3EABA

Crystal structure of spastin mit in complex with escrt iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
MGSMEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spastin
publication title Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3eabA01
2CPTA 2A9UA 2LRLA 2WY2A 3K1SA 2WWVA 4ZEYA 5FVLA 3ZSSA 4U7IA 2XZEA 4U7YA 4U2ZA 4IT4A 4CN6A 3ZT5A 2CRBA 5FVKA 4A5XA 2W2UA 4CN1A 4WZXA 5LB7B 2JQKA 4NIQA 4CN4A 4U33A 2V6YA 1YXRA 4P1NA 2JQ9A 2DL1A 2JQHA 3ZT6A 4U31A 2V6YB 2V6XA 2MPKA 4U3CA 4U2YA 3ZSTA 2LRKA 1WCRA 1WR0A 5CGMA 3EABA 3ZT7A 5CJ5A 2K3WA 1WFDA 2RPAA
chains in the Genus database with same CATH superfamily
2HH7A 2A9UA 3RYHE 4CI1B 1BR2A 1SUMB 2V1DB 4UELA 5JREA 2UUCT 1QUUA 2XHEB 3ZYKA 1YXRA 5LGUB 3P8CD 4IHJE 1OEDC 3AE2A 1YQ3A 4HFHA 4HN9A 4UF0A 2PTFA 5FYMA 2AE9A 4TV9E 4C90A 4HFDA 3TLVA 3ONLC 4TN7B 2IIUA 4TNWA 1G73A 4JEHB 3IF8B 2WZIA 2IC6A 4QKNA 2CLYC 3E08A 4KUMB 3C4WA 4ZXLA 3VRBA 4K0KT 4PNIA 2BBHA 3E22E 3FZLB 1HFAA 3MZKB 5BMVE 4O4HE 4YTMA 4EAHA 1Y01A 4WW0A 2K5BB 4WBOA 5FY0A 1N36T 1W0BA 4TNVA 5J2UE 2UXXB 3ONJA 2GK9A 2J4GA 2LRKA 2NR4A 3OTOT 1UK5A 3AE5A 3TLWA 1O3XA 4TV8E 2VKJA 4ERRA 1VRBA 3KVBA 2FJDA 2XPKA 2UXDT 2LSYA 2VL0A 2PBIA 1XNRT 3AE3A 5HEHA 3AA1B 3RI5A 2YU1A 5LCYA 2W66A 3ZMSB 3RIAA 3ZSSA 4TWFA 3PJAJ 4BJMA 2YDQA 2HN1A 4JI6T 2BDEA 2V6XA 1NAFA 5E0OA 5LGTB 2LLYA 1U4QA 3ZT7A 3HI2A 3FZFB 2KLQA 1J1JA 5C3JA 3CK6A 5KMGP 2Q9QC 4AXPA 2WDQA 3O4XE 4HKAA 2L9QA 3P50A 4JUYA 4DV5T 4L0RA 2LM9A 4OHFA 2VKDA 3F2EA 3T8OA 3JAFA 2LJLA 4OYKA 4HFBA 2WWVA 2XQ5A 1CHUA 5JVDE 3EDVA 2V7IA 3UU6A 1MNDA 4A97A 2JMHA 5JQGE 2LKGA 2C5KT 1Z8UA 5L3DB 2WCAA 2NWBA 2K48A 3AEAA 4MLKA 3AEDA 3O1JA 2BVMA 2PJQA 5LXTE 4KBMB 5HEOA 5LP6E 2XAGB 2BZBA 3A8YC 2JQKA 2K9AA 1XZYA 3KINB 5CA0E 4YXDA 4LF8T 2C0SA 4LF6T 1BR1A 5JDFA 2IC9A 3UFGA 2WU2A 2X67A 2DCFA 5AQGB 4QX8B 4CN6A 3IBPA 3HR0A 4NIQA 1T72A 3PUZF 5HXRA 2N2NA 2VASA 3VU7H 4YHHT 4P0AA 5L2LA 4ZS2A 4PJLA 2KWHA 1D1BA 5AQSB 4PJJA 3GA8A 4PAGA 3S4UA 5AQKB 3P4RA 3RC3A 5HAXA 2KZ7B 3RIUC 3UTKA 1MMDA 3C64A 4UF0B 3WAKA 4HFIA 2XSAA 2YOEA 1QLBA 5L3CB 4COFA 3UU8A 2YDSA 2X51A 2NOXA 3P7IA 3KDSE 2JJ9A 5DJQC 5JR9A 3C4ZA 2XQ8A 3ZCJA 4U74A 3FBZA 3ZC1A 3AE4A 3KV5A 1LKXA 3B13A 3JAEA 5EZYE 4AKRB 2BKOA 3MA9A 2KNDA 1UCUA 3AE9A 3OKQA 5EK3A 3RF1A 2H7OA 3CX7B 5FVKA 3EAMA 4F8HA 3PU3A 1XDPA 5JH7E 3KVAA 3I1AA 4H63H 2R6GF 2OA5A 4ILUA 2XAFB 3ONXA 2EHOA 3O1IA 5LOVE 5A1LA 2WS3A 4PK5A 4LF9T 4JLEA 2MBGA 1MIWA 1VOMA 3RKGA 4P1NA 5CFBA 2JPFA 3J9X1 3N9QA 2NTXA 3C51A 5CJ5A 3RPUA 1HG5A 5HWXA 2W62A 1UGOA 4UVAB 1NEKA 5HCJA 3ZCIA 5LG3A 3AECA 2N1GA 3C98B 2CXDA 1KK7A 2DHRA 3PUVF 2DNXA 2CWOA 3JC6C 2H3RA 2E9XC 4AKGA 1N32T 1WFDA 4LFBT 3PURA 4MHCA 1OEDA 1NWMX 2C5IT 5L3EB 4X1KE 5FL1A 4QXHB 2ZLYA 2V5DA 2WWUA 3ZJ2A 3ZJ1A 2E5LT 3BQIA 3N2KE 3SRZA 4B3MT 3RIFA 4AQGA 5KXJA 5JDQA 3Q5XA 3N9LA 4AQFC 5F3JA 2WDVA 2WSSV 1UX5A 1ZV4X 3C50A 3F31A 2XQ9A 4DR4T 2UUAT 4AI6A 4B3TT 3AVSA 4GKJT 4AQYT 2VB6A 5J2TE 4H9QC 2M6BA 4I50E 4KHZF 1D0ZA 2DL1A 4EYYR 2W0GA 1KEYA 4PJMA 5HEGA 1DU2A 4IDOA 3EVYA 3NZQA 4EOZB 4UV8B 4Z90A 4YHJA 4QH5A 4KP3C 4QX7B 4A56A 2H7VC 3ZMZB 3A7MA 5HEUA 2WZHA 2L8KA 2WM9A 1Y64B 2BG9C 2Y48B 2WU5A 4EIWA 2E9XD 5LHIB 2NW9A 3K1SA 3OBVE 1KNZA 2IMLA 4IT4A 1E2AA 3EI0A 4O4IE 4GOUA 2QRXA 2X9HA 4DR3T 4CI3B 3PUWF 2Q9QA 4K0UA 3FZHB 5LA6E 3E0ZA 5JR9B 3PUYF 2NW8A 3SWHA 3ETVA 2CXFA 2ES0A 5AQHB 2A3DA 3G06A 3P4WA 2VVNA 3ZT5A 2XUEA 1HG2A 1T8BA 1M7KA 3CVRA 5LG4A 5JDGA 4ILBA 4N78D 2B1EA 4YT0A 5JDLA 3ZMVB 1HX8A 3B57A 3C4XA 5AQFB 4MALA 2SPCA 5J0ZA 5BR8T 4BA9A 3VKGA 1JNZA 4U2YA 3UFEA 1U5PA 3L09A 5AQTB 3N2OA 3J7Yq 4O8SA 3ZPOA 1I94T 2EHOB 2UU9T 3PDYA 5AQIB 3HA4A 5AQPB 2D0TA 4H9RC 2WBLA 2NTYA 3N9OA 2VVSA 5LHHB 4H9OC 2XQ4A 3N9MA 2E5VA 4L5GA 3R6NA 3HKDE 4IDNA 2W61A 1N33T 5FXWA 4O2BE 3PUSA 3ZN1B 2BS2A 2FUPA 4G2AA 4DR1T 2ZMAA 3MJXA 4LMLA 1WCRA 3W15B 4X66T 2RPAA 2V7KA 2BKNA 1XDOA 2J47A 2XM2A 3AE8A 4QH4A 1OEDB 4QWNB 5AQMB 2ZM0A 1IJ6A 1HR0T 3ZT6A 2X0LB 1D1CA 4IGUA 4ZI2C 2X9WA 3K3NA 3AAEB 4DV3T 2BVLA 4IL4A 4EEBA 1UURA 3Q5EA 4NUUA 3P4QA 3KV4A 2K24A 4A98A 2L3LA 2FJBA 1MMGA 4DO0A 4EEDA 3ZEFB 2CLYB 1KNRA 1HX1B 4PK6A 2DWKA 5AQRB 4ZHQE 4U31A 4WYVA 2CBIA 4HWHA 3ZSTA 3N5LA 4C91A 3LDQB 5L3BB 2IDOB 2A72A 3ZN0B 1BR4A 1MIYA 5L3GB 3ANWA 2MYSA 2CM0A 4MBQA 2YEVC 3AEEA 3PE0A 3LSVA 2N9DA 5JDMA 5GONE 4H9SE 2XQ3A 4JI5T 2J1DG 5ABEA 1MMNA 3I0OA 4DUZT 4Z91A 4DNDA 4FJOA 3TLUA 2HN2A 2W67A 3TKLB 5ABFA 3P4PA 2XQAA 4YSYA 5HEJA 3FXDB 4QH1A 3UT5E 1ZOYA 1X9BA 3OYZA 3SFEA 5C8YE 4AKLA 5EK2A 1WR0A 4ZI2D 2Q9QB 1WLXA 4PFPA 3AB3B 3UU4A 2XTLA 2DLRA 3AXJA 4GIWA 4JV5T 3LFMA 2Y8DA 3PUQA 4HFVA 1AJ3A 4KHPT 3CQGB 5AFUL 2E9XA 4CN4A 4HEAA 3CMLA 2CWYA 4P0BA 3KV9A 4DBRA 4ZZCA 1KNPA 4DUYT 2BS3A 4IE6A 5H6RB 1XMQT 4ZS3A 5FXVA 1YQ4A 3NBXX 5LMNT 3PUXF 2JRKA 3N2GE 2MOZA 3MXZA 1FIOA 3ZLIA 4IDZA 3HKEE 2CXLA 4JEUB 2OLTA 2V7LA 4I55E 3R84B 1SE7A 5LGNB 3AA6B 5KDMC 3I0QA 1FMWA 1W9RA 4LMJA 4YTNA 1Z0PA 4ADZA 3EHZA 2JQHA 2KXPB 4EV6A 5FY1A 3NWIA 5C2TA 4ZOLE 1UUSA 2LHNA 4H9PC 4NXMT 3CQCB 3RHWA 3AA7B 3RQUA 1D1AA 2W4XA 3GWHA 4PFOA 3K3OA 2JIWA 4EZ4A 3K3QC 2VQFT 4DV6T 2JQ9A 4DV7T 4H9NC 3I9WA 1HNZT 4ISTA 4UVCB 1IBKT 4U72A 2BG9A 1WYCA 4CXYA 3ETUA 3H37A 2YU2A 4IDQA 4GKKT 3ZYMA 3K8PC 4X62T 3Q5WA 3VR9A 4M1PA 2K3WA 3PTRB 5CA1E 3OYXA 1HF8A 3KBUA 4OX9T 2XM1A 4WBNE 3BQKA 2XAHB 4CXXA 4HWFA 4X5TA 3AA0B 2YK0A 4UVBB 4B6XA 4ZZBA 4E7ZA 3UU3A 4EZHA 3L39A 4O4JE 1D0YA 3KFWX 4IL9A 2NW7A 2WMNA 3NRYA 1FMVA 2D0UA 1QSDA 1V9DA 3ANWB 4JI2T 2HHHT 3QB5A 3RX6A 2Y6XA 4DV4T 4YTPA 2FJAA 5JDHA 3P4SA 4IE7A 3RLFF 5AQOB 2LHRA 1IAPA 4TWDA 3AE1A 2H88A 1MIVA 3CWZB 4KMCA 2YKSA 4IE0A 2M6IA 2MAWA 4J2CA 5ABFB 5AQLB 2DWGA 2I59A 4Q25A 4G63A 2M67A 4EB6E 1G8XA 1YKEB 4OFZA 3QC9A 5ETWA 3PU8A 1OEDE 2E8IA 5CGMA 2C5JA 2D2SA 4HFCA 2VQET 4CZZB 2WY2A 2ACXA 3AXJB 3IEEA 4U2ZA 2LOPA 2OV9A 2I6HA 3B5MA 4DR2T 4LMKA 3UUNA 2E9XB 1MMAA 1S94A 1WYBA 2XASB 3RRCA 5HXEA 2IUBA 4I43B 3GN5A 4NUVA 2LSGA 3IA3A 5LNKA 2WP9A 3RYCE 3T1HT 2FBWA 4KX6A 5AQVB 4CXWA 2VK9A 2KINB 4YSXA 2LSKA 3ZC0A 2CBJA 1IBLT 3Q2MA 3MACA 3IHRA 5L4HA 1NENA 5ABHA 3CX8B 2KSRA 4QXCB 3KV6A 2X9YA 5HCMA 2PFVA 2I0MA 4UV9B 4ZI7E 4HWIB 4UEMA 3OJAA 2YINA 1ZHCA 2ACZA 3RKOA 3Q5DA 1L0VA 1VCSA 4JBWF 4PK4A 5HWYA 2IHR1 2HPLA 5EK4A 4YY3T 2V8SV 2LSJA 5JRCA 1HNXT 1VCTA 4FI5A 2QGSA 3DJBA 1YW0A 3AEBA 4OK0A 5FVLA 3O1HA 2ZM6T 2BG9B 4HWCA 5LB7B 1LVFA 4GYSA 2LE8A 4LF7T 5HXHA 1XNQT 4DR6T 5FXXA 4H63V 4ZEYA 3ESLA 2H89A 2G0UA 3TLSA 2W63A 3QK6A 1D0XA 3RH3A 3LK42 3NKZA 2LOSA 5FNVE 2X66A 3F57A 1W09A 1N34T 4JI7T 3DTOA 4YLHA 4CN1A 1XMOT 3LG7A 5HXCA 5L3FB 2XQ7A 3LBXB 2V26A 4BJNA 4KI0F 1US7B 1WRDA 3RIUA 3ZYLA 4AISA 2WQYA 3HKCE 5HYAA 2V7MA 4ZI3D 3UULA 2EHOD 1GQEA 3U78A 3OPCA 5F8PA 3GMIA 3M65A 5FMNA 3EABA 3FZMB 3U3IA 2WAUA 2XZEA 3JCFA 2KMFA 1OWAA 3H3MA 3DP7A 3CPZA 3MK7C 4JI3T 2QVAA 4X65T 4DV2T 1LRZA 1T98A 4Z8XA 4U3CA 1JNRA 3UUBA 2BS4A 3HL6A 4EXTA 3VKHA 4IREA 5LHGB 4I0UA 1MNEA 1FJGT 2KWIB 4LFCT 3V5UA 3A5XA 4YSZA 2QA7A 4IIJE 2VKHA 5H6QB 2CEAA 4HE8A 2BBJA 1YD8G 4TUYE 3FB2A 3L8RA 1S35A 3UU5A 5JTGA 5DQVA 4AKIA 3GN5B 3SFDA 3SOLA 2CA5A 2XJ7A 2YN6A 1W0AA 2X68A 1J5WA 3FHNA 3OVUA 3UQ4A 2DI4A 4XAXB 4AIUA 3PJAA 4LFAT 3Q9DA 4E7SA 4DR7T 4YFSA 3CIRA 4ISSA 3TLTA 3AVRA 1H7CA 1SA0E 4TZ4C 2F4VT 2QYWA 3M3ZB 2ODVA 5LBQB 4XBFB 2CCQA 5ABGA 1ZP0A 4HTEA 2XQ6A 2D5UA 3JADA 4JI0T 4CQIA 1LVKA 2UXNB 3FBLA 5DQWA 3H3AA 5JRCB 4XZCA 5LJNA 5ADXL 1SHZC 4DBQA 3CQXC 4X1IE 3NVOA 4WZXA 4AQFA 2V6YA 5J1GA 2ZM8A 1HNWT 4UR9A 2MPKA 3QUJA 2LM2A 4LF4T 4O4LE 1IJ5A 2D9DA 4PJNA 3LJCA 5IHYA 2CRBA 2Q9QD 5LYJE 3O9XA 3I9YA 3N9NA 3AAIA 4LF5T 4EGWA 3RC8A 3V5SA 1HS7A 5HXSA 3CKDA 4EYUA 4UIGA 5M4YA 3UUXB 5F5WA 5LJMA 3RRWA 3ABVA 4DV0T 3NRXA 5LBMA 3NZPA 5FXZA 3VR8A 2CHOA 4WNKA 1OXZA 2MTQA 5AQNB 2YDRA 4YJ2E 1WR6A 1R8IA 3SS1A 3PUAA 2W2UA 2RP4A 1T7SA 2AXDS 1E1HB 4B3RT 2WMOA 3QB5K 3AE6A 4IE4A 4AKHA 2V7JA 5IUXA 2X0YA 5CB4E 4YJ3E 1X79A 2IW5B 2E2AA 3L3PA 3WI3A 1UX4A 1IBMT 2BG9E 4ILAA 2BKPA 3PV0F 4U33A 2WDRA 4TWHA 4L9IA 4X1YE 3UUMA 2W00A 1EZ3A 4MFRA 3VRAA 4DIDB 2HPJA 3LBXA 4QHOA 1YKHB 2KT9A 1I6ZA 1BR0A 1J5ET 3AEFA 2RA1A 1HCIA 3ZMUB 4U7IA 3QNUA 3RYFE 2X0HA 4A5XA 3PUGA 2XQYA 5AQQB 3RQWA 4O2AE 2V5CA 2CHNA 5AQJB 5FY7A 4JI1T 2ZM2A 5FL0A 4DV1T 2LT3A 2VL8A 2ODUA 2X9XA 4NPPA 4HFEA 2LRLA 3QOFA 2VWAA 3EUHA 4IDPA 4HGAA 4BAYB 5TAOA 2JMKA 1FEWA 2XAJB 3ZKRA 4PW8A 4ILCA 4QXBB 3RGLA 2UXCT 3VHLA 5L47A 4JYAT 4GK0E 1HTJF 3FXEB 5DABA 4ANJA 4U7YA 2IAKA 2XAQB 3FZKB 4DR5T 3CX6B 3ZMTB 2LEHA 4OYJA 4NXNT 2PG8A 2A2FX 3D0TA 2XSBA 3UQ7A 2LKHA 3KBTA 5FP3A 3HKBE 4UXNB 5JR9C 3WAJA 5KX5E 3X1DA 3AE7A 1M62A 5FKYA 4B3ST 5AQUB 2V6YB 1ZEEA 3AAAB 2LSIA 4TX5A 3LK3B 4V1Av 2J62A 3LK2B 2XY8B 2VKOA 2FJEA 1KFYA 4ASKA 2Z6EA 4JI4T 4GK5E 2VURA 4HWDA 1E7PA 2CE7A 4DMVA 1ZKEA 1XWMA 1CUNA 3N9PA 4DMWA 3JC6D 4X64T 2CPTA 4ZI3C 5JDNA 4F6RC 2EHOC 2P9BA 5LMUT 2UXBT 4I4TE 2JQQA 2NP9A 3BK9A 1IZNB 3BQLA 3AEGA 4IE5A 3RYIE 3MKDA 1KF6A 5IYZE 4CI2B 4DVDA 2CMRA 4P09A 2UUBT 2WB5A 3EDUA 2B76A 4GYRA 5L4EA 4JI8T 1B7TA 4X20E 3T1YT 5IWAT
chains in the Genus database with same CATH topology
2CPTA 2A9UA 2LRLA 2WY2A 3K1SA 2WWVA 4ZEYA 5FVLA 3ZSSA 4U7IA 2XZEA 4U7YA 4U2ZA 4IT4A 4CN6A 3ZT5A 2CRBA 5FVKA 4A5XA 2W2UA 4CN1A 4WZXA 5LB7B 2JQKA 4NIQA 4CN4A 4U33A 2V6YA 1YXRA 4P1NA 2JQ9A 2DL1A 2JQHA 3ZT6A 4U31A 2V6YB 2V6XA 2MPKA 4U3CA 4U2YA 3ZSTA 2LRKA 1WCRA 1WR0A 5CGMA 3EABA 3ZT7A 5CJ5A 2K3WA 1WFDA 2RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPT A;  2A9U A;  2LRL A;  2WY2 A;  3K1S A;  2WWV A;  4ZEY A;  5FVL A;  3ZSS A;  4U7I A;  2XZE A;  4U7Y A;  4U2Z A;  4IT4 A;  4CN6 A;  3ZT5 A;  2CRB A;  5FVK A;  4A5X A;  2W2U A;  4CN1 A;  4WZX A;  5LB7 B;  2JQK A;  4NIQ A;  4CN4 A;  4U33 A;  2V6Y A;  1YXR A;  4P1N A;  2JQ9 A;  2DL1 A;  2JQH A;  3ZT6 A;  4U31 A;  2V6Y B;  2V6X A;  2MPK A;  4U3C A;  4U2Y A;  3ZST A;  2LRK A;  1WCR A;  1WR0 A;  5CGM A;  3EAB A;  3ZT7 A;  5CJ5 A;  2K3W A;  1WFD A;  2RPA A; 
#chains in the Genus database with same CATH topology
 2HH7 A;  2A9U A;  3RYH E;  4CI1 B;  1BR2 A;  1SUM B;  2V1D B;  4UEL A;  5JRE A;  2UUC T;  1QUU A;  2XHE B;  3ZYK A;  1YXR A;  5LGU B;  3P8C D;  4IHJ E;  1OED C;  3AE2 A;  1YQ3 A;  4HFH A;  4HN9 A;  4UF0 A;  2PTF A;  5FYM A;  2AE9 A;  4TV9 E;  4C90 A;  4HFD A;  3TLV A;  3ONL C;  4TN7 B;  2IIU A;  4TNW A;  1G73 A;  4JEH B;  3IF8 B;  2WZI A;  2IC6 A;  4QKN A;  2CLY C;  3E08 A;  4KUM B;  3C4W A;  4ZXL A;  3VRB A;  4K0K T;  4PNI A;  2BBH A;  3E22 E;  3FZL B;  1HFA A;  3MZK B;  5BMV E;  4O4H E;  4YTM A;  4EAH A;  1Y01 A;  4WW0 A;  2K5B B;  4WBO A;  5FY0 A;  1N36 T;  1W0B A;  4TNV A;  5J2U E;  2UXX B;  3ONJ A;  2GK9 A;  2J4G A;  2LRK A;  2NR4 A;  3OTO T;  1UK5 A;  3AE5 A;  3TLW A;  1O3X A;  4TV8 E;  2VKJ A;  4ERR A;  1VRB A;  3KVB A;  2FJD A;  2XPK A;  2UXD T;  2LSY A;  2VL0 A;  2PBI A;  1XNR T;  3AE3 A;  5HEH A;  3AA1 B;  3RI5 A;  2YU1 A;  5LCY A;  2W66 A;  3ZMS B;  3RIA A;  3ZSS A;  4TWF A;  3PJA J;  4BJM A;  2YDQ A;  2HN1 A;  4JI6 T;  2BDE A;  2V6X A;  1NAF A;  5E0O A;  5LGT B;  2LLY A;  1U4Q A;  3ZT7 A;  3HI2 A;  3FZF B;  2KLQ A;  1J1J A;  5C3J A;  3CK6 A;  5KMG P;  2Q9Q C;  4AXP A;  2WDQ A;  3O4X E;  4HKA A;  2L9Q A;  3P50 A;  4JUY A;  4DV5 T;  4L0R A;  2LM9 A;  4OHF A;  2VKD A;  3F2E A;  3T8O A;  3JAF A;  2LJL A;  4OYK A;  4HFB A;  2WWV A;  2XQ5 A;  1CHU A;  5JVD E;  3EDV A;  2V7I A;  3UU6 A;  1MND A;  4A97 A;  2JMH A;  5JQG E;  2LKG A;  2C5K T;  1Z8U A;  5L3D B;  2WCA A;  2NWB A;  2K48 A;  3AEA A;  4MLK A;  3AED A;  3O1J A;  2BVM A;  2PJQ A;  5LXT E;  4KBM B;  5HEO A;  5LP6 E;  2XAG B;  2BZB A;  3A8Y C;  2JQK A;  2K9A A;  1XZY A;  3KIN B;  5CA0 E;  4YXD A;  4LF8 T;  2C0S A;  4LF6 T;  1BR1 A;  5JDF A;  2IC9 A;  3UFG A;  2WU2 A;  2X67 A;  2DCF A;  5AQG B;  4QX8 B;  4CN6 A;  3IBP A;  3HR0 A;  4NIQ A;  1T72 A;  3PUZ F;  5HXR A;  2N2N A;  2VAS A;  3VU7 H;  4YHH T;  4P0A A;  5L2L A;  4ZS2 A;  4PJL A;  2KWH A;  1D1B A;  5AQS B;  4PJJ A;  3GA8 A;  4PAG A;  3S4U A;  5AQK B;  3P4R A;  3RC3 A;  5HAX A;  2KZ7 B;  3RIU C;  3UTK A;  1MMD A;  3C64 A;  4UF0 B;  3WAK A;  4HFI A;  2XSA A;  2YOE A;  1QLB A;  5L3C B;  4COF A;  3UU8 A;  2YDS A;  2X51 A;  2NOX A;  3P7I A;  3KDS E;  2JJ9 A;  5DJQ C;  5JR9 A;  3C4Z A;  2XQ8 A;  3ZCJ A;  4U74 A;  3FBZ A;  3ZC1 A;  3AE4 A;  3KV5 A;  1LKX A;  3B13 A;  3JAE A;  5EZY E;  4AKR B;  2BKO A;  3MA9 A;  2KND A;  1UCU A;  3AE9 A;  3OKQ A;  5EK3 A;  3RF1 A;  2H7O A;  3CX7 B;  5FVK A;  3EAM A;  4F8H A;  3PU3 A;  1XDP A;  5JH7 E;  3KVA A;  3I1A A;  4H63 H;  2R6G F;  2OA5 A;  4ILU A;  2XAF B;  3ONX A;  2EHO A;  3O1I A;  5LOV E;  5A1L A;  2WS3 A;  4PK5 A;  4LF9 T;  4JLE A;  2MBG A;  1MIW A;  1VOM A;  3RKG A;  4P1N A;  5CFB A;  2JPF A;  3J9X 1;  3N9Q A;  2NTX A;  3C51 A;  5CJ5 A;  3RPU A;  1HG5 A;  5HWX A;  2W62 A;  1UGO A;  4UVA B;  1NEK A;  5HCJ A;  3ZCI A;  5LG3 A;  3AEC A;  2N1G A;  3C98 B;  2CXD A;  1KK7 A;  2DHR A;  3PUV F;  2DNX A;  2CWO A;  3JC6 C;  2H3R A;  2E9X C;  4AKG A;  1N32 T;  1WFD A;  4LFB T;  3PUR A;  4MHC A;  1OED A;  1NWM X;  2C5I T;  5L3E B;  4X1K E;  5FL1 A;  4QXH B;  2ZLY A;  2V5D A;  2WWU A;  3ZJ2 A;  3ZJ1 A;  2E5L T;  3BQI A;  3N2K E;  3SRZ A;  4B3M T;  3RIF A;  4AQG A;  5KXJ A;  5JDQ A;  3Q5X A;  3N9L A;  4AQF C;  5F3J A;  2WDV A;  2WSS V;  1UX5 A;  1ZV4 X;  3C50 A;  3F31 A;  2XQ9 A;  4DR4 T;  2UUA T;  4AI6 A;  4B3T T;  3AVS A;  4GKJ T;  4AQY T;  2VB6 A;  5J2T E;  4H9Q C;  2M6B A;  4I50 E;  4KHZ F;  1D0Z A;  2DL1 A;  4EYY R;  2W0G A;  1KEY A;  4PJM A;  5HEG A;  1DU2 A;  4IDO A;  3EVY A;  3NZQ A;  4EOZ B;  4UV8 B;  4Z90 A;  4YHJ A;  4QH5 A;  4KP3 C;  4QX7 B;  4A56 A;  2H7V C;  3ZMZ B;  3A7M A;  5HEU A;  2WZH A;  2L8K A;  2WM9 A;  1Y64 B;  2BG9 C;  2Y48 B;  2WU5 A;  4EIW A;  2E9X D;  5LHI B;  2NW9 A;  3K1S A;  3OBV E;  1KNZ A;  2IML A;  4IT4 A;  1E2A A;  3EI0 A;  4O4I E;  4GOU A;  2QRX A;  2X9H A;  4DR3 T;  4CI3 B;  3PUW F;  2Q9Q A;  4K0U A;  3FZH B;  5LA6 E;  3E0Z A;  5JR9 B;  3PUY F;  2NW8 A;  3SWH A;  3ETV A;  2CXF A;  2ES0 A;  5AQH B;  2A3D A;  3G06 A;  3P4W A;  2VVN A;  3ZT5 A;  2XUE A;  1HG2 A;  1T8B A;  1M7K A;  3CVR A;  5LG4 A;  5JDG A;  4ILB A;  4N78 D;  2B1E A;  4YT0 A;  5JDL A;  3ZMV B;  1HX8 A;  3B57 A;  3C4X A;  5AQF B;  4MAL A;  2SPC A;  5J0Z A;  5BR8 T;  4BA9 A;  3VKG A;  1JNZ A;  4U2Y A;  3UFE A;  1U5P A;  3L09 A;  5AQT B;  3N2O A;  3J7Y q;  4O8S A;  3ZPO A;  1I94 T;  2EHO B;  2UU9 T;  3PDY A;  5AQI B;  3HA4 A;  5AQP B;  2D0T A;  4H9R C;  2WBL A;  2NTY A;  3N9O A;  2VVS A;  5LHH B;  4H9O C;  2XQ4 A;  3N9M A;  2E5V A;  4L5G A;  3R6N A;  3HKD E;  4IDN A;  2W61 A;  1N33 T;  5FXW A;  4O2B E;  3PUS A;  3ZN1 B;  2BS2 A;  2FUP A;  4G2A A;  4DR1 T;  2ZMA A;  3MJX A;  4LML A;  1WCR A;  3W15 B;  4X66 T;  2RPA A;  2V7K A;  2BKN A;  1XDO A;  2J47 A;  2XM2 A;  3AE8 A;  4QH4 A;  1OED B;  4QWN B;  5AQM B;  2ZM0 A;  1IJ6 A;  1HR0 T;  3ZT6 A;  2X0L B;  1D1C A;  4IGU A;  4ZI2 C;  2X9W A;  3K3N A;  3AAE B;  4DV3 T;  2BVL A;  4IL4 A;  4EEB A;  1UUR A;  3Q5E A;  4NUU A;  3P4Q A;  3KV4 A;  2K24 A;  4A98 A;  2L3L A;  2FJB A;  1MMG A;  4DO0 A;  4EED A;  3ZEF B;  2CLY B;  1KNR A;  1HX1 B;  4PK6 A;  2DWK A;  5AQR B;  4ZHQ E;  4U31 A;  4WYV A;  2CBI A;  4HWH A;  3ZST A;  3N5L A;  4C91 A;  3LDQ B;  5L3B B;  2IDO B;  2A72 A;  3ZN0 B;  1BR4 A;  1MIY A;  5L3G B;  3ANW A;  2MYS A;  2CM0 A;  4MBQ A;  2YEV C;  3AEE A;  3PE0 A;  3LSV A;  2N9D A;  5JDM A;  5GON E;  4H9S E;  2XQ3 A;  4JI5 T;  2J1D G;  5ABE A;  1MMN A;  3I0O A;  4DUZ T;  4Z91 A;  4DND A;  4FJO A;  3TLU A;  2HN2 A;  2W67 A;  3TKL B;  5ABF A;  3P4P A;  2XQA A;  4YSY A;  5HEJ A;  3FXD B;  4QH1 A;  3UT5 E;  1ZOY A;  1X9B A;  3OYZ A;  3SFE A;  5C8Y E;  4AKL A;  5EK2 A;  1WR0 A;  4ZI2 D;  2Q9Q B;  1WLX A;  4PFP A;  3AB3 B;  3UU4 A;  2XTL A;  2DLR A;  3AXJ A;  4GIW A;  4JV5 T;  3LFM A;  2Y8D A;  3PUQ A;  4HFV A;  1AJ3 A;  4KHP T;  3CQG B;  5AFU L;  2E9X A;  4CN4 A;  4HEA A;  3CML A;  2CWY A;  4P0B A;  3KV9 A;  4DBR A;  4ZZC A;  1KNP A;  4DUY T;  2BS3 A;  4IE6 A;  5H6R B;  1XMQ T;  4ZS3 A;  5FXV A;  1YQ4 A;  3NBX X;  5LMN T;  3PUX F;  2JRK A;  3N2G E;  2MOZ A;  3MXZ A;  1FIO A;  3ZLI A;  4IDZ A;  3HKE E;  2CXL A;  4JEU B;  2OLT A;  2V7L A;  4I55 E;  3R84 B;  1SE7 A;  5LGN B;  3AA6 B;  5KDM C;  3I0Q A;  1FMW A;  1W9R A;  4LMJ A;  4YTN A;  1Z0P A;  4ADZ A;  3EHZ A;  2JQH A;  2KXP B;  4EV6 A;  5FY1 A;  3NWI A;  5C2T A;  4ZOL E;  1UUS A;  2LHN A;  4H9P C;  4NXM T;  3CQC B;  3RHW A;  3AA7 B;  3RQU A;  1D1A A;  2W4X A;  3GWH A;  4PFO A;  3K3O A;  2JIW A;  4EZ4 A;  3K3Q C;  2VQF T;  4DV6 T;  2JQ9 A;  4DV7 T;  4H9N C;  3I9W A;  1HNZ T;  4IST A;  4UVC B;  1IBK T;  4U72 A;  2BG9 A;  1WYC A;  4CXY A;  3ETU A;  3H37 A;  2YU2 A;  4IDQ A;  4GKK T;  3ZYM A;  3K8P C;  4X62 T;  3Q5W A;  3VR9 A;  4M1P A;  2K3W A;  3PTR B;  5CA1 E;  3OYX A;  1HF8 A;  3KBU A;  4OX9 T;  2XM1 A;  4WBN E;  3BQK A;  2XAH B;  4CXX A;  4HWF A;  4X5T A;  3AA0 B;  2YK0 A;  4UVB B;  4B6X A;  4ZZB A;  4E7Z A;  3UU3 A;  4EZH A;  3L39 A;  4O4J E;  1D0Y A;  3KFW X;  4IL9 A;  2NW7 A;  2WMN A;  3NRY A;  1FMV A;  2D0U A;  1QSD A;  1V9D A;  3ANW B;  4JI2 T;  2HHH T;  3QB5 A;  3RX6 A;  2Y6X A;  4DV4 T;  4YTP A;  2FJA A;  5JDH A;  3P4S A;  4IE7 A;  3RLF F;  5AQO B;  2LHR A;  1IAP A;  4TWD A;  3AE1 A;  2H88 A;  1MIV A;  3CWZ B;  4KMC A;  2YKS A;  4IE0 A;  2M6I A;  2MAW A;  4J2C A;  5ABF B;  5AQL B;  2DWG A;  2I59 A;  4Q25 A;  4G63 A;  2M67 A;  4EB6 E;  1G8X A;  1YKE B;  4OFZ A;  3QC9 A;  5ETW A;  3PU8 A;  1OED E;  2E8I A;  5CGM A;  2C5J A;  2D2S A;  4HFC A;  2VQE T;  4CZZ B;  2WY2 A;  2ACX A;  3AXJ B;  3IEE A;  4U2Z A;  2LOP A;  2OV9 A;  2I6H A;  3B5M A;  4DR2 T;  4LMK A;  3UUN A;  2E9X B;  1MMA A;  1S94 A;  1WYB A;  2XAS B;  3RRC A;  5HXE A;  2IUB A;  4I43 B;  3GN5 A;  4NUV A;  2LSG A;  3IA3 A;  5LNK A;  2WP9 A;  3RYC E;  3T1H T;  2FBW A;  4KX6 A;  5AQV B;  4CXW A;  2VK9 A;  2KIN B;  4YSX A;  2LSK A;  3ZC0 A;  2CBJ A;  1IBL T;  3Q2M A;  3MAC A;  3IHR A;  5L4H A;  1NEN A;  5ABH A;  3CX8 B;  2KSR A;  4QXC B;  3KV6 A;  2X9Y A;  5HCM A;  2PFV A;  2I0M A;  4UV9 B;  4ZI7 E;  4HWI B;  4UEM A;  3OJA A;  2YIN A;  1ZHC A;  2ACZ A;  3RKO A;  3Q5D A;  1L0V A;  1VCS A;  4JBW F;  4PK4 A;  5HWY A;  2IHR 1;  2HPL A;  5EK4 A;  4YY3 T;  2V8S V;  2LSJ A;  5JRC A;  1HNX T;  1VCT A;  4FI5 A;  2QGS A;  3DJB A;  1YW0 A;  3AEB A;  4OK0 A;  5FVL A;  3O1H A;  2ZM6 T;  2BG9 B;  4HWC A;  5LB7 B;  1LVF A;  4GYS A;  2LE8 A;  4LF7 T;  5HXH A;  1XNQ T;  4DR6 T;  5FXX A;  4H63 V;  4ZEY A;  3ESL A;  2H89 A;  2G0U A;  3TLS A;  2W63 A;  3QK6 A;  1D0X A;  3RH3 A;  3LK4 2;  3NKZ A;  2LOS A;  5FNV E;  2X66 A;  3F57 A;  1W09 A;  1N34 T;  4JI7 T;  3DTO A;  4YLH A;  4CN1 A;  1XMO T;  3LG7 A;  5HXC A;  5L3F B;  2XQ7 A;  3LBX B;  2V26 A;  4BJN A;  4KI0 F;  1US7 B;  1WRD A;  3RIU A;  3ZYL A;  4AIS A;  2WQY A;  3HKC E;  5HYA A;  2V7M A;  4ZI3 D;  3UUL A;  2EHO D;  1GQE A;  3U78 A;  3OPC A;  5F8P A;  3GMI A;  3M65 A;  5FMN A;  3EAB A;  3FZM B;  3U3I A;  2WAU A;  2XZE A;  3JCF A;  2KMF A;  1OWA A;  3H3M A;  3DP7 A;  3CPZ A;  3MK7 C;  4JI3 T;  2QVA A;  4X65 T;  4DV2 T;  1LRZ A;  1T98 A;  4Z8X A;  4U3C A;  1JNR A;  3UUB A;  2BS4 A;  3HL6 A;  4EXT A;  3VKH A;  4IRE A;  5LHG B;  4I0U A;  1MNE A;  1FJG T;  2KWI B;  4LFC T;  3V5U A;  3A5X A;  4YSZ A;  2QA7 A;  4IIJ E;  2VKH A;  5H6Q B;  2CEA A;  4HE8 A;  2BBJ A;  1YD8 G;  4TUY E;  3FB2 A;  3L8R A;  1S35 A;  3UU5 A;  5JTG A;  5DQV A;  4AKI A;  3GN5 B;  3SFD A;  3SOL A;  2CA5 A;  2XJ7 A;  2YN6 A;  1W0A A;  2X68 A;  1J5W A;  3FHN A;  3OVU A;  3UQ4 A;  2DI4 A;  4XAX B;  4AIU A;  3PJA A;  4LFA T;  3Q9D A;  4E7S A;  4DR7 T;  4YFS A;  3CIR A;  4ISS A;  3TLT A;  3AVR A;  1H7C A;  1SA0 E;  4TZ4 C;  2F4V T;  2QYW A;  3M3Z B;  2ODV A;  5LBQ B;  4XBF B;  2CCQ A;  5ABG A;  1ZP0 A;  4HTE A;  2XQ6 A;  2D5U A;  3JAD A;  4JI0 T;  4CQI A;  1LVK A;  2UXN B;  3FBL A;  5DQW A;  3H3A A;  5JRC B;  4XZC A;  5LJN A;  5ADX L;  1SHZ C;  4DBQ A;  3CQX C;  4X1I E;  3NVO A;  4WZX A;  4AQF A;  2V6Y A;  5J1G A;  2ZM8 A;  1HNW T;  4UR9 A;  2MPK A;  3QUJ A;  2LM2 A;  4LF4 T;  4O4L E;  1IJ5 A;  2D9D A;  4PJN A;  3LJC A;  5IHY A;  2CRB A;  2Q9Q D;  5LYJ E;  3O9X A;  3I9Y A;  3N9N A;  3AAI A;  4LF5 T;  4EGW A;  3RC8 A;  3V5S A;  1HS7 A;  5HXS A;  3CKD A;  4EYU A;  4UIG A;  5M4Y A;  3UUX B;  5F5W A;  5LJM A;  3RRW A;  3ABV A;  4DV0 T;  3NRX A;  5LBM A;  3NZP A;  5FXZ A;  3VR8 A;  2CHO A;  4WNK A;  1OXZ A;  2MTQ A;  5AQN B;  2YDR A;  4YJ2 E;  1WR6 A;  1R8I A;  3SS1 A;  3PUA A;  2W2U A;  2RP4 A;  1T7S A;  2AXD S;  1E1H B;  4B3R T;  2WMO A;  3QB5 K;  3AE6 A;  4IE4 A;  4AKH A;  2V7J A;  5IUX A;  2X0Y A;  5CB4 E;  4YJ3 E;  1X79 A;  2IW5 B;  2E2A A;  3L3P A;  3WI3 A;  1UX4 A;  1IBM T;  2BG9 E;  4ILA A;  2BKP A;  3PV0 F;  4U33 A;  2WDR A;  4TWH A;  4L9I A;  4X1Y E;  3UUM A;  2W00 A;  1EZ3 A;  4MFR A;  3VRA A;  4DID B;  2HPJ A;  3LBX A;  4QHO A;  1YKH B;  2KT9 A;  1I6Z A;  1BR0 A;  1J5E T;  3AEF A;  2RA1 A;  1HCI A;  3ZMU B;  4U7I A;  3QNU A;  3RYF E;  2X0H A;  4A5X A;  3PUG A;  2XQY A;  5AQQ B;  3RQW A;  4O2A E;  2V5C A;  2CHN A;  5AQJ B;  5FY7 A;  4JI1 T;  2ZM2 A;  5FL0 A;  4DV1 T;  2LT3 A;  2VL8 A;  2ODU A;  2X9X A;  4NPP A;  4HFE A;  2LRL A;  3QOF A;  2VWA A;  3EUH A;  4IDP A;  4HGA A;  4BAY B;  5TAO A;  2JMK A;  1FEW A;  2XAJ B;  3ZKR A;  4PW8 A;  4ILC A;  4QXB B;  3RGL A;  2UXC T;  3VHL A;  5L47 A;  4JYA T;  4GK0 E;  1HTJ F;  3FXE B;  5DAB A;  4ANJ A;  4U7Y A;  2IAK A;  2XAQ B;  3FZK B;  4DR5 T;  3CX6 B;  3ZMT B;  2LEH A;  4OYJ A;  4NXN T;  2PG8 A;  2A2F X;  3D0T A;  2XSB A;  3UQ7 A;  2LKH A;  3KBT A;  5FP3 A;  3HKB E;  4UXN B;  5JR9 C;  3WAJ A;  5KX5 E;  3X1D A;  3AE7 A;  1M62 A;  5FKY A;  4B3S T;  5AQU B;  2V6Y B;  1ZEE A;  3AAA B;  2LSI A;  4TX5 A;  3LK3 B;  4V1A v;  2J62 A;  3LK2 B;  2XY8 B;  2VKO A;  2FJE A;  1KFY A;  4ASK A;  2Z6E A;  4JI4 T;  4GK5 E;  2VUR A;  4HWD A;  1E7P A;  2CE7 A;  4DMV A;  1ZKE A;  1XWM A;  1CUN A;  3N9P A;  4DMW A;  3JC6 D;  4X64 T;  2CPT A;  4ZI3 C;  5JDN A;  4F6R C;  2EHO C;  2P9B A;  5LMU T;  2UXB T;  4I4T E;  2JQQ A;  2NP9 A;  3BK9 A;  1IZN B;  3BQL A;  3AEG A;  4IE5 A;  3RYI E;  3MKD A;  1KF6 A;  5IYZ E;  4CI2 B;  4DVD A;  2CMR A;  4P09 A;  2UUB T;  2WB5 A;  3EDU A;  2B76 A;  4GYR A;  5L4E A;  4JI8 T;  1B7T A;  4X20 E;  3T1Y T;  5IWA T; 
#chains in the Genus database with same CATH homology
 2CPT A;  2A9U A;  2LRL A;  2WY2 A;  3K1S A;  2WWV A;  4ZEY A;  5FVL A;  3ZSS A;  4U7I A;  2XZE A;  4U7Y A;  4U2Z A;  4IT4 A;  4CN6 A;  3ZT5 A;  2CRB A;  5FVK A;  4A5X A;  2W2U A;  4CN1 A;  4WZX A;  5LB7 B;  2JQK A;  4NIQ A;  4CN4 A;  4U33 A;  2V6Y A;  1YXR A;  4P1N A;  2JQ9 A;  2DL1 A;  2JQH A;  3ZT6 A;  4U31 A;  2V6Y B;  2V6X A;  2MPK A;  4U3C A;  4U2Y A;  3ZST A;  2LRK A;  1WCR A;  1WR0 A;  5CGM A;  3EAB A;  3ZT7 A;  5CJ5 A;  2K3W A;  1WFD A;  2RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...