3EABA

Crystal structure of spastin mit in complex with escrt iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
b'MGSMEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spastin
publication title Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3eabA01
2RPAA 1WFDA 2JQKA 4U7YA 2MPKA 2WY2A 5FVLA 5FVKA 1WR0A 4CN6A 2LRKA 3ZT6A 4U2ZA 4A5XA 4U3CA 4WZXA 5CJ5A 2JQ9A 1WCRA 2XZEA 2V6YA 4U7IA 3ZSSA 3ZSTA 4CN4A 4CN1A 5LB7B 3ZT7A 2K3WA 2W2UA 4U33A 2JQHA 3K1SA 2CPTA 4ZEYA 2DL1A 4U2YA 2LRLA 2V6YB 4P1NA 2V6XA 4NIQA 2CRBA 4U31A 2WWVA 2A9UA 5CGMA 3ZT5A 3EABA 1YXRA 4IT4A
chains in the Genus database with same CATH superfamily
2NTYA 5JH7E 1YKHB 2C5IT 3VHLA 4LFAT 4H9PC 2XQ8A 4A56A 3UU5A 3P4RA 4P0AA 3N9QA 3KVAA 4JEHB 1EZ3A 2UU9T 1E1HB 4IDNA 5HXCA 3FZLB 2LT3A 2WDRA 4JBWF 4PJJA 1G8XA 2V26A 3RQUA 4E7ZA 2LM9A 3FZKB 4QKNA 2J1DG 3NKZA 1KEYA 3TLVA 2D5UA 1HCIA 4COFA 2VASA 3P4WA 4L9IA 5AQLB 4DR5T 1FMWA 3ZJ2A 3BQKA 3PUSA 5LG4A 3HKCE 4L5GA 4DNDA 2CBJA 1T72A 5CA1E 1YQ3A 1IJ6A 4KHPT 1HX8A 5LXTE 5J2UE 3C4ZA 3CQXC 2H3RA 4ZI2C 1QSDA 4G63A 4JI4T 2E2AA 3ANWB 1S94A 1MIWA 4YY3T 2VKHA 4HTEA 2LSKA 3FXDB 1HG5A 3KBTA 3PUGA 3UU4A 2JRKA 2UUCT 2V6YA 4CN4A 1UCUA 3MZKB 3N2KE 3PUWF 3B13A 3AECA 5TAOA 2CRBA 2I59A 4QX7B 2WWUA 4ZS3A 2KLQA 4DV7T 4X1YE 3TLWA 3ZJ1A 3FB2A 3VU7H 5AQKB 2XAJB 4PK4A 2NW9A 2WSSV 2BG9E 3D0TA 5H6RB 3IF8B 3KFWX 3SFDA 1WR0A 4AQFA 5L3DB 3LDQB 2AXDS 3BK9A 3ZN0B 3CX6B 2HHHT 3K3NA 4X20E 4P0BA 3PV0F 3JADA 1N36T 3Q5DA 4ILAA 1IBLT 4H63V 2HPJA 5FL0A 3UT5E 3NZPA 3AAEB 4HFEA 5AQTB 1Z8UA 3FZHB 4EYYR 3L39A 2WBLA 4ILCA 5LG3A 1W0BA 2CM0A 4EGWA 1KFYA 4O2BE 2Z6EA 4CXYA 2FJAA 2VK9A 3I0QA 4IL4A 2IC6A 3EVYA 5AQUB 5C2TA 2WAUA 4NUUA 3O4XE 2CLYC 2IUBA 3PU3A 3B57A 2GK9A 4EZHA 2XM1A 3ZMZB 4YSYA 4AKIA 3N9NA 4U31A 2X9XA 3AXJA 1UX4A 4TWDA 3RYHE 2W61A 2ES0A 1DU2A 1G73A 2CEAA 4ILUA 4JI8T 3OBVE 4EZ4A 4M1PA 4OX9T 4LMJA 4CXWA 3PE0A 2VVNA 3E22E 3LG7A 2WZIA 1MIVA 5LB7B 3FHNA 3I0OA 4TZ4C 5AQVB 1MMGA 4HFIA 2YKSA 4TUYE 5ADXL 3UU8A 3AE3A 3A7MA 5IUXA 4IIJE 1X9BA 2BS4A 5LP6E 1VCSA 4GKJT 2BVMA 4ZHQE 5EZYE 1KF6A 4HFHA 3B5MA 2LLYA 2MOZA 2MYSA 4WBNE 3SS1A 3RF1A 4EEBA 4IDOA 2W0GA 4WZXA 1IAPA 3RC3A 2VQET 5AQRB 4XBFB 4KBMB 5FXWA 4I4TE 2VVSA 2W66A 2MPKA 3VR8A 3N9MA 1NAFA 2FBWA 3RGLA 4B3MT 4AKHA 2E9XC 2FJEA 5EK2A 3RIAA 4EEDA 2LKHA 5F8PA 4YSZA 4JEUB 1XMQT 2OLTA 4HWFA 1ZHCA 1HG2A 4K0KT 4ZI3C 5L2LA 3Q5XA 4HWHA 2WY2A 2V7MA 4FI5A 5IHYA 3Q5EA 2A72A 4X66T 5F5WA 5JR9B 2YN6A 1VRBA 1I6ZA 2X0LB 2J47A 2A2FX 3RIUC 3UULA 4DIDB 1D0ZA 2BDEA 4IREA 5L3EB 3P4QA 3PURA 5CGMA 3ETUA 3Q2MA 3AE2A 3KV5A 3TLTA 3R84B 3WAJA 5LCYA 2HPLA 3CWZB 5HXHA 3UUXB 1MNEA 2ODVA 3C51A 4GOUA 2BS3A 1E7PA 3HL6A 2RP4A 2X51A 4ZI7E 1L0VA 2BG9C 4DR3T 2BS2A 2QGSA 5LGUB 4V1Av 1LVKA 2LOPA 4IE0A 4E7SA 2H7OA 3P4SA 3CIRA 3EABA 1J1JA 1BR4A 1BR1A 2J4GA 4CI3B 3AEFA 1SE7A 1WCRA 4YJ3E 2LKGA 1O3XA 1I94T 1JNZA 1QLBA 1HNZT 2LM2A 4TV9E 3HKEE 5KXJA 1XNRT 3AVRA 3L09A 4DMVA 1YW0A 4ILBA 3OKQA 2EHOB 4UXNB 3V5UA 2YU2A 5DJQC 4LF8T 3QB5A 1BR2A 2W2UA 1VOMA 3HI2A 5EK3A 3UUBA 4GK0E 4Z8XA 5ETWA 2YK0A 2VWAA 3JCFA 3WI3A 2J62A 3K3QC 2ZLYA 4IDPA 2IC9A 5JRCA 4I50E 2JQQA 4A97A 1M7KA 4JI6T 2P9BA 3WAKA 4O4JE 4YJ2E 4EYUA 2JIWA 2XPKA 4YTMA 5ABEA 3ZPOA 2BKNA 1ZOYA 4DV3T 4UELA 4DVDA 4PFPA 4DV0T 3PUQA 1SHZC 3L8RA 2KINB 2XAHB 5HEJA 4C90A 3QNUA 1X79A 2IW5B 4DMWA 2LRKA 1HS7A 4LF4T 2NWBA 3ABVA 5C8YE 1KK7A 2WDVA 3AEGA 4Z90A 1OEDC 4X64T 1HTJF 2LEHA 3LJCA 3LK2B 5AQHB 2XUEA 3I9YA 2KZ7B 3OYXA 3PJAA 1KNRA 1FIOA 4CXXA 1OXZA 2Y48B 5ABFA 3MK7C 5ABHA 4PK5A 5ABFB 3OVUA 5CFBA 3A5XA 2LSJA 3AA6B 4BA9A 3ZCIA 3H3AA 4IT4A 2JQKA 3U78A 4PJNA 4PK6A 4CI1B 3UTKA 5JDNA 4PNIA 1QUUA 2CPTA 3TLUA 4AQGA 2VKOA 4JLEA 4HFBA 5HCJA 1KNZA 2VQFT 3QB5K 1J5WA 4KX6A 2NW8A 3RKGA 4LF7T 1LKXA 3NZQA 5FY0A 3O1HA 5J2TE 2X66A 2KWIB 2YDQA 3AEAA 4I55E 5FMNA 3VKHA 4UVAB 2YDSA 2B76A 3P8CD 3X1DA 3EDVA 2AE9A 3PTRB 5LNKA 4UF0A 3LK42 3ZYLA 2CHNA 4UF0B 3KBUA 2VKDA 5LHHB 2LRLA 2V6YB 2C0SA 4KP3C 3OJAA 2KT9A 1V9DA 5AQFB 3PUZF 2V7LA 1SUMB 4GYRA 4WW0A 2JQ9A 4I43B 2XASB 5LGTB 2ODUA 5LYJE 2FJDA 3KINB 4QXBB 3AVSA 2CWOA 2CCQA 3E08A 5LBMA 2NTXA 3EHZA 4NXMT 3LFMA 1KNPA 4CQIA 2ACZA 4H9SE 3FBZA 1T7SA 1ZKEA 2JQHA 2DWKA 5KX5E 4WYVA 3UU6A 3PU8A 3PUYF 5L47A 5LGNB 4HWCA 1HNXT 3GN5A 2I0MA 4A5XA 2DI4A 3K8PC 4IGUA 3QOFA 3GN5B 3DJBA 4DR1T 4UV9B 5BR8T 2W00A 4KUMB 5A1LA 1HR0T 2WMOA 5DQVA 3IEEA 1J5ET 1HFAA 5L3FB 4H9OC 4U2YA 1XWMA 4YSXA 2ZMAA 3QK6A 3CX8B 2X0HA 3FBLA 3ZCJA 1Y01A 3AXJB 2VL8A 2NOXA 4U3CA 1YKEB 2WQYA 2WDQA 5JQGE 3ZC1A 4B3ST 1FJGT 3AEEA 2V6XA 5JTGA 2IHR1 2WMNA 2XQ5A 2UXXB 4QH5A 5IYZE 3PUXF 3ZSSA 4EB6E 2E9XD 3AA1B 5FXVA 4IDZA 4YT0A 1MNDA 4CZZB 2PJQA 4NIQA 2VKJA 2CA5A 2LSIA 2V5CA 3Q5WA 1XDPA 4ZI3D 5DABA 2XTLA 1OEDE 4HWIB 1Z0PA 4IE4A 4H63H 1Y64B 4DUYT 4DV4T 1WR6A 2WU2A 2E9XA 2HH7A 2XQ4A 4GIWA 2CE7A 3U3IA 4YTPA 4HGAA 1UX5A 2E9XB 4L0RA 4WNKA 1S35A 3GMIA 3KV9A 4UV8B 4BJNA 4CN6A 4WBOA 1CUNA 1W09A 3HKBE 2WM9A 3C4WA 2D9DA 3CKDA 3PDYA 1ZEEA 3RIFA 2DWGA 2I6HA 4TN7B 4C91A 3GA8A 1D1BA 4X65T 1IBKT 1WYBA 2JMHA 3RIUA 2Q9QC 3ZC0A 4O4HE 2NP9A 4GK5E 4HWDA 2IAKA 2V5DA 4UIGA 1UGOA 1HX1B 4LFBT 4JI7T 1D0YA 4ERRA 2Y6XA 4XAXB 3N9OA 5AFUL 2QYWA 4OYJA 3LSVA 4LFCT 3CPZA 2XJ7A 3CQCB 3RYFE 4CN1A 4AQYT 3SWHA 3H37A 1E2AA 3OPCA 5LHGB 4TV8E 5HYAA 2BG9A 3CQGB 2CBIA 4I0UA 3EDUA 3N2GE 4PJLA 2IIUA 2YOEA 4PAGA 2BG9B 5E0OA 5L3GB 5FXZA 1IZNB 3C4XA 1YQ4A 4TWHA 3HA4A 4JI0T 3N2OA 2MAWA 2X9YA 4H9NC 2WB5A 4ZZCA 3KV4A 4YTNA 2ZM6T 3GWHA 2JMKA 3FZMB 4B6XA 4XZCA 2JJ9A 1IBMT 3AE7A 3TKLB 3UQ4A 1N34T 5LA6E 4IHJE 2UXDT 4JUYA 2A3DA 1WLXA 5FVLA 3IHRA 3FZFB 3LBXA 5AQPB 3NRYA 1GQEA 2ACXA 3UFEA 3RI5A 4QH1A 5JR9C 2L9QA 4BJMA 5JDGA 2LOSA 3F57A 5AQGB 3I1AA 2OA5A 5JDMA 3ZEFB 2M6BA 3QC9A 3ESLA 4JV5T 3UFGA 2E8IA 2VL0A 5FXXA 2YU1A 4BAYB 3JAFA 3AE8A 1D1CA 2RA1A 4LMLA 4YXDA 2BKOA 3ZMUB 5HEUA 3OYZA 3J7Yq 5L3BB 4QX8B 2W4XA 3PUVF 5DQWA 2YDRA 2V7IA 3IA3A 3AE6A 4HEAA 5H6QB 4AKRB 3G06A 3C64A 1HF8A 3J9X1 4H9QC 5LJMA 3ZSTA 5JRCB 3NBXX 4UEMA 4EXTA 2L8KA 3ZYKA 1UUSA 2H89A 4HFDA 3OTOT 1OEDA 2BKPA 2D0TA 1LVFA 2ZM2A 3RC8A 2K24A 3JC6C 2UUAT 3QUJA 3AEDA 2EHOC 1XZYA 5HWXA 1VCTA 4QXHB 4JYAT 4G2AA 5HEOA 4B3RT 3ONLC 2SPCA 2D0UA 5FNVE 4EV6A 1MIYA 2QA7A 3AAIA 3ZMSB 4ADZA 2XQ6A 3W15B 1US7B 3VKGA 2DHRA 4ZI2D 1UURA 3K3OA 1B7TA 4DV6T 4EAHA 5JDQA 2HN1A 2WWVA 4DBQA 4FJOA 4Q25A 1SA0E 2VURA 2LSGA 3UQ7A 1XNQT 2CXLA 2WCAA 2XAGB 3ONJA 2WU5A 3ONXA 3MACA 4IE6A 3RH3A 3V5SA 4U33A 1FEWA 4QHOA 1H7CA 1HNWT 1FMVA 2XM2A 3Q9DA 1MMAA 4MBQA 3O1IA 1U4QA 3C98B 5JDFA 4AKGA 4AISA 5M4YA 4GYSA 4J2CA 4DV1T 2G0UA 2E5VA 3SOLA 3NRXA 3NVOA 2UUBT 4QH4A 2XHEB 2XAFB 5JDHA 2H88A 5FL1A 2DLRA 2LJLA 4QWNB 2FUPA 3UUMA 2JPFA 4AKLA 2K9AA 2WS3A 2A9UA 2M6IA 2CHOA 2PTFA 2XQAA 2LHRA 3ZLIA 4GKKT 1N33T 3ANWA 5LOVE 1NENA 5LJNA 1T98A 1LRZA 3ZMVB 3N9LA 2K3WA 4MFRA 4O8SA 4U74A 4MALA 4DO0A 3BQLA 1W9RA 3M65A 4AIUA 4X1IE 4ANJA 3ZYMA 5FY1A 4X1KE 3ZN1B 3ZT6A 5CJ5A 1WRDA 3N9PA 4ASKA 4B3TT 4YHHT 3O1JA 4OHFA 3RKOA 4X5TA 1R8IA 3KVBA 3TLSA 1WFDA 3UUNA 2KSRA 4DR2T 3RRWA 4F8HA 4IE5A 4YLHA 3RRCA 3KV6A 2PBIA 2LSYA 2WZHA 2V7JA 5IWAT 5JVDE 4AXPA 4MLKA 3EUHA 2X67A 4A98A 2B1EA 5L4EA 2CLYB 2W63A 4MHCA 3P7IA 4N78D 2K48A 1WYCA 5BMVE 4OK0A 2CMRA 3ZMTB 4DR7T 3H3MA 3LK3B 2DL1A 4OYKA 5FY7A 3N5LA 2OV9A 5HEGA 1ZV4X 5L3CB 3AA0B 4NXNT 2DNXA 1XDOA 3JAEA 3T8OA 4K0UA 1IJ5A 3S4UA 4F6RC 2N9DA 3RLFF 4O2AE 4AQFC 3RX6A 5FYMA 3EAMA 3AA7B 2M67A 3T1YT 4IE7A 2BVLA 4U2ZA 3E0ZA 5AQSB 3VRBA 4H9RC 2KWHA 2Y8DA 2NR4A 4DR6T 5J1GA 2R6GF 2KNDA 4LF5T 4EOZB 2WP9A 2V8SV 3AE9A 2X0YA 3ETVA 3RYCE 4O4LE 2HN2A 2Q9QD 5CB4E 4EIWA 1NEKA 2LE8A 5AQMB 1MMNA 1UK5A 5AQJB 4NPPA 1BR0A 3ZT5A 3CX7B 2DCFA 5F3JA 2XQYA 3F31A 1ZP0A 2IMLA 5FKYA 4X62T 3FXEB 2PFVA 3ZT7A 3HR0A 2Q9QA 5AQNB 4DV2T 5LMNT 2Q9QB 1YXRA 5HCMA 3EI0A 2QRXA 5HEHA 2YINA 2XY8B 1D1AA 1YD8G 2CXFA 2UXNB 5HWYA 2PG8A 3VR9A 2MBGA 3RQWA 4ISTA 4JI1T 2YEVC 2X9HA 4KMCA 4TX5A 4UVCB 4U72A 1NWMX 2XQ7A 4HFVA 4U7IA 2L3LA 5C3JA 4KI0F 3IBPA 2KXPB 3DP7A 5AQIB 2NW7A 1CHUA 5AQQB 3L3PA 2UXCT 5JREA 1U5PA 4AI6A 4QXCB 1N32T 5GONE 2N1GA 3AB3B 4KHZF 3KDSE 5HXRA 3ZKRA 2KMFA 3PJAJ 4TNVA 3MXZA 4IL9A 5JR9A 4O4IE 2E5LT 4TWFA 2UXBT 3A8YC 2QVAA 3R6NA 3I9WA 4ISSA 2BBJA 5KDMC 1XMOT 4IDQA 3P50A 3C50A 5ABGA 2H7VC 2XSAA 3HKDE 3RHWA 3M3ZB 3SFEA 2BZBA 3CK6A 1OWAA 3NWIA 3BQIA 2N2NA 3AE4A 3MKDA 3LBXB 4NUVA 3MA9A 4TNWA 4DR4T 4LF6T 5HXEA 2VB6A 5LMUT 5FP3A 4DUZT 2XZEA 3JC6D 3RPUA 4PFOA 2FJBA 2EHOD 4ZEYA 4ZOLE 4PJMA 3P4PA 2XSBA 4P09A 4UVBB 3AEBA 4YFSA 5HAXA 2V1DB 5JDLA 4JI2T 4UR9A 5LBQB 4CI2B 1M62A 3AE1A 3O9XA 3AAAB 3K1SA 2W62A 4OFZA 4PW8A 4YHJA 5EK4A 2V7KA 2F4VT 2XQ3A 1AJ3A 2ZM8A 4JI5T 2EHOA 5KMGP 2RPAA 2C5KT 3RYIE 4U7YA 3T1HT 4LF9T 2MTQA 1D0XA 5L4HA 2XQ9A 3CVRA 3F2EA 4DV5T 3MJXA 4HKAA 2X68A 4P1NA 3AE5A 2LHNA 1W0AA 3VRAA 3DTOA 2BBHA 5FVKA 3SRZA 1OEDB 4JI3T 4ZZBA 5LHIB 2CWYA 2X9WA 4Z91A 1JNRA 3UU3A 1T8BA 2ZM0A 2CXDA 2C5JA 1MMDA 3PUAA 2W67A 5HXSA 3CMLA 2K5BB 4ZXLA 5J0ZA 4HE8A 4ZS2A 4LMKA 2D2SA 4HFCA 5CA0E 2IDOB 4HN9A 5AQOB 2XAQB 4DBRA
chains in the Genus database with same CATH topology
2RPAA 1WFDA 2JQKA 4U7YA 2MPKA 2WY2A 5FVLA 5FVKA 1WR0A 4CN6A 2LRKA 3ZT6A 4U2ZA 4A5XA 4U3CA 4WZXA 5CJ5A 2JQ9A 1WCRA 2XZEA 2V6YA 4U7IA 3ZSSA 3ZSTA 4CN4A 4CN1A 5LB7B 3ZT7A 2K3WA 2W2UA 4U33A 2JQHA 3K1SA 2CPTA 4ZEYA 2DL1A 4U2YA 2LRLA 2V6YB 4P1NA 2V6XA 4NIQA 2CRBA 4U31A 2WWVA 2A9UA 5CGMA 3ZT5A 3EABA 1YXRA 4IT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPA A;  1WFD A;  2JQK A;  4U7Y A;  2MPK A;  2WY2 A;  5FVL A;  5FVK A;  1WR0 A;  4CN6 A;  2LRK A;  3ZT6 A;  4U2Z A;  4A5X A;  4U3C A;  4WZX A;  5CJ5 A;  2JQ9 A;  1WCR A;  2XZE A;  2V6Y A;  4U7I A;  3ZSS A;  3ZST A;  4CN4 A;  4CN1 A;  5LB7 B;  3ZT7 A;  2K3W A;  2W2U A;  4U33 A;  2JQH A;  3K1S A;  2CPT A;  4ZEY A;  2DL1 A;  4U2Y A;  2LRL A;  2V6Y B;  4P1N A;  2V6X A;  4NIQ A;  2CRB A;  4U31 A;  2WWV A;  2A9U A;  5CGM A;  3ZT5 A;  3EAB A;  1YXR A;  4IT4 A; 
#chains in the Genus database with same CATH topology
 2NTY A;  5JH7 E;  1YKH B;  2C5I T;  3VHL A;  4LFA T;  4H9P C;  2XQ8 A;  4A56 A;  3UU5 A;  3P4R A;  4P0A A;  3N9Q A;  3KVA A;  4JEH B;  1EZ3 A;  2UU9 T;  1E1H B;  4IDN A;  5HXC A;  3FZL B;  2LT3 A;  2WDR A;  4JBW F;  4PJJ A;  1G8X A;  2V26 A;  3RQU A;  4E7Z A;  2LM9 A;  3FZK B;  4QKN A;  2J1D G;  3NKZ A;  1KEY A;  3TLV A;  2D5U A;  1HCI A;  4COF A;  2VAS A;  3P4W A;  4L9I A;  5AQL B;  4DR5 T;  1FMW A;  3ZJ2 A;  3BQK A;  3PUS A;  5LG4 A;  3HKC E;  4L5G A;  4DND A;  2CBJ A;  1T72 A;  5CA1 E;  1YQ3 A;  1IJ6 A;  4KHP T;  1HX8 A;  5LXT E;  5J2U E;  3C4Z A;  3CQX C;  2H3R A;  4ZI2 C;  1QSD A;  4G63 A;  4JI4 T;  2E2A A;  3ANW B;  1S94 A;  1MIW A;  4YY3 T;  2VKH A;  4HTE A;  2LSK A;  3FXD B;  1HG5 A;  3KBT A;  3PUG A;  3UU4 A;  2JRK A;  2UUC T;  2V6Y A;  4CN4 A;  1UCU A;  3MZK B;  3N2K E;  3PUW F;  3B13 A;  3AEC A;  5TAO A;  2CRB A;  2I59 A;  4QX7 B;  2WWU A;  4ZS3 A;  2KLQ A;  4DV7 T;  4X1Y E;  3TLW A;  3ZJ1 A;  3FB2 A;  3VU7 H;  5AQK B;  2XAJ B;  4PK4 A;  2NW9 A;  2WSS V;  2BG9 E;  3D0T A;  5H6R B;  3IF8 B;  3KFW X;  3SFD A;  1WR0 A;  4AQF A;  5L3D B;  3LDQ B;  2AXD S;  3BK9 A;  3ZN0 B;  3CX6 B;  2HHH T;  3K3N A;  4X20 E;  4P0B A;  3PV0 F;  3JAD A;  1N36 T;  3Q5D A;  4ILA A;  1IBL T;  4H63 V;  2HPJ A;  5FL0 A;  3UT5 E;  3NZP A;  3AAE B;  4HFE A;  5AQT B;  1Z8U A;  3FZH B;  4EYY R;  3L39 A;  2WBL A;  4ILC A;  5LG3 A;  1W0B A;  2CM0 A;  4EGW A;  1KFY A;  4O2B E;  2Z6E A;  4CXY A;  2FJA A;  2VK9 A;  3I0Q A;  4IL4 A;  2IC6 A;  3EVY A;  5AQU B;  5C2T A;  2WAU A;  4NUU A;  3O4X E;  2CLY C;  2IUB A;  3PU3 A;  3B57 A;  2GK9 A;  4EZH A;  2XM1 A;  3ZMZ B;  4YSY A;  4AKI A;  3N9N A;  4U31 A;  2X9X A;  3AXJ A;  1UX4 A;  4TWD A;  3RYH E;  2W61 A;  2ES0 A;  1DU2 A;  1G73 A;  2CEA A;  4ILU A;  4JI8 T;  3OBV E;  4EZ4 A;  4M1P A;  4OX9 T;  4LMJ A;  4CXW A;  3PE0 A;  2VVN A;  3E22 E;  3LG7 A;  2WZI A;  1MIV A;  5LB7 B;  3FHN A;  3I0O A;  4TZ4 C;  5AQV B;  1MMG A;  4HFI A;  2YKS A;  4TUY E;  5ADX L;  3UU8 A;  3AE3 A;  3A7M A;  5IUX A;  4IIJ E;  1X9B A;  2BS4 A;  5LP6 E;  1VCS A;  4GKJ T;  2BVM A;  4ZHQ E;  5EZY E;  1KF6 A;  4HFH A;  3B5M A;  2LLY A;  2MOZ A;  2MYS A;  4WBN E;  3SS1 A;  3RF1 A;  4EEB A;  4IDO A;  2W0G A;  4WZX A;  1IAP A;  3RC3 A;  2VQE T;  5AQR B;  4XBF B;  4KBM B;  5FXW A;  4I4T E;  2VVS A;  2W66 A;  2MPK A;  3VR8 A;  3N9M A;  1NAF A;  2FBW A;  3RGL A;  4B3M T;  4AKH A;  2E9X C;  2FJE A;  5EK2 A;  3RIA A;  4EED A;  2LKH A;  5F8P A;  4YSZ A;  4JEU B;  1XMQ T;  2OLT A;  4HWF A;  1ZHC A;  1HG2 A;  4K0K T;  4ZI3 C;  5L2L A;  3Q5X A;  4HWH A;  2WY2 A;  2V7M A;  4FI5 A;  5IHY A;  3Q5E A;  2A72 A;  4X66 T;  5F5W A;  5JR9 B;  2YN6 A;  1VRB A;  1I6Z A;  2X0L B;  2J47 A;  2A2F X;  3RIU C;  3UUL A;  4DID B;  1D0Z A;  2BDE A;  4IRE A;  5L3E B;  3P4Q A;  3PUR A;  5CGM A;  3ETU A;  3Q2M A;  3AE2 A;  3KV5 A;  3TLT A;  3R84 B;  3WAJ A;  5LCY A;  2HPL A;  3CWZ B;  5HXH A;  3UUX B;  1MNE A;  2ODV A;  3C51 A;  4GOU A;  2BS3 A;  1E7P A;  3HL6 A;  2RP4 A;  2X51 A;  4ZI7 E;  1L0V A;  2BG9 C;  4DR3 T;  2BS2 A;  2QGS A;  5LGU B;  4V1A v;  1LVK A;  2LOP A;  4IE0 A;  4E7S A;  2H7O A;  3P4S A;  3CIR A;  3EAB A;  1J1J A;  1BR4 A;  1BR1 A;  2J4G A;  4CI3 B;  3AEF A;  1SE7 A;  1WCR A;  4YJ3 E;  2LKG A;  1O3X A;  1I94 T;  1JNZ A;  1QLB A;  1HNZ T;  2LM2 A;  4TV9 E;  3HKE E;  5KXJ A;  1XNR T;  3AVR A;  3L09 A;  4DMV A;  1YW0 A;  4ILB A;  3OKQ A;  2EHO B;  4UXN B;  3V5U A;  2YU2 A;  5DJQ C;  4LF8 T;  3QB5 A;  1BR2 A;  2W2U A;  1VOM A;  3HI2 A;  5EK3 A;  3UUB A;  4GK0 E;  4Z8X A;  5ETW A;  2YK0 A;  2VWA A;  3JCF A;  3WI3 A;  2J62 A;  3K3Q C;  2ZLY A;  4IDP A;  2IC9 A;  5JRC A;  4I50 E;  2JQQ A;  4A97 A;  1M7K A;  4JI6 T;  2P9B A;  3WAK A;  4O4J E;  4YJ2 E;  4EYU A;  2JIW A;  2XPK A;  4YTM A;  5ABE A;  3ZPO A;  2BKN A;  1ZOY A;  4DV3 T;  4UEL A;  4DVD A;  4PFP A;  4DV0 T;  3PUQ A;  1SHZ C;  3L8R A;  2KIN B;  2XAH B;  5HEJ A;  4C90 A;  3QNU A;  1X79 A;  2IW5 B;  4DMW A;  2LRK A;  1HS7 A;  4LF4 T;  2NWB A;  3ABV A;  5C8Y E;  1KK7 A;  2WDV A;  3AEG A;  4Z90 A;  1OED C;  4X64 T;  1HTJ F;  2LEH A;  3LJC A;  3LK2 B;  5AQH B;  2XUE A;  3I9Y A;  2KZ7 B;  3OYX A;  3PJA A;  1KNR A;  1FIO A;  4CXX A;  1OXZ A;  2Y48 B;  5ABF A;  3MK7 C;  5ABH A;  4PK5 A;  5ABF B;  3OVU A;  5CFB A;  3A5X A;  2LSJ A;  3AA6 B;  4BA9 A;  3ZCI A;  3H3A A;  4IT4 A;  2JQK A;  3U78 A;  4PJN A;  4PK6 A;  4CI1 B;  3UTK A;  5JDN A;  4PNI A;  1QUU A;  2CPT A;  3TLU A;  4AQG A;  2VKO A;  4JLE A;  4HFB A;  5HCJ A;  1KNZ A;  2VQF T;  3QB5 K;  1J5W A;  4KX6 A;  2NW8 A;  3RKG A;  4LF7 T;  1LKX A;  3NZQ A;  5FY0 A;  3O1H A;  5J2T E;  2X66 A;  2KWI B;  2YDQ A;  3AEA A;  4I55 E;  5FMN A;  3VKH A;  4UVA B;  2YDS A;  2B76 A;  3P8C D;  3X1D A;  3EDV A;  2AE9 A;  3PTR B;  5LNK A;  4UF0 A;  3LK4 2;  3ZYL A;  2CHN A;  4UF0 B;  3KBU A;  2VKD A;  5LHH B;  2LRL A;  2V6Y B;  2C0S A;  4KP3 C;  3OJA A;  2KT9 A;  1V9D A;  5AQF B;  3PUZ F;  2V7L A;  1SUM B;  4GYR A;  4WW0 A;  2JQ9 A;  4I43 B;  2XAS B;  5LGT B;  2ODU A;  5LYJ E;  2FJD A;  3KIN B;  4QXB B;  3AVS A;  2CWO A;  2CCQ A;  3E08 A;  5LBM A;  2NTX A;  3EHZ A;  4NXM T;  3LFM A;  1KNP A;  4CQI A;  2ACZ A;  4H9S E;  3FBZ A;  1T7S A;  1ZKE A;  2JQH A;  2DWK A;  5KX5 E;  4WYV A;  3UU6 A;  3PU8 A;  3PUY F;  5L47 A;  5LGN B;  4HWC A;  1HNX T;  3GN5 A;  2I0M A;  4A5X A;  2DI4 A;  3K8P C;  4IGU A;  3QOF A;  3GN5 B;  3DJB A;  4DR1 T;  4UV9 B;  5BR8 T;  2W00 A;  4KUM B;  5A1L A;  1HR0 T;  2WMO A;  5DQV A;  3IEE A;  1J5E T;  1HFA A;  5L3F B;  4H9O C;  4U2Y A;  1XWM A;  4YSX A;  2ZMA A;  3QK6 A;  3CX8 B;  2X0H A;  3FBL A;  3ZCJ A;  1Y01 A;  3AXJ B;  2VL8 A;  2NOX A;  4U3C A;  1YKE B;  2WQY A;  2WDQ A;  5JQG E;  3ZC1 A;  4B3S T;  1FJG T;  3AEE A;  2V6X A;  5JTG A;  2IHR 1;  2WMN A;  2XQ5 A;  2UXX B;  4QH5 A;  5IYZ E;  3PUX F;  3ZSS A;  4EB6 E;  2E9X D;  3AA1 B;  5FXV A;  4IDZ A;  4YT0 A;  1MND A;  4CZZ B;  2PJQ A;  4NIQ A;  2VKJ A;  2CA5 A;  2LSI A;  2V5C A;  3Q5W A;  1XDP A;  4ZI3 D;  5DAB A;  2XTL A;  1OED E;  4HWI B;  1Z0P A;  4IE4 A;  4H63 H;  1Y64 B;  4DUY T;  4DV4 T;  1WR6 A;  2WU2 A;  2E9X A;  2HH7 A;  2XQ4 A;  4GIW A;  2CE7 A;  3U3I A;  4YTP A;  4HGA A;  1UX5 A;  2E9X B;  4L0R A;  4WNK A;  1S35 A;  3GMI A;  3KV9 A;  4UV8 B;  4BJN A;  4CN6 A;  4WBO A;  1CUN A;  1W09 A;  3HKB E;  2WM9 A;  3C4W A;  2D9D A;  3CKD A;  3PDY A;  1ZEE A;  3RIF A;  2DWG A;  2I6H A;  4TN7 B;  4C91 A;  3GA8 A;  1D1B A;  4X65 T;  1IBK T;  1WYB A;  2JMH A;  3RIU A;  2Q9Q C;  3ZC0 A;  4O4H E;  2NP9 A;  4GK5 E;  4HWD A;  2IAK A;  2V5D A;  4UIG A;  1UGO A;  1HX1 B;  4LFB T;  4JI7 T;  1D0Y A;  4ERR A;  2Y6X A;  4XAX B;  3N9O A;  5AFU L;  2QYW A;  4OYJ A;  3LSV A;  4LFC T;  3CPZ A;  2XJ7 A;  3CQC B;  3RYF E;  4CN1 A;  4AQY T;  3SWH A;  3H37 A;  1E2A A;  3OPC A;  5LHG B;  4TV8 E;  5HYA A;  2BG9 A;  3CQG B;  2CBI A;  4I0U A;  3EDU A;  3N2G E;  4PJL A;  2IIU A;  2YOE A;  4PAG A;  2BG9 B;  5E0O A;  5L3G B;  5FXZ A;  1IZN B;  3C4X A;  1YQ4 A;  4TWH A;  3HA4 A;  4JI0 T;  3N2O A;  2MAW A;  2X9Y A;  4H9N C;  2WB5 A;  4ZZC A;  3KV4 A;  4YTN A;  2ZM6 T;  3GWH A;  2JMK A;  3FZM B;  4B6X A;  4XZC A;  2JJ9 A;  1IBM T;  3AE7 A;  3TKL B;  3UQ4 A;  1N34 T;  5LA6 E;  4IHJ E;  2UXD T;  4JUY A;  2A3D A;  1WLX A;  5FVL A;  3IHR A;  3FZF B;  3LBX A;  5AQP B;  3NRY A;  1GQE A;  2ACX A;  3UFE A;  3RI5 A;  4QH1 A;  5JR9 C;  2L9Q A;  4BJM A;  5JDG A;  2LOS A;  3F57 A;  5AQG B;  3I1A A;  2OA5 A;  5JDM A;  3ZEF B;  2M6B A;  3QC9 A;  3ESL A;  4JV5 T;  3UFG A;  2E8I A;  2VL0 A;  5FXX A;  2YU1 A;  4BAY B;  3JAF A;  3AE8 A;  1D1C A;  2RA1 A;  4LML A;  4YXD A;  2BKO A;  3ZMU B;  5HEU A;  3OYZ A;  3J7Y q;  5L3B B;  4QX8 B;  2W4X A;  3PUV F;  5DQW A;  2YDR A;  2V7I A;  3IA3 A;  3AE6 A;  4HEA A;  5H6Q B;  4AKR B;  3G06 A;  3C64 A;  1HF8 A;  3J9X 1;  4H9Q C;  5LJM A;  3ZST A;  5JRC B;  3NBX X;  4UEM A;  4EXT A;  2L8K A;  3ZYK A;  1UUS A;  2H89 A;  4HFD A;  3OTO T;  1OED A;  2BKP A;  2D0T A;  1LVF A;  2ZM2 A;  3RC8 A;  2K24 A;  3JC6 C;  2UUA T;  3QUJ A;  3AED A;  2EHO C;  1XZY A;  5HWX A;  1VCT A;  4QXH B;  4JYA T;  4G2A A;  5HEO A;  4B3R T;  3ONL C;  2SPC A;  2D0U A;  5FNV E;  4EV6 A;  1MIY A;  2QA7 A;  3AAI A;  3ZMS B;  4ADZ A;  2XQ6 A;  3W15 B;  1US7 B;  3VKG A;  2DHR A;  4ZI2 D;  1UUR A;  3K3O A;  1B7T A;  4DV6 T;  4EAH A;  5JDQ A;  2HN1 A;  2WWV A;  4DBQ A;  4FJO A;  4Q25 A;  1SA0 E;  2VUR A;  2LSG A;  3UQ7 A;  1XNQ T;  2CXL A;  2WCA A;  2XAG B;  3ONJ A;  2WU5 A;  3ONX A;  3MAC A;  4IE6 A;  3RH3 A;  3V5S A;  4U33 A;  1FEW A;  4QHO A;  1H7C A;  1HNW T;  1FMV A;  2XM2 A;  3Q9D A;  1MMA A;  4MBQ A;  3O1I A;  1U4Q A;  3C98 B;  5JDF A;  4AKG A;  4AIS A;  5M4Y A;  4GYS A;  4J2C A;  4DV1 T;  2G0U A;  2E5V A;  3SOL A;  3NRX A;  3NVO A;  2UUB T;  4QH4 A;  2XHE B;  2XAF B;  5JDH A;  2H88 A;  5FL1 A;  2DLR A;  2LJL A;  4QWN B;  2FUP A;  3UUM A;  2JPF A;  4AKL A;  2K9A A;  2WS3 A;  2A9U A;  2M6I A;  2CHO A;  2PTF A;  2XQA A;  2LHR A;  3ZLI A;  4GKK T;  1N33 T;  3ANW A;  5LOV E;  1NEN A;  5LJN A;  1T98 A;  1LRZ A;  3ZMV B;  3N9L A;  2K3W A;  4MFR A;  4O8S A;  4U74 A;  4MAL A;  4DO0 A;  3BQL A;  1W9R A;  3M65 A;  4AIU A;  4X1I E;  4ANJ A;  3ZYM A;  5FY1 A;  4X1K E;  3ZN1 B;  3ZT6 A;  5CJ5 A;  1WRD A;  3N9P A;  4ASK A;  4B3T T;  4YHH T;  3O1J A;  4OHF A;  3RKO A;  4X5T A;  1R8I A;  3KVB A;  3TLS A;  1WFD A;  3UUN A;  2KSR A;  4DR2 T;  3RRW A;  4F8H A;  4IE5 A;  4YLH A;  3RRC A;  3KV6 A;  2PBI A;  2LSY A;  2WZH A;  2V7J A;  5IWA T;  5JVD E;  4AXP A;  4MLK A;  3EUH A;  2X67 A;  4A98 A;  2B1E A;  5L4E A;  2CLY B;  2W63 A;  4MHC A;  3P7I A;  4N78 D;  2K48 A;  1WYC A;  5BMV E;  4OK0 A;  2CMR A;  3ZMT B;  4DR7 T;  3H3M A;  3LK3 B;  2DL1 A;  4OYK A;  5FY7 A;  3N5L A;  2OV9 A;  5HEG A;  1ZV4 X;  5L3C B;  3AA0 B;  4NXN T;  2DNX A;  1XDO A;  3JAE A;  3T8O A;  4K0U A;  1IJ5 A;  3S4U A;  4F6R C;  2N9D A;  3RLF F;  4O2A E;  4AQF C;  3RX6 A;  5FYM A;  3EAM A;  3AA7 B;  2M67 A;  3T1Y T;  4IE7 A;  2BVL A;  4U2Z A;  3E0Z A;  5AQS B;  3VRB A;  4H9R C;  2KWH A;  2Y8D A;  2NR4 A;  4DR6 T;  5J1G A;  2R6G F;  2KND A;  4LF5 T;  4EOZ B;  2WP9 A;  2V8S V;  3AE9 A;  2X0Y A;  3ETV A;  3RYC E;  4O4L E;  2HN2 A;  2Q9Q D;  5CB4 E;  4EIW A;  1NEK A;  2LE8 A;  5AQM B;  1MMN A;  1UK5 A;  5AQJ B;  4NPP A;  1BR0 A;  3ZT5 A;  3CX7 B;  2DCF A;  5F3J A;  2XQY A;  3F31 A;  1ZP0 A;  2IML A;  5FKY A;  4X62 T;  3FXE B;  2PFV A;  3ZT7 A;  3HR0 A;  2Q9Q A;  5AQN B;  4DV2 T;  5LMN T;  2Q9Q B;  1YXR A;  5HCM A;  3EI0 A;  2QRX A;  5HEH A;  2YIN A;  2XY8 B;  1D1A A;  1YD8 G;  2CXF A;  2UXN B;  5HWY A;  2PG8 A;  3VR9 A;  2MBG A;  3RQW A;  4IST A;  4JI1 T;  2YEV C;  2X9H A;  4KMC A;  4TX5 A;  4UVC B;  4U72 A;  1NWM X;  2XQ7 A;  4HFV A;  4U7I A;  2L3L A;  5C3J A;  4KI0 F;  3IBP A;  2KXP B;  3DP7 A;  5AQI B;  2NW7 A;  1CHU A;  5AQQ B;  3L3P A;  2UXC T;  5JRE A;  1U5P A;  4AI6 A;  4QXC B;  1N32 T;  5GON E;  2N1G A;  3AB3 B;  4KHZ F;  3KDS E;  5HXR A;  3ZKR A;  2KMF A;  3PJA J;  4TNV A;  3MXZ A;  4IL9 A;  5JR9 A;  4O4I E;  2E5L T;  4TWF A;  2UXB T;  3A8Y C;  2QVA A;  3R6N A;  3I9W A;  4ISS A;  2BBJ A;  5KDM C;  1XMO T;  4IDQ A;  3P50 A;  3C50 A;  5ABG A;  2H7V C;  2XSA A;  3HKD E;  3RHW A;  3M3Z B;  3SFE A;  2BZB A;  3CK6 A;  1OWA A;  3NWI A;  3BQI A;  2N2N A;  3AE4 A;  3MKD A;  3LBX B;  4NUV A;  3MA9 A;  4TNW A;  4DR4 T;  4LF6 T;  5HXE A;  2VB6 A;  5LMU T;  5FP3 A;  4DUZ T;  2XZE A;  3JC6 D;  3RPU A;  4PFO A;  2FJB A;  2EHO D;  4ZEY A;  4ZOL E;  4PJM A;  3P4P A;  2XSB A;  4P09 A;  4UVB B;  3AEB A;  4YFS A;  5HAX A;  2V1D B;  5JDL A;  4JI2 T;  4UR9 A;  5LBQ B;  4CI2 B;  1M62 A;  3AE1 A;  3O9X A;  3AAA B;  3K1S A;  2W62 A;  4OFZ A;  4PW8 A;  4YHJ A;  5EK4 A;  2V7K A;  2F4V T;  2XQ3 A;  1AJ3 A;  2ZM8 A;  4JI5 T;  2EHO A;  5KMG P;  2RPA A;  2C5K T;  3RYI E;  4U7Y A;  3T1H T;  4LF9 T;  2MTQ A;  1D0X A;  5L4H A;  2XQ9 A;  3CVR A;  3F2E A;  4DV5 T;  3MJX A;  4HKA A;  2X68 A;  4P1N A;  3AE5 A;  2LHN A;  1W0A A;  3VRA A;  3DTO A;  2BBH A;  5FVK A;  3SRZ A;  1OED B;  4JI3 T;  4ZZB A;  5LHI B;  2CWY A;  2X9W A;  4Z91 A;  1JNR A;  3UU3 A;  1T8B A;  2ZM0 A;  2CXD A;  2C5J A;  1MMD A;  3PUA A;  2W67 A;  5HXS A;  3CML A;  2K5B B;  4ZXL A;  5J0Z A;  4HE8 A;  4ZS2 A;  4LMK A;  2D2S A;  4HFC A;  5CA0 E;  2IDO B;  4HN9 A;  5AQO B;  2XAQ B;  4DBR A; 
#chains in the Genus database with same CATH homology
 2RPA A;  1WFD A;  2JQK A;  4U7Y A;  2MPK A;  2WY2 A;  5FVL A;  5FVK A;  1WR0 A;  4CN6 A;  2LRK A;  3ZT6 A;  4U2Z A;  4A5X A;  4U3C A;  4WZX A;  5CJ5 A;  2JQ9 A;  1WCR A;  2XZE A;  2V6Y A;  4U7I A;  3ZSS A;  3ZST A;  4CN4 A;  4CN1 A;  5LB7 B;  3ZT7 A;  2K3W A;  2W2U A;  4U33 A;  2JQH A;  3K1S A;  2CPT A;  4ZEY A;  2DL1 A;  4U2Y A;  2LRL A;  2V6Y B;  4P1N A;  2V6X A;  4NIQ A;  2CRB A;  4U31 A;  2WWV A;  2A9U A;  5CGM A;  3ZT5 A;  3EAB A;  1YXR A;  4IT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...