3EA6A

Atomic resolution of crystal structure of sek
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
DIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQCNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of an Emerging Pyrogenic Superantigen, SEK
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Staphylococcal enterotoxin K
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ea6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ea6A01
1ESFA 4Z9CB 1FGBD 1L0YB 1EU4A 1PZID 1S5ED 1PTOD 4RCOA 1HA5A 1KLGD 3R2IA 1JWUD 3BVGA 4UDUC 1PYWD 1CHPD 1LTAD 1PRTC 1YN4A 4RGOS 1XTCD 4RGTA 2G9HD 3BYTB 1SBBB 1D6EC 5ELFA 5TSSA 3DWPA 3W2DA 1PTOF 2O2LD 3MC0B 1EU3A 3R8BA 2R61A 1M4VA 1LTRD 2Z8LA 5FKAC 1EFID 1RCVD 4DXGA 1JCKB 1KTKA 1SEBD 1ET6A 1FD7D 1TY2A 2XRSD 1PRTF 2NTTA 1LLRD 1I4PA 1SE4A 1SJHD 3GP7A 4O1NA 1LTTD 5ELCA 5I4DA 1HQRD 1LTSD 1TY0A 1GOZA 3TSSA 2XN9C 1EEID 1SE2A 1HXYD 1TS2A 3V05A 1S5BD 1JWSD 1I4XA 1S5CD 1TS3A 1T5XD 1UNSA 1BXTA 1FNUA 3BZDB 1LTGD 1V1PA 1D5ZC 1I4HA 1LTBD 2AQ1B 1EEFD 1TS4A 4OHJA 4RFBA 1S5DD 4RGMA 1I4GA 2XNAC 2IJ0A 1PTOC 4L63B 1G8ZD 3O13A 1STEA 1FNWA 1BCPF 1D5MC 3R2TA 2AQ3B 1RD9D 2QILA 4L6TB 5ELBA 1QILA 1ENFA 1F77A 1FNVA 1SE3A 3KLSX 2SEBD 3BYYB 1I4RA 3DWAA 3EFXD 1AW7A 1YN3A 2NTSA 1CK1A 1V1PB 4DXFA 1PTOH 1CT1D 1SXTA 1B1ZA 3DWQA 3EA6A 1PZKD 1L0XB 1LT4D 1S5FD 2IPKD 4RHRA 5D3DA 1EWCA 1BCPB 1I4QA 1LT5D 1KLUD 3MFGA 1JWMD 1V1OA 2ICIA 4BWGB 1YN5A 5D3IB 1AN8A 2WV6D 1BCPD 1XXGA 1DJRD 4RH6A 2TSSA 3BVMA 2CHBD 1UUPA 1LT6D 4K6LA 1TS5A 1DYQA 1RF2D 4C56C 1JR0D 1CHQD 1HTLD 1MD2D 4ZYSA 3SEBA 2RDHA 1JQYD 4RGNA 1BCPC 2XRQD 5FK9C 3BVZA 1RDPD 1D5XC 1CQVA 3OWEB 1PRTB 3CHBD 5ELDA 4TSSA 1LT3D 1B44D 1LO5D 1PZJD 2RDGA 1SJED 1PRTD 2J4XA 5ELEA 2QEJC 3URYA 1PTOB 1ET9A 2AQ2B 4NZLB 4RHSA 1LTID
chains in the Genus database with same CATH superfamily
4A8XC 1X3FA 2EIFA 1XCQL 1XX8A 2F3VA 1DOKA 3TEZA 3HOWH 1Q3LA 1GUGA 2JXMB 1B3QA 3H15A 1C79A 2OEDA 1QF6A 1S3OA 2ZTCA 3B6YA 5K36G 1YJ1A 1MIUA 1MGSA 4FXDA 4A3LH 4N9PA 4MH8A 2RQXA 1YITA 1EQRA 1HJPA 2LKVA 1KM7A 2KACA 3W2DA 3K5OA 3T1HL 3VR2A 1N8RC 3EFCA 5FO8B 3S1NH 4X3KA 5BR8Q 2NBUA 2WDTB 2W55A 3ABVB 3QARA 4DHZB 4GKKL 2Y5BB 1ET6A 1FD7D 3IXSA 4QAYA 1GUTA 3CCLA 5BYQA 1U4MA 5EGTA 5IO9A 3D0FA 4A3DG 4J6HA 2EMSA 1PFSA 3AMZA 5IKCM 4A3DB 1YQ4B 1WCMH 2AMCB 1EQVA 3B2GA 4H44C 5CORA 2DNCA 1TS3A 2I1KA 3I63C 3TCAA 3OTOL 1GC7A 3TL5A 2AWOA 2QDLA 3U8ZA 4B95A 2E74C 2CWAA 2GLSA 2E2JB 3WANA 3PUZA 4FADA 4K81A 1OQQA 2L32A 4W9KA 4A3JH 1TJEA 2FINB 3KUPA 2BGFA 4WAAA 4NPSA 2H4OA 1B9NA 3MWYW 2QMTA 3VFKA 3L3OC 4HLEA 4V190 5ELNA 1NI2A 1EF1A 1ZYRD 4G0NB 1BO0A 2YYZA 5M3FG 4Y7NB 4JPSA 2Z0SA 3ZYYX 4A6QA 3DXJC 1OQRA 4LUZA 3C3LA 1HE8A 4DR6L 2AL3A 2RPQA 2Z4HA 3NVZA 4A3KH 4AYBB 4ILWA 3HOXH 3TMPB 4E74A 1WMHA 1E8XA 1C77A 2DYMA 4I65A 2LGDA 3GTGH 1EL0A 4BY1H 3S2HH 1E90A 3S9WA 1Q90A 2K5QA 2CS4A 1TR5A 4EVOA 1FRRA 2ZM6L 1UE5A 5L95C 3RN5A 2WP8J 4RHRA 2D3CA 2RCNA 5D3DA 3A33B 3Q22A 3B2FA 2K01A 2YEPF 1TWGH 4A3GG 1NENB 1E0ZA 4DV3L 4ITKA 2GBRA 4M02A 4LNKA 3VR9B 5BMIA 1STNA 2CKHB 3NY5A 2MRPA 1QB5D 3MVVA 1JWBD 3APCA 4A3FG 3GV3A 3PHXB 4BBSB 1FMAD 4BXXH 1PH8A 3M4QA 5BN3A 4NDXA 3TEHB 2JA6B 1Q10A 3H7PA 1L2FA 2FMMA 2NZ1D 4B9XA 1Q8KA 2KT7A 5DEHA 1HR0Q 3U7DA 4OEMB 1YVCA 4LF5Q 3D32A 3TEWA 1XLPA 3MXUA 2EYOA 4DR5L 3ZDTA 5FK9C 1UF0A 4KN7C 5FJ8G 2F0HA 2Y0SE 5JJKA 1BUIC 3PUWA 1V8QA 1EZ6A 3M4PA 5T1GA 4F88A 1N63A 4GGQA 2EJFC 1U9RA 2DBYA 3AEBB 4W9EA 4I7AA 2D07B 5GADC 4AS1A 4I7ZC 3S15H 4N58A 2K14A 4RHSA 2N78A 1Q82C 1LTID 2E2HH 2WLBA 3ULPA 1HFNA 1NEKB 1S5ED 4IPGA 2H5XA 4RKLA 5FO7B 4FJYA 1ENAA 2ZT9C 2EJMA 3CCEA 2IO3B 2LUMA 4LTUA 3K59A 1LTAD 1QUQB 4HIMA 3KQ4A 4KY5A 2WQYB 2Q8IB 2FAZA 1RLFA 2EXZA 1JMLA 2D5DA 1VZ7A 4IWOA 2DJFC 3H6MA 3JC66 3HOYG 2KCNA 2Q8TA 3TBLD 2MW5A 3VYSA 2KQ7A 2JUOA 1UGJA 1EU3A 4IFDI 5C44H 1D4BA 2BA1A 5IYBG 2N1VA 2EJGC 2OHFA 1CZGA 4O42A 3KLWA 1WYGA 3F2UA 3E3XA 4Y52H 2XBBC 3ZLZA 1V2YA 3GP7A 2E2IB 1H8CA 3F1ZA 2IO2B 1JE4A 5K5PA 2BYVE 4QIWB 2L0CA 3KLRA 2G4SA 1SE2A 2F0EA 3V05A 4DAYB 1YHQA 2LFNA 3FDTA 5KGUA 4XQQA 1VQMA 2E76C 4H02A 2PCFB 4DV6Q 4IC7B 3KBGA 4JI2L 1OFFA 4MZ9A 4A3JG 2VS1A 4NAWB 5GAEC 1U4LA 4ZK9B 3N32A 3GTLH 1A2UA 5NUCA 3U58A 4US9A 2OJRA 4GOCA 2JA5G 5EBCA 3T3OA 3WOEA 4S3SA 4A93G 4LK1C 3APFA 4IM2A 4P16A 3L9AX 2K1BA 2SOBA 1CA5A 1CKMA 2L55A 3PUVA 2ZZPB 4MACA 3HOZB 2L12A 3K7AB 2IX3A 4A3KG 3Q8AA 1FXTB 5AZFA 2KWUB 3NTHA 3DVGX 1XJVA 1FNVA 1CSPA 4AH6A 1C7YA 1AW7A 4IJHA 2F4VL 3N1XC 3T1YQ 4OONA 2KTRB 3VHTC 3EA6A 3AECB 1D1IA 4HVBA 4IDIA 2MCNB 1V9JA 3PUYA 2DZKA 1PGXA 4C1NK 3J80E 3OW2A 2INPE 4MJSA 4DA2A 4W9IA 2Y0SB 3DWGC 4CYEA 5AZGA 1L7YA 1E7ZA 2M4NA 1JWMD 4AQYL 5CV7A 5J22A 1VMPA 1BCPD 1XPOA 3J7A5 2QCZA 4U673 3A4SC 3RD4A 1A6XA 1G2TA 1WXSA 4XT1B 3TP7A 2K28A 1STAA 2WB1E 4C56C 1WZ3A 3AFQA 1II3A 1QNKA 3L4PA 1DCZA 3KF6B 1WE7A 5KNDA 2AUJD 4R8IA 2IY1B 1IBKL 4UP7A 1SDFA 3M7GA 4MT5A 2L1BA 4FYDA 1P3QU 5JHBA 4MELA 2UUBL 2B8GA 1I6HH 4PZ6A 1RWSA 4R3DA 4TKNA 2EXDA 2KOXA 5EDSA 1C9OA 1HZBA 4A3IG 3IVFA 2VH1A 2ENBA 3H1UA 2L4NA 2KHSA 3H3VH 5I2YA 3NPPA 3CQZH 1TWFB 3DWAA 2KTRA 2M1MA 4IUTA 1GB1A 1TWHH 2P5ZX 2WNMA 1E7PB 4A3KB 1PA6A 4DAYA 3I55A 4R4OA 1JT8A 3R2IA 3ND9A 4UDUC 2K4KA 4P74A 5J3BA 1IUEA 1E6EB 1YMHE 1J7AA 4D2KA 3QR8A 2IHFA 4RGOS 2YEPB 4N6EB 3ZVVA 5CV6A 3TMEA 2NBWB 2FIDA 3GD7A 1QWYA 3RNGC 5IAAC 1D6EC 4W9FA 4LNOA 3GB1A 3PV0A 4NJ7A 3RZFA 2N1WA 2NBVB 4JWUC 4P6VF 3QOJA 1DOXA 3GTMH 4P7IA 2RD0A 4QGUA 4XC2A 2K04A 1KQSA 4OZBA 1SF0A 4R4IA 2ON8A 3HOUH 2XRSD 2MA9B 3W1SA 1I5FA 2HDMA 2KAJA 1CFMA 3P63A 3PZ7A 1EF5A 1STYA 1R7SA 5C6AA 1SROA 4JI0Q 2N7DA 2K52A 2QEXA 3S1RH 2KFKB 4C3HB 3VDYA 3ULLA 3KUCB 4HIOA 1BXTA 3BK2A 2WINB 1K3RA 2KX0A 4XQJA 1AEXA 2RGFA 5C5MA 3L7ZC 4BOSC 2OF1A 4OHJA 1MPEA 5IGFA 1WY8A 3LYYA 3QJZA 1T0SC 1TBEA 1V81A 1C9FA 5FOBB 1MJDA 4NXNL 3GTOB 1YNXA 3DHQA 3SHLA 1IW7D 2ZPNA 3MXGA 1XEEA 4HSPA 3HG9A 3LWUA 3EECA 3MJWA 1ROEA 4ASWC 1G51A 4W9GA 3E0JA 4DBGA 3RCZA 4BVUC 4KDIC 2HCCA 2ID0A 1MSGA 3J7ZC 3A74A 2JZZA 1CI3M 3QWZB 4KKIA 5GAHC 2PKOA 5HY6A 3STBC 3T53B 3ALBA 4BKTA 4DXFA 2FUG1 2WGSA 1NCVA 2KHIA 1KL9A 1HNZQ 1S4ZA 4PMCA 2JZPA 2FMCA 1QKZA 5H92C 1P0RA 3PVLA 3ZTDA 3DOWA 3WWVA 5ISRA 4U68A 2PQEA 2DY7A 3IT6B 3ZJVA 4ZDVA 5D3IB 2L8JA 1VMCA 4X3SA 4FXCA 4KIKA 4IOAA 1SNDA 2WXOA 5AZHA 2ZVOA 3OG5A 2BT6A 1C4AA 1UGMA 1E2WA 3D6CA 3M3YH 4K7UA 1HTLD 3SR6A 2NVYB 3AEAB 2EY1A 3ZJUA 1EIGA 1V1QA 2KECA 4ME3A 5E7NA 2L0TA 1L6VA 4M0WB 5IOCA 3J81i 2GBMA 1VCIA 1PRTB 1C4QA 4N8FA 3A7LA 1W6JA 3NZUA 3W1SC 4ZYNA 1W3SA 1AE3A 3U4ZA 4JOIC 1TYGB 1WXQA 1SJED 2K5PA 1BQQT 4OGQC 3P4SB 2PO4A 2LY7A 4YSZB 3S2HB 4NZLB 1QOFA 2A6EC 4K8IA 4KKUA 3HOXG 2B2UA 4DR5Q 1BBXC 2KNBA 3CD6A 4IOIE 1J5EQ 1IGCA 2KXJA 1PTOD 4C3HG 4OW0A 1U4RA 2Z1CA 3S24A 2AKWB 3SK5A 2O6VA 1GM5A 3HZXA 2A73B 4L8JA 5AUKA 3OYYA 4RGTA 3W9CB 3NUCA 3DBHI 2AHOB 1E8WA 3GZNB 3TDQA 2WXRA 3DHIC 1A3VA 1GO3E 3ONAB 2O2LD 3K5LA 3K0YA 5EKKA 3H09A 2Z6KC 1EIYB 2R61A 2NZOA 2CH4A 2WXIA 5EE9A 1Q81C 2BS2B 2Z8LA 4EZLA 2MO1A 3KYDD 3VH4B 3GQBA 3KUZA 1W2BA 3KDFA 1JJGA 1JRUA 2H88B 3CIRB 1KABA 1TWCH 2W3SA 5ELCA 4YY3Q 3TUOA 3X3MA 3LDZE 3I4NH 1WI0A 3LJ3A 2RKSA 2HCIA 2RF4A 1CA6A 3C0RB 4XYCA 1S5BD 1TWCB 3I73A 2KJ6A 1J6QA 4K7SA 4DV0L 4HKQA 2SNMA 4FXKC 4FO2A 1K52A 3M95A 2B3AA 2BH2A 2XSCA 3RMHA 3M4OH 3IBEA 3KBXA 4JV5Q 4G50A 1GHJA 3KF6A 3S17H 4FBJB 2K5VA 3MXNB 3T4AC 4PS3A 3U2SC 2WX0A 3K7UC 1N33L 2FHTA 1WYDA 4MGKE 1Q12A 5HI1A 1WX7A 5JJIA 5G3LF 3QCAA 1SNOA 3O65B 1Y1VH 3PTFC 1EUVB 3KUDB 2FUHB 1RTNA 2C5CA 2HJ1A 2NCNA 4AWJA 1EYCA 3HOWB 1WJJA 2WIIB 4MIUA 2B63G 4KSLC 4YCUA 1WR6E 5BYRA 3W1YA 1Z7TA 3I4NB 3RD2A 1SGHA 2UUAL 3KWVA 3WOFA 1I4RA 2LI5A 2JA8B 1QZHA 3FILB 3NZSA 3BZKA 2W54A 3HOVG 2VQEL 1B8AA 1LTLA 3OAWA 4J6IA 1ESRA 2JSVX 2HE7A 4WJQA 2SAKA 1NUCA 1U4AA 4V0BA 5IYBH 2JJQA 2MP1A 4YCVA 1K51A 1WTWA 3BS1A 3BG3A 1J7CA 4N59A 2YU9B 4BA1I 4KHPQ 2K33A 3A8JE 2CHZA 1PH5A 2AWTA 2IGGA 3WAPA 3K57A 3S14B 5LMNL 5DM73 4QCLA 2DGYA 4HRSA 1JOOA 2F0NA 1JQ4A 3AE3B 2YTVA 4RF1A 1TS5A 1DYQA 4WJOA 3OMCA 1CHQD 1MKHA 1SLJA 1RM6C 2ICEC 2DJGC 2F0TA 5FO9B 2LMCA 3UQAA 5C4JH 2CH4W 2MBEA 2Y0SG 3BVZA 2FCQA 2PMVA 3NRZA 4A9AA 4X66Q 1ZXIA 2QDFA 3AYHB 3VDZA 4OIJA 4YTNB 2B2VC 3PSEB 3Q14C 1Q5WB 5CTRC 3L2PA 1N60A 2WX1A 3G7LA 1YOVB 2I38A 4LCDE 1F52A 4HK2A 1QZEA 3KWLA 4BKGA 4XDXA 1F9JA 2CHWA 3ZXVA 1XLNA 4ZQ3A 3OLMD 1L1OB 2N9KA 4MDKE 3I8ZA 4H13C 3U30A 3A1QA 2IT1A 2L5TA 2K32A 5C0XG 1JC7A 5M3FB 4XWWA 1A0IA 1OXXK 3V6CB 2EE1A 2UUCL 3S2DB 2A5UA 3AE5B 1E3PA 4LDTB 5DCNA 1YQ3B 4M8MA 1VQKA 2HQLA 3IFDA 4YY3L 3L17A 3AFPA 2K5HA 3MC0B 1ICFB 1FRDA 3DM3A 1PFNA 1QOHA 1CZWA 1O7LA 1E1TA 5EKIA 3T9LA 1XNRL 3X23A 2MHJA 4HIKA 1EFID 2GBNA 1Y1WB 1JCKB 2KMAA 1KTKA 2KX3A 5G5GA 2LGYA 3E6ZX 4DV4L 3GTQH 4TQUS 3J81c 4NKLA 2F0OA 3VAWA 4TVAB 2NTTA 4QF4A 1EY7A 3OSOA 5COYA 3WAMA 1F2RI 1S72A 3RZOH 1PFBA 4AJWA 1Y8NB 5IGBA 1TS2A 1SYGA 1LXDA 2O5IC 3CAMA 4K2LA 3VR6A 4DK5A 5AJ3Q 4DFAA 3CCRA 1F2LA 3HOUB 4Q2JA 4LF7L 2EOTA 1Q7YC 2R92G 4XZ4A 4DPGA 1D5ZC 2KDBA 1NR4A 2KCMA 1Y56A 1KAWA 2PMZE 1TWAH 3T1YL 4X6AH 3J9CA 2KQ4X 3PO3H 4N9F4 4BBRH 2J52A 3K9OB 1F9RA 1N33Q 4G4KA 1F1HA 2FXQA 2UWQA 3PT2B 3GTPH 2KZRA 1KRHA 3RMKC 1VQAA 1H9SA 4GLVB 1N34Q 2QIEB 3HRDD 4GU2A 2BF8B 2J0MA 1X55A 1F77A 2GVAA 4K3CA 2F0QA 1TWHB 4B3TL 3JSVA 3E9SA 2RMMA 4X3TA 2NVUI 1VQCA 3EQLC 4OWXB 5M5XB 3UI3A 2A4ZA 1C48A 1RKNA 5FJ8H 4JI5Q 1VDZA 4A3BB 4CDCC 3K5MA 4A3OA 5LMNQ 2X6GA 1SR3A 2F0FA 3RR5A 3PIP3 1QOBA 3ER0A 3U4EG 1BKBA 2DHZA 4II2B 1RFAA 2K3UA 4CO7A 1UZXB 3AN1A 1STGA 3MFGA 4IOCA 4OVVA 1Q0WB 1CQFA 4RG1A 1NI3A 1UE6A 3R3OA 1XXGA 4GZYC 3DM1A 1E8ZA 2NVYH 3H7SA 2ASQA 2CHBD 4P1BC 1I3QB 2R7FA 1PH3A 1GJXA 3U4VA 2WXQA 4BZAA 5EPKA 3CQZB 5C4XH 4K1RB 2NPTA 3U7ZA 4M8AA 2OCEA 2MGSA 3SEBA 3GS2A 1X9NA 2JWUA 5HG2A 4RGNA 2G4DB 2KCTA 3I72A 2GMIC 3DHHC 4DV5Q 1AE2A 2F0PA 1J0GA 1CQVA 2K50A 1VQLA 3CHBD 2D10A 3K8AA 5ELDA 5C44G 1N34L 3Q6SA 3Q8BA 4MEMA 3QK0A 1EUJA 2R93B 2KD0A 1LO5D 3H0GB 3S2AA 4HJ7A 1IBMQ 2JA5H 1JICA 4M8NA 4KZ0A 4A93H 1QVCA 4PNYA 5IP9H 1QLBB 3VH3B 1GXDC 1GKHA 3VYUA 3AXCA 1L4ZB 3FHWA 1XF5L 1ZKHA 2N9LA 5EPJA 2LXJA 4FHKA 4HJ5A 1P8LA 1GNUA 2LEKA 1X3EA 1C4CA 3Q23A 3ZRFA 2KVZA 4FULA 2GN5A 4J15A 3I4MG 4R1JA 4HPPA 1FO4A 3BVGA 4A76A 3ZO5B 1WCMG 1PRTC 2B2WA 2K22A 1Y8RC 2M8SA 4USAA 4BOZB 2V1YA 2I2YA 4DR2Q 2J7ZA 4JI0L 4DR7L 1HZ5A 1X54A 1L0WA 1KDAA 2WXFA 4A3LG 5DPSA 4KZCA 2BBCA 3M85A 1L5PA 5HGQA 2VL6A 4X62L 3IT4B 1X65A 1M4VA 1VDVA 4KJNA 5IY0A 4AP4C 2INDC 3RNCC 4IFDG 1XNRQ 3K9PB 3VYTA 4OO1H 2JU6X 1X3GA 3J7AV 3GTGB 1LLRD 1SE4A 4HMJA 1HHVA 1MG8A 2QJLA 3PF4A 4H7BA 3GTJB 3RNUA 5I9PA 3GO5A 1QNUA 1AARA 4BBNF 4BS9A 2JE6I 4A3FB 3I4MB 2G45B 1I4XA 4TQ1A 3CCMA 3I57A 1WSPA 4JI3Q 1VQDA 2WAQB 3MTSA 5C0XI 2Q2TA 3GTPB 1PQSA 3HP3A 3A9JB 1WYWB 2A6ED 1VQ7A 2VNUD 1FXAA 2LXAA 1LTBD 1WX9A 3Q3JA 3RZDH 4BBRG 2NR2A 3ZNZB 3GTLB 1SYCA 5JOBA 4A3GH 3FRPB 1EM7A 4JLCA 3SU8X 1EY4A 2AQ3B 4J1MA 4Q0FA 4II3B 1GD7A 4KD3A 1K73C 2IYDB 2BB5A 4HJGE 1VLBA 3GTKH 3SDZA 3HOZG 2PE6B 4MGZE 2BYFA 3PQIA 3W5UB 1KC8C 4PS7A 2B2TA 3WAOA 2LS01 2KC2A 2UXCL 1NDDA 1XWEA 5EKLA 5C44B 3UGBB 2F0VA 3E5SA 3EN2A 5JVG3 3CWIA 4RAUC 3LWEA 2N55A 5IODA 3P2BA 1BCPB 2GBKA 2M56B 5IN7A 2EPBA 3IG3A 4LLGM 3U9SA 4BWGB 2FIFA 1V43A 1N32Q 3V61A 4KD4A 4HTHA 1NVID 2XGTA 1K83H 2BYEA 4RWSC 3R7QA 3VA7A 4LW1A 2CR5A 4DR1L 4BBSG 4DDID 1EY5A 1S3SG 2KUMA 3AI5A 2QHOA 4FXGC 4H2AA 3I90A 2IL8A 5A35A 1NR2A 4HCEA 5DPRA 3VXWA 1YHAA 3ZUNA 2IGDA 1JORA 2MSED 2WWZA 1KH0A 4G57A 1BR9A 5C2TB 2JT4B 1HR0W 4TSSA 5EE0A 1B44D 3NVWA 5IYDH 2KVMA 1VQPA 4LWCA 2BB6A 5D14A 3HHMA 3HKZE 5D2MB 1RAXA 2ES2A 4QUFA 2JYTA 2HIVA 3DVGY 3LNNA 4RNAA 3SFDB 4EEWA 4EQ5A 4GXBA 3L16A 3NVYA 3BU2A 3DPDA 1JWUD 3B0AA 3FVQA 1ISNA 1RODA 2QA4A 1KXLA 2PNHA 3KH0A 1HUNA 4YXDB 3VR4A 5AEKB 2KJXA 2MP2B 3DWPA 3WA0A 1A63A 2DYOA 4QQBX 2L52A 1BT0A 1LTRD 1NBWA 4IJLA 1XT9B 2E2JH 1DGJA 1L1OC 4JI6L 2I07B 4KI0A 3TRZA 2D5GA 2EKIA 2SNSA 2QW7A 4MSMB 1A3UA 2DNFA 3EJIA 1LTTD 1UE1A 4FF2A 5LLIA 3B9JA 4JYAL 2HDEA 4AUQC 1HXYD 2PZTA 1TT2A 2JXXA 2ZEQA 5IGCA 2UUAQ 3Q0AA 1JWSD 1I94Q 4B3SQ 5DPTA 3APDA 1SFOB 4A90A 4CJ1B 4KGTA 3Q8FA 3SK4A 3RN9C 1R4QB 3G71A 4PK1A 1T0QC 1A8VA 3L08A 4JI1Q 4MHEA 4OO1I 1K8RB 3S1NB 3MHSD 1QVGA 2PYKA 1SNMA 1UWXA 2B2WC 2CU1A 1B4OA 2L7RA 4URKA 5E6OA 2BE5D 4DR2L 2KCCA 1EY8A 3CPFA 3AE1B 1Q86C 1ICWA 3F2DA 5E6JA 2UYZB 2WU5B 2WXKA 4ZHPA 5IGGA 4DR4Q 3DBRI 3FAHA 2UU7A 2C7HA 2YTYA 3FP9A 2FBWB 4CBVA 4L1BA 5J39A 4A3DH 1XMQL 3OWFA 1R4MI 3I3TB 4A3CH 1XMOQ 3D8GA 5C3XA 3I56A 2ZW0A 3NENA 3QWNA 2D11A 3CXCA 1KLVA 4ZRIA 4GDLB 4NAWA 3SD5A 3N9YC 1ZKOA 4FLHA 4A93B 1C8CA 2HD5B 1Z47A 1K8OA 1I35A 3VTUA 1VQHA 2MP2A 1KJTA 4E6IA 1M1KC 1QCBD 4A3PA 4I6LB 3I4LA 1O80A 2F3IA 3N6RA 2ICIA 1WF9A 3NOBA 2LD9A 2JN4A 1GHKA 3S2DH 1JOKA 4B3SL 1XCTL 2DNEA 4KVGB 1FCCC 4NMZA 2VQEQ 3C1EA 2M19A 3UDXA 4BBNC 4CHTB 2ZM6Q 3TN2A 1D2BA 4HN7A 1HNZL 2ZXPA 3TIXA 4LF8Q 1J8CA 2CVRA 3DBRB 2L15A 1JR0D 2ZCCA 3ZJYC 4DV4Q 2CQOA 4JI6Q 5HURA 1QOAA 3FILA 1YJWA 5FLMH 3Q3MC 1SE8A 2XRQD 3I9V1 3KFUA 1LM8B 4DR7Q 3N1YC 5IT9L 1AZPA 3A1QB 1PV4A 2RSOA 4CKCA 2YV5A 2RDGA 4GNXB 3AH7A 1BUVT 1PRTD 4DV2L 3FKYA 1DOMA 1QZGA 2KMCA 3L54A 4ZOHC 1UWVA 2BCOA 3PIPA 1HH2P 1R9TB 5IWAL 5CBAE 1XQQA 3MJ5A 3E0EA 2WAQE 4R4TA 1WM3A 1CSQA 2LASA 4WH4A 4LF9Q 4Y7NH 3S16H 1CZPA 2CJOA 3AE4B 3QX1A 4POGA 1B2TA 4LFBL 4ODGA 4DUYL 2BDNA 2HHHQ 3ML9A 4DK6C 2F0DA 4P75A 4BBRB 2A6HD 1DONA 4DHJB 4JCVE 2J7QB 2N88A 4HJKA 3TREA 3I4OA 2JA7H 2C7NB 2V4LA 3NS1A 2RHQB 4NW2A 4PYZA 5CHFA 4JBMA 3Q3NC 5FKAC 5F2DA 1N36L 4LUVA 2KWVB 3RLNA 1N62A 3BZCA 3AMUA 2Z0DB 4WJPA 1TY0A 4KY6A 5IGEA 2JK8A 3WIMA 2DY8A 1K8AC 1XD3B 4K0KL 3I7FA 1SRUA 1DOIA 1FPYA 1QT9A 2IHEA 3CC2A 1B3AA 2EMTA 2ZNVB 1C4PA 2O2VB 2ASBA 3ZTCA 4KK7A 4EQOA 4C7ZA 5LHY1 3HUIA 3CF5A 5JH5C 2XNAC 1TZ1A 4PT5A 4UPAA 4ALPA 2PVGC 1OEYA 1IP9A 2N9PC 1WD0A 4AOFA 2R2OA 4NXNQ 2F0JA 2HD3A 5HKHA 2BQQA 1VD2A 4YIJA 4J8QA 1HTOA 1RD9D 3C2PA 5E6PA 1A15A 1ML0D 1F9PA 2ALYB 1VQ5A 4L6TB 1X6OA 2LRUA 1HNXQ 1Z9FA 3IRBA 2XTIA 1T9HA 2X6LA 4JI1L 1WXMA 2I5LX 5C3EG 2FE8A 1NMGA 1SXTA 3TJPA 4JVZA 4TV3A 4IUQA 4OVUA 1IBLL 4GOPC 3GTMB 1UWMA 4EE2A 1D3ZA 3CCJA 3S1QB 1YEZA 2KN4A 1P16A 4R4QA 2K39A 1PMRA 3SK6A 4P73A 1V1OA 1K0RA 4PZ7A 1WH3A 4GNXA 3BK1A 3GZNI 1Y69U 3KDFB 3S16B 2WDRB 1TXYA 4L5QA 2MJEA 2AX5A 5BYSA 3PO2B 2A6HC 1IBLQ 1WGKA 2TSSA 2IZVB 1C76A 2KLCA 1WZ0A 2DUDA 1RF2D 4IKGA 4GIVA 4FDBA 4LFCQ 4OX9Q 2KFKA 1K8GA 3PF5A 2LJ5A 4DAMA 5JPNC 3NK9A 4TRDA 2PTLA 1H9RA 3VR8B 2INCC 3RI7C 1RDPD 2MJDA 3KJPA 4ABNA 3J80i 3BDOA 2JPHA 4KGSA 1GUAB 2NN6H 2EYHA 5IGDA 4RKBA 1WOCA 1UD7A 2V1CC 1KAAA 2NPTB 5BN4A 1WXAA 2YLMA 5ELEA 3V60A 2PMZB 2XVSA 1IGDA 3CCVA 4X57B 3I2ZA 3UINB 2WFWA 5C3EB 4I6PA 3L10B 4DK1A 2NB0A 3HVDA 1WGHA 5C1ZA 3OPOA 4Z9CB 4KX6B 4ZRJA 1L0YB 2A1AA 4B9KA 1PDQA 1J8IA 2GVBA 1KLGD 2X69A 4H0LC 3I91A 1GB4A 3TQYA 4PS8A 2KN5A 3ZQ4A 3DEPA 4HMIA 4R9WA 2JA6G 2BWES 3W1BA 3RT3B 3NBHA 3UF8A 2F0UA 2NZHA 3PZDA 1E7VA 3U52E 2DN8A 4MNOA 5TSSA 3RZWC 5AUIA 1Q1BA 2OQ0A 4F7XA 4KHPL 3GTOH 4KKSA 2LSSA 4CKEA 4DDGD 1STBA 4LDTD 4P1CC 3KW5B 3ZNID 4K14A 1GVPA 1BMLC 1ZW7A 3A4RA 1JROA 1KOTA 4JBJA 4LF4L 1PUTA 3K5NA 2WXNA 2OEOA 4B0MA 4IWPA 1YHBA 1EWHA 4EFOA 4JWSC 2NWGA 4C3HH 4M00A 4K5XA 2W82A 5LMNW 2F3WA 2G5DA 4C4VA 2KO3A 1UBIA 4DUYQ 2PLPA 1F2YA 3A55A 3HGBA 3PREA 1T5XD 3A56A 2B2UC 2SDFA 2VZKD 1CKNA 1DD2A 2A68D 1YX6B 2CJNA 4IQZA 3CU7A 5CV5A 2HHHL 3NHEB 3UQBA 2F0LA 3SR1A 3EVQA 2B3GA 2KFJA 3ZNHB 4GNXC 4YTPB 1IYFA 1PYBA 4MJSB 4LJPB 1PTOC 2Z4IA 1G8ZD 4S17A 2AYOB 3RFZB 4JG2A 4CDEC 2V3PA 5C3JB 4HSVA 1IHZA 1WTVA 1C0AA 3MC9A 2EYJA 4M0WA 3R2TA 1T6BX 1AYFA 1UEBA 3DHGC 4LFAQ 1L0VB 2QILA 1F2RC 3ZW3A 2D2QA 3S1RB 3K0XA 3NBHB 5LMUL 1IKMA 5J18A 4HEA1 3W5OA 1D1KA 1IBML 1MHHE 1QJOA 1ZEQX 4LFCL 4OX9L 3G48A 3EFXD 5I6YA 2D3BA 1B53A 1V1PB 4WORA 1B1ZA 1ACCA 2REXA 4MH0E 1A2TA 2IGHA 3TEYA 1H9SB 3PGEA 4NJCA 1S5FD 2O6VD 2IPKD 3HOVH 4A75A 4DV0Q 4UHVA 2LHEA 1V97A 1P7FA 2DENB 3KK7A 3MFYA 3ULJA 5IE8A 3F2CA 1GUWA 1LT5D 1O7IA 1KLUD 3MEFA 2ZJQA 5E4XA 1N36Q 4ZLTF 4DHJD 3U50C 5L37A 4DV3Q 1BF4A 4PMBA 2KLGA 1N5XA 3AV8A 1H95A 1KRSA 4HWIB 1YNJC 2B2YC 2QDBA 1TKGA 3L0OA 3GDEA 3TP6A 1ENCA 2EYLA 3NTIA 2Z59B 4FJVB 2PNRC 3CW2C 3AU5A 2MQHA 1HTPA 3QIAA 2JYOA 5IT9E 2I0QA 2PQAA 2F0WA 3EROA 4YCWA 5IP4D 1G6PA 4A3EB 3T13A 2JEAI 3QB3A 2PI2A 4XDCA 1D5XC 3Q8EA 3P20A 2EY5A 4J3OD 2R93H 1ZOYB 5IP7H 1JE5A 2EZVA 1PH7A 5IT9c 1LV9A 4LFAL 3SE0A 4IFDH 4HIDA 1XO3A 2Z6BA 1PH6A 1J5EL 4NNJB 1HZAA 1SMXA 2GI9A 2F0KA 5KYIA 4DV6L 2NMQA 3VRBB 4XYOA 1AZQA 1EU4A 2F0IA 3KOJA 5EAYA 3IAYA 1MHXA 2KANA 4KKJA 3L13A 3K81C 2JA6H 1FIQA 3DCGA 2KEDA 2MLBA 3NJTA 3HOZH 4GOPB 5C0XH 1YNTE 1XTCD 2XEWA 4AIMA 4WJ3M 2JRHA 3MTNB 1YJIA 1TZOA 1SE9A 4A20A 2EELA 4NJ6A 1K8MA 2DAFA 4ICUA 3RZDB 2NVXB 1UE7A 5C0XJ 1YJ9A 4BY7H 1Y8PB 1MHWC 1M90C 2A74C 3G4SA 1P1AA 2O2VA 2WXPA 3LB8C 5G2NA 4PG3A 3CRLC 3OJ3A 3NXWA 1EY6A 1WE6A 1MSHA 4IUUA 2LGXA 3Q3FA 3A9KB 3D3RA 4IALA 4IUNA 4YSYB 2WS3B 4YWLA 5FLMG 3ZKJC 4C2MH 4BA2I 1SIJA 2ZXOA 1NY4A 4LNNA 1UNSA 4EX5A 3DQVA 5FR6A 3SDLC 3R7RA 4A3GB 4XX5A 3HRZC 4GN4B 1E7UA 2JF5A 4RFBA 2AQ1B 4K5VA 1EEFD 1E1OA 3PO3B 1S5DD 1H9JA 2B39A 2K8HA 4IPHA 3FPPA 3SK8A 3I3CA 4W9CA 4NP5A 2C5LC 5JHAA 2E3TA 1Q1OA 4NY0A 1GUSA 3K6OA 5I9OA 1ZPSA 4F8MA 5IYDG 4BKSA 3M9BA 3VUXA 2KENA 4IPCA 1XPUA 1EY0A 2LGIA 2R3ZA 2RCFA 1PXUA 3E9HA 3AE8B 4G7ZC 2WAQG 4XIGS 2ZNVC 1ZXHA 2WXMA 1SE3A 3FMCA 1D8LA 1V9PA 5FLXE 3GTJH 2A5HA 2RPVA 3I5JC 4ME5A 2WKDA 1YN3A 2NTSA 3PRPB 5KIXA 1PH1A 3OHXC 3JAMi 3CF6E 3CSTA 5C4XG 4JQWC 4RM8A 4NPNA 2PW9A 2CQAA 2E75C 2JA5B 1G2SA 3H3VI 3DBHB 2PW7A 4BY7B 2VB3X 1YX5B 2CW0C 3PO3G 4HJ9A 5DM63 4R8NA 5C4ZA 5AJ3L 4DR3Q 4ZHOA 5H1SE 1T3QA 5CYUA 4N8X1 5CX3A 2N0SB 1EFWA 1GPXA 4B3RQ 2B76B 3AULA 2XWBB 3AU4A 4ACFA 4E71A 2Y5CA 1NE3A 4OVZA 5JZEB 2M9VA 2BPSA 2K9XA 2L0FA 4MGYE 1Q1EA 3QO2A 1BBWA 1HFGA 3OJ4B 2CHXA 2E2HB 3AEGB 1VQGA 2R6GA 2OOBB 1MJCA 2Q2HA 1NYQA 3S15B 4DR6Q 1GUOA 3R3MA 3G6JB 3Q6BA 1YD8U 3W1GA 1Q46A 4GOPA 1Z2MA 5JEAJ 4ANVA 4LJZC 1VF7A 5G5HA 2MX2A 1U0LA 2E8GA 4OWWB 5GQOA 3HIZA 3RNAC 4C3JG 4GLSC 4Q5VA 3GE8C 2EDGA 4YHHQ 3HVZA 3RNEC 1VR9A 2NVTB 4A3EH 4DNRB 3H94A 1BVSA 3CP0A 4XE0A 5A2QE 2IY0B 4DGZA 1NJIC 2PJHA 3H91A 3V3XA 3HOXB 1I3QH 3ERSX 2AL6A 2V9HA 1VQIA 2KYWA 1HA5A 1VF5C 2B2YA 2NVQH 1PYWD 4WQOB 3K7AH 1YN4A 1SMYC 1VJKA 1EZ8A 4GN1A 3IKJA 4K0KQ 1N5WA 2OT2A 2A69D 3NG0A 1IBKQ 4CQNA 5T8IA 1G6JA 1SAPA 1TWGB 1VQ8A 1I7HA 1Z5SB 2JXTA 3DUZA 2OTJA 2D3GA 1A3TA 1BNZA 3NP8A 4X64L 1IZ6A 3AU7A 1WFQA 1BOSA 1MG4A 1ZP0B 1FYCA 1N32L 4DXGA 1WX8A 4IPDA 4WURA 1TY2A 1YNNC 3QC8B 1XLQA 2K75A 3MAQA 2BYTA 4BY1B 1PRTF 1F9SA 1FL0A 3D31A 3P7JA 4C2MB 4NQLB 3I4MH 1HQRD 4B3ML 4IWQA 1NYRA 3Q2AC 4B9WA 1VCBA 2RVLA 1VQOA 1ZE3D 1PHJA 2MUYA 3QA8A 2G1EA 3P75A 1HNXL 3BDCA 5FLXL 4DXAB 4ULLA 4LNQA 1EIHA 1R4NB 3ONSA 2K8BA 3ETRA 4WWPA 1WRDB 1PFMA 5J1ZA 3ZGZA 5IWAQ 1TQOA 4IN3A 3UI2A 2NVXH 1V8CA 3JW0X 2RBMA 1FFVA 3RNFC 4L63B 2D2CC 3EC8A 3CRKC 3NSWA 3KYCD 2M2LA 3O13A 1IKLA 2L3ZA 2PPBC 4FHJA 4X3UA 2ATWA 1AP0A 1MI2A 1WXVA 1PH9A 2A68C 4GLXA 2TMPA 4XDDA 2E2DC 4UP9A 1XNQL 1KF6B 3DEOA 1WTOA 5E4WC 1LACA 4WQMA 1NTGA 2KA7A 2WB1B 1YIJA 4LF6Q 2EYPA 2GA4B 2RA4A 3BIID 2WYQA 2ZCBA 3ZXRA 5EJWA 2I1JA 2L76A 2C7MB 1O78A 2WACA 1F2MA 2LWPA 4US8A 1T0YA 3VUYA 2PPHA 3KF8A 5CV9A 2JX5A 3STBD 4EGVA 3PRZA 4JX1C 5E6NA 2Q2UA 3C1FA 2PQAB 2ZJPA 2WXGA 2FCNA 4XTCS 1HR0L 3DVNU 4UP8A 2IO1B 3D4WA 3AEVA 2DLBA 2JP1A 2M17A 3IHPC 1NAPA 3KLSA 2EVBA 2NUCA 4K6LA 4PYUA 2VW9A 1P7EA 1VZ8A 3H8HA 1YIWA 1WGDA 2KWCA 4IURA 5KEEA 5JJLA 4BBSH 2GBJA 3RUIB 3MEHA 2BKRB 3QQ8B 1WD1A 2VUMH 2RDHA 2VB2X 1XMOL 3SGIA 4B6WA 1EOVA 3ITPA 2DX5B 2IDYA 2CFMA 1YJNA 3OWEB 1E9MA 1L1OA 4HPLB 1PGAA 3EFUA 1OXVA 1FXIA 4B08A 2B2TC 1I50H 3HOVB 4MM3B 3TEXA 1YJJA 4B3TQ 2F0MA 5JPMC 4LUOA 1OGWA 2J4XA 3T56B 1CUKA 1KNAA 1VQJA 2QEJC 5C4JB 2Z0EB 3RPFC 5DLQE 4XXEA 2MH7A 1YZ6A 1D7QA 4C3IG 1EYDA 4P72A 1ILQA 1ESFA 4IUMB 2HDLA 2PE9A 3HOWG 5C3WA 4KGRA 1T0RC 4C3IB 1KIXA 1U5KA 1IL2A 3MA2B 3J80L 1VQFA 3RUZA 1X32A 3NVVA 1WJUA 5D94A 4ZRKA 2JQOA 3BJUA 1GG3A 5D6JB 1B7YB 3RLFA 2K5NA 2BDOA 2YU9H 3PRMB 4JI4Q 1BBUA 1PVOA 2BVCA 2KDFB 3NEMA 2V4IB 3E9IA 3U9OA 1RHPA 1SIFA 1TGZB 2KVRA 2JEBI 4JOIA 4RMAA 2BTEA 4PV1C 3AQQA 1VQ4A 4JE3B 4ANXA 3C46A 2WKCA 2BA0A 2NYZD 1YI2A 3MHZA 5BMGA 2DZJA 2EYFA 3NWTA 3LX0A 2W3RA 4W9JA 2MHVA 1C78A 3M4YA 5M5YB 4LJOB 1LTSD 1E5WA 2JQRB 4QMGA 3HKSA 2MQJA 3ZRCA 5HFYA 4DV7L 1T5EA 2IX0A 5K36H 5CGKA 1JALA 3WDNA 1VQ9A 4LF6L 1XMQQ 1K9MC 2B63B 3TS0A 1OO9B 1ZYRC 4ZRPA 2PW5A 4DAVA 1LTGD 4TMAB 1CKOA 1MI0A 4DU9A 4POFA 1BDOA 3MP9A 4RGMA 2IW3A 4LNIA 4KV6A 4EZJA 4JI7Q 3S17B 1RRBA 2WDVB 3JSVB 1V80A 4MM3A 4A3BG 4YSXB 4ICVA 3A8IE 3TP5A 1L6UA 1UELA 5D65A 4M01A 5C23A 2EY2A 2NN6G 2D0PA 3M4OB 1C1YB 2O4XA 2UU9Q 2VY3A 1Q8IA 1PGBA 2JYEA 3V2TA 1E10A 1JB7A 5IYCG 4FF1A 4OO1G 2R7ZH 4IM3A 4A4IA 4G11A 4OZCA 1JJCB 3ECIA 5GAGC 1NMFA 4QY7A 2CWPA 1B70B 1HNWQ 3BYYB 4LF7Q 2G3QB 2L00B 5EE3A 3HEJA 1PTOH 1CT1D 3MZ5A 2QSDA 3SXHA 2EQSA 3CCUA 1V5OA 2BS4B 2JA7B 4HROA 3DDCB 1L2NA 1DGSA 4DF7A 2AUKA 3VVWB 1MBYA 3CCSA 1I4QA 4WJNA 4FJZA 4K7WA 4G7OC 1PH2A 3S1MB 2L9HA 4IM0A 1AN8A 4CDDC 2HIXA 4JBWA 4BXXG 3P1MA 2N9EB 2M00A 4HAEA 3SHQA 4R4CA 5EQ0A 2LUEA 3FKIH 2QGQA 3EHVA 3UE0A 1HQMC 2V3NA 5EPLA 4AQYQ 2JA8G 3T8MA 5CBEE 2WDQB 3BY4B 2V4DA 3A5UA 2KMMA 4KTAA 5M9OA 3H9DA 1MD2D 5JVH3 4O0AA 3RYTA 3J81L 4YWGG 5IIFA 1R4NI 4XWTA 2D62A 2NVTH 4YWKA 3CC7A 4HR7B 1ZDXA 1RTOA 3GOEA 4LK0M 2UXBL 1X3PA 2GRIA 3VTWA 2IX1A 4QUCA 4TQ0A 1K50A 1WGRA 1LT3D 1SYEA 1CMXB 2LFIA 2LZ6A 4OL7A 1H9MA 4WIPA 3TBIB 2LXKA 1W6KA 4O2DA 2ZJRA 4UY8C 1JWAD 3N20C 2H1EA 4OELB 5GMVA 1X3QA 2MBOA 2UUBQ 2N7JA 3PGZA 1AWDA 2MWSB 3EIVA 4TKOB 3PIOA 4JV5L 3VUWA 2F0GA 1B9RA 1IBXB 5CC4A 2QF7A 4F87A 3CPWA 1V49A 1ASZA 4ANUA 2R7ZB 4ZUJA 1Y1VB 2L11A 2J53A 3HOYH 1SBBB 1VZ6A 3X0WA 1OTRB 4WWMA 4KHVA 2KWDA 2GB1A 2PEAA 4FP5D 4DNIA 1OTCA 3CSFA 4KDLB 4DHZE 2RDFA 4L5RC 3R8BA 2WXHA 5KNBA 2F4IA 4P2CB 2F03A 2JA7G 1TKEA 3IAS1 2EYMA 4W9HA 1X1MA 4DKAC 2JRIB 2KJHB 2UXDL 4XYQA 4DK0A 1V5TA 1VQBA 4ARIA 3QHTA 3GTKB 3FC4A 1RIPA 4WAFA 1KDCA 1NNXA 1VQEA 2PZWA 5M5YH 4IW0A 5H8YE 3KVFB 4A3MB 4QJFA 3BWUD 3A0JA 2VXWA 4GDKA 1R4PB 1C3TA 2XWJB 3VA5A 4RM9A 2IWHA 4WWOA 1HZ9A 1I4HA 3PUXA 1FM0D 3J7YW 1QVFA 2IJ0A 2HTHA 2K05A 1EQQA 3PSIA 4RF0A 3SVMA 3UDFA 2KK8A 4F1SA 3FPUB 2WHIA 4IUVA 2N4FA 4CJ0B 1SMYD 1RL2A 1SN8A 2KDEB 4LNFA 2UXBQ 1SYDA 1AFPA 1ZDVA 2LGSA 3D6WA 5ELOA 5HHDG 5ELBA 4EZKA 3JYUA 4WRDA 2K5WA 1QILA 1KFYB 1ENFA 3G6EA 4DV5L 1JMCA 4GB9A 1O7YA 3KLSX 4K5WA 2SEBD 2Z9HA 2J0KA 4AJYB 1R9TH 2EKEC 1SB3C 3M7NA 3HKZB 1CK1A 3IFWB 2KEEA 4HCNB 5CHVC 4F8CB 3NUHB 3DWQA 1EOTA 3PCOB 2ACZB 3ZIMA 1L0XB 2CU3A 4W9DA 4JI2Q 3ZJTA 2ZPYA 4JW0A 3ZNGC 1SYBA 1E22A 2I5MX 1EWCA 3H7PB 3JAML 4YL8A 1YBYA 1IL8A 3BINA 1R4MB 3N3KB 1Z6HA 1KD1C 2DZMA 5JJZA 2MJ3A 1QG7A 2VZAA 3V62A 4NAMA 2YVCA 4CKBA 2RDBC 5L83A 4K8JA 1TVXA 2Q5WD 4FA6A 4MSQB 1HTQA 4JPBW 3PV1A 1EO6A 1ASYA 2NVQB 4RH6A 4GLAC 3HK0A 3NTKA 4GSWA 3BVMA 5KHQA 2WB1G 5DPWA 5LL6S 3NZ3A 4B0EA 4BFRA 5I2XA 2E6XA 2XK5A 2BE5C 2D9UA 1XPRA 1EWYC 4YTMB 3DWMA 4A3CG 1K53A 1WJ4A 3JVZX 5CHWA 3IL8A 4JL9A 3JAME 4W9LA 4OXPA 1GJZA 1JQYD 4ZKBB 2E5LQ 1LYLA 1WGYA 4GN3B 2VRRB 3Q69A 3PMFA 2PIAA 5AFWA 5C4HA 1I6HB 4DV2Q 3C8YA 2C9OA 3V96A 1UBQA 2NN6I 1HEZE 3JAMc 1B50A 4JI5L 3MC8A 4JI7L 1FEHA 2V3SA 4FN2A 4HEDA 1QQRA 2AQ2B 3NQIA 3B1LX 3C19A 1DZ1A 4ZUIA 1IPGA 1WIAA 5BMHA 3PLVA 4NQKE 1OQYA 2VH2A 3HOUG 3WALA 3A54A 2MFIA 3TS2A 4P71A 1FGBD 2HT1A 2K1FA 1STHA 2Y3AA 4L2YA 4RCOA 3AE9B 4DR4L 5BN5A 2FNJB 4DV1L 3Q8DA 4HKZE 1QE6A 4C1NI 1WI5A 5KYLA 3CKIB 1EYAA 2ZTDA 1FJGL 2G9HD 3BYTB 4N9TA 1M8AA 4DNTB 1WTPA 2Y5PA 2MJ8A 2OXPA 4KLKA 1FGUA 5ELFA 2LRWA 4E3CA 3F8TA 1WGGA 2MNAA 4C7YA 4LAAA 1LABA 2C60A 1ZGUB 1A70A 4MTKA 2FJ2A 2JA9A 1HZ6A 5JXVA 4X62Q 2O6VB 1WRIA 1SSNA 4K6DA 1EQTA 2B2VA 2KTFA 4KIKB 2L05A 4EUTA 3RULA 1SFOH 1IYVA 1EIFA 3N52A 5M5XH 1I4PA 4LF4Q 2KQ3A 5CV8A 2M0AA 4HJ8A 2DWQA 2X38A 5LNK1 1WJNA 4YWMA 1E2ZA 4L5TA 1N9WA 3NE5B 1JJ2A 2VUMG 1V6EA 3IAM1 4ARCA 1KDBA 2PVOD 4JI8L 2KBNA 1PYSB 2F52A 4AQ7A 3AEEB 1A5RA 3TZDA 4ID6A 3ERQA 3UE1A 1CM9A 2LHDA 3OIPA 5JEAH 1VRAB 4K3BA 2WU2B 2J0JA 1OXUA 4JC0A 2AEHA 4KY7A 1WTXA 3T3NA 1STEA 1NBFC 5FLXc 1WJ6A 1FNWA 3CMEA 5M3MG 3KJOA 1HCZA 4TUUA 4NB3A 4MTNA 1D5MC 4C3JH 2OJWA 3NQTA 3PO0A 3R66C 4IUPA 2K6QA 2WP9B 2JSOA 2K7VA 2PZUA 4DK3C 2HTME 2N49A 2ZTEA 3CMMB 4I6NB 3W3AA 4ZRZA 1F9QA 1P9DU 3KF8B 3RZOB 1TWFH 1IW7C 4PZ8A 2E2IH 2GOWA 3OTOQ 1GUNA 2BKFA 1E0BA 2K6DB 1FCLA 4BKSD 2H89B 2Q8RE 1LT4D 3H0GH 4FVMA 4B3MQ 1Y14B 1LGRA 1MFWA 3ENEA 3HS0C 4DWFA 3EUB2 2KHJA 1I94L 2CKZB 2M0XA 1TTNA 3E56A 3UIOB 1GAQB 5G3LD 2WV6D 2MBBB 1N61A 5DNFA 3J80c 2D3AA 2J0TD 1X56A 4B3RL 3UIPB 2A19A 4DQOC 1O7ZA 1UUPA 1LT6D 1VS0A 1E8YA 3VR5A 4IZ8A 1J9OA 4AYBG 1K83B 5C3EH 2VQFL 1QUQA 1YNND 5TR5A 2I5HA 1I42A 3ZDMC 4KSKC 5M3MB 3T51B 1UEAB 1M94A 2F4VQ 1IYUA 2ZJDA 3AE7B 4YT0B 1PZJD 2LMCB 5GROA 4DV1Q 5IYCH 1RJTA 1RYJA 2R7ZG 4PMWA 2KJRA 2FCSA 2LXCA 1MVKA 1PFDA 2A69C 1CKNB 3OOCA 2LJIA 1K28A 2VQFQ 2G9DA 4HCPB 1PZID 2HJ8A 3AEDB 4HCSA 4IO9A 2FCMA 4JIOU 5IOIA 3QG1A 1K3BC 3FKIB 3HM3A 4DR1Q 4HJAA 1CHPD 3DMUA 1IBXA 4XT3B 1S1QB 3PO2G 3QOLA 4C3JB 4DV7Q 4BY1G 2R93G 5IP7G 4HDOA 3J81E 2QC8A 3A5ZB 5FR3A 3QJYA 1PTOF 1NSNS 1XYIA 3S1QH 1TWAB 3P42A 4L23A 2E5LL 2EY6A 1A62A 4PQXA 4X64Q 2PI2E 1H9KA 1N6ZA 2N9XA 2L1AA 4KJOA 3T16A 1SNCA 4BY7G 5KHOA 3CC4A 4LF8L 2JA8H 4A3MH 1WWTA 3A8KE 1SJHD 2OWOA 4O1NA 3Q24A 1PH4A 4A3FH 4K2KA 1WCMB 3PZ8A 1Y1VG 4ANWA 1KRTA 4JI4L 1JOQA 1DXMA 3VTVA 1EEID 2JY6A 2RSNA 5J2RA 2LVPA 1LUZA 3GV6A 4IFDJ 1FNUA 3DVNV 3BZDB 1JRPA 3J7AF 1TIFA 1ZUD2 1Y1WH 4GKJL 3WCQA 5CR3A 2BS3B 4ZAIA 3ML8A 3PIO3 1I4GA 3NELA 3CCQA 2KDIA 3P4PB 2LVOA 3QIJA 5EE1A 2JVCA 1IYJB 4NXMQ 2J42A 4DUZQ 3PS6A 1WR1A 1PDXA 1B9MA 1FR3A 4DAPA 1TIID 1QOGA 3UDIA 3I4NG 3OIQA 2B63H 3K58A 3I70A 4XQNA 1ILPA 1J19A 5JAVA 4HXDA 3KYHC 1F2ZA 3NS8A 4JI8Q 4C80A 4RCNA 3EGRA 2OTLA 1KNEA 2BH8A 3A7AB 3DLLA 3UDGA 2DAJA 4GDLA 4C00A 5E1FA 5HGTA 2LVQA 3A9JA 3K80C 1J7BA 1TU2B 3GTQB 3H0GG 2NBFA 4NXML 3RNBC 3DBSA 4APVA 1CJEA 1F0ZA 4LMQD 2K6AA 4JGHB 2K5DA 1EYGA 4JBKA 2KOLA 4LF5L 3SFEB 5LXIB 1L4DB 2KDMA 3W5VB 2BOSA 4DR3L 3Q8CA 2IY5B 3HOYB 1AH9A 2RHSB 2OQKA 3EBEA 1E24A 1DJRD 2QKIC 4G7HC 5C4XB 2IO0B 5CV4A 2XK5B 3PHWB 2CW0D 2VZKB 3QAQA 5BO4B 2INNE 2DYBA 4LFBQ 2Q2IA 1LM0A 1UH6A 3AE2B 1IXRA 4ZYSA 4WFN3 4LF9L 3AB5A 2F1MA 5M5WB 3M63B 1ZXTA 5E3FA 2KHWB 1FD6A 3B08A 4S0RA 4ZRQA 4KHZA 1E2VA 3PLUA 3TP8A 4MGIE 1XTDA 5T1IA 1EY9A 5LMUQ 1S40A 1FJGQ 1WM2A 2UU9L 4X65L 1HRJA 4M1UB 3MXPA 3P4RB 3ND8A 2K25A 3A9KA 3M62B 1CTMA 3VYRA 4A3BH 3GE3C 5LL6X 3N30A 3D4RA 2ONQA 4IG7B 1PTOB 4GMVA 1ET9A 4G3XB 2B29A 1V86A 4RMFA 3RN2A 4EOYA 3MXNA 3M3YB 2L83A 2N3SA 3RLOA 2WXJA 4REZA 1EWIA 3P1HA 5KRUA 4L5SA 2A8VA 3PO2H 1U4PA 1PLFA 2NS5A 4A3IB 3P4QB 4X65Q 1GC6A 4QIWE 5EBDA 1SSOA 2ZVNA 2YTXA 4JK1C 2D0OA 1HPCA 5MPOA 2C35B 4X66L 1WTHA 1VQNA 2C9WB 4A3JB 3AM9A 3LXFA 2HUGA 4QB4A 5DAUA 4A3EG 4GKKQ 4BAXA 3Q3OC 1RCVD 2O5JC 4GDKB 1MJEA 1SEBD 4A3MG 2JZ3B 4GS3A 3OW7A 3X3NA 2W9NA 1K0SA 5I4DA 3FEWX 2KC1A 1JB3A 4WJWA 2V0GA 2X8XX 1RFKA 1GOZA 1JW9D 3TSSA 2XN9C 3AB9A 3OMGA 1G91A 1LQBA 5BR8L 2UXDQ 3TZUA 1VQ6A 5LXHA 1S5CD 1OEYJ 3T1HQ 4DN4M 2R92H 1Y1WG 5D7GA 1TT5B 5I6WA 5KNCA 2HQEA 1DOLA 3N1ZC 1V1PA 3H6NA 2K03A 1TS4A 2MBQA 4ZKCB 3H3VC 5C5LA 1WVLA 4XGAB 2Z6KA 1I6VC 3DBLB 4MN3A 5J17A 2CCZA 3VRAB 4KV2A 4ZCKA 4YHHL 3L0WB 4KN4C 1BCPF 3HKZG 4DUZL 4QL5A 2RSUA 1WTQA 3FKIG 3PPAA 2R92B 1G6ZA 3NBIA 4A3IH 3VR3A 3VQIA 3LGJA 5M3FH 4OIKA 3MHBA 1Y8OB 2MBHA 1UAPA 3IFTA 5CMDA 2ZW1A 4EQPA 2MEKA 1OXSC 2I46A 3ICEA 1H4RA 1HUMA 2XIWA 1WTRA 2B8FA 4HDQA 1PZKD 4WJ4A 4GKJQ 1YNJD 2F0SA 3NWSA 4JYAQ 3AE6B 2ZXRA 4HPMB 1XLOA 4F7ZA 1TKYA 2DZIA 2FFKB 4A55A 1FVIA 1LFDA 1ONLA 1WMHB 4UAIA 3V6EB 4JI3L 1P98A 4CHKA 3HM6X 3R93A 4RA8A 4FF3A 1YN5A 4OZAA 4WWNA 2VUMB 2QCPX 1HZCA 4EQNA 3F2BA 4CGYB 2JWZA 5GXGB 1OXTA 3DBLI 3HFZB 2UUCQ 2MPMA 4C3IH 5IA7A 4CDFC 1SNPA 2N8NA 3D4DA 1KHIA 2AWNA 3NHHA 2K0PA 4GN5A 2BWFA 3S14H 2IBIB 4AYBE 4CJ2C 1SYFA 4KMUC 5JEAG 1BCPC 3J81j 1XNQQ 2N7EA 3S1MH 2UXCQ 2WXLA 2KKCA 1DM0B 1I50B 2R7DA 2R2QA 3AEFB 1WFYA 2BW2A 2RR9A 4FNFA 5M3MH 1G291 1HA6A 5IP9G 5A2QL 2MO0A 3CMAA 1FFUA 1YQBA 2KQSA 3M3JA 4C4VB 4EKUA 1TKWB 3URYA 1SNQA 4FF4A 4OWTB 1HNWL 5M5WH 1DOYA 2K8CA 4KKTA 5G55A 3BDLA
chains in the Genus database with same CATH topology
4A8XC 1XCQL 1XX8A 2F3VA 1DOKA 3TEZA 1Q3LA 1GUGA 2JXMB 2OEDA 1C79A 1QF6A 5K36G 1MGSA 4FXDA 4N9PA 4MH8A 2RQXA 2LKVA 2KACA 3W2DA 3K5OA 3VR2A 5FO8B 4X3KA 2W55A 3ABVB 1ET6A 1FD7D 3IXSA 1GUTA 5BYQA 1U4MA 5EGTA 4J6HA 3AMZA 4A3DB 1YQ4B 1EQVA 3B2GA 4H44C 5CORA 2DNCA 1TS3A 2AWOA 2E74C 2E2JB 3PUZA 1OQQA 2L32A 1TJEA 2FINB 3KUPA 2H4OA 1B9NA 3MWYW 2QMTA 3L3OC 4V190 1ZYRD 1BO0A 2YYZA 4Y7NB 4JPSA 3ZYYX 4A6QA 3DXJC 1OQRA 3C3LA 2Z4HA 3NVZA 4AYBB 4ILWA 2DYMA 1C77A 4I65A 1EL0A 3S9WA 1Q90A 2K5QA 1TR5A 4EVOA 1FRRA 2WP8J 4RHRA 5D3DA 3Q22A 3B2FA 2K01A 2YEPF 1NENB 1E0ZA 4ITKA 3VR9B 5BMIA 1STNA 1QB5D 3MVVA 1JWBD 3GV3A 4BBSB 1FMAD 5BN3A 2JA6B 4NDXA 1Q10A 2FMMA 2NZ1D 4B9XA 5DEHA 3TEWA 1XLPA 3MXUA 2EYOA 5FK9C 4KN7C 2F0HA 1BUIC 3PUWA 1V8QA 1EZ6A 5T1GA 4F88A 1N63A 2EJFC 1U9RA 2DBYA 3AEBB 4AS1A 4I7ZC 4N58A 4RHSA 1LTID 2WLBA 1HFNA 1NEKB 1S5ED 4RKLA 5FO7B 1ENAA 2ZT9C 2EJMA 2LUMA 4LTUA 3K59A 1LTAD 3KQ4A 4KY5A 2WQYB 2Q8IB 2EXZA 1JMLA 2D5DA 1VZ7A 3H6MA 2KCNA 2Q8TA 3VYSA 1UGJA 1EU3A 4IFDI 1D4BA 2BA1A 2EJGC 2OHFA 1CZGA 4O42A 1WYGA 3F2UA 3GP7A 2E2IB 1JE4A 5K5PA 4QIWB 2L0CA 3KLRA 1SE2A 2F0EA 3V05A 2LFNA 3FDTA 5KGUA 4XQQA 2E76C 2PCFB 3KBGA 1OFFA 4NAWB 1U4LA 4ZK9B 1A2UA 5NUCA 4US9A 5EBCA 3T3OA 3WOEA 4S3SA 4LK1C 4P16A 3L9AX 2K1BA 2SOBA 1CA5A 3PUVA 2L55A 4MACA 3HOZB 2L12A 3K7AB 2IX3A 3Q8AA 3NTHA 1FNVA 1AW7A 3EA6A 3AECB 1D1IA 4IDIA 3PUYA 1PGXA 4C1NK 3J80E 2INPE 4DA2A 2Y0SB 3DWGC 1JWMD 5CV7A 5J22A 1VMPA 1BCPD 4U673 3RD4A 1A6XA 1G2TA 4XT1B 3TP7A 2K28A 1STAA 4C56C 1II3A 1QNKA 3L4PA 1DCZA 5KNDA 2AUJD 4R8IA 1SDFA 3M7GA 4MT5A 2L1BA 4FYDA 2B8GA 1RWSA 4R3DA 2ENBA 2L4NA 2KHSA 5I2YA 3NPPA 3DWAA 1TWFB 4IUTA 1GB1A 2WNMA 1E7PB 4A3KB 4DAYA 1E6EB 3ND9A 3R2IA 4UDUC 1IUEA 4D2KA 1YMHE 1J7AA 2YEPB 4N6EB 4RGOS 5CV6A 3TMEA 3GD7A 1QWYA 1D6EC 3GB1A 3PV0A 4JWUC 4P6VF 3QOJA 1DOXA 2K04A 4OZBA 1SF0A 2ON8A 3W1SA 2XRSD 3P63A 2HDMA 2KAJA 1CFMA 3PZ7A 1STYA 1R7SA 5C6AA 4C3HB 1BXTA 3BK2A 2WINB 4XQJA 1AEXA 5C5MA 3L7ZC 2OF1A 4OHJA 1MPEA 5IGFA 3LYYA 1C9FA 5FOBB 3GTOB 3DHQA 3SHLA 1IW7D 3MXGA 1XEEA 4HSPA 3HG9A 3LWUA 1ROEA 3E0JA 2HCCA 2ID0A 1MSGA 1CI3M 4KKIA 2PKOA 3T53B 4DXFA 2FUG1 1NCVA 1S4ZA 4PMCA 2JZPA 2FMCA 1QKZA 5H92C 5ISRA 4U68A 2PQEA 2DY7A 3IT6B 3ZJVA 5D3IB 1VMCA 4X3SA 4FXCA 1SNDA 2WXOA 2BT6A 1C4AA 1E2WA 3D6CA 1HTLD 3SR6A 2NVYB 3AEAB 2EY1A 3ZJUA 1EIGA 2KECA 1L6VA 5IOCA 1VCIA 1PRTB 1C4QA 3A7LA 1W6JA 1WXQA 2K5PA 1TYGB 1SJED 1BQQT 4OGQC 3P4SB 2PO4A 2LY7A 4YSZB 3S2HB 4NZLB 1QOFA 2A6EC 4K8IA 4KKUA 2B2UA 1BBXC 4IOIE 1IGCA 1PTOD 4C3HG 4OW0A 1U4RA 2Z1CA 3SK5A 3HZXA 2A73B 4L8JA 5AUKA 4RGTA 3W9CB 3NUCA 3TDQA 2WXRA 1A3VA 3ONAB 2O2LD 3K5LA 3K0YA 5EKKA 3H09A 5EE9A 2R61A 2WXIA 2BS2B 2Z8LA 3GQBA 2H88B 3CIRB 1KABA 3TUOA 2W3SA 5ELCA 3X3MA 2RKSA 2HCIA 1CA6A 1S5BD 1TWCB 3I73A 4HKQA 2SNMA 4FXKC 4FO2A 1K52A 2XSCA 3RMHA 3KBXA 1GHJA 3T4AC 3U2SC 2FHTA 1Q12A 5HI1A 5G3LF 1SNOA 1RTNA 2C5CA 1EYCA 3HOWB 2WIIB 4MIUA 5BYRA 1Z7TA 3I4NB 3KWVA 3WOFA 1I4RA 2JA8B 3FILB 2W54A 1ESRA 2JSVX 2SAKA 1NUCA 4V0BA 2MP1A 1K51A 1WTWA 3BS1A 3BG3A 1J7CA 4N59A 2YU9B 4BA1I 2K33A 3A8JE 2IGGA 3K57A 3S14B 5DM73 4QCLA 4HRSA 1JOOA 2F0NA 1JQ4A 3AE3B 4RF1A 1TS5A 1DYQA 3OMCA 1CHQD 1RM6C 2ICEC 2LMCA 2F0TA 5FO9B 3BVZA 3NRZA 2PMVA 4A9AA 1ZXIA 4OIJA 4YTNB 2B2VC 1N60A 3G7LA 2I38A 3KWLA 4XDXA 1XLNA 4ZQ3A 2N9KA 3I8ZA 4H13C 2IT1A 2L5TA 2K32A 5C0XG 1JC7A 5M3FB 4XWWA 1OXXK 2EE1A 3S2DB 3AE5B 1YQ3B 3IFDA 3MC0B 1FRDA 1PFNA 1QOHA 1CZWA 1O7LA 5EKIA 1EFID 1Y1WB 1JCKB 5G5GA 1KTKA 3E6ZX 4TQUS 4NKLA 2F0OA 2NTTA 4QF4A 1EY7A 3OSOA 5COYA 1F2RI 1PFBA 1Y8NB 5IGBA 1TS2A 1SYGA 2O5IC 4K2LA 3VR6A 4DFAA 3HOUB 1F2LA 4Q2JA 2EOTA 1D5ZC 1NR4A 1Y56A 3J9CA 2KQ4X 2J52A 1F9RA 4G4KA 1KRHA 2QIEB 1H9SA 3HRDD 1F77A 2F0QA 1TWHB 3E9SA 2RMMA 4X3TA 3EQLC 5M5XB 3UI3A 1C48A 1RKNA 1VDZA 4A3BB 3K5MA 2X6GA 2F0FA 1QOBA 3PIP3 3U4EG 2K3UA 3AN1A 1STGA 3MFGA 1CQFA 1NI3A 3R3OA 1XXGA 4GZYC 3DM1A 2CHBD 1I3QB 1GJXA 2WXQA 5EPKA 3CQZB 3U7ZA 4M8AA 3SEBA 2MGSA 3GS2A 5HG2A 2JWUA 4RGNA 3I72A 2F0PA 1CQVA 3CHBD 5ELDA 3Q8BA 3Q6SA 2R93B 1LO5D 3H0GB 1JICA 1QLBB 4PNYA 1GXDC 3VYUA 1L4ZB 1XF5L 2N9LA 5EPJA 2LEKA 1C4CA 3Q23A 1FO4A 3BVGA 2B2WA 1PRTC 2K22A 4USAA 2I2YA 2J7ZA 1HZ5A 2WXFA 1KDAA 2BBCA 3M85A 1L5PA 3IT4B 1VDVA 1M4VA 4KJNA 4IFDG 3VYTA 4OO1H 2JU6X 3J7AV 3GTGB 1LLRD 1SE4A 4HMJA 1HHVA 2QJLA 4H7BA 3GTJB 5I9PA 3GO5A 1QNUA 3I4MB 2JE6I 4A3FB 4BS9A 4TQ1A 1I4XA 3I57A 1WSPA 2WAQB 3MTSA 5C0XI 3GTPB 3HP3A 2A6ED 1FXAA 2VNUD 1LTBD 3GTLB 1SYCA 5JOBA 3FRPB 1EM7A 1EY4A 2AQ3B 4J1MA 4Q0FA 4KD3A 2BB5A 4HJGE 1VLBA 3SDZA 3W5UB 2B2TA 2LS01 1XWEA 5EKLA 5C44B 2F0VA 3E5SA 5JVG3 3CWIA 4RAUC 3LWEA 2N55A 5IODA 1BCPB 2M56B 2EPBA 4LLGM 3U9SA 4BWGB 1V43A 4KD4A 4HTHA 1NVID 4RWSC 3VA7A 1EY5A 2KUMA 4H2AA 4FXGC 3I90A 2IL8A 5A35A 1NR2A 4HCEA 2IGDA 1JORA 1KH0A 4G57A 1BR9A 5C2TB 4TSSA 5EE0A 1B44D 3NVWA 2KVMA 2BB6A 5D14A 4QUFA 2JYTA 3LNNA 4RNAA 3SFDB 3NVYA 1JWUD 3FVQA 1RODA 1HUNA 4YXDB 3VR4A 2KJXA 3DWPA 2DYOA 2L52A 1LTRD 1DGJA 2I07B 4KI0A 2D5GA 2EKIA 2SNSA 1A3UA 3EJIA 1LTTD 4FF2A 3B9JA 2HDEA 1HXYD 2PZTA 1TT2A 5IGCA 3Q0AA 1JWSD 1SFOB 4A90A 4CJ1B 4KGTA 3Q8FA 3SK4A 1R4QB 4MHEA 4OO1I 3S1NB 2PYKA 1SNMA 1UWXA 2B2WC 1B4OA 2BE5D 2KCCA 1EY8A 3AE1B 1ICWA 5E6JA 2WU5B 2WXKA 4ZHPA 5IGGA 3FAHA 2FBWB 4CBVA 4L1BA 5J39A 3OWFA 3D8GA 5C3XA 2ZW0A 3QWNA 4GDLB 3N9YC 1ZKOA 4A93B 1C8CA 1Z47A 1K8OA 4E6IA 1QCBD 3I4LA 1O80A 3N6RA 2ICIA 1GHKA 1XCTL 1JOKA 2DNEA 1FCCC 4NMZA 3C1EA 2M19A 4CHTB 3TN2A 1D2BA 4HN7A 2ZXPA 2CVRA 1JR0D 1QOAA 5HURA 3FILA 2XRQD 3I9V1 5IT9L 1AZPA 2RSOA 4CKCA 2RDGA 3AH7A 1BUVT 1PRTD 1DOMA 4ZOHC 2BCOA 1R9TB 3MJ5A 5CBAE 4WH4A 2CJOA 3AE4B 1CZPA 1B2TA 4ODGA 2BDNA 2F0DA 4BBRB 2A6HD 1DONA 2N88A 3NS1A 4NW2A 5FKAC 5F2DA 1N62A 3AMUA 1TY0A 4KY6A 5IGEA 2DY8A 1DOIA 1QT9A 1B3AA 1C4PA 4KK7A 4EQOA 4C7ZA 5LHY1 3HUIA 2XNAC 4PT5A 2PVGC 1WD0A 2F0JA 4YIJA 4J8QA 1RD9D 3C2PA 1A15A 1ML0D 1F9PA 4L6TB 2X6LA 2FE8A 1SXTA 4IUQA 3GTMB 1UWMA 4EE2A 3S1QB 2KN4A 1PMRA 3SK6A 1V1OA 3BK1A 1Y69U 3S16B 2WDRB 2MJEA 2AX5A 5BYSA 3PO2B 2A6HC 1WGKA 2TSSA 1C76A 1RF2D 4IKGA 5JPNC 3NK9A 4TRDA 2PTLA 1H9RA 3VR8B 1RDPD 2MJDA 4ABNA 3BDOA 4KGSA 2NN6H 2EYHA 5IGDA 4RKBA 1KAAA 5BN4A 5ELEA 2PMZB 2XVSA 1IGDA 5C3EB 4DK1A 2NB0A 3HVDA 3OPOA 4Z9CB 4KX6B 1L0YB 1PDQA 1J8IA 2X69A 1KLGD 4H0LC 3I91A 1GB4A 3ZQ4A 3DEPA 4HMIA 4R9WA 3NBHA 2F0UA 3U52E 2DN8A 5TSSA 5AUIA 1Q1BA 4F7XA 4KKSA 4CKEA 1STBA 4K14A 1BMLC 1JROA 1PUTA 2WXNA 3K5NA 2OEOA 4B0MA 1EWHA 4JWSC 2NWGA 4K5XA 2W82A 2F3WA 2PLPA 1F2YA 3A55A 3HGBA 1T5XD 3A56A 2B2UC 2SDFA 2VZKD 1DD2A 2A68D 2CJNA 4IQZA 3CU7A 5CV5A 2F0LA 3SR1A 3EVQA 4YTPB 1PTOC 2Z4IA 1G8ZD 3RFZB 2V3PA 5C3JB 4HSVA 1IHZA 1WTVA 4M0WA 2EYJA 3R2TA 1T6BX 1AYFA 1L0VB 2QILA 1F2RC 3S1RB 1IKMA 4HEA1 1D1KA 1MHHE 1QJOA 1ZEQX 3EFXD 5I6YA 1B53A 1V1PB 4WORA 1B1ZA 1ACCA 3TEYA 1A2TA 2IGHA 1H9SB 4NJCA 1S5FD 2IPKD 2LHEA 1V97A 1P7FA 3KK7A 3MFYA 1GUWA 1LT5D 1KLUD 5E4XA 4ZLTF 1BF4A 4PMBA 1N5XA 3AV8A 1YNJC 2B2YC 2QDBA 1TKGA 3TP6A 1ENCA 2EYLA 3NTIA 2PNRC 1HTPA 3QIAA 2JYOA 5IT9E 3EROA 2F0WA 4A3EB 3T13A 2JEAI 3QB3A 4XDCA 1D5XC 3Q8EA 3P20A 2EY5A 4J3OD 1ZOYB 2EZVA 1LV9A 3SE0A 4IFDH 1XO3A 2GI9A 2F0KA 5KYIA 2NMQA 3VRBB 4XYOA 1AZQA 1EU4A 2F0IA 3IAYA 1MHXA 4KKJA 1FIQA 2KEDA 5C0XH 1YNTE 1XTCD 1YJIA 1TZOA 2EELA 1K8MA 3RZDB 2NVXB 5C0XJ 1Y8PB 2A74C 2WXPA 3LB8C 3CRLC 3NXWA 1EY6A 1MSHA 4IUUA 3D3RA 4IALA 4IUNA 4YSYB 2WS3B 4BA2I 1SIJA 2ZXOA 1UNSA 4A3GB 3HRZC 4RFBA 2AQ1B 4K5VA 1EEFD 3PO3B 1S5DD 1H9JA 2B39A 3SK8A 3FPPA 3I3CA 4NP5A 2E3TA 1GUSA 3K6OA 5I9OA 1ZPSA 4F8MA 1EY0A 2LGIA 2R3ZA 3AE8B 1PXUA 4G7ZC 4XIGS 1ZXHA 2WXMA 1SE3A 3FMCA 5FLXE 2RPVA 2A5HA 4ME5A 2WKDA 1YN3A 2NTSA 5KIXA 3OHXC 2PW9A 2CQAA 2E75C 2JA5B 1G2SA 2PW7A 4BY7B 2VB3X 2CW0C 5DM63 4R8NA 5C4ZA 4ZHOA 1T3QA 5CYUA 2N0SB 1GPXA 2B76B 2XWBB 2Y5CA 4OVZA 2M9VA 2K9XA 1Q1EA 3QO2A 1HFGA 2E2HB 3AEGB 2R6GA 1NYQA 3S15B 1GUOA 3G6JB 5JEAJ 4LJZC 1VF7A 5G5HA 4C3JG 4GLSC 4Q5VA 2EDGA 3HVZA 1VR9A 2NVTB 4DNRB 3H94A 4XE0A 5A2QE 4DGZA 3H91A 3V3XA 3HOXB 1HA5A 1VF5C 2B2YA 1PYWD 1YN4A 1SMYC 1VJKA 1EZ8A 3IKJA 1N5WA 2OT2A 2A69D 4CQNA 5T8IA 1SAPA 1TWGB 1I7HA 2JXTA 3DUZA 1A3TA 1BNZA 3NP8A 3AU7A 1BOSA 1ZP0B 1FYCA 4DXGA 4WURA 1TY2A 1YNNC 1XLQA 3MAQA 2BYTA 4BY1B 1PRTF 1F9SA 3D31A 3P7JA 4C2MB 1HQRD 1NYRA 4B9WA 2RVLA 1ZE3D 2MUYA 2G1EA 3P75A 3BDCA 5FLXL 4ULLA 1EIHA 3ETRA 3ZGZA 1PFMA 5J1ZA 1TQOA 4IN3A 3UI2A 1V8CA 2RBMA 1FFVA 4L63B 2D2CC 3CRKC 3NSWA 2M2LA 3O13A 1IKLA 2PPBC 4X3UA 1AP0A 1MI2A 2A68C 2TMPA 4XDDA 2E2DC 1KF6B 1WTOA 3DEOA 5E4WC 1LACA 4WQMA 2KA7A 2WB1B 2EYPA 2GA4B 2RA4A 3BIID 5EJWA 1O78A 2WACA 1F2MA 4US8A 3KF8A 5CV9A 2JX5A 4EGVA 4JX1C 3C1FA 2WXGA 4XTCS 3D4WA 2DLBA 2JP1A 1NAPA 3KLSA 2EVBA 2NUCA 4K6LA 1P7EA 1VZ8A 3H8HA 4IURA 5KEEA 3MEHA 1WD1A 2RDHA 2VB2X 3ITPA 2IDYA 3OWEB 1E9MA 1PGAA 1OXVA 1FXIA 4B08A 2B2TC 4MM3B 3HOVB 3TEXA 1YJJA 2F0MA 5JPMC 2J4XA 3T56B 1KNAA 2QEJC 5C4JB 3RPFC 4XXEA 2MH7A 4C3IG 1EYDA 1ILQA 1ESFA 2HDLA 4KGRA 5C3WA 4C3IB 3MA2B 3J80L 3RUZA 1X32A 3NVVA 3RLFA 2BDOA 2V4IB 3U9OA 1RHPA 2JEBI 2BTEA 4PV1C 4JE3B 3C46A 2WKCA 2BA0A 2NYZD 3MHZA 5BMGA 2EYFA 3NWTA 3LX0A 2W3RA 2MHVA 1C78A 3M4YA 5M5YB 1LTSD 2JQRB 4QMGA 5HFYA 1T5EA 2IX0A 5K36H 5CGKA 1JALA 3WDNA 2B63B 1OO9B 1ZYRC 4ZRPA 2PW5A 4DAVA 1LTGD 4TMAB 1MI0A 4DU9A 1BDOA 3MP9A 4RGMA 2IW3A 4KV6A 3S17B 2WDVB 4YSXB 3A8IE 3TP5A 1L6UA 5D65A 2EY2A 2NN6G 3M4OB 2O4XA 1Q8IA 1PGBA 2JYEA 3V2TA 1E10A 4FF1A 4OO1G 4OZCA 3BYYB 5EE3A 3HEJA 1PTOH 1CT1D 3MZ5A 2QSDA 3SXHA 2BS4B 2JA7B 4HROA 4DF7A 2AUKA 1MBYA 1I4QA 4G7OC 3S1MB 2L9HA 1AN8A 3P1MA 4JBWA 2M00A 4HAEA 5EQ0A 2V3NA 1HQMC 5EPLA 5CBEE 2WDQB 2V4DA 2KMMA 4KTAA 5M9OA 1MD2D 5JVH3 3J81L 4YWGG 5IIFA 4XWTA 2D62A 4HR7B 1ZDXA 1RTOA 4LK0M 1X3PA 2GRIA 2IX1A 4QUCA 4TQ0A 1K50A 1LT3D 1SYEA 2LFIA 4OL7A 1H9MA 4WIPA 3TBIB 1W6KA 1JWAD 2H1EA 1X3QA 2N7JA 1AWDA 4TKOB 2F0GA 1B9RA 1IBXB 5CC4A 2QF7A 4F87A 2R7ZB 4ZUJA 1Y1VB 2L11A 2J53A 1SBBB 1VZ6A 4WWMA 4KHVA 2KWDA 2GB1A 4FP5D 2RDFA 3R8BA 2WXHA 5KNBA 2F4IA 4P2CB 2F03A 1TKEA 3IAS1 2EYMA 4XYQA 4DK0A 4ARIA 3GTKB 3FC4A 4WAFA 1KDCA 2PZWA 5H8YE 4A3MB 3BWUD 2VXWA 1R4PB 2XWJB 3VA5A 2IWHA 1I4HA 3PUXA 1FM0D 3J7YW 2IJ0A 2K05A 4RF0A 3SVMA 3FPUB 4IUVA 4CJ0B 1SMYD 1SYDA 1AFPA 1ZDVA 3D6WA 5HHDG 5ELBA 4WRDA 2K5WA 1QILA 1KFYB 1ENFA 1O7YA 3KLSX 4K5WA 2SEBD 1SB3C 3M7NA 3HKZB 1CK1A 2KEEA 3NUHB 3DWQA 1EOTA 2ACZB 1L0XB 2CU3A 3ZJTA 1SYBA 1EWCA 3JAML 1IL8A 1Z6HA 5JJZA 2MJ3A 1QG7A 4NAMA 4CKBA 4K8JA 1TVXA 2Q5WD 2NVQB 4RH6A 3NTKA 3BVMA 5LL6S 3NZ3A 4B0EA 5I2XA 2E6XA 2BE5C 2D9UA 1EWYC 4YTMB 3DWMA 1K53A 3IL8A 3JAME 1JQYD 4ZKBB 3Q69A 3PMFA 2PIAA 5AFWA 5C4HA 1I6HB 3C8YA 2C9OA 3V96A 2NN6I 1HEZE 1B50A 1FEHA 4HEDA 1QQRA 2AQ2B 3NQIA 1DZ1A 4ZUIA 5BMHA 3A54A 2Y3AA 1FGBD 1STHA 4L2YA 4RCOA 3AE9B 5BN5A 4HKZE 1QE6A 4C1NI 5KYLA 3CKIB 1EYAA 2G9HD 3BYTB 4N9TA 1M8AA 4DNTB 1WTPA 2Y5PA 2MJ8A 2OXPA 5ELFA 4C7YA 4LAAA 1LABA 1A70A 2FJ2A 5JXVA 1HZ6A 1WRIA 1SSNA 4K6DA 1EQTA 2B2VA 1IYVA 3N52A 1I4PA 2KQ3A 5CV8A 2M0AA 2DWQA 2X38A 5LNK1 1E2ZA 3NE5B 3IAM1 4ARCA 1KDBA 2PVOD 4AQ7A 3AEEB 3TZDA 4ID6A 3ERQA 1CM9A 2LHDA 3OIPA 5JEAH 1VRAB 2WU2B 1OXUA 4KY7A 1WTXA 3T3NA 1STEA 1FNWA 1HCZA 1D5MC 3PO0A 3NQTA 4IUPA 2WP9B 2JSOA 2K7VA 2PZUA 2HTME 3W3AA 4ZRZA 1F9QA 3RZOB 1IW7C 1GUNA 1E0BA 1FCLA 2H89B 2Q8RE 1LT4D 4FVMA 3HS0C 3EUB2 3E56A 1GAQB 5G3LD 2WV6D 1N61A 5DNFA 2J0TD 4DQOC 1O7ZA 1UUPA 1LT6D 3VR5A 4IZ8A 1J9OA 1K83B 1YNND 5M3MB 3T51B 1UEAB 1IYUA 3AE7B 4YT0B 1PZJD 2LMCB 1RYJA 1RJTA 4PMWA 1MVKA 1PFDA 2A69C 3OOCA 2LJIA 2G9DA 1PZID 3AEDB 4HCSA 3FKIB 3QG1A 1CHPD 3DMUA 1IBXA 4XT3B 3QOLA 4C3JB 3J81E 5FR3A 3QJYA 1PTOF 1NSNS 1XYIA 1TWAB 3P42A 4L23A 2EY6A 4PQXA 1H9KA 2L1AA 4KJOA 3T16A 1SNCA 1WWTA 3A8KE 1SJHD 4O1NA 3Q24A 4K2KA 1WCMB 3PZ8A 1JOQA 1DXMA 1EEID 2RSNA 3GV6A 4IFDJ 1FNUA 3BZDB 1JRPA 3J7AF 1ZUD2 3WCQA 5CR3A 2BS3B 4ZAIA 3PIO3 1I4GA 3P4PB 5EE1A 2J42A 1PDXA 1B9MA 1FR3A 4DAPA 1TIID 1QOGA 3OIQA 3K58A 3I70A 4XQNA 1ILPA 4C80A 5JAVA 1F2ZA 4RCNA 3EGRA 1KNEA 3A7AB 5E1FA 5HGTA 1J7BA 1TU2B 3GTQB 2NBFA 1CJEA 1F0ZA 4LMQD 2K6AA 2K5DA 3SFEB 2KOLA 1L4DB 2KDMA 3W5VB 2BOSA 3Q8CA 3HOYB 4G7HC 1DJRD 2QKIC 5C4XB 5CV4A 2CW0D 2VZKB 2INNE 3AE2B 4ZYSA 4WFN3 3AB5A 2F1MA 5M5WB 1ZXTA 5E3FA 1FD6A 4ZRQA 4KHZA 1E2VA 3TP8A 5T1IA 1EY9A 1HRJA 4M1UB 3MXPA 3P4RB 3ND8A 1CTMA 3VYRA 5LL6X 3D4RA 2ONQA 1PTOB 1ET9A 3MXNA 3M3YB 2L83A 2WXJA 4REZA 3P1HA 5KRUA 1U4PA 1PLFA 4A3IB 3P4QB 5EBDA 1SSOA 4JK1C 5MPOA 1HPCA 3AM9A 3LXFA 4A3JB 2HUGA 4QB4A 5DAUA 1RCVD 2O5JC 4GDKB 1SEBD 3OW7A 3X3NA 5I4DA 3FEWX 1JB3A 4WJWA 2V0GA 1RFKA 1GOZA 1JW9D 3TSSA 2XN9C 3AB9A 3OMGA 1G91A 3TZUA 1S5CD 4DN4M 5D7GA 5I6WA 5KNCA 2HQEA 1DOLA 1V1PA 2K03A 1TS4A 4ZKCB 3H3VC 5C5LA 1WVLA 1I6VC 4MN3A 3VRAB 4KN4C 1BCPF 1WTQA 2R92B 1G6ZA 3NBIA 3VR3A 3VQIA 4OIKA 3MHBA