3EABA

Crystal structure of spastin mit in complex with escrt iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
MGSMEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Spastin
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3eabA01
4U31A 2V6YB 4U2ZA 3ZT6A 2DL1A 2V6XA 2WY2A 4U2YA 5FVKA 4U7IA 4CN4A 2CRBA 4P1NA 3ZSSA 2W2UA 1WFDA 2JQKA 3ZT7A 2K3WA 4U33A 1WR0A 4NIQA 4IT4A 3ZT5A 4ZEYA 4U7YA 4CN1A 4CN6A 2MPKA 2LRKA 5FVLA 2LRLA 3EABA 2WWVA 5CGMA 5CJ5A 2JQ9A 2JQHA 1YXRA 2XZEA 4WZXA 1WCRA 2V6YA 2CPTA 4A5XA 5LB7B 2RPAA 2A9UA 4U3CA 3K1SA 3ZSTA
chains in the Genus database with same CATH superfamily
4X62T 2H7OA 2LHRA 3RQUA 4YSZA 3LK3B 3RIUC 3DP7A 2BKOA 3X1DA 3BQKA 2CRBA 1XWMA 5J1GA 3ONJA 5AQMB 5HXHA 4LMLA 3AAEB 3PUQA 4X65T 2D9DA 3HI2A 5HEJA 2YK0A 3UULA 4DMWA 5AQOB 4UELA 3RF1A 3FZKB 4DR5T 3ANWB 5FNVE 1U4QA 3O1IA 4E7ZA 3PUGA 1J5ET 3I1AA 3QC9A 5L4HA 3PE0A 4HKAA 3ESLA 4QHOA 3F57A 3SS1A 4EAHA 3AA6B 3AVRA 3AE6A 1IAPA 2MAWA 2XZEA 2VVSA 2CPTA 2Z6EA 1LKXA 3N2GE 4U72A 2KSRA 3HA4A 2XQ7A 4QXCB 2AXDS 2LSJA 2V6YB 2X0HA 3EDVA 4ZOLE 4UVAB 2LKHA 2V7LA 4B3TT 2Y6XA 4ZXLA 2DLRA 2W61A 2WP9A 3QB5K 1UGOA 4O4LE 3N9LA 5LG4A 4JI4T 4TV9E 4KBMB 3K3NA 2VKJA 1O3XA 2X9XA 5LG3A 1ZEEA 2YDQA 4K0KT 3LBXB 3P7IA 4IT4A 1D0ZA 4MLKA 2E9XB 3RYIE 3FHNA 2MPKA 4CN1A 1W0AA 2C5JA 2W4XA 3C4ZA 3CQGB 4HWCA 3ABVA 5HXRA 2Y8DA 3AE2A 1UCUA 5LCYA 2V1DB 3VRAA 1D1AA 2LE8A 4IREA 2KT9A 4IDZA 3PDYA 2BKPA 1M62A 3RKOA 3PUVF 4JBWF 4JEUB 2DWGA 3UT5E 2QGSA 2IW5B 4HFIA 4YHJA 2HN2A 3KBUA 1EZ3A 4MBQA 4QKNA 5LB7B 1HX8A 3CWZB 2I6HA 3UU6A 4JV5T 3EDUA 2E8IA 3PJAA 3NBXX 4B3MT 2E9XC 4TWDA 5DABA 1SA0E 2BS3A 3KV5A 4G2AA 4TUYE 5AQRB 4DBQA 1SHZC 4JI8T 2UXCT 1Y64B 3AB3B 4B3RT 4WBNE 3T8OA 5JR9A 3L3PA 4OX9T 3O1HA 1T72A 2FUPA 3ONXA 2ACZA 4EYYR 4Q25A 3N9MA 4GOUA 1OEDB 3RX6A 5HAXA 4JI2T 4ASKA 2WWVA 3ZMUB 2MOZA 3QB5A 3U3IA 2XAGB 1E2AA 3NKZA 5CJ5A 3AE8A 4GYRA 1WYCA 2E9XD 2XAHB 5CB4E 3ZN0B 5JR9B 5ABFB 1BR0A 4XBFB 2KWHA 2D5UA 3AA1B 4U3CA 5L4EA 4X66T 2LT3A 4QX7B 5F5WA 1HNZT 3KV9A 4PJMA 3LFMA 5EK2A 2UUCT 3OVUA 2V6XA 4YJ3E 1N33T 2BBJA 4DR3T 3CMLA 3PUWF 3IEEA 1HX1B 2V5DA 1T98A 1KNZA 2XSBA 2VK9A 4LMKA 1WFDA 2FJBA 2V8SV 2XY8B 3DTOA 4GK5E 2WU5A 5DQWA 5H6QB 1I94T 1HF8A 2A72A 2XPKA 3AE9A 3Q2MA 4MALA 5AQNB 3SRZA 4X1IE 5AQJB 2YU2A 4EIWA 2LRKA 3RIFA 3ANWA 1H7CA 2IIUA 3H3MA 4UVBB 2K24A 2WMOA 3UTKA 5ABHA 2DCFA 2VL0A 4WYVA 2KNDA 3ZLIA 3R84B 2L3LA 5HEOA 1J5WA 3QK6A 3LSVA 1R8IA 2LM9A 2W63A 2ZM8A 3BK9A 4H9NC 5LOVE 4ZS3A 2IHR1 2XAFB 2BS4A 4J2CA 1WCRA 3ZJ2A 3L8RA 3ZYMA 3VR9A 3ZYLA 5H6RB 4LF8T 3T1HT 3RYCE 2WZHA 3UFGA 1KK7A 1CHUA 3CX8B 3MKDA 2BVMA 4ZI3C 3B5MA 3T1YT 5LJNA 3C51A 3PTRB 2X67A 3PU8A 5L3DB 1Z8UA 1HG5A 1XDPA 5LHHB 3WAJA 3EI0A 4H63V 2VB6A 3AEDA 3PUSA 4JUYA 4L0RA 4BJMA 2BZBA 4PFPA 5FXWA 4DV7T 4JI3T 4Z91A 3RRCA 3K3OA 3N9PA 3ZC1A 5CA0E 5HYAA 2PG8A 4TWHA 5HXCA 3UFEA 2GK9A 2ES0A 3KVBA 2ZLYA 5AQTB 2KWIB 2W67A 4CI2B 4YJ2E 5KX5E 1I6ZA 4HFDA 4TV8E 3VKGA 3FZLB 4LF9T 2LOPA 1SE7A 3AE3A 1UX4A 3RGLA 3JCFA 3ZN1B 4L5GA 2X0LB 4X64T 4AKHA 3A5XA 5LGUB 1WR6A 2FBWA 3BQLA 3Q5DA 4UV8B 1YW0A 4QXBB 5HCMA 5L47A 3ZT6A 2DL1A 5IUXA 1UX5A 2PTFA 4DR2T 1MIVA 1YKEB 5IHYA 4P0BA 3ETUA 3ZMVB 5JDNA 5L3EB 2HHHT 3LJCA 1ZP0A 3FZHB 3OBVE 5FYMA 3ZPOA 3ZEFB 2X9YA 3AEAA 3VU7H 2K5BB 2YINA 3I9YA 4CN6A 2XM2A 4DNDA 5FXZA 2CHNA 2LKGA 3K3QC 4BAYB 2WSSV 4JI0T 1HG2A 2E5VA 4IDQA 3LBXA 4QH1A 1NENA 3P4WA 2KLQA 2CXFA 1FMWA 2KMFA 2L8KA 3OPCA 2IUBA 3ZJ1A 3HR0A 4I43B 4WW0A 1MNDA 3MXZA 5LBMA 3CIRA 3M3ZB 2H88A 2XUEA 4HWHA 4O2BE 4U74A 4E7SA 4CI3B 1AJ3A 2WDVA 3ZSTA 2VL8A 4ILBA 4EZHA 3AECA 4U31A 2B1EA 5AQFB 1UUSA 2W00A 3PJAJ 4U7IA 4CN4A 1J1JA 3EVYA 1NEKA 4ZZCA 5C8YE 1D0YA 3O9XA 4EOZB 2XSAA 1N32T 1FJGT 4DR1T 4DR4T 4KHPT 3I0QA 4NIQA 2QA7A 2ZM2A 3MZKB 3PU3A 4PK5A 4DV0T 3UU4A 2X51A 5JDFA 4F6RC 1MIYA 2PJQA 1U5PA 2V7MA 1XMOT 3NRYA 4YFSA 4EZ4A 5J2TE 3NRXA 2QRXA 2VURA 5AQIB 2JMKA 4YSYA 2NR4A 2V5CA 3AE5A 3I9WA 2LSKA 4ZI7E 1ZKEA 2OA5A 3AEEA 3KVAA 4ZS2A 4ILUA 2X66A 2JIWA 4JI5T 4ADZA 4CQIA 1YXRA 4PFOA 3LK2B 2V7IA 4DO0A 5CA1E 4DBRA 1ZV4X 2CE7A 3GWHA 5LGTB 1W0BA 3JC6C 3V5UA 5JTGA 2MTQA 1IJ6A 5IWAT 2P9BA 2YKSA 1MNEA 1Z0PA 4HWIB 1WLXA 2UXBT 2XQYA 3AXJB 4X1KE 3CX7B 4O2AE 4JI1T 3U78A 2N1GA 2W62A 4FI5A 3TLTA 2F4VT 2YEVC 2HPJA 2M6BA 2XQAA 2YU1A 1HNWT 5JRCB 1YKHB 2CHOA 1YQ3A 2JQKA 2FJDA 3L09A 4U33A 1KFYA 4I50E 4AQFC 4DUZT 4JI6T 4HEAA 3IA3A 2V7KA 2WZIA 4YTMA 4H9RC 4BA9A 5L3GB 4A56A 3ETVA 3RH3A 4Z8XA 2Q9QA 2CBJA 3UQ7A 5L3FB 4MHCA 2UXNB 4I55E 4UF0A 1XZYA 2DWKA 1JNZA 3GMIA 3PUXF 4OHFA 2YDRA 4UXNB 5FY1A 3UU3A 4ERRA 2X9WA 3B13A 4TNWA 4YTNA 5FXXA 1VCTA 1MMDA 2BS2A 2K48A 1V9DA 3ZCJA 5EK4A 2V6YA 2UUAT 1LRZA 2WDQA 5L2LA 2M67A 4TN7B 5JH7E 4JEHB 2UUBT 1DU2A 2XJ7A 3Q9DA 5KDMC 4AKIA 3OYZA 4YLHA 4EYUA 1WRDA 3HKEE 4V1Av 5DQVA 5LGNB 4LF4T 3E0ZA 5FVKA 5AQUB 2HPLA 2XASB 2ACXA 2WU2A 3FXDB 3ZMTB 3RYFE 5LJMA 5FL0A 2VQFT 2PBIA 2FJAA 2VVNA 2VKDA 1FEWA 3OJAA 4IIJE 4IE6A 3IF8B 5AQVB 3RI5A 4A98A 2CWYA 4DV6T 4DR7T 2EHOD 2VKHA 3PUAA 5LP6E 2JJ9A 1BR4A 3HKCE 2YN6A 2WQYA 4AQFA 4CXXA 2EHOB 3IBPA 2LRLA 3OKQA 2Q9QD 2XM1A 3Q5XA 5HXEA 3EABA 5IYZE 3W15B 2MBGA 4AKRB 1BR1A 5JDQA 2KINB 2HN1A 3AEFA 3AEBA 2JQ9A 2IAKA 3EUHA 4A5XA 3Q5EA 4IE7A 2I0MA 3O1JA 3LG7A 3ZYKA 4HWDA 2UXDT 2WDRA 4U2ZA 1KF6A 2WWUA 2XAJB 3P50A 4IE4A 5AQHB 3GN5A 5AQKB 2WAUA 5AQQB 4KUMB 3GA8A 1L0VA 3HL6A 3TKLB 2G0UA 4IL4A 1ZOYA 1OXZA 5C2TA 2EHOC 2X9HA 3IHRA 4P1NA 3ZSSA 4Z90A 5JDLA 4DUYT 4NXNT 3EAMA 4GK0E 2WCAA 3KBTA 3N9NA 2XTLA 1X79A 3AAAB 1OEDA 3P4PA 4IDOA 4O8SA 1MMAA 3RRWA 4DV2T 3RC8A 4H63H 2L9QA 3LDQB 3JC6D 2BG9C 2R6GF 4FJOA 4HFEA 5ABEA 1HNXT 4H9OC 4O4JE 3FXEB 4WNKA 5E0OA 3S4UA 2MYSA 3P4SA 5J2UE 4EV6A 2Y48B 4PK6A 2JQHA 3M65A 2J47A 3N2OA 4HFVA 4PJLA 4UR9A 2RPAA 4JLEA 3C4WA 4X20E 2ODVA 2SPCA 3MACA 4CI1B 3CVRA 3CK6A 5ABGA 4C90A 4ZI3D 4X1YE 2BG9B 2W66A 3SOLA 2J1DG 5LHGB 3ZC0A 4DV5T 4B6XA 2K9AA 2IC9A 2WM9A 1XDOA 5L3BB 2WBLA 2V7JA 2VQET 2W2UA 1KNPA 2FJEA 4H9PC 2QVAA 4YXDA 3ZT7A 3WAKA 4OK0A 4MFRA 1WR0A 4ILAA 3RYHE 4EEDA 4ZI2C 5JREA 2ZM0A 3C4XA 4XZCA 2JPFA 4KMCA 4KX6A 4UIGA 4QXHB 1T8BA 4KP3C 2YOEA 3FBLA 2IDOB 1KEYA 4GIWA 4LF6T 5JRCA 1WYBA 3V5SA 4TNVA 3P4QA 4B3ST 2XQ6A 2IMLA 2N2NA 3JAEA 4QWNB 4HGAA 3WI3A 4EXTA 2XQ3A 1ZHCA 4DV3T 4GKKT 2JQQA 5LBQB 5AQLB 2ZM6T 2OV9A 2CXLA 1KNRA 4LFCT 4COFA 3UUNA 4IHJE 4L9IA 4DMVA 2KZ7B 3K1SA 3KV6A 3TLUA 4ZI2D 4HN9A 4IE0A 3LK42 5LMUT 4HTEA 3NVOA 2LLYA 2H7VC 4IDPA 1IZNB 4BJNA 4LFBT 5L3CB 4KI0F 4JYAT 3ZMSB 2VASA 2J4GA 3N2KE 1VCSA 4DR6T 4HFHA 2J62A 3FB2A 2LSYA 5AQPB 5BMVE 2W0GA 1SUMB 2JRKA 4YY3T 2BVLA 5FMNA 3E22E 4HWFA 2B76A 4DV1T 1QUUA 3AE4A 2WS3A 2CLYB 3I0OA 3KDSE 3ONLC 1W9RA 1NAFA 3VRBA 3AA0B 3F31A 4EGWA 4I0UA 1LVKA 4PK4A 5ETWA 2OLTA 2RP4A 3B57A 3P8CD 4HFCA 4I4TE 4GYSA 4PAGA 5HEHA 2D0TA 1D1BA 2NW9A 3QNUA 2XAQB 1FMVA 4YHHT 1QLBA 2ZMAA 2LM2A 2Q9QB 4AIUA 5C3JA 5HEGA 4UF0B 3SFEA 3UU5A 5FP3A 4LF7T 1HTJF 2WB5A 5FY7A 2BG9A 4ISSA 1OEDE 2DHRA 5EZYE 1IBMT 1JNRA 1M7KA 1FIOA 2A3DA 1G8XA 2I59A 3MJXA 4HFBA 3RLFF 5LHIB 2CA5A 3CQCB 4C91A 4LF5T 2H3RA 2LOSA 4K0UA 4PNIA 4QH5A 3SFDA 2VWAA 1QSDA 3D0TA 3RC3A 4QX8B 1UURA 2A2FX 3ZKRA 3RPUA 2C0SA 4CXWA 3VKHA 1X9BA 2Q9QC 4G63A 2LSGA 5FXVA 4IDNA 3R6NA 5HXSA 2CWOA 4U7YA 1S35A 3RIUA 5FL1A 4IE5A 3BQIA 3K8PC 4PW8A 5JDMA 1N36T 2C5IT 2JMHA 3E08A 3G06A 5HWXA 4TZ4C 5J0ZA 1D0XA 2LHNA 1XNQT 1US7B 4PJNA 3RQWA 1OWAA 2D0UA 2CEAA 3C64A 4P09A 2BDEA 2LEHA 4IGUA 2EHOA 4AXPA 1XMQT 1N34T 2M6IA 1MMGA 4UEMA 2A9UA 3SWHA 3PURA 2CM0A 3VHLA 1G73A 2VKOA 5LXTE 3ZCIA 1GQEA 4UV9B 2HH7A 4U2YA 4PJJA 1W09A 5ADXL 4ISTA 2XQ9A 3KV4A 5AQGB 5TAOA 4AKLA 1CUNA 4NUVA 4F8HA 1VOMA 1HCIA 3GN5B 5JVDE 4ILCA 3ZMZB 3HKDE 2NW8A 2X68A 4OFZA 3ZT5A 4YT0A 5KMGP 4ZZBA 3N9OA 3MA9A 2CMRA 5JR9C 2XQ5A 1LVFA 2V26A 3TLWA 4EEBA 4OYKA 3AE7A 3QUJA 2LSIA 5FVLA 5FY0A 3J9X1 3AVSA 3C98B 3PV0F 1VRBA 2WMNA 5EK3A 5F8PA 4JI7T 3N5LA 4O4IE 2QYWA 4A97A 3RKGA 3HKBE 2PFVA 2H89A 4CZZB 1XNRT 3A7MA 2XQ8A 4HE8A 3NWIA 4N78D 4OYJA 3AXJA 5CFBA 5LYJE 3VR8A 5AFUL 1Y01A 3AE1A 3QOFA 4ANJA 2RA1A 3C50A 4YSXA 5KXJA 2D2SA 4DIDB 4IL9A 5A1LA 2C5KT 2XHEB 2NW7A 3KFWX 5JQGE 4AI6A 2DNXA 3OTOT 3FZMB 2YDSA 3AAIA 5AQSB 3TLVA 4TX5A 2BBHA 1B7TA 1HFAA 2K3WA 4AKGA 2NOXA 1D1CA 1T7SA 4P0AA 2E9XA 3H3AA 5FKYA 4UVCB 3TLSA 2CLYC 3OYXA 1BR2A 2NTXA 4H9QC 1MIWA 2UXXB 3KINB 4H9SE 5HCJA 3RHWA 4M1PA 5JDGA 3JADA 5BR8T 2BG9E 4XAXB 4LMJA 5F3JA 5ABFA 5JDHA 5LNKA 4LFAT 2KXPB 3CX6B 3O4XE 5GONE 5LA6E 2IC6A 5HWYA 3UU8A 5CGMA 2CBIA 1YD8G 3RIAA 2E5LT 4WZXA 1IBKT 2UU9T 4NUUA 4ZHQE 2ODUA 2DI4A 1E7PA 1NWMX 1UK5A 3UUBA 3N9QA 4O4HE 1S94A 1YQ4A 4CXYA 5LMNT 4AISA 2WY2A 4GKJT 3UUXB 4AQYT 2CCQA 2BKNA 3FBZA 3AA7B 3L39A 3F2EA 5M4YA 2N9DA 3J7Yq 4NXMT 3P4RA 2NWBA 4ZEYA 3JAFA 5DJQC 1HS7A 2CXDA 2NP9A 4AQGA 2E2AA 4EB6E 4WBOA 1OEDC 3FZFB 3Q5WA 4KHZF 3PUYF 4TWFA 2X0YA 1IBLT 4DV4T 2LJLA 3CPZA 3NZQA 3PUZF 3AEGA 1E1HB 4DVDA 1MMNA 5HEUA 3UQ4A 2AE9A 3CQXC 3A8YC 3MK7C 1HR0T 3UUMA 2XQ4A 3DJBA 3NZPA 3EHZA 1IJ5A 4QH4A 4YTPA 3CKDA 2NTYA 4NPPA 3H37A 4X5TA
chains in the Genus database with same CATH topology
4U31A 2V6YB 4U2ZA 3ZT6A 2DL1A 2V6XA 2WY2A 4U2YA 5FVKA 4U7IA 4CN4A 2CRBA 4P1NA 3ZSSA 2W2UA 1WFDA 2JQKA 3ZT7A 2K3WA 4U33A 1WR0A 4NIQA 4IT4A 3ZT5A 4ZEYA 4U7YA 4CN1A 4CN6A 2MPKA 2LRKA 5FVLA 2LRLA 3EABA 2WWVA 5CGMA 5CJ5A 2JQ9A 2JQHA 1YXRA 2XZEA 4WZXA 1WCRA 2V6YA 2CPTA 4A5XA 5LB7B 2RPAA 2A9UA 4U3CA 3K1SA 3ZSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U31 A;  2V6Y B;  4U2Z A;  3ZT6 A;  2DL1 A;  2V6X A;  2WY2 A;  4U2Y A;  5FVK A;  4U7I A;  4CN4 A;  2CRB A;  4P1N A;  3ZSS A;  2W2U A;  1WFD A;  2JQK A;  3ZT7 A;  2K3W A;  4U33 A;  1WR0 A;  4NIQ A;  4IT4 A;  3ZT5 A;  4ZEY A;  4U7Y A;  4CN1 A;  4CN6 A;  2MPK A;  2LRK A;  5FVL A;  2LRL A;  3EAB A;  2WWV A;  5CGM A;  5CJ5 A;  2JQ9 A;  2JQH A;  1YXR A;  2XZE A;  4WZX A;  1WCR A;  2V6Y A;  2CPT A;  4A5X A;  5LB7 B;  2RPA A;  2A9U A;  4U3C A;  3K1S A;  3ZST A; 
#chains in the Genus database with same CATH topology
 4X62 T;  2H7O A;  2LHR A;  3RQU A;  4YSZ A;  3LK3 B;  3RIU C;  3DP7 A;  2BKO A;  3X1D A;  3BQK A;  2CRB A;  1XWM A;  5J1G A;  3ONJ A;  5AQM B;  5HXH A;  4LML A;  3AAE B;  3PUQ A;  4X65 T;  2D9D A;  3HI2 A;  5HEJ A;  2YK0 A;  3UUL A;  4DMW A;  5AQO B;  4UEL A;  3RF1 A;  3FZK B;  4DR5 T;  3ANW B;  5FNV E;  1U4Q A;  3O1I A;  4E7Z A;  3PUG A;  1J5E T;  3I1A A;  3QC9 A;  5L4H A;  3PE0 A;  4HKA A;  3ESL A;  4QHO A;  3F57 A;  3SS1 A;  4EAH A;  3AA6 B;  3AVR A;  3AE6 A;  1IAP A;  2MAW A;  2XZE A;  2VVS A;  2CPT A;  2Z6E A;  1LKX A;  3N2G E;  4U72 A;  2KSR A;  3HA4 A;  2XQ7 A;  4QXC B;  2AXD S;  2LSJ A;  2V6Y B;  2X0H A;  3EDV A;  4ZOL E;  4UVA B;  2LKH A;  2V7L A;  4B3T T;  2Y6X A;  4ZXL A;  2DLR A;  2W61 A;  2WP9 A;  3QB5 K;  1UGO A;  4O4L E;  3N9L A;  5LG4 A;  4JI4 T;  4TV9 E;  4KBM B;  3K3N A;  2VKJ A;  1O3X A;  2X9X A;  5LG3 A;  1ZEE A;  2YDQ A;  4K0K T;  3LBX B;  3P7I A;  4IT4 A;  1D0Z A;  4MLK A;  2E9X B;  3RYI E;  3FHN A;  2MPK A;  4CN1 A;  1W0A A;  2C5J A;  2W4X A;  3C4Z A;  3CQG B;  4HWC A;  3ABV A;  5HXR A;  2Y8D A;  3AE2 A;  1UCU A;  5LCY A;  2V1D B;  3VRA A;  1D1A A;  2LE8 A;  4IRE A;  2KT9 A;  4IDZ A;  3PDY A;  2BKP A;  1M62 A;  3RKO A;  3PUV F;  4JBW F;  4JEU B;  2DWG A;  3UT5 E;  2QGS A;  2IW5 B;  4HFI A;  4YHJ A;  2HN2 A;  3KBU A;  1EZ3 A;  4MBQ A;  4QKN A;  5LB7 B;  1HX8 A;  3CWZ B;  2I6H A;  3UU6 A;  4JV5 T;  3EDU A;  2E8I A;  3PJA A;  3NBX X;  4B3M T;  2E9X C;  4TWD A;  5DAB A;  1SA0 E;  2BS3 A;  3KV5 A;  4G2A A;  4TUY E;  5AQR B;  4DBQ A;  1SHZ C;  4JI8 T;  2UXC T;  1Y64 B;  3AB3 B;  4B3R T;  4WBN E;  3T8O A;  5JR9 A;  3L3P A;  4OX9 T;  3O1H A;  1T72 A;  2FUP A;  3ONX A;  2ACZ A;  4EYY R;  4Q25 A;  3N9M A;  4GOU A;  1OED B;  3RX6 A;  5HAX A;  4JI2 T;  4ASK A;  2WWV A;  3ZMU B;  2MOZ A;  3QB5 A;  3U3I A;  2XAG B;  1E2A A;  3NKZ A;  5CJ5 A;  3AE8 A;  4GYR A;  1WYC A;  2E9X D;  2XAH B;  5CB4 E;  3ZN0 B;  5JR9 B;  5ABF B;  1BR0 A;  4XBF B;  2KWH A;  2D5U A;  3AA1 B;  4U3C A;  5L4E A;  4X66 T;  2LT3 A;  4QX7 B;  5F5W A;  1HNZ T;  3KV9 A;  4PJM A;  3LFM A;  5EK2 A;  2UUC T;  3OVU A;  2V6X A;  4YJ3 E;  1N33 T;  2BBJ A;  4DR3 T;  3CML A;  3PUW F;  3IEE A;  1HX1 B;  2V5D A;  1T98 A;  1KNZ A;  2XSB A;  2VK9 A;  4LMK A;  1WFD A;  2FJB A;  2V8S V;  2XY8 B;  3DTO A;  4GK5 E;  2WU5 A;  5DQW A;  5H6Q B;  1I94 T;  1HF8 A;  2A72 A;  2XPK A;  3AE9 A;  3Q2M A;  4MAL A;  5AQN B;  3SRZ A;  4X1I E;  5AQJ B;  2YU2 A;  4EIW A;  2LRK A;  3RIF A;  3ANW A;  1H7C A;  2IIU A;  3H3M A;  4UVB B;  2K24 A;  2WMO A;  3UTK A;  5ABH A;  2DCF A;  2VL0 A;  4WYV A;  2KND A;  3ZLI A;  3R84 B;  2L3L A;  5HEO A;  1J5W A;  3QK6 A;  3LSV A;  1R8I A;  2LM9 A;  2W63 A;  2ZM8 A;  3BK9 A;  4H9N C;  5LOV E;  4ZS3 A;  2IHR 1;  2XAF B;  2BS4 A;  4J2C A;  1WCR A;  3ZJ2 A;  3L8R A;  3ZYM A;  3VR9 A;  3ZYL A;  5H6R B;  4LF8 T;  3T1H T;  3RYC E;  2WZH A;  3UFG A;  1KK7 A;  1CHU A;  3CX8 B;  3MKD A;  2BVM A;  4ZI3 C;  3B5M A;  3T1Y T;  5LJN A;  3C51 A;  3PTR B;  2X67 A;  3PU8 A;  5L3D B;  1Z8U A;  1HG5 A;  1XDP A;  5LHH B;  3WAJ A;  3EI0 A;  4H63 V;  2VB6 A;  3AED A;  3PUS A;  4JUY A;  4L0R A;  4BJM A;  2BZB A;  4PFP A;  5FXW A;  4DV7 T;  4JI3 T;  4Z91 A;  3RRC A;  3K3O A;  3N9P A;  3ZC1 A;  5CA0 E;  5HYA A;  2PG8 A;  4TWH A;  5HXC A;  3UFE A;  2GK9 A;  2ES0 A;  3KVB A;  2ZLY A;  5AQT B;  2KWI B;  2W67 A;  4CI2 B;  4YJ2 E;  5KX5 E;  1I6Z A;  4HFD A;  4TV8 E;  3VKG A;  3FZL B;  4LF9 T;  2LOP A;  1SE7 A;  3AE3 A;  1UX4 A;  3RGL A;  3JCF A;  3ZN1 B;  4L5G A;  2X0L B;  4X64 T;  4AKH A;  3A5X A;  5LGU B;  1WR6 A;  2FBW A;  3BQL A;  3Q5D A;  4UV8 B;  1YW0 A;  4QXB B;  5HCM A;  5L47 A;  3ZT6 A;  2DL1 A;  5IUX A;  1UX5 A;  2PTF A;  4DR2 T;  1MIV A;  1YKE B;  5IHY A;  4P0B A;  3ETU A;  3ZMV B;  5JDN A;  5L3E B;  2HHH T;  3LJC A;  1ZP0 A;  3FZH B;  3OBV E;  5FYM A;  3ZPO A;  3ZEF B;  2X9Y A;  3AEA A;  3VU7 H;  2K5B B;  2YIN A;  3I9Y A;  4CN6 A;  2XM2 A;  4DND A;  5FXZ A;  2CHN A;  2LKG A;  3K3Q C;  4BAY B;  2WSS V;  4JI0 T;  1HG2 A;  2E5V A;  4IDQ A;  3LBX A;  4QH1 A;  1NEN A;  3P4W A;  2KLQ A;  2CXF A;  1FMW A;  2KMF A;  2L8K A;  3OPC A;  2IUB A;  3ZJ1 A;  3HR0 A;  4I43 B;  4WW0 A;  1MND A;  3MXZ A;  5LBM A;  3CIR A;  3M3Z B;  2H88 A;  2XUE A;  4HWH A;  4O2B E;  4U74 A;  4E7S A;  4CI3 B;  1AJ3 A;  2WDV A;  3ZST A;  2VL8 A;  4ILB A;  4EZH A;  3AEC A;  4U31 A;  2B1E A;  5AQF B;  1UUS A;  2W00 A;  3PJA J;  4U7I A;  4CN4 A;  1J1J A;  3EVY A;  1NEK A;  4ZZC A;  5C8Y E;  1D0Y A;  3O9X A;  4EOZ B;  2XSA A;  1N32 T;  1FJG T;  4DR1 T;  4DR4 T;  4KHP T;  3I0Q A;  4NIQ A;  2QA7 A;  2ZM2 A;  3MZK B;  3PU3 A;  4PK5 A;  4DV0 T;  3UU4 A;  2X51 A;  5JDF A;  4F6R C;  1MIY A;  2PJQ A;  1U5P A;  2V7M A;  1XMO T;  3NRY A;  4YFS A;  4EZ4 A;  5J2T E;  3NRX A;  2QRX A;  2VUR A;  5AQI B;  2JMK A;  4YSY A;  2NR4 A;  2V5C A;  3AE5 A;  3I9W A;  2LSK A;  4ZI7 E;  1ZKE A;  2OA5 A;  3AEE A;  3KVA A;  4ZS2 A;  4ILU A;  2X66 A;  2JIW A;  4JI5 T;  4ADZ A;  4CQI A;  1YXR A;  4PFO A;  3LK2 B;  2V7I A;  4DO0 A;  5CA1 E;  4DBR A;  1ZV4 X;  2CE7 A;  3GWH A;  5LGT B;  1W0B A;  3JC6 C;  3V5U A;  5JTG A;  2MTQ A;  1IJ6 A;  5IWA T;  2P9B A;  2YKS A;  1MNE A;  1Z0P A;  4HWI B;  1WLX A;  2UXB T;  2XQY A;  3AXJ B;  4X1K E;  3CX7 B;  4O2A E;  4JI1 T;  3U78 A;  2N1G A;  2W62 A;  4FI5 A;  3TLT A;  2F4V T;  2YEV C;  2HPJ A;  2M6B A;  2XQA A;  2YU1 A;  1HNW T;  5JRC B;  1YKH B;  2CHO A;  1YQ3 A;  2JQK A;  2FJD A;  3L09 A;  4U33 A;  1KFY A;  4I50 E;  4AQF C;  4DUZ T;  4JI6 T;  4HEA A;  3IA3 A;  2V7K A;  2WZI A;  4YTM A;  4H9R C;  4BA9 A;  5L3G B;  4A56 A;  3ETV A;  3RH3 A;  4Z8X A;  2Q9Q A;  2CBJ A;  3UQ7 A;  5L3F B;  4MHC A;  2UXN B;  4I55 E;  4UF0 A;  1XZY A;  2DWK A;  1JNZ A;  3GMI A;  3PUX F;  4OHF A;  2YDR A;  4UXN B;  5FY1 A;  3UU3 A;  4ERR A;  2X9W A;  3B13 A;  4TNW A;  4YTN A;  5FXX A;  1VCT A;  1MMD A;  2BS2 A;  2K48 A;  1V9D A;  3ZCJ A;  5EK4 A;  2V6Y A;  2UUA T;  1LRZ A;  2WDQ A;  5L2L A;  2M67 A;  4TN7 B;  5JH7 E;  4JEH B;  2UUB T;  1DU2 A;  2XJ7 A;  3Q9D A;  5KDM C;  4AKI A;  3OYZ A;  4YLH A;  4EYU A;  1WRD A;  3HKE E;  4V1A v;  5DQV A;  5LGN B;  4LF4 T;  3E0Z A;  5FVK A;  5AQU B;  2HPL A;  2XAS B;  2ACX A;  2WU2 A;  3FXD B;  3ZMT B;  3RYF E;  5LJM A;  5FL0 A;  2VQF T;  2PBI A;  2FJA A;  2VVN A;  2VKD A;  1FEW A;  3OJA A;  4IIJ E;  4IE6 A;  3IF8 B;  5AQV B;  3RI5 A;  4A98 A;  2CWY A;  4DV6 T;  4DR7 T;  2EHO D;  2VKH A;  3PUA A;  5LP6 E;  2JJ9 A;  1BR4 A;  3HKC E;  2YN6 A;  2WQY A;  4AQF A;  4CXX A;  2EHO B;  3IBP A;  2LRL A;  3OKQ A;  2Q9Q D;  2XM1 A;  3Q5X A;  5HXE A;  3EAB A;  5IYZ E;  3W15 B;  2MBG A;  4AKR B;  1BR1 A;  5JDQ A;  2KIN B;  2HN1 A;  3AEF A;  3AEB A;  2JQ9 A;  2IAK A;  3EUH A;  4A5X A;  3Q5E A;  4IE7 A;  2I0M A;  3O1J A;  3LG7 A;  3ZYK A;  4HWD A;  2UXD T;  2WDR A;  4U2Z A;  1KF6 A;  2WWU A;  2XAJ B;  3P50 A;  4IE4 A;  5AQH B;  3GN5 A;  5AQK B;  2WAU A;  5AQQ B;  4KUM B;  3GA8 A;  1L0V A;  3HL6 A;  3TKL B;  2G0U A;  4IL4 A;  1ZOY A;  1OXZ A;  5C2T A;  2EHO C;  2X9H A;  3IHR A;  4P1N A;  3ZSS A;  4Z90 A;  5JDL A;  4DUY T;  4NXN T;  3EAM A;  4GK0 E;  2WCA A;  3KBT A;  3N9N A;  2XTL A;  1X79 A;  3AAA B;  1OED A;  3P4P A;  4IDO A;  4O8S A;  1MMA A;  3RRW A;  4DV2 T;  3RC8 A;  4H63 H;  2L9Q A;  3LDQ B;  3JC6 D;  2BG9 C;  2R6G F;  4FJO A;  4HFE A;  5ABE A;  1HNX T;  4H9O C;  4O4J E;  3FXE B;  4WNK A;  5E0O A;  3S4U A;  2MYS A;  3P4S A;  5J2U E;  4EV6 A;  2Y48 B;  4PK6 A;  2JQH A;  3M65 A;  2J47 A;  3N2O A;  4HFV A;  4PJL A;  4UR9 A;  2RPA A;  4JLE A;  3C4W A;  4X20 E;  2ODV A;  2SPC A;  3MAC A;  4CI1 B;  3CVR A;  3CK6 A;  5ABG A;  4C90 A;  4ZI3 D;  4X1Y E;  2BG9 B;  2W66 A;  3SOL A;  2J1D G;  5LHG B;  3ZC0 A;  4DV5 T;  4B6X A;  2K9A A;  2IC9 A;  2WM9 A;  1XDO A;  5L3B B;  2WBL A;  2V7J A;  2VQE T;  2W2U A;  1KNP A;  2FJE A;  4H9P C;  2QVA A;  4YXD A;  3ZT7 A;  3WAK A;  4OK0 A;  4MFR A;  1WR0 A;  4ILA A;  3RYH E;  4EED A;  4ZI2 C;  5JRE A;  2ZM0 A;  3C4X A;  4XZC A;  2JPF A;  4KMC A;  4KX6 A;  4UIG A;  4QXH B;  1T8B A;  4KP3 C;  2YOE A;  3FBL A;  2IDO B;  1KEY A;  4GIW A;  4LF6 T;  5JRC A;  1WYB A;  3V5S A;  4TNV A;  3P4Q A;  4B3S T;  2XQ6 A;  2IML A;  2N2N A;  3JAE A;  4QWN B;  4HGA A;  3WI3 A;  4EXT A;  2XQ3 A;  1ZHC A;  4DV3 T;  4GKK T;  2JQQ A;  5LBQ B;  5AQL B;  2ZM6 T;  2OV9 A;  2CXL A;  1KNR A;  4LFC T;  4COF A;  3UUN A;  4IHJ E;  4L9I A;  4DMV A;  2KZ7 B;  3K1S A;  3KV6 A;  3TLU A;  4ZI2 D;  4HN9 A;  4IE0 A;  3LK4 2;  5LMU T;  4HTE A;  3NVO A;  2LLY A;  2H7V C;  4IDP A;  1IZN B;  4BJN A;  4LFB T;  5L3C B;  4KI0 F;  4JYA T;  3ZMS B;  2VAS A;  2J4G A;  3N2K E;  1VCS A;  4DR6 T;  4HFH A;  2J62 A;  3FB2 A;  2LSY A;  5AQP B;  5BMV E;  2W0G A;  1SUM B;  2JRK A;  4YY3 T;  2BVL A;  5FMN A;  3E22 E;  4HWF A;  2B76 A;  4DV1 T;  1QUU A;  3AE4 A;  2WS3 A;  2CLY B;  3I0O A;  3KDS E;  3ONL C;  1W9R A;  1NAF A;  3VRB A;  3AA0 B;  3F31 A;  4EGW A;  4I0U A;  1LVK A;  4PK4 A;  5ETW A;  2OLT A;  2RP4 A;  3B57 A;  3P8C D;  4HFC A;  4I4T E;  4GYS A;  4PAG A;  5HEH A;  2D0T A;  1D1B A;  2NW9 A;  3QNU A;  2XAQ B;  1FMV A;  4YHH T;  1QLB A;  2ZMA A;  2LM2 A;  2Q9Q B;  4AIU A;  5C3J A;  5HEG A;  4UF0 B;  3SFE A;  3UU5 A;  5FP3 A;  4LF7 T;  1HTJ F;  2WB5 A;  5FY7 A;  2BG9 A;  4ISS A;  1OED E;  2DHR A;  5EZY E;  1IBM T;  1JNR A;  1M7K A;  1FIO A;  2A3D A;  1G8X A;  2I59 A;  3MJX A;  4HFB A;  3RLF F;  5LHI B;  2CA5 A;  3CQC B;  4C91 A;  4LF5 T;  2H3R A;  2LOS A;  4K0U A;  4PNI A;  4QH5 A;  3SFD A;  2VWA A;  1QSD A;  3D0T A;  3RC3 A;  4QX8 B;  1UUR A;  2A2F X;  3ZKR A;  3RPU A;  2C0S A;  4CXW A;  3VKH A;  1X9B A;  2Q9Q C;  4G63 A;  2LSG A;  5FXV A;  4IDN A;  3R6N A;  5HXS A;  2CWO A;  4U7Y A;  1S35 A;  3RIU A;  5FL1 A;  4IE5 A;  3BQI A;  3K8P C;  4PW8 A;  5JDM A;  1N36 T;  2C5I T;  2JMH A;  3E08 A;  3G06 A;  5HWX A;  4TZ4 C;  5J0Z A;  1D0X A;  2LHN A;  1XNQ T;  1US7 B;  4PJN A;  3RQW A;  1OWA A;  2D0U A;  2CEA A;  3C64 A;  4P09 A;  2BDE A;  2LEH A;  4IGU A;  2EHO A;  4AXP A;  1XMQ T;  1N34 T;  2M6I A;  1MMG A;  4UEM A;  2A9U A;  3SWH A;  3PUR A;  2CM0 A;  3VHL A;  1G73 A;  2VKO A;  5LXT E;  3ZCI A;  1GQE A;  4UV9 B;  2HH7 A;  4U2Y A;  4PJJ A;  1W09 A;  5ADX L;  4IST A;  2XQ9 A;  3KV4 A;  5AQG B;  5TAO A;  4AKL A;  1CUN A;  4NUV A;  4F8H A;  1VOM A;  1HCI A;  3GN5 B;  5JVD E;  4ILC A;  3ZMZ B;  3HKD E;  2NW8 A;  2X68 A;  4OFZ A;  3ZT5 A;  4YT0 A;  5KMG P;  4ZZB A;  3N9O A;  3MA9 A;  2CMR A;  5JR9 C;  2XQ5 A;  1LVF A;  2V26 A;  3TLW A;  4EEB A;  4OYK A;  3AE7 A;  3QUJ A;  2LSI A;  5FVL A;  5FY0 A;  3J9X 1;  3AVS A;  3C98 B;  3PV0 F;  1VRB A;  2WMN A;  5EK3 A;  5F8P A;  4JI7 T;  3N5L A;  4O4I E;  2QYW A;  4A97 A;  3RKG A;  3HKB E;  2PFV A;  2H89 A;  4CZZ B;  1XNR T;  3A7M A;  2XQ8 A;  4HE8 A;  3NWI A;  4N78 D;  4OYJ A;  3AXJ A;  5CFB A;  5LYJ E;  3VR8 A;  5AFU L;  1Y01 A;  3AE1 A;  3QOF A;  4ANJ A;  2RA1 A;  3C50 A;  4YSX A;  5KXJ A;  2D2S A;  4DID B;  4IL9 A;  5A1L A;  2C5K T;  2XHE B;  2NW7 A;  3KFW X;  5JQG E;  4AI6 A;  2DNX A;  3OTO T;  3FZM B;  2YDS A;  3AAI A;  5AQS B;  3TLV A;  4TX5 A;  2BBH A;  1B7T A;  1HFA A;  2K3W A;  4AKG A;  2NOX A;  1D1C A;  1T7S A;  4P0A A;  2E9X A;  3H3A A;  5FKY A;  4UVC B;  3TLS A;  2CLY C;  3OYX A;  1BR2 A;  2NTX A;  4H9Q C;  1MIW A;  2UXX B;  3KIN B;  4H9S E;  5HCJ A;  3RHW A;  4M1P A;  5JDG A;  3JAD A;  5BR8 T;  2BG9 E;  4XAX B;  4LMJ A;  5F3J A;  5ABF A;  5JDH A;  5LNK A;  4LFA T;  2KXP B;  3CX6 B;  3O4X E;  5GON E;  5LA6 E;  2IC6 A;  5HWY A;  3UU8 A;  5CGM A;  2CBI A;  1YD8 G;  3RIA A;  2E5L T;  4WZX A;  1IBK T;  2UU9 T;  4NUU A;  4ZHQ E;  2ODU A;  2DI4 A;  1E7P A;  1NWM X;  1UK5 A;  3UUB A;  3N9Q A;  4O4H E;  1S94 A;  1YQ4 A;  4CXY A;  5LMN T;  4AIS A;  2WY2 A;  4GKJ T;  3UUX B;  4AQY T;  2CCQ A;  2BKN A;  3FBZ A;  3AA7 B;  3L39 A;  3F2E A;  5M4Y A;  2N9D A;  3J7Y q;  4NXM T;  3P4R A;  2NWB A;  4ZEY A;  3JAF A;  5DJQ C;  1HS7 A;  2CXD A;  2NP9 A;  4AQG A;  2E2A A;  4EB6 E;  4WBO A;  1OED C;  3FZF B;  3Q5W A;  4KHZ F;  3PUY F;  4TWF A;  2X0Y A;  1IBL T;  4DV4 T;  2LJL A;  3CPZ A;  3NZQ A;  3PUZ F;  3AEG A;  1E1H B;  4DVD A;  1MMN A;  5HEU A;  3UQ4 A;  2AE9 A;  3CQX C;  3A8Y C;  3MK7 C;  1HR0 T;  3UUM A;  2XQ4 A;  3DJB A;  3NZP A;  3EHZ A;  1IJ5 A;  4QH4 A;  4YTP A;  3CKD A;  2NTY A;  4NPP A;  3H37 A;  4X5T A; 
#chains in the Genus database with same CATH homology
 4U31 A;  2V6Y B;  4U2Z A;  3ZT6 A;  2DL1 A;  2V6X A;  2WY2 A;  4U2Y A;  5FVK A;  4U7I A;  4CN4 A;  2CRB A;  4P1N A;  3ZSS A;  2W2U A;  1WFD A;  2JQK A;  3ZT7 A;  2K3W A;  4U33 A;  1WR0 A;  4NIQ A;  4IT4 A;  3ZT5 A;  4ZEY A;  4U7Y A;  4CN1 A;  4CN6 A;  2MPK A;  2LRK A;  5FVL A;  2LRL A;  3EAB A;  2WWV A;  5CGM A;  5CJ5 A;  2JQ9 A;  2JQH A;  1YXR A;  2XZE A;  4WZX A;  1WCR A;  2V6Y A;  2CPT A;  4A5X A;  5LB7 B;  2RPA A;  2A9U A;  4U3C A;  3K1S A;  3ZST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...