Y1VB 4XTCS 2IHFA 2DAJA 2MQJA 1MJEA 2L3ZA 4J1MA 3S2AA 2LGSA 4ZRQA 5JPNC 2PIAA 5IOIA 1B3AA 2K14A 4X3TA 2JP1A 1F9SA 5A2QL 3QJZA 3UINB 2LGDA 3AV8A 1IGDA 3WDNA 2RDGA 2WXRA 2JA7H 2Y5CA 4MEMA 1R4PB 2A19A 4CKBA 4A75A 1YITA 1HNZQ 1TWHB 3VUXA 2K5VA 4FN2A 2BDOA 1N5XA 2FIFA 3AU7A 3NTIA 3UQBA 1Q81C 5C4XH 2QKIC 3GV3A 4R8NA 1VQKA 2V9HA 3AB5A 2I0QA 2C7HA 3MXNB 5HGQA 4N59A 4A3KG 5JJIA 1NI2A 1KNAA 1WR1A 4RGNA 4HN7A 2WXPA 3RNAC 3CF6E 1W2BA 3KF8B 2Z0EB 3L10B 3TEZA 1SGHA 1CFMA 3BDLA 2HD3A 4LDTD 2NN6I 2IO1B 4BKSA 1UBIA 3FRPB 4KHPL 2WXOA 3BINA 1B70B 1PRTC 1HR0L 1WJJA 1K8OA 4JPBW 4JBJA 4BBSB 1XJVA 3ZUNA 5IIFA 4BY7G 2JRHA 3KLRA 4DHJB 3M4PA 2JK8A 3BK2A 5CGKA 1FFVA 4N8X1 4TRDA 3P1MA 3HIZA 3EQLC 4WJOA 3GTPB 2EJFC 4JG2A 3HOZG 1IL2A 1HXYD 3DDCB 4P1BC 4KX6B 2L11A 3GOEA 3U52E 2SDFA 1TXYA 1ILQA 1LTRD 3I91A 1II3A 2BB5A 4NPSA 4X6AH 3HGBA 3E6ZX 2XWJB 4MNOA 2K22A 2FIDA 2K8CA 3W1SC 4JI7L 2N55A 4IFDH 2KC1A 4HDQA 2OHFA 1A8VA 2GI9A 2VZAA 3U4EG 2Z0DB 4B95A 2D5DA 3PIOA 4DR3L 4DR7Q 5CV6A 4DAVA 1HUMA 2IW3A 2K3UA 5ELDA 3DBSA 1YIJA 2AWNA 3H7SA 1WM2A 1DGSA 2JPHA 1JJGA 2KDMA 1CA5A 2JA7G 4BS9A 2DNEA 4ARIA 1TVXA 3R2IA 4C3JH 2BE5D 3TP6A 4L63B 1ZPSA 1ZW7A 3U2SC 1V1QA 1NR2A 2WXMA 1EYGA 1GHJA 1TS3A 5C4XG 2XTIA 4QUCA 4DK6C 2W82A 2KT7A 3BS1A 1JWUD 1KC8C 3TRZA 1MHHE 3TL5A 3I4MB 4LJPB 3KJOA 2F0IA 2BF8B 3Q24A 3HK0A 4IPDA 4QF4A 2WB1G 1LABA 1HR0Q 4OVUA 1CHQD 2W3RA 1P8LA 2JY6A 3T1YL 2NMQA 1D1KA 5C3WA 3PF5A 3MAQA 4H02A 2KDEB 2NWGA 4WJQA 2UXCQ 3TJPA 1I4QA 2MBEA 1TR5A 2N3SA 1QE6A 1QOFA 2LGYA 5TR5A 3W1SA 3NVYA 2MWSB 2WXQA 1VQ7A 4MGZE 4MGYE 3ZIMA 3VQIA 2BA1A 3W2DA 3IKJA 3DCGA 2A5UA 1PZID 2F0WA 4LDTB 1H9RA 3RZWC 3TP7A 1ACCA 1PFNA 1CKNA 4OX9L 2EKIA 2X8XX 3ZDTA 4JI7Q 4TV3A 3K5OA 4IUUA 1UE5A 4O1NA 3K57A 4NJCA 1HZ5A 2RVLA 1A62A 2RDHA 4IFDG 2E8GA 3GTJB 1U0LA 1RD9D 3OMGA 1Z6HA 4MIUA 4ZDVA 2ZCCA 1NI3A 3Q6BA 3ICEA 3M4OB 2WXHA 1RTNA 2G5DA 4IUQA 2UUBL 2WXIA 5JHAA 3STBD 1WR6E 3F2CA 1SMYC 4HVBA 4QQBX 1E8WA 4J8QA 4ANXA 3V2TA 4YY3Q 5I6WA 1UE7A 4RFBA 2EDGA 2KECA
chains in the Genus database with same CATH topology
3P75A 1EQVA 1QQRA 2H4OA 1EWHA 2K6AA 1QNKA 4C3JG 3SVMA 2CJNA 1KDBA 1ZEQX 3PUZA 1FGBD 1SNDA 2DYOA 2FBWB 1K51A 3FKIB 1ILPA 2E2JB 2BS3B 2EOTA 2WDVB 1WD1A 3LB8C 2KEDA 3MEHA 4X3KA 1I4HA 1TWFB 2MHVA 4LK1C 4FF3A 2QILA 3PUYA 4EVOA 3OMCA 1SDFA 3CWIA 2X38A 2DY7A 1AYFA 4NP5A 1VLBA 1KTKA 3N6RA 1TU2B 4TQ1A 1FNUA 1W6JA 1AZQA 2PVOD 3GD7A 5EGTA 1D2BA 5M9OA 2GA4B 3KBXA 5FLXE 2RSOA 4HAEA 1N60A 2MPMA 3D6WA 2KVMA 4V0BA 2INNE 5FR3A 2MP1A 3PUWA 1FXAA 1S5DD 2EZVA 2JA8B 3TN2A 4WWMA 5CV4A 1LTGD 4XQNA 1DOYA 1G2SA 3HOYB 4I65A 3Q8BA 4KGRA 1ENCA 3L4PA 1OXTA 3BIID 3BYYB 5GXGB 1FD6A 5M5WB 4K5WA 3K0YA 3J9CA 3MXNA 2KA7A 4WURA 1H9KA 1UGJA 4A3DB 4M8AA 3MHBA 4A3FB 3EJIA 5J22A 3N52A 2HCCA 4US8A 1ET6A 2XVSA 4BBRB 1S4ZA 1X3QA 3S15B 4TKOB 2NN6H 1KRHA 2JA6B 4C56C 1G91A 1F9RA 3I4LA 3CRKC 1I6HB 2J4XA 3LXFA 2RKSA 5FK9C 2QDBA 2KQ4X 1PGXA 1N5WA 1A3VA 2KMMA 4KGTA 4B9WA 3MXPA 1GOZA 1VCIA 4XQQA 2XRSD 2CVRA 3QG1A 3MFYA 4F87A 1B9RA 2WLBA 4K14A 5KNCA 3S2DB 3GTOB 2N7JA 2IT1A 1TKWB 1JALA 2BT6A 5EE0A 1BNZA 5BMIA 4C1NI 5C4JB 4L23A 3P4PB 4IURA 4Q0FA 1SBBB 3FPPA 2KOLA 2EYFA 3UI3A 1IUEA 5JPMC 4R3DA 4HMIA 5J1ZA 1A70A 3K58A 3I57A 2K32A 1H9SA 2CW0C 2A6HC 1WD0A 4NZLB 4XDCA 4CHTB 2KCCA 2NN6G 1VZ7A 1CM9A 1KLUD 4K5VA 1LT4D 2DWQA 1EWYC 1EL0A 2L32A 2VB2X 2Z8LA 2LMCA 3NTKA 2EXZA 3Q23A 3ABVB 1C4CA 3AEGB 5DNFA 4RWSC 4XXEA 4LJZC 1IGCA 4O42A 2EY5A 1B4OA 3R93A 2PTLA 2FE8A 4WIPA 5DEHA 2WS3B 3HP3A 1EIHA 4XDDA 4RH6A 4KN7C 2OEOA 3CQZB 4FXDA 2ZXRA 3P42A 1ZDXA 4H0LC 1SYFA 4DXGA 4CGYB 1AN8A 2D9UA 2LGIA 4P6VF 1IL8A 5CV5A 5DM73 1NYRA 1EWCA 1RFKA 3E9SA 4C3HB 4CJ0B 3Q8EA 3NBHA 4B0MA 4K6DA 1YNNC 1FNVA 2ID0A 4F8MA 4FNFA 4YTPB 4IQZA 4ZLTF 4ZRPA 2PZWA 4ZUIA 1Q3LA 4IN3A 1WSPA 3D8GA 1LTBD 3T4AC 1TQOA 5TSSA 1BXTA 3HOZB 1XCQL 4OVZA 3OW7A 3AEBB 3FAHA 1E10A 4ME5A 4FVMA 1ML0D 1GUNA 1ET9A 3T51B 1DJRD 1MI2A 5CR3A 4USAA 3I3CA 1PXUA 1VMPA 1L0XB 2WU5B 4BA1I 3AB9A 3VRAB 2F0QA 5KRUA 3AE9B 2OF1A 5JEAH 2ON8A 3FMCA 3D3RA 1STAA 5C4XB 3PIP3 5K5PA 2ICEC 2A5HA 2K5WA 4IUNA 1RYJA 5EE3A 1ZKOA 4RKBA 2EELA 3GTMB 1DM0B 1TIID 3NTHA 3S1MB 2F0EA 4DXFA 3PO0A 1ZXHA 5FOBB 3U9SA 4A3MB 3TP8A 2K9XA 2HQEA 2HCIA 4H44C 1E2VA 1VZ8A 4EGVA 3B2GA 1TS4A 3KK7A 1Z7TA 3A8KE 2LUMA 3FVQA 4KMUC 4KJOA 3Q22A 2GRIA 3FPUB 1VDZA 3E56A 5E3FA 1BF4A 2NB0A 3H0GB 5EE1A 3VA7A 1DOLA 1YN4A 4KGSA 3MHZA 1EM7A 1N62A 4AS1A 1PLFA 1OO9B 1V1PB 5F2DA 5EJWA 1LO5D 1QCBD 2LKVA 4M0WA 1YNTE 1WTXA 4IUVA 1E0ZA 3Q8FA 1XX8A 2AQ1B 1Q90A 2N88A 3B9JA 4DQOC 1R9TB 4KV6A 1C9FA 4PMWA 1NR4A 2R7ZB 3KLSA 3DEOA 2Q8IB 1AFPA 3DWAA 4TSSA 1LTSD 1KF6B 2CHBD 2J0TD 1RJTA 4HMJA 3L9AX 3NS1A 1YJJA 1F2ZA 1U4RA 4YSZB 1C78A 1AW7A 5H8YE 5I2YA 3H3VC 5JVH3 2J52A 5E1FA 4ZHOA 1STHA 4Z9CB 4YTMB 4CQNA 4IKGA 1XLQA 5BN5A 1Y56A 1SNPA 2E2IB 4CKEA 3VYSA 1O7YA 2YU9B 2OT2A 4D2KA 4Y7NB 3RPFC 1TWCB 2R3ZA 1RM6C 1JICA 2FMCA 4DA2A 3A7LA 4I7ZC 1HQRD 4WJWA 1JWMD 1F2YA 2PLPA 3QOJA 5KIXA 1WVLA 1EYCA 1DD2A 2N9KA 1W6KA 1F2LA 1QT9A 3PV0A 2EJGC 1PDQA 2A68D 1SJHD 2INPE 5ELCA 2NZ1D 3J80E 4MT5A 3NWSA 1VJKA 4KKIA 1GPXA 3D4DA 2TMPA 2L83A 5FLXL 5BYQA 4FYDA 2XNAC 3C1FA 4PV1C 4WORA 1IKMA 2BYTA 3T13A 4WAFA 3IT6B 2JSVX 4KTAA 1RKNA 3PZ8A 2F4IA 1PTOC 3TSSA 2VUMB 1F9PA 2JXTA 4EQPA 1QG7A 4PMBA 1D5XC 3BZDB 5LNK1 3J7YW 1HA6A 1A3UA 2ZT9C 2KHSA 4ARCA 3P4SB 2DN8A 3HRZC 1Y1WB 1OQQA 4RF1A 4LK0M 3CU7A 4RKLA 1E6EB 5D3IB 1RF2D 5HG2A 4FP5D 1GUTA 1TY2A 4F88A 2B63B 1KFYB 3I70A 4GDKB 1F2MA 2ZXPA 4LTUA 3MTSA 1C79A 2LEKA 1BO0A 4X3UA 1K83B 4XE0A 1NENB 2MJEA 4B0EA 3BYTB 5T8IA 3PUXA 3I9V1 5M3FB 4A3EB 1HA5A 1B9NA 4KY6A 4ZUJA 1OQRA 3ZJTA 5C2TB 2JWUA 3RFZB 2EY2A 2VXWA 2WP8J 4ZKCB 5KEEA 1C4PA 5C3JB 1ESFA 5G5HA 1UUPA 1C48A 2AWOA 1SNOA 5M3MB 4K8JA 2A69C 2PMVA 2D2CC 4YSXB 3A8JE 4J3OD 3A7AB 5IT9E 1KAAA 3W5VB 1STEA 2KQ3A 4GLSC 5C0XJ 2HDEA 4XT1B 1QOGA 2GB1A 4C2MB 2H1EA 1S5ED 1ZYRC 2F03A 2RSNA 3LNNA 5EKLA 2SEBD 1N61A 1PTOH 1YNJC 4C3IG 3ZJVA 2PCFB 1EEID 1HQMC 1FD7D 2I07B 1RHPA 3F2UA 2TSSA 3NVWA 3NK9A 2Q8TA 1GB1A 3DWGC 2H89B 2JSOA 3FILB 1GUGA 1CQVA 5EBDA 2O4XA 1AZPA 2IGGA 1IBXA 4NAMA 3GO5A 3HS0C 1K53A 3KWVA 4ZYSA 2PW7A 2J7ZA 4EQOA 2M2LA 3DUZA 4XDXA 3D4RA 2XSCA 1MBYA 3DWPA 2WDRB 3HVZA 3AEFB 4OL7A 2KUMA 2MGSA 1WWTA 3I4NB 1YN3A 4DNTB 4G4KA 2W54A 4XT3B 4LLGM 1R4QB 3SK8A 4XYOA 1L0VB 3FEWX 1PUTA 3J81E 2ZW0A 2B2YC 1QLBB 3NRZA 4DAPA 4A3BB 1IW7C 5KGUA 2I2YA 1SYGA 4OHJA 1UNSA 3BG3A 2F0PA 1KABA 3C3LA 1EY9A 1L0YB 1YQ4B 5D3DA 5IGGA 2B8FA 1TS5A 1XLOA 4ZAIA 4HRSA 3ERQA 1LACA 4OIJA 5JJZA 2JQRB 3IAM1 4NMZA 5BN4A 2LJIA 1B9MA 1F2RI 5IOCA 4HCEA 1STYA 2LHEA 4C80A 2F3VA 4HKZE 4ID6A 3LYYA 3IFDA 1VF5C 1PYWD 2KAJA 2PQEA 2B2YA 4AQ7A 4ABNA 3BVZA 3AH7A 5BYSA 4A55A 1JOKA 4PQXA 4OZBA 1OXVA 1D1IA 4PT5A 3EROA 2WXKA 4R8IA 1U4PA 3KF8A 3VR2A 1MSHA 2K28A 2K5DA 1FMAD 1FRRA 2WU2B 3IT4B 3IXSA 3J7AV 1Q8IA 5G5GA 4L8JA 2QEJC 1I3QB 4NDXA 4DFAA 4OGQC 4IZ8A 2F0UA 3AE2B 3N9YC 3BVGA 4FO2A 4V190 1EOTA 2HUGA 1HTLD 1DCZA 3R2TA 4B9XA 1SYCA 2XIWA 5LL6S 2EYPA 5I9PA 5IGBA 1TY0A 5M5XB 2D5GA 1EQTA 1XTCD 3H09A 2YEPF 2N9LA 4N9TA 1VR9A 1BUVT 2A6ED 1CK1A 1KNEA 3AE3B 4KY7A 1CT1D 5I6YA 4G7OC 5D65A 1GXDC 3MC0B 1WYGA 1JWAD 3RZOB 4G7HC 1GJXA 1WXQA 1VZ6A 5CV7A 3NP8A 3DMUA 1V8CA 1TZOA 2MJ8A 1E2WA 1CQFA 4HTHA 1DGJA 3TZDA 3CIRB 1WRIA 5CBAE 3TP5A 2A74C 3TZUA 2HDMA 4P2CB 3MA2B 1D4BA 1RTOA 2V4DA 1CHPD 4RHRA 3AE8B 3NE5B 1T5EA 1EZ6A 1CZWA 5C0XI 2ZW1A 5BMHA 3H91A 5E4XA 1STBA 2Q8RE 3R8BA 2BE5C 4JBWA 2M00A 1F2RC 1TYGB 3NVVA 2E6XA 3PUVA 3HOUB 3ITPA 1MHXA 2LS01 4DN4M 1BOSA 4RCNA 2LFIA 4HSVA 2DY8A 2Y5PA 2WP9B 3WCQA 2VB3X 1GUOA 1SIJA 3GTQB 2RBMA 2Z1CA 1SFOB 1HZ6A 5FO7B 4CJ2C 4QCLA 5DM63 4A9AA 5COYA 1WTRA 3VR8B 2AQ3B 2PZUA 3KBGA 3TEYA 1KLGD 4BY1B 2WINB 3MXGA 2WACA 5E6JA 1B53A 1D5MC 2R6GA 2X6GA 4KKTA 4KHZA 1PFBA 4KD3A 2X6LA 1G6ZA 2L1AA 3AE5B 4X3SA 5EKKA 1EY8A 3OHXC 3VR4A 1WTWA 2PVGC 3A56A 4ZRZA 1YN5A 3PMFA 4A3KB 3QWNA 1D6EC 1JW9D 1FIQA 2JE6I 2K7VA 1JQYD 1L6UA 3DEPA 1G2TA 1RODA 4WFN3 3M85A 5EPLA 3ETRA 1IYVA 1EY4A 4BY7B 1GUWA 1XWEA 3SR1A 3AE4B 3ZGZA 3BDCA 1RCVD 3RMHA 3NHHA 2SNMA 4HR7B 3P20A 4K5XA 3AMZA 3J80L 1WTVA 3CKIB 2RQXA 4XQJA 1ENAA 4CKCA 1I4RA 1Q10A 4A90A 2EYLA 2AQ2B 1ZXIA 3EA6A 2F0GA 4Q5VA 3S14B 1HFNA 1BCPF 1JORA 4ODGA 2JA7B 2F0VA 2JXMB 1HTPA 4RA8A 3GTGB 4A3IB 1C4AA 2R61A 2LHDA 1SAPA 3M4YA 5CC4A 3JAME 4MACA 4MH8A 2WB1B 3T3NA 2YYZA 3IAS1 1LLRD 1S5FD 4DU9A 3QO2A 5EQ0A 2IX1A 1WTQA 2QMTA 1FR3A 4N58A 4K8IA 2FHTA 2B2WC 3OIQA 2E2DC 4N9PA 1ESRA 1C76A 1M8AA 1G291 1PRTD 2E76C 4XWWA 2W3SA 3GP7A 2F0OA 3DXJC 1SE2A 3E0JA 4PMCA 3KUPA 2DYMA 2L55A 3AECB 1YQ3B 2JEBI 1SSNA 1C8CA 2G9DA 1CZPA 4KKSA 2MUYA 1MSGA 2NTTA 4Q2JA 4YXDB 3T56B 1DONA 4K2LA 2L4NA 2DBYA 1PZJD 1JWSD 4C3JB 3G7LA 3VYTA 2NVXB 4WH4A 3ZJUA 2K5PA 3L7ZC 3NQTA 1CJEA 2B2WA 1B2TA 5IT9L 4F7XA 1C77A 3OIPA 2L12A 2F3WA 3VR9B 5C6AA 3H6MA 3LWUA 3BVMA 2BW2A 1LT5D 2O5JC 4R9WA 1U4LA 5C0XH 3BK1A 1DZ1A 3OOCA 1JQ4A 1KDCA 3D31A 2FFKB 1PDXA 1EYAA 2NYZD 4YWGG 1O80A 3HKZB 1OXSC 1XEEA 4RGTA 3NBIA 1G8ZD 4YTNB 2KWDA 1DYQA 1P7EA 1PRTB 3M7NA 1DOXA 2JEAI 1XYIA 5M5YB 1QOBA 4DGZA 4FF4A 4RGOS 2F0TA 3WOFA 1ZE3D 5H92C 2B2UC 1SMYD 1NVID 1PMRA 1V97A 5KYIA 3P1HA 1K52A 2A73B 5AFWA 5G3LD 3IFTA 2ICIA 1UWMA 1EU3A 3J81L 4TQ0A 2AUJD 1SNQA 2J53A 3EFXD 1DOIA 3AE1B 4L1BA 5C0XG 1DXMA 4DK1A 1T3QA 3NZ3A 1XLNA 1FM0D 2AX5A 1JMLA 3A54A 5ISRA 5FKAC 4KY5A 3VYUA 2YEPB 2DLBA 3D4WA 1C4QA 1V8QA 2JU6X 1MD2D 3OWFA 1JRPA 3WOEA 1B44D 2FINB 2QJLA 3Q69A 3BDOA 3VA5A 5BN3A 2HTME 2V3PA 2PYKA 1QOAA 3SFEB 5C3XA 1NUCA 3C1EA 1I4GA 3VR6A 3MJ5A 1S5BD 5C3EB 3SHLA 1ROEA 5EPJA 4FXCA 5HURA 3M3YB 1GB4A 2N0SB 1JCKB 1JR0D 2JX5A 2PPBC 2F0DA 3U9OA 3LWEA 1RDPD 1BBXC 1ZUD2 4YSYB 4GDLB 1SB3C 2EVBA 1V1OA 2NVYB 3Q8AA 1QJOA 4RCOA 2M56B 2AUKA 3W9CB 4MM3B 3I72A 2WKDA 4NKLA 2F0HA 1B50A 1VRAB 2VNUD 1J7AA 1SE4A 1Q1EA 1KDAA 1A2UA 1CTMA 1I4XA 3EGRA 1U4MA 4G7ZC 3EVQA 1HPCA 3QOLA 3ZQ4A 2R92B 3SEBA 5IGCA 1JWBD 1FNWA 4J6HA 2M0AA 2WXFA 2IX0A 4UAIA 1BCPD 1FXIA 3KQ4A 4OIKA 3MZ5A 4ZK9B 3BWUD 2WQYB 1DOKA 1N63A 4C3HG 5IGDA 5JVG3 2KN4A 3U7ZA 1ENFA 1X32A 4JK1C 1TWAB 1Q12A 3K5LA 2JYTA 3HOWB 4XYQA 4TQUS 4L2YA 2F0LA 2R93B 1F9QA 1V1PA 3FC4A 1L5PA 2Z4HA 3ND8A 3DWQA 1LTTD 4GZYC 1FFUA 1QNUA 1LT3D 3B2FA 2RMMA 3QJYA 4FXKC 1ZOYB 3HVDA 2PNRC 1SXTA 2BB6A 2PW5A 4KI0A 4M1UB 1WCMB 1QKZA 1EY7A 3AE7B 3VR5A 1SJED 1JB3A 1JROA 2WXLA 4PNYA 1FRDA 4A3JB 2CW0D 3V3XA 2A6HD 3AN1A 1E0BA 2C9OA 2CU3A 3GTLB 2MJ3A 3SXHA 3AEAB 2FJ2A 5CV8A 2LY7A 4HEDA 1PZKD 4OO1I 4DAYA 1AP0A 2F0NA 2Y0SB 1STGA 3S16B 1EFID 3W5UB 1TJEA 5T1GA 2SAKA 1BCPB 3MFGA 4KD4A 5CYUA 4HCSA 5CV9A 3C46A 1NSNS 5IODA 1H9SB 2Z4IA 4ZKBB 3S2HB 5C5LA 2LFNA 4U68A 3MVVA 3KWLA 2BCOA 2NUCA 4QMGA 2MEKA 1I4PA 1JC7A 5C4ZA 3ONAB 1EZ8A 2SOBA 3PO3B 2L5TA 1J7BA 3TEWA 1OXUA 4A6QA 3X3MA 5C5MA 1HCZA 2LMCB 3K5MA 5FO9B 5AUKA 2MJDA 4A8XC 3HZXA 2EYHA 1PFMA 3NUCA 2D62A 2JA5B 1EEFD 2EYOA 2L52A 1UEAB 3GQBA 1PTOF 1YNND 2WV6D 2OEDA 3TDQA 1H9JA 1GAQB 1KH0A 5ELFA 5FO8B 3GTKB 2ONQA 3Q0AA 1XCTL 2WDQB 4C7ZA 2F0KA 4A3GB 2ZXOA 3PIO3 3AEEB 2QCPX 4ZQ3A 1HEZE 1XO3A 3RUZA 3A55A 1CA6A 4TMAB 4EQNA 2A68C 3A8IE 2L0CA 1MPEA 5I9OA 1TKGA 1PRTF 3P4QB 3T3OA 1ONLA 1A15A 5D7GA 3OPOA 1GHKA 2IL8A 1OXXK 4KHVA 4JE3B 3NQIA 3TUOA 2FUG1 2JYEA 1VF7A 2E74C 4FF2A 3QIAA 4OZAA 2EY1A 1BMLC 3JAML 4KJNA 4E6IA 1P7FA 4RHSA 3HG9A 5A2QE 2PO4A 2EE1A 2IPKD 2I46A 1FCLA 3EUB2 2K04A 3K5NA 2O2LD 4HEA1 3RLFA 2MH7A 5JAVA 5CBEE 4ZOHC 2I38A 1I50B 1LT6D 4NAWB 4YT0B 5KNBA 1M4VA 4P16A 1LTID 1BQQT 1DOMA 3I90A 4K2KA 1B1ZA 2VZKD 2WKCA 5ELBA 2K01A 1U9RA 3J7AF 3K59A 3HOXB 1JOQA 1QB5D 5JOBA 5T1IA 1BCPC 5HGTA 4IFDJ 5BMGA 4OZCA 2BBCA 1QF6A 1IYUA 1T6BX 3V05A 2M9VA 2BTEA 1EY6A 1UAPA 2QF7A 1VDVA 5EE9A 1V43A 2NVQB 1I6VC 3S17B 3C8YA 2WNMA 3RZDB 5J39A 2F0MA 5A35A 3MP9A 2WXGA 1D5ZC 3S1NB 3PO2B 4FF1A 3SFDB 3FILA 1QOHA 1RWSA 1STNA 3NSWA 5G3LF 2SNSA 3P4RB 1R7SA 3URYA 1PGBA 3L3OC 2CQAA 3Q6SA 4LAAA 4S3SA 4H2AA 4OO1H 2G9HD 1PFDA 1TT2A 5HFYA 2QIEB 1E9MA 1EYDA 2WXJA 5IGFA 2JYOA 3SE0A 5IGEA 2WAQB 4XWTA 4IALA 1Y8PB 1TWGB 2QSDA 3NUHB 2BS2B 4L6TB 1IKLA 3HUIA 1SE3A 2RDFA 1FEHA 4LMQD 2NTSA 2VZKB 5HHDG 2V4IB 1LTAD 1HRJA 2BOSA 3SK4A 4WRDA 1NCVA 2O5IC 1Y8OB 2BDNA 1EY5A 1H9MA 1TKEA 1K8MA 2NVTB 2PMZB 3GB1A 4KKUA 2B2VC 4OW0A 1BDOA 1A6XA 2V3NA 3QB3A 3HEJA 2OXPA 4N6EB 3CRLC 2F0SA 3G6JB 5LL6X 2L9HA 4H7BA 3P63A 3DM1A 1MI0A 4ZHPA 3MXUA 1XLPA 2IGDA 4IDIA 2E2HB 1SYBA 1MVKA 4OO1G 2WIIB 5LHY1 4HSPA 1NAPA 2XWBB 5ELEA 3ZYYX 4JX1C 3V96A 1GUSA 2PKOA 2E3TA 5HI1A 1FYCA 3VRBB 1A2TA 3DWMA 1EIGA 3T53B 1E2ZA 1O78A 3O13A 4EE2A 2B2VA 1S5CD 4HJGE 2K05A 2XN9C 3S9WA 1OFFA 4CBVA 2C5CA 1FCCC 3CHBD 2KCNA 3DHQA 2EPBA 3SDZA 1XF5L 1PTOD 4KKJA 1NEKB 4H13C 2PZTA 2PW9A 2B8GA 3AMUA 1O7LA 1J7CA 5DAUA 1LV9A 3VYRA 5BYRA 3H94A 4WQMA 3AEDB 3IAYA 1UWXA 2RA4A 4C3IB 3VR3A 1L4DB 2F0JA 4C7YA 3IL8A 4JWSC 3FDTA 3GS2A 1YJIA 3KLSX 1AWDA 5D14A 2BS4B 3NWTA 5NUCA 1X3PA 1Y69U 2K0PA 1ZDVA 1NYQA 1I7HA 3OWEB 3P7JA 2ENBA 5EPKA 1YMHE 4YIJA 4QB4A 1AEXA 2JZPA 1ZXTA 4JPSA 1VMCA 4CJ1B 1SNCA 4DNRB 1F77A 1WTPA 1J9OA 2Y3AA 2B2TC 2K5QA 1PGAA 4HKQA 1SYEA 1Q1BA 3NPPA 2RPVA 5CORA 4ITKA 2IGHA 2K1BA 3SR6A 4NW2A 1L6VA 1E7PB 2A69D 2A6EC 1QILA 1WTOA 5EKIA 4IFDI 2HDLA 2WXNA 3Q8CA 3GV6A 4RGMA 1MGSA 1BUIC 4UDUC 3TMEA 2J42A 1PTOB 1ZYRD 5KNDA 4MN3A 2IJ0A 5JEAG 3E5SA 5K36H 3X3NA 4JWUC 2EJMA 1YNJD 1EY0A 2EY6A 3ND9A 5EBCA 1BR9A 4AYBB 1TS2A 3R3OA 2EYMA 2XRQD 2G1EA 4QUFA 3K7AB 2B2TA 4BWGB 3PZ7A 5JXVA 5KYLA 1XXGA 1HFGA 3W3AA 1A3TA 4XIGS 5C4HA 3S1QB 2E75C 2K33A 1SNMA 4ULLA 4RF0A 1FO4A 3OSOA 1HHVA 4KN4C 4A93B 3D6CA 4K6LA 3T16A 3HRDD 3K6OA 1ICWA 1JOOA 3HOVB 3AM9A 2IX3A 5AUIA 4ILWA 1IHZA 2V0GA 1L4ZB 4IUPA 1IBXB 1SEBD 3C2PA 2W55A 5MPOA 2DNCA 1CZGA 5E4WC 4DK0A 2F0FA 1K50A 4KK7A 5I4DA 2KEEA 3I73A 1TKYA 3SK6A 2KACA 4RNAA 2KJXA 1J8IA 4FXGC 4REZA 5K36G 1IW7D 1T5XD 4DF7A 2L1BA 1SYDA 2IWHA 2ACZB 2NBFA 5I2XA 2M19A 5C44B 4G57A 1O7ZA 1SSOA 3S1RB 1F0ZA 3RD4A 3M7GA 2CJOA 4IUTA 1Z47A 3MWYW 3TBIB 2B2UA 2K03A 2F1MA 3H8HA 3SK5A 2H88B 3AE6B 4IOIE 4QIWB 4C1NK 2Q5WD 2B76B 3TEXA 1JE4A 5CMDA 2EYJA 4US9A 1QWYA 3NVZA 4MHEA 3I8ZA 2IDYA 1HUNA 3LX0A 1SF0A 1CI3M 1EU4A 1WGKA 4B08A 4HROA 1Y8NB 2X69A 2BA0A 5JEAJ 4BA2I 4U673 1ZP0B 2FMMA 2B39A 3UI2A 4RAUC 3NXWA 1Y1VB 4XTCS 4J1MA 4ZRQA 5JPNC 2PIAA 1B3AA 4X3TA 2JP1A 1F9SA 5A2QL 3AV8A 1IGDA 3WDNA 2RDGA 2WXRA 2Y5CA 1R4PB 4CKBA 1TWHB 2BDOA 1N5XA 3AU7A 3NTIA 2QKIC 3GV3A 4R8NA 3AB5A 4N59A 1KNAA 4RGNA 4HN7A 2WXPA 3TEZA 1CFMA 3BDLA 2NN6I 3FRPB 2WXOA 1PRTC 1K8OA 4BBSB 5IIFA 3KLRA 3BK2A 5CGKA 1FFVA 4TRDA 3P1MA 3EQLC 3GTPB 2EJFC 1HXYD 4KX6B 2L11A 3U52E 2SDFA 1ILQA 1LTRD 3I91A 1II3A 2BB5A 3HGBA 3E6ZX 2XWJB 2K22A 2N55A 4IFDH 2OHFA 2GI9A 3U4EG 2D5DA 5CV6A 4DAVA 1HUMA 2IW3A 2K3UA 5ELDA 2AWNA 2KDMA 1CA5A 4BS9A 2DNEA 4ARIA 1TVXA 3R2IA 2BE5D 3TP6A 4L63B 1ZPSA 3U2SC 1NR2A