3EABA

Crystal structure of spastin mit in complex with escrt iii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
b'MGSMEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spastin
molecule tags Cell cycle
source organism Homo sapiens
publication title Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B.
pubmed doi rcsb
total genus 37
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 3eabA01
3ZSSA 2DL1A 2XZEA 4U31A 3ZSTA 3K1SA 2JQHA 2V6YB 2CPTA 2CRBA 1WCRA 4U7IA 1WFDA 4U7YA 3ZT6A 2V6XA 2LRKA 2WY2A 2K3WA 3ZT5A 4U2ZA 5LB7B 5FVLA 2JQKA 2V6YA 4P1NA 1WR0A 4CN4A 4CN6A 4ZEYA 2WWVA 2A9UA 4CN1A 4A5XA 4WZXA 2W2UA 2MPKA 5CGMA 5CJ5A 3EABA 4NIQA 4IT4A 3ZT7A 4U2YA 2RPAA 2JQ9A 4U3CA 5FVKA 2LRLA 1YXRA 4U33A
chains in the Genus database with same CATH superfamily
4YT0A 2HN2A 3N2GE 4PJJA 4PFOA 2CEAA 3E22E 2C0SA 4DBQA 1ZEEA 4JYAT 3ETVA 3AA0B 2UXDT 1MMAA 3FBZA 3VU7H 1D1BA 2PJQA 3AEBA 3Q5XA 4EEBA 2KWIB 3N9PA 5C8YE 4WW0A 4LF7T 4F8HA 4YXDA 5KX5E 4PK6A 2K5BB 4IL4A 4CQIA 5JRCA 3ABVA 1KK7A 2CCQA 2CWYA 2NP9A 2BG9B 5LGNB 1SE7A 1SA0E 3N5LA 4AXPA 2UUCT 3AE8A 1G73A 5L3CB 5ABFA 2FJAA 2ZMAA 1R8IA 3EABA 5AQHB 1U4QA 2V26A 3CX6B 2D0TA 3JCFA 3Q5DA 4ISSA 4ZS3A 3T1YT 4JI6T 4LF9T 2YOEA 2FJDA 3P4PA 3J7Yq 4HWDA 1XMOT 5J1GA 3LDQB 5IYZE 3ETUA 2LRLA 1JNZA 2JQQA 2QA7A 3AEFA 3EUHA 4O4HE 3UUMA 3UU3A 3N9OA 4X64T 4M1PA 4U31A 4COFA 2B76A 2VB6A 3K1SA 2N2NA 3RQUA 3RYIE 3QB5K 3C4XA 2C5JA 4G2AA 2MTQA 4EV6A 2HHHT 2JMKA 2WY2A 3P4QA 1N36T 3E08A 1IZNB 2CM0A 3UTKA 1QSDA 3JAFA 4X62T 2LM9A 3GMIA 4H9RC 3AXJB 1WYCA 2CBJA 4DR4T 4UXNB 4P0BA 2DI4A 3AECA 5CA1E 4DR3T 4KHZF 2XM1A 3L09A 1HNXT 5AQTB 3AAIA 3PUAA 4GK0E 3AEDA 4ZZCA 1HF8A 2JMHA 2XQ4A 3PJAA 4TWHA 1FMWA 2HPJA 3PJAJ 5JDQA 1FEWA 5CA0E 2LHRA 3A7MA 5AQFB 3PUZF 4DMWA 5JR9B 3AA1B 3VR8A 1N33T 3AE6A 4CZZB 1AJ3A 3PE0A 3BQLA 1ZOYA 4BJMA 2PTFA 1BR4A 2J47A 4PJMA 4HFEA 2XUEA 2ZM8A 4I50E 5AQUB 3KVBA 5JDGA 2JQHA 5IHYA 4X5TA 1WCRA 1V9DA 3FZFB 3Q5WA 1W09A 5LOVE 4QX8B 5L4HA 5H6QB 3BQKA 2G0UA 3QC9A 4ZI3D 2KXPB 2LSJA 2V7KA 3RC3A 3HI2A 2ODUA 2QVAA 5HXRA 3RH3A 2NWBA 3ANWB 2WWVA 3S4UA 5HWXA 5HWYA 2I0MA 1UX4A 5AQJB 4PNIA 5KDMC 2VASA 2MYSA 4C90A 5J2UE 4JI1T 2LE8A 3AXJA 4ILCA 1MMDA 2M67A 1D0ZA 5AQVB 4DR7T 2J62A 2XQ7A 4PW8A 5L47A 2XQ8A 3AB3B 2WDVA 3C4WA 4ASKA 2RPAA 3P4RA 4N78D 5L3EB 5JDNA 5L4EA 3R84B 5FYMA 5LCYA 5ABEA 1YXRA 2IMLA 3RHWA 4YTPA 1UK5A 2WU5A 4KMCA 4CI2B 4B3RT 1WRDA 4CXWA 4P09A 2WU2A 5LA6E 2LEHA 4IE0A 5JREA 2W67A 3AE7A 1IBLT 5HXHA 1T7SA 4NUVA 4UV9B 3RC8A 4UVBB 1ZV4X 2ACZA 1M7KA 1XDOA 2IUBA 2KWHA 2WMNA 2BDEA 2Y6XA 2WQYA 3EDVA 2PFVA 4TX5A 3SOLA 5LMNT 4AKHA 1BR2A 4HGAA 2V6YA 3CPZA 1WLXA 3TKLB 5JDMA 2WMOA 2XM2A 4H9NC 3AAAB 3BQIA 2LSGA 3V5UA 3ZKRA 1FMVA 4OHFA 2EHOC 3SS1A 5KMGP 2CLYB 4ISTA 1OEDB 5HEOA 2E8IA 3UU8A 5L3FB 2CXLA 4HFCA 2XQ9A 3CQXC 4O4IE 1S35A 4ILAA 4OYKA 5LGUB 1I6ZA 2LKHA 2D2SA 2WSSV 1DU2A 3MA9A 4U3CA 3ZLIA 4EZHA 2BS3A 5FXWA 5JQGE 1W0BA 1E7PA 1T8BA 4TZ4C 2D9DA 2VKHA 4YHJA 5LG4A 3PV0F 4LFCT 3VKHA 4DV1T 4HFBA 3ZYKA 5HCJA 3ZJ2A 3OBVE 3AE1A 5FL1A 3ZC0A 3WI3A 3CWZB 1FIOA 4KUMB 2V7IA 4QXCB 4DR1T 5ABFB 5FL0A 3MK7C 4P1NA 2X0LB 3LK2B 1UURA 4QKNA 2HN1A 2XASB 2CMRA 1UUSA 3TLTA 4DO0A 2Y8DA 3ZMVB 4HKAA 1HR0T 3FBLA 1HNZT 2KMFA 4TN7B 2DHRA 5EK3A 1XNQT 5JH7E 3RIUC 5BMVE 3I0OA 2OA5A 3NRXA 4ILUA 5TAOA 5JR9C 4V1Av 3RYHE 5IUXA 2XQYA 5AQIB 4AKGA 1J5WA 4HFHA 4IDNA 5FKYA 4DMVA 5LGTB 5J2TE 2IC6A 4GKKT 1T72A 2QGSA 4U33A 2Y48B 4IDPA 3ZSSA 2E9XC 3D0TA 4TV9E 2E9XD 3TLSA 4AISA 4WBNE 4YFSA 4JI2T 2ZM6T 4DUZT 4B3TT 1N32T 4B6XA 4X65T 3AAEB 2XSBA 3KVAA 4U7IA 1IJ5A 2Q9QA 3FZMB 2VKJA 3EDUA 2E9XA 3GN5A 3PUXF 4FJOA 4IDZA 4L5GA 3ZEFB 4X66T 2K3WA 3LFMA 2LT3A 3SFEA 3JADA 4QHOA 2Q9QD 2RP4A 2XAHB 3OKQA 2W66A 5HYAA 2A9UA 2DNXA 3RIFA 1W0AA 4ZI7E 1HCIA 2XHEB 5JR9A 2W4XA 4DV3T 1XNRT 4AQYT 3BK9A 4IHJE 4AIUA 2MPKA 3N9QA 3PUGA 4DUYT 1OEDE 2ZM0A 4LMLA 1H7CA 2UXNB 1GQEA 2M6BA 4IT4A 3ZT7A 1N34T 4MLKA 5FMNA 2Q9QC 4HE8A 4UR9A 3LSVA 3E0ZA 3UT5E 4HWFA 2NTXA 2VVSA 4J2CA 3ZCIA 2LLYA 3RKOA 5LJNA 2BKPA 3OYXA 1XWMA 3KV6A 3AEGA 1YD8G 4G63A 3KFWX 4IE4A 4CI1B 2E5LT 4JV5T 2BG9C 2JJ9A 4FI5A 4ZI2C 3OJAA 4WYVA 3ZMUB 3QB5A 2CRBA 4UV8B 3ANWA 5IWAT 4P0AA 3N2OA 4IGUA 2L9QA 1UCUA 3CX7B 3ZYLA 3PDYA 2XQ6A 3HKDE 5CFBA 2XY8B 2FBWA 3IA3A 4U74A 4WNKA 5FXZA 3VRBA 4CN1A 5LG3A 4DV5T 3I9WA 3RLFF 1NEKA 2XPKA 4JI4T 1LVFA 3NBXX 1MNDA 3CK6A 3AEEA 3ZN0B 1KEYA 2ODVA 3HA4A 3CVRA 3KBTA 3U3IA 3L8RA 4IE7A 2I59A 5AQMB 4PJLA 3KV5A 3ZPOA 3AE2A 4UVAB 4BA9A 1D0XA 3CKDA 4H9OC 4K0UA 4QH5A 4QXBB 1MIVA 2X51A 4IIJE 2QRXA 4QH4A 4UELA 4UVCB 2XZEA 4OFZA 5ABHA 3O4XE 1EZ3A 3M3ZB 1FJGT 3Q5EA 4DVDA 1CUNA 1D1CA 5HEHA 2LKGA 1G8XA 1WFDA 2DWGA 2WCAA 3HKBE 3N9LA 4YY3T 3M65A 2V6XA 5AFUL 4DBRA 3F2EA 1IAPA 2CHNA 5LMUT 5CB4E 3IHRA 4NPPA 3CMLA 4TV8E 5DQVA 5FVLA 1UX5A 3QK6A 2EHOA 4X1IE 4YTNA 2XTLA 4A5XA 3CQCB 3AVSA 3H3AA 3VKGA 1Y01A 4LF4T 1UGOA 5HCMA 4PJNA 4H9PC 2V8SV 3ZMTB 4JI8T 3FXEB 4EYYR 4I55E 4ZI3C 3VRAA 1LRZA 4YSZA 2BBHA 2WDQA 4LF5T 5LBMA 3T8OA 2VQET 5A1LA 3NRYA 2MAWA 4AKLA 2XQAA 4ZXLA 3WAJA 2VKOA 4CN4A 2UUBT 1OEDA 2XAJB 4O4JE 3CIRA 4XAXB 1I94T 2IIUA 2F4VT 4YLHA 1T98A 1ZKEA 2WAUA 3AE3A 3KV4A 2CA5A 5AQPB 4EZ4A 3AEAA 4C91A 3LBXA 4JI5T 4NXNT 4JBWF 3U78A 2D0UA 3UFEA 1X9BA 4ZHQE 2YKSA 1HG2A 1B7TA 5F3JA 2CHOA 5FY0A 1KFYA 2A2FX 5H6RB 4AI6A 3C64A 2K9AA 5AQGB 3RYCE 4I4TE 2LSIA 1YW0A 3QUJA 4X1KE 5AQQB 2X67A 3EAMA 1O3XA 4ZZBA 4KHPT 3ONJA 2V5DA 5CJ5A 3UQ4A 2BS4A 2PG8A 1HFAA 4HFIA 4ILBA 5HEUA 5L3DB 4DNDA 4AKRB 1KNRA 3AE4A 5L3GB 4L9IA 1X79A 3V5SA 3ZJ1A 3IBPA 5LP6E 3PU3A 3MZKB 2Q9QB 4NUUA 3J9X1 1IBKT 3AE5A 5AQLB 1YQ3A 3QOFA 4DR6T 4EB6E 2H89A 3HKCE 4IDOA 3RYFE 4EYUA 4IDQA 1MMGA 4TWDA 3RPUA 4ZI2D 4DV6T 5LHHB 4HWHA 1WYBA 2W00A 2XSAA 1J1JA 4O2BE 5L3BB 3C4ZA 3AA7B 2VL8A 3ONLC 2MOZA 4LF6T 5AQKB 3DJBA 4ZEYA 4HN9A 1WR0A 5F8PA 3LBXB 5LHIB 2DLRA 1VCTA 3IEEA 2BVMA 1HG5A 2UXBT 2YINA 1Z8UA 2H7VC 3LK42 2ZLYA 3PTRB 5E0OA 4H63H 5FXXA 3RKGA 4HFDA 2WZHA 5JRCB 2IW5B 4NIQA 3HR0A 3P50A 2ACXA 3UUXB 1M62A 1HTJF 2XAQB 3GA8A 2M6IA 5BR8T 4GYSA 4CXXA 3RQWA 2KNDA 4ANJA 4UEMA 2DCFA 5ADXL 3KV9A 5FVKA 1ZP0A 2N1GA 2X0HA 4IL9A 3TLVA 2CE7A 2UU9T 3HKEE 3SWHA 4Z91A 3NZQA 3ZSTA 3PUQA 3FB2A 4H63V 1US7B 4TNWA 5C3JA 2V6YB 2GK9A 3WAKA 2CXFA 3C50A 3L3PA 4X20E 3KINB 2L8KA 4X1YE 4EAHA 3IF8B 4KP3C 4DIDB 1NWMX 2X66A 2BKOA 1QUUA 2BS2A 3DTOA 2LHNA 4QX7B 2BG9E 3B57A 4YSYA 1S94A 1SHZC 2K48A 4Z90A 4O4LE 3LK3B 5AQRB 4PK4A 2XJ7A 3I9YA 3O9XA 2V7LA 2KZ7B 5J0ZA 1SUMB 4U2YA 2DWKA 3UFGA 1YKEB 2X68A 4XBFB 5L2LA 2A72A 4YSXA 4EIWA 3K3NA 1KF6A 5LJMA 4PFPA 2NW8A 3T1HT 2DL1A 2V5CA 3A8YC 4OK0A 3OYZA 4GYRA 1OEDC 2WWUA 5AQSB 3ZYMA 2X9WA 4EGWA 5JDLA 1E1HB 3P4SA 1VOMA 4U72A 5JDFA 5JTGA 2P9BA 2D5UA 2J4GA 2W62A 4NXMT 2EHOD 5HXSA 3ZT5A 3C98B 4DV0T 2WM9A 5HAXA 1NENA 5FXVA 4GKJT 2YN6A 3F31A 2JRKA 4E7SA 4MHCA 4WZXA 3MKDA 3FHNA 4XZCA 2A3DA 2LOPA 2W2UA 3EVYA 3FXDB 3K3OA 2KLQA 2SPCA 4ERRA 2XQ3A 2CLYC 4Q25A 1WR6A 3PUYF 2C5KT 2OLTA 2IDOB 2W61A 4ZOLE 2VQFT 3AA6B 4DV7T 4UIGA 3B5MA 1E2AA 2KT9A 3H3MA 3ONXA 4A56A 2PBIA 1OXZA 2X9YA 5KXJA 4AKIA 3GN5B 5HEJA 3CQGB 2FUPA 4LFBT 4DR5T 4JI3T 2LJLA 2RA1A 4AQGA 3NWIA 3RX6A 2YDRA 2BG9A 2LSKA 2VL0A 2E5VA 1XMQT 2VK9A 4JLEA 5M4YA 2XQ5A 4UF0B 2NOXA 3MACA 5AQOB 1KNPA 4YHHT 4E7ZA 4IE5A 5LNKA 4EXTA 4GOUA 4JI7T 2WZIA 3Q9DA 2BBJA 4A98A 3JC6C 2UXCT 3Q2MA 1KNZA 3EI0A 3O1IA 4O2AE 3UULA 4CI3B 4PK5A 4OYJA 1VRBA 2LOSA 3TLWA 3ZMZB 2VWAA 3I1AA 5HEGA 4HEAA 3PURA 3PU8A 5HXEA 2IAKA 2VKDA 5DQWA 3ZN1B 4I43B 5F5WA 2K24A 5HXCA 2QYWA 2L3LA 3OPCA 2HH7A 4MBQA 1YQ4A 4LFAT 4HWCA 4MFRA 3UUBA 4OX9T 2X0YA 4O8SA 5DJQC 4IREA 4HTEA 2CWOA 2KINB 1HNWT 3FZLB 4GIWA 2CPTA 5ETWA 4U7YA 2V7MA 2WS3A 2WB5A 4HFVA 1Y64B 3MJXA 2OV9A 2R6GF 3K8PC 3LJCA 4TWFA 1MMNA 5LB7B 1J5ET 2JQKA 4AQFA 2Z6EA 1Z0PA 3VR9A 4LMKA 3X1DA 3I0QA 5LYJE 2VURA 2LSYA 3RRWA 3UU6A 3KBUA 4UF0A 4LMJA 3ZCJA 1OWAA 2NR4A 3TLUA 1BR1A 3L39A 5DABA 4AQFC 5LXTE 1IBMT 2V7JA 2XAGB 4JEHB 1HX1B 2NTYA 2CXDA 2C5IT 2WDRA 4PAGA 1MIYA 3NVOA 1ZHCA 4EEDA 2LM2A 3EHZA 2ES0A 2NW7A 2W0GA 3CX8B 3P7IA 1HX8A 4K0KT 2BVLA 2W63A 3NZPA 2MBGA 3ZMSB 1QLBA 3F57A 3RI5A 4EOZB 4Z8XA 5FNVE 2IHR1 3PUSA 2YDQA 4I0UA 3UQ7A 3R6NA 3KDSE 2KSRA 1MNEA 3HL6A 5AQNB 3P4WA 2BZBA 4BAYB 3K3QC 1U5PA 4ZS2A 3UU5A 2H88A 4JUYA 4BJNA 2EHOB 1W9RA 4YTMA 3H37A 3ZT6A 4ADZA 3RF1A 5FY1A 1MIWA 4KBMB 1LKXA 1JNRA 1YKHB 4MALA 2J1DG 4U2ZA 5EK4A 2B1EA 3RIUA 2JIWA 5LBQB 4YJ2E 1IJ6A 4JEUB 3OTOT 5EK2A 4YJ3E 2AXDS 4LF8T 1LVKA 3AE9A 5FY7A 1CHUA 2E9XB 5LHGB 1XZYA 3FZKB 2WBLA 3C51A 3SFDA 3UU4A 3VHLA 3W15B 4H9SE 4A97A 4DV2T 5JDHA 2N9DA 3FZHB 3JC6D 4DV4T 3PUVF 3RIAA 2VVNA 2YK0A 3N9MA 2H3RA 3AVRA 4WBOA 4F6RC 3QNUA 2E2AA 3LG7A 2FJEA 2JQ9A 2YU1A 2HPLA 3MXZA 3G06A 2X9HA 4HWIB 3SRZA 4IE6A 2UUAT 2IC9A 3GWHA 3O1HA 3OVUA 1XDPA 2H7OA 4JI0T 2FJBA 4CXYA 3N2KE 3PUWF 4TUYE 4DR2T 1HS7A 4B3ST 2UXXB 4KI0F 3N9NA 2NW9A 2YU2A 3RGLA 2LRKA 3P8CD 4QWNB 4TNVA 1D0YA 2YDSA 2BKNA 3A5XA 2CBIA 3DP7A 4CN6A 3O1JA 1BR0A 5JVDE 2XAFB 3B13A 5ABGA 4B3MT 2YEVC 3ESLA 3JAEA 1L0VA 5FP3A 5CGMA 4QH1A 2ZM2A 2V1DB 3NKZA 4QXHB 5EZYE 4KX6A 2I6HA 3ZC1A 5C2TA 4H9QC 4L0RA 2JPFA 1NAFA 2WP9A 1D1AA 3RRCA 1VCSA 5GONE 3UUNA 2AE9A 2X9XA 4GK5E
chains in the Genus database with same CATH topology
3ZSSA 2DL1A 2XZEA 4U31A 3ZSTA 3K1SA 2JQHA 2V6YB 2CPTA 2CRBA 1WCRA 4U7IA 1WFDA 4U7YA 3ZT6A 2V6XA 2LRKA 2WY2A 2K3WA 3ZT5A 4U2ZA 5LB7B 5FVLA 2JQKA 2V6YA 4P1NA 1WR0A 4CN4A 4CN6A 4ZEYA 2WWVA 2A9UA 4CN1A 4A5XA 4WZXA 2W2UA 2MPKA 5CGMA 5CJ5A 3EABA 4NIQA 4IT4A 3ZT7A 4U2YA 2RPAA 2JQ9A 4U3CA 5FVKA 2LRLA 1YXRA 4U33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSS A;  2DL1 A;  2XZE A;  4U31 A;  3ZST A;  3K1S A;  2JQH A;  2V6Y B;  2CPT A;  2CRB A;  1WCR A;  4U7I A;  1WFD A;  4U7Y A;  3ZT6 A;  2V6X A;  2LRK A;  2WY2 A;  2K3W A;  3ZT5 A;  4U2Z A;  5LB7 B;  5FVL A;  2JQK A;  2V6Y A;  4P1N A;  1WR0 A;  4CN4 A;  4CN6 A;  4ZEY A;  2WWV A;  2A9U A;  4CN1 A;  4A5X A;  4WZX A;  2W2U A;  2MPK A;  5CGM A;  5CJ5 A;  3EAB A;  4NIQ A;  4IT4 A;  3ZT7 A;  4U2Y A;  2RPA A;  2JQ9 A;  4U3C A;  5FVK A;  2LRL A;  1YXR A;  4U33 A; 
#chains in the Genus database with same CATH topology
 4YT0 A;  2HN2 A;  3N2G E;  4PJJ A;  4PFO A;  2CEA A;  3E22 E;  2C0S A;  4DBQ A;  1ZEE A;  4JYA T;  3ETV A;  3AA0 B;  2UXD T;  1MMA A;  3FBZ A;  3VU7 H;  1D1B A;  2PJQ A;  3AEB A;  3Q5X A;  4EEB A;  2KWI B;  3N9P A;  5C8Y E;  4WW0 A;  4LF7 T;  4F8H A;  4YXD A;  5KX5 E;  4PK6 A;  2K5B B;  4IL4 A;  4CQI A;  5JRC A;  3ABV A;  1KK7 A;  2CCQ A;  2CWY A;  2NP9 A;  2BG9 B;  5LGN B;  1SE7 A;  1SA0 E;  3N5L A;  4AXP A;  2UUC T;  3AE8 A;  1G73 A;  5L3C B;  5ABF A;  2FJA A;  2ZMA A;  1R8I A;  3EAB A;  5AQH B;  1U4Q A;  2V26 A;  3CX6 B;  2D0T A;  3JCF A;  3Q5D A;  4ISS A;  4ZS3 A;  3T1Y T;  4JI6 T;  4LF9 T;  2YOE A;  2FJD A;  3P4P A;  3J7Y q;  4HWD A;  1XMO T;  5J1G A;  3LDQ B;  5IYZ E;  3ETU A;  2LRL A;  1JNZ A;  2JQQ A;  2QA7 A;  3AEF A;  3EUH A;  4O4H E;  3UUM A;  3UU3 A;  3N9O A;  4X64 T;  4M1P A;  4U31 A;  4COF A;  2B76 A;  2VB6 A;  3K1S A;  2N2N A;  3RQU A;  3RYI E;  3QB5 K;  3C4X A;  2C5J A;  4G2A A;  2MTQ A;  4EV6 A;  2HHH T;  2JMK A;  2WY2 A;  3P4Q A;  1N36 T;  3E08 A;  1IZN B;  2CM0 A;  3UTK A;  1QSD A;  3JAF A;  4X62 T;  2LM9 A;  3GMI A;  4H9R C;  3AXJ B;  1WYC A;  2CBJ A;  4DR4 T;  4UXN B;  4P0B A;  2DI4 A;  3AEC A;  5CA1 E;  4DR3 T;  4KHZ F;  2XM1 A;  3L09 A;  1HNX T;  5AQT B;  3AAI A;  3PUA A;  4GK0 E;  3AED A;  4ZZC A;  1HF8 A;  2JMH A;  2XQ4 A;  3PJA A;  4TWH A;  1FMW A;  2HPJ A;  3PJA J;  5JDQ A;  1FEW A;  5CA0 E;  2LHR A;  3A7M A;  5AQF B;  3PUZ F;  4DMW A;  5JR9 B;  3AA1 B;  3VR8 A;  1N33 T;  3AE6 A;  4CZZ B;  1AJ3 A;  3PE0 A;  3BQL A;  1ZOY A;  4BJM A;  2PTF A;  1BR4 A;  2J47 A;  4PJM A;  4HFE A;  2XUE A;  2ZM8 A;  4I50 E;  5AQU B;  3KVB A;  5JDG A;  2JQH A;  5IHY A;  4X5T A;  1WCR A;  1V9D A;  3FZF B;  3Q5W A;  1W09 A;  5LOV E;  4QX8 B;  5L4H A;  5H6Q B;  3BQK A;  2G0U A;  3QC9 A;  4ZI3 D;  2KXP B;  2LSJ A;  2V7K A;  3RC3 A;  3HI2 A;  2ODU A;  2QVA A;  5HXR A;  3RH3 A;  2NWB A;  3ANW B;  2WWV A;  3S4U A;  5HWX A;  5HWY A;  2I0M A;  1UX4 A;  5AQJ B;  4PNI A;  5KDM C;  2VAS A;  2MYS A;  4C90 A;  5J2U E;  4JI1 T;  2LE8 A;  3AXJ A;  4ILC A;  1MMD A;  2M67 A;  1D0Z A;  5AQV B;  4DR7 T;  2J62 A;  2XQ7 A;  4PW8 A;  5L47 A;  2XQ8 A;  3AB3 B;  2WDV A;  3C4W A;  4ASK A;  2RPA A;  3P4R A;  4N78 D;  5L3E B;  5JDN A;  5L4E A;  3R84 B;  5FYM A;  5LCY A;  5ABE A;  1YXR A;  2IML A;  3RHW A;  4YTP A;  1UK5 A;  2WU5 A;  4KMC A;  4CI2 B;  4B3R T;  1WRD A;  4CXW A;  4P09 A;  2WU2 A;  5LA6 E;  2LEH A;  4IE0 A;  5JRE A;  2W67 A;  3AE7 A;  1IBL T;  5HXH A;  1T7S A;  4NUV A;  4UV9 B;  3RC8 A;  4UVB B;  1ZV4 X;  2ACZ A;  1M7K A;  1XDO A;  2IUB A;  2KWH A;  2WMN A;  2BDE A;  2Y6X A;  2WQY A;  3EDV A;  2PFV A;  4TX5 A;  3SOL A;  5LMN T;  4AKH A;  1BR2 A;  4HGA A;  2V6Y A;  3CPZ A;  1WLX A;  3TKL B;  5JDM A;  2WMO A;  2XM2 A;  4H9N C;  3AAA B;  3BQI A;  2LSG A;  3V5U A;  3ZKR A;  1FMV A;  4OHF A;  2EHO C;  3SS1 A;  5KMG P;  2CLY B;  4IST A;  1OED B;  5HEO A;  2E8I A;  3UU8 A;  5L3F B;  2CXL A;  4HFC A;  2XQ9 A;  3CQX C;  4O4I E;  1S35 A;  4ILA A;  4OYK A;  5LGU B;  1I6Z A;  2LKH A;  2D2S A;  2WSS V;  1DU2 A;  3MA9 A;  4U3C A;  3ZLI A;  4EZH A;  2BS3 A;  5FXW A;  5JQG E;  1W0B A;  1E7P A;  1T8B A;  4TZ4 C;  2D9D A;  2VKH A;  4YHJ A;  5LG4 A;  3PV0 F;  4LFC T;  3VKH A;  4DV1 T;  4HFB A;  3ZYK A;  5HCJ A;  3ZJ2 A;  3OBV E;  3AE1 A;  5FL1 A;  3ZC0 A;  3WI3 A;  3CWZ B;  1FIO A;  4KUM B;  2V7I A;  4QXC B;  4DR1 T;  5ABF B;  5FL0 A;  3MK7 C;  4P1N A;  2X0L B;  3LK2 B;  1UUR A;  4QKN A;  2HN1 A;  2XAS B;  2CMR A;  1UUS A;  3TLT A;  4DO0 A;  2Y8D A;  3ZMV B;  4HKA A;  1HR0 T;  3FBL A;  1HNZ T;  2KMF A;  4TN7 B;  2DHR A;  5EK3 A;  1XNQ T;  5JH7 E;  3RIU C;  5BMV E;  3I0O A;  2OA5 A;  3NRX A;  4ILU A;  5TAO A;  5JR9 C;  4V1A v;  3RYH E;  5IUX A;  2XQY A;  5AQI B;  4AKG A;  1J5W A;  4HFH A;  4IDN A;  5FKY A;  4DMV A;  5LGT B;  5J2T E;  2IC6 A;  4GKK T;  1T72 A;  2QGS A;  4U33 A;  2Y48 B;  4IDP A;  3ZSS A;  2E9X C;  3D0T A;  4TV9 E;  2E9X D;  3TLS A;  4AIS A;  4WBN E;  4YFS A;  4JI2 T;  2ZM6 T;  4DUZ T;  4B3T T;  1N32 T;  4B6X A;  4X65 T;  3AAE B;  2XSB A;  3KVA A;  4U7I A;  1IJ5 A;  2Q9Q A;  3FZM B;  2VKJ A;  3EDU A;  2E9X A;  3GN5 A;  3PUX F;  4FJO A;  4IDZ A;  4L5G A;  3ZEF B;  4X66 T;  2K3W A;  3LFM A;  2LT3 A;  3SFE A;  3JAD A;  4QHO A;  2Q9Q D;  2RP4 A;  2XAH B;  3OKQ A;  2W66 A;  5HYA A;  2A9U A;  2DNX A;  3RIF A;  1W0A A;  4ZI7 E;  1HCI A;  2XHE B;  5JR9 A;  2W4X A;  4DV3 T;  1XNR T;  4AQY T;  3BK9 A;  4IHJ E;  4AIU A;  2MPK A;  3N9Q A;  3PUG A;  4DUY T;  1OED E;  2ZM0 A;  4LML A;  1H7C A;  2UXN B;  1GQE A;  2M6B A;  4IT4 A;  3ZT7 A;  1N34 T;  4MLK A;  5FMN A;  2Q9Q C;  4HE8 A;  4UR9 A;  3LSV A;  3E0Z A;  3UT5 E;  4HWF A;  2NTX A;  2VVS A;  4J2C A;  3ZCI A;  2LLY A;  3RKO A;  5LJN A;  2BKP A;  3OYX A;  1XWM A;  3KV6 A;  3AEG A;  1YD8 G;  4G63 A;  3KFW X;  4IE4 A;  4CI1 B;  2E5L T;  4JV5 T;  2BG9 C;  2JJ9 A;  4FI5 A;  4ZI2 C;  3OJA A;  4WYV A;  3ZMU B;  3QB5 A;  2CRB A;  4UV8 B;  3ANW A;  5IWA T;  4P0A A;  3N2O A;  4IGU A;  2L9Q A;  1UCU A;  3CX7 B;  3ZYL A;  3PDY A;  2XQ6 A;  3HKD E;  5CFB A;  2XY8 B;  2FBW A;  3IA3 A;  4U74 A;  4WNK A;  5FXZ A;  3VRB A;  4CN1 A;  5LG3 A;  4DV5 T;  3I9W A;  3RLF F;  1NEK A;  2XPK A;  4JI4 T;  1LVF A;  3NBX X;  1MND A;  3CK6 A;  3AEE A;  3ZN0 B;  1KEY A;  2ODV A;  3HA4 A;  3CVR A;  3KBT A;  3U3I A;  3L8R A;  4IE7 A;  2I59 A;  5AQM B;  4PJL A;  3KV5 A;  3ZPO A;  3AE2 A;  4UVA B;  4BA9 A;  1D0X A;  3CKD A;  4H9O C;  4K0U A;  4QH5 A;  4QXB B;  1MIV A;  2X51 A;  4IIJ E;  2QRX A;  4QH4 A;  4UEL A;  4UVC B;  2XZE A;  4OFZ A;  5ABH A;  3O4X E;  1EZ3 A;  3M3Z B;  1FJG T;  3Q5E A;  4DVD A;  1CUN A;  1D1C A;  5HEH A;  2LKG A;  1G8X A;  1WFD A;  2DWG A;  2WCA A;  3HKB E;  3N9L A;  4YY3 T;  3M65 A;  2V6X A;  5AFU L;  4DBR A;  3F2E A;  1IAP A;  2CHN A;  5LMU T;  5CB4 E;  3IHR A;  4NPP A;  3CML A;  4TV8 E;  5DQV A;  5FVL A;  1UX5 A;  3QK6 A;  2EHO A;  4X1I E;  4YTN A;  2XTL A;  4A5X A;  3CQC B;  3AVS A;  3H3A A;  3VKG A;  1Y01 A;  4LF4 T;  1UGO A;  5HCM A;  4PJN A;  4H9P C;  2V8S V;  3ZMT B;  4JI8 T;  3FXE B;  4EYY R;  4I55 E;  4ZI3 C;  3VRA A;  1LRZ A;  4YSZ A;  2BBH A;  2WDQ A;  4LF5 T;  5LBM A;  3T8O A;  2VQE T;  5A1L A;  3NRY A;  2MAW A;  4AKL A;  2XQA A;  4ZXL A;  3WAJ A;  2VKO A;  4CN4 A;  2UUB T;  1OED A;  2XAJ B;  4O4J E;  3CIR A;  4XAX B;  1I94 T;  2IIU A;  2F4V T;  4YLH A;  1T98 A;  1ZKE A;  2WAU A;  3AE3 A;  3KV4 A;  2CA5 A;  5AQP B;  4EZ4 A;  3AEA A;  4C91 A;  3LBX A;  4JI5 T;  4NXN T;  4JBW F;  3U78 A;  2D0U A;  3UFE A;  1X9B A;  4ZHQ E;  2YKS A;  1HG2 A;  1B7T A;  5F3J A;  2CHO A;  5FY0 A;  1KFY A;  2A2F X;  5H6R B;  4AI6 A;  3C64 A;  2K9A A;  5AQG B;  3RYC E;  4I4T E;  2LSI A;  1YW0 A;  3QUJ A;  4X1K E;  5AQQ B;  2X67 A;  3EAM A;  1O3X A;  4ZZB A;  4KHP T;  3ONJ A;  2V5D A;  5CJ5 A;  3UQ4 A;  2BS4 A;  2PG8 A;  1HFA A;  4HFI A;  4ILB A;  5HEU A;  5L3D B;  4DND A;  4AKR B;  1KNR A;  3AE4 A;  5L3G B;  4L9I A;  1X79 A;  3V5S A;  3ZJ1 A;  3IBP A;  5LP6 E;  3PU3 A;  3MZK B;  2Q9Q B;  4NUU A;  3J9X 1;  1IBK T;  3AE5 A;  5AQL B;  1YQ3 A;  3QOF A;  4DR6 T;  4EB6 E;  2H89 A;  3HKC E;  4IDO A;  3RYF E;  4EYU A;  4IDQ A;  1MMG A;  4TWD A;  3RPU A;  4ZI2 D;  4DV6 T;  5LHH B;  4HWH A;  1WYB A;  2W00 A;  2XSA A;  1J1J A;  4O2B E;  5L3B B;  3C4Z A;  3AA7 B;  2VL8 A;  3ONL C;  2MOZ A;  4LF6 T;  5AQK B;  3DJB A;  4ZEY A;  4HN9 A;  1WR0 A;  5F8P A;  3LBX B;  5LHI B;  2DLR A;  1VCT A;  3IEE A;  2BVM A;  1HG5 A;  2UXB T;  2YIN A;  1Z8U A;  2H7V C;  3LK4 2;  2ZLY A;  3PTR B;  5E0O A;  4H63 H;  5FXX A;  3RKG A;  4HFD A;  2WZH A;  5JRC B;  2IW5 B;  4NIQ A;  3HR0 A;  3P50 A;  2ACX A;  3UUX B;  1M62 A;  1HTJ F;  2XAQ B;  3GA8 A;  2M6I A;  5BR8 T;  4GYS A;  4CXX A;  3RQW A;  2KND A;  4ANJ A;  4UEM A;  2DCF A;  5ADX L;  3KV9 A;  5FVK A;  1ZP0 A;  2N1G A;  2X0H A;  4IL9 A;  3TLV A;  2CE7 A;  2UU9 T;  3HKE E;  3SWH A;  4Z91 A;  3NZQ A;  3ZST A;  3PUQ A;  3FB2 A;  4H63 V;  1US7 B;  4TNW A;  5C3J A;  2V6Y B;  2GK9 A;  3WAK A;  2CXF A;  3C50 A;  3L3P A;  4X20 E;  3KIN B;  2L8K A;  4X1Y E;  4EAH A;  3IF8 B;  4KP3 C;  4DID B;  1NWM X;  2X66 A;  2BKO A;  1QUU A;  2BS2 A;  3DTO A;  2LHN A;  4QX7 B;  2BG9 E;  3B57 A;  4YSY A;  1S94 A;  1SHZ C;  2K48 A;  4Z90 A;  4O4L E;  3LK3 B;  5AQR B;  4PK4 A;  2XJ7 A;  3I9Y A;  3O9X A;  2V7L A;  2KZ7 B;  5J0Z A;  1SUM B;  4U2Y A;  2DWK A;  3UFG A;  1YKE B;  2X68 A;  4XBF B;  5L2L A;  2A72 A;  4YSX A;  4EIW A;  3K3N A;  1KF6 A;  5LJM A;  4PFP A;  2NW8 A;  3T1H T;  2DL1 A;  2V5C A;  3A8Y C;  4OK0 A;  3OYZ A;  4GYR A;  1OED C;  2WWU A;  5AQS B;  3ZYM A;  2X9W A;  4EGW A;  5JDL A;  1E1H B;  3P4S A;  1VOM A;  4U72 A;  5JDF A;  5JTG A;  2P9B A;  2D5U A;  2J4G A;  2W62 A;  4NXM T;  2EHO D;  5HXS A;  3ZT5 A;  3C98 B;  4DV0 T;  2WM9 A;  5HAX A;  1NEN A;  5FXV A;  4GKJ T;  2YN6 A;  3F31 A;  2JRK A;  4E7S A;  4MHC A;  4WZX A;  3MKD A;  3FHN A;  4XZC A;  2A3D A;  2LOP A;  2W2U A;  3EVY A;  3FXD B;  3K3O A;  2KLQ A;  2SPC A;  4ERR A;  2XQ3 A;  2CLY C;  4Q25 A;  1WR6 A;  3PUY F;  2C5K T;  2OLT A;  2IDO B;  2W61 A;  4ZOL E;  2VQF T;  3AA6 B;  4DV7 T;  4UIG A;  3B5M A;  1E2A A;  2KT9 A;  3H3M A;  3ONX A;  4A56 A;  2PBI A;  1OXZ A;  2X9Y A;  5KXJ A;  4AKI A;  3GN5 B;  5HEJ A;  3CQG B;  2FUP A;  4LFB T;  4DR5 T;  4JI3 T;  2LJL A;  2RA1 A;  4AQG A;  3NWI A;  3RX6 A;  2YDR A;  2BG9 A;  2LSK A;  2VL0 A;  2E5V A;  1XMQ T;  2VK9 A;  4JLE A;  5M4Y A;  2XQ5 A;  4UF0 B;  2NOX A;  3MAC A;  5AQO B;  1KNP A;  4YHH T;  4E7Z A;  4IE5 A;  5LNK A;  4EXT A;  4GOU A;  4JI7 T;  2WZI A;  3Q9D A;  2BBJ A;  4A98 A;  3JC6 C;  2UXC T;  3Q2M A;  1KNZ A;  3EI0 A;  3O1I A;  4O2A E;  3UUL A;  4CI3 B;  4PK5 A;  4OYJ A;  1VRB A;  2LOS A;  3TLW A;  3ZMZ B;  2VWA A;  3I1A A;  5HEG A;  4HEA A;  3PUR A;  3PU8 A;  5HXE A;  2IAK A;  2VKD A;  5DQW A;  3ZN1 B;  4I43 B;  5F5W A;  2K24 A;  5HXC A;  2QYW A;  2L3L A;  3OPC A;  2HH7 A;  4MBQ A;  1YQ4 A;  4LFA T;  4HWC A;  4MFR A;  3UUB A;  4OX9 T;  2X0Y A;  4O8S A;  5DJQ C;  4IRE A;  4HTE A;  2CWO A;  2KIN B;  1HNW T;  3FZL B;  4GIW A;  2CPT A;  5ETW A;  4U7Y A;  2V7M A;  2WS3 A;  2WB5 A;  4HFV A;  1Y64 B;  3MJX A;  2OV9 A;  2R6G F;  3K8P C;  3LJC A;  4TWF A;  1MMN A;  5LB7 B;  1J5E T;  2JQK A;  4AQF A;  2Z6E A;  1Z0P A;  3VR9 A;  4LMK A;  3X1D A;  3I0Q A;  5LYJ E;  2VUR A;  2LSY A;  3RRW A;  3UU6 A;  3KBU A;  4UF0 A;  4LMJ A;  3ZCJ A;  1OWA A;  2NR4 A;  3TLU A;  1BR1 A;  3L39 A;  5DAB A;  4AQF C;  5LXT E;  1IBM T;  2V7J A;  2XAG B;  4JEH B;  1HX1 B;  2NTY A;  2CXD A;  2C5I T;  2WDR A;  4PAG A;  1MIY A;  3NVO A;  1ZHC A;  4EED A;  2LM2 A;  3EHZ A;  2ES0 A;  2NW7 A;  2W0G A;  3CX8 B;  3P7I A;  1HX8 A;  4K0K T;  2BVL A;  2W63 A;  3NZP A;  2MBG A;  3ZMS B;  1QLB A;  3F57 A;  3RI5 A;  4EOZ B;  4Z8X A;  5FNV E;  2IHR 1;  3PUS A;  2YDQ A;  4I0U A;  3UQ7 A;  3R6N A;  3KDS E;  2KSR A;  1MNE A;  3HL6 A;  5AQN B;  3P4W A;  2BZB A;  4BAY B;  3K3Q C;  1U5P A;  4ZS2 A;  3UU5 A;  2H88 A;  4JUY A;  4BJN A;  2EHO B;  1W9R A;  4YTM A;  3H37 A;  3ZT6 A;  4ADZ A;  3RF1 A;  5FY1 A;  1MIW A;  4KBM B;  1LKX A;  1JNR A;  1YKH B;  4MAL A;  2J1D G;  4U2Z A;  5EK4 A;  2B1E A;  3RIU A;  2JIW A;  5LBQ B;  4YJ2 E;  1IJ6 A;  4JEU B;  3OTO T;  5EK2 A;  4YJ3 E;  2AXD S;  4LF8 T;  1LVK A;  3AE9 A;  5FY7 A;  1CHU A;  2E9X B;  5LHG B;  1XZY A;  3FZK B;  2WBL A;  3C51 A;  3SFD A;  3UU4 A;  3VHL A;  3W15 B;  4H9S E;  4A97 A;  4DV2 T;  5JDH A;  2N9D A;  3FZH B;  3JC6 D;  4DV4 T;  3PUV F;  3RIA A;  2VVN A;  2YK0 A;  3N9M A;  2H3R A;  3AVR A;  4WBO A;  4F6R C;  3QNU A;  2E2A A;  3LG7 A;  2FJE A;  2JQ9 A;  2YU1 A;  2HPL A;  3MXZ A;  3G06 A;  2X9H A;  4HWI B;  3SRZ A;  4IE6 A;  2UUA T;  2IC9 A;  3GWH A;  3O1H A;  3OVU A;  1XDP A;  2H7O A;  4JI0 T;  2FJB A;  4CXY A;  3N2K E;  3PUW F;  4TUY E;  4DR2 T;  1HS7 A;  4B3S T;  2UXX B;  4KI0 F;  3N9N A;  2NW9 A;  2YU2 A;  3RGL A;  2LRK A;  3P8C D;  4QWN B;  4TNV A;  1D0Y A;  2YDS A;  2BKN A;  3A5X A;  2CBI A;  3DP7 A;  4CN6 A;  3O1J A;  1BR0 A;  5JVD E;  2XAF B;  3B13 A;  5ABG A;  4B3M T;  2YEV C;  3ESL A;  3JAE A;  1L0V A;  5FP3 A;  5CGM A;  4QH1 A;  2ZM2 A;  2V1D B;  3NKZ A;  4QXH B;  5EZY E;  4KX6 A;  2I6H A;  3ZC1 A;  5C2T A;  4H9Q C;  4L0R A;  2JPF A;  1NAF A;  2WP9 A;  1D1A A;  3RRC A;  1VCS A;  5GON E;  3UUN A;  2AE9 A;  2X9X A;  4GK5 E; 
#chains in the Genus database with same CATH homology
 3ZSS A;  2DL1 A;  2XZE A;  4U31 A;  3ZST A;  3K1S A;  2JQH A;  2V6Y B;  2CPT A;  2CRB A;  1WCR A;  4U7I A;  1WFD A;  4U7Y A;  3ZT6 A;  2V6X A;  2LRK A;  2WY2 A;  2K3W A;  3ZT5 A;  4U2Z A;  5LB7 B;  5FVL A;  2JQK A;  2V6Y A;  4P1N A;  1WR0 A;  4CN4 A;  4CN6 A;  4ZEY A;  2WWV A;  2A9U A;  4CN1 A;  4A5X A;  4WZX A;  2W2U A;  2MPK A;  5CGM A;  5CJ5 A;  3EAB A;  4NIQ A;  4IT4 A;  3ZT7 A;  4U2Y A;  2RPA A;  2JQ9 A;  4U3C A;  5FVK A;  2LRL A;  1YXR A;  4U33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...