3EAEA

Pwwp domain of human hepatoma-derived growth factor 2 (hdgf2)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
PHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Hepatoma-derived growth factor-related protein 2
total genus 19
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3eaeA00
1OZ3A 4PLIA 4PL6A 2X4WA 4A4GA 1WJSA 2RHUA 4RG2A 4C5IA 5FRNA 3ASKA 4IUTA 3UT1A 2DIGA 2L8DA 2LVMA 4N4IA 2RI5A 2NLUA 2R58A 4GY5A 4IUUA 2LDMA 2QQSA 3QKJA 3OYEA 2CKKA 2X35A 1WJRA 1WJQA 4BE0A 4NS5A 3S3NA 1WGSA 3OB9A 4IUVA 4PLLA 3P8DA 4BACA 4E7HA 2EFIA 3SD4A 3L42A 2BIVA 3EAEA 4A4HA 3MEAA 3NTIA 2GF7A 3OA6A 3Q1JA 3OYDA 3L2VA 3PFSA 4HCZA 5D6YA 3OMGA 2QQRA 2HQEA 1OZ2A 2RJFA 2X4XA 4LD6A 4QVZA 2P0KA 2DAQA 4C5HA 2BUDA 2XDPA 3ME9A 4UC4A 2GFAA 3PMIA 3QBYA 3C4SA 4IUPA 3L2RA 4E7KA 4ZTFA 3OYCA 3OYHA 2WACA 2O4XB 5FRMA 4E7IA 2LCCA 2M16A 3FC3A 2R5MA 3PNWC 3BDLA 2RI2A 4BE2A 2F5KA 3L2UA 5M9OA 3LGLA 3PMTA 2HQXA 3LGFA 2FHDA 2YRVA 2MWOA 4IUQA 3OYJA 3CEYA 4FL6A 4QQ6A 1H3ZA 3OYBA 4Q5WA 1OI1A 2JTFA 2RJCA 3FDRA 5C6SA 1MHNA 5J39A 1G5VA 2RHZA 3OMCA 2D9TA 4QW2A 1N27A 2XK0A 2EQMA 3MEUA 3L2WA 2EQUA 1XNIA 2O4XA 2X4YA 3OQ5A 2PQWA 2L3RA 2R57A 3LLRA 4IURA 4QQDA 5KCHA 3LYIA 3OS1A 3FEOA 3OYNA 4A4FA 3NTHA 3OS0A 3P8HA 5FROA 4BDYA 4N4HA 2RHXA 4E7JA 4C5GA 4BD3A 1RI0A 4FU6A 4ZTJA 3MEVA 3OYGA 5IN1A 5J26A 4BE1A 2EKOA 5D6XA 2E6NA 4BDZA 4OVAA 2RI3A 3MEWA 3NTKA 5KCOA 2RJEA 3OYMA 3DB4A 3L2QA 2GFUA 3KUFA 3QIIA 3META 1KHCA 2LRQA 5D6WA 2EQKA 5IAYA 3OY9A 2EQJA 2RHIA 2E5QA 3OYFA 4B9XA 4A4EA 3S3MA 1OYXA 3M9QA 2RJDA 2RHYA 2JZ2A 4C5EA 3OYLA 3QJ6A 5KH6A 1SSFA 3OYIA 2MWPA 2R5AA 4IKFA 2G3RA 3E9GA 2M1HA 5C0MA 2DIQA 4N4GA 4QQGA 3ZEHA 4L59A 2RO0A 3OYAA 2B8AA 3LX7A 3S3OA 3DB3A 3UWNA 3E9FA 3MP6A 2M0OA 3F70A 3H6ZA 3MP1A 3S6WA 2K3YA 3MO8A 2IG0A 3OS2A 3FLGA 3MP8A 4Z02A 5KE3A 4E7LA 3DLMA 2BKDN 4II1A 2LTOA 3GOXA 4B9WA 5CIUA 4X34A 3LH0A 4EDUA 4CRIA 2K3XA 2L89A 3H8ZA 3O8VA 3OYKA 2VYTA 5KE2A
chains in the Genus database with same CATH superfamily
2P4RA 3G6EA 2EVRA 4RTXA 2RF0A 4N4IA 2RI5A 4X9CA 3GPLA 2E4HA 1LNXA 2R58A 4IUUA 3VV0A 2DL8A 2QQSA 1N9RA 1PC0A 1KHIA 3HRSA 4M7AF 4A4HA 4OB0B 3CC7Q 1FMKA 4LUEA 4C8QB 2PVGB 3OMGA 1F1BB 4UC4A 3CCJA 4XTVA 3CCEA 1HD3A 1GCQC 4PFZA 1OQKA 1SHGA 4C0ZA 2V8KA 3FC3A 4AFQC 2E1HA 1QCFA 2BZYA 5AT1B 2LP5A 2VGMA 2ZPEB 4PJJA 3QXEB 3CMET 2LQKA 1VQLA 4C8QC 5IH2A 1AT1B 5GAOm 4J7FA 1QVGA 3PIPA 3SHWA 3CD6T 1I4K1 2L3RA 2VXFA 2FYKA 5J3BA 5HK0A 3A5ZB 1RI0A 7AT1B 1MMDA 1XOVA 2DEQA 2LQNA 1YJNQ 1XJWB 1NM7A 2JZ2A 3OYLA 1WI7A 2RPNA 4FSSA 2R5AA 2L0AA 2HCKA 4R56A 4M75C 4EIKA 1NJIR 2KY9A 2C0IA 3OS2A 1QCOA 1IHVA 2BKDN 1N8RR 4XTXA 3UPUA 4X34A 2CP5A 4C8QG 1B07A 4PJOG 1K73C 2LX9A 3GIBA 1GRIA 1K8AU 2EGEA 1YJWT 1Y96A 2BE9B 1NG2A 1RAHB 1UHFA 1ZUUA 2LX7A 1W2BA 1BIBA 1R0BG 1Y57A 4EMKB 4RMOA 1Q82U 5CCAA 3S3NA 4PJLA 4J9FA 2ABLA 2K2VA 4RTYA 2EFIA 3CC4Q 1KQSS 2PVDB 2EJFA 1Q81C 3C0CA 2B86A 4ZGEB 3OA6A 1M3AA 1JEGA 1W6XA 3JV3A 1K1ZA 1YJNA 1M8VA 2D0NA 3JB9G 4ZTFA 1N6AA 2EIFA 8AT1B 1KD1R 3HPWA 2LT4A 1GBQA 3SWNB 1UGPB 1W70A 3FJ5A 2KRSA 1P92A 1VQ5Q 3AT1B 2KE9A 2CSIA 2HNIA 1OEBA 2JTMA 2AIRB 5IHNA 2DJZA 3RIRA 1QLYA 3EGDB 1TOVA 1LCKA 1D09B 3CMEA 3BFMA 4BY6C 2QAZA 3M56A 3OS1A 3OSVA 1EIFA 2NUZA 3NGPA 1OX9A 2YUOA 1WX6A 5LJ3g 3CC4A 5GAN7 4ZTJA 3JCMe 1VYTA 2E6NA 1WZOA 2RI3A 4LNPA 1K9AA 3OY9A 2E5QA 2M02A 5DM7R 1VQKT 1R8OB 1E6HA 3HKSA 4RTWA 2M1HA 3CCMA 4O6JA 4M78A 1NLOC 2X3XD 3UWNA 2DXBA 2O31A 1VQ8A 3M5AA 1YHQQ 2PUKB 4PK4A 4J6XA 2QTXA 3ULRB 1QVFS 4PL6A 2DXCA 3TSWA 2KI7A 4L6V5 1VQ5A 3CCRT 2CH4W 1UGRB 2LDMA 6AT1B 2CKKA 2ZGWA 4MDXA 2AKLA 1YJ9T 4P5NA 5LJ3d 2XICA 1ZBXA 5KYNA 1GFCA 4F16A 2X9HA 3CMEQ 3Q1JA 1PKSA 5CKFA 2K9GA 1HXDA 3DLLA 1IGQA 2DA9A 2XDPA 2QEXT 2YUQA 1ABOA 2ROTA 4DEXA 2M16A 3QDFA 2R5MA 4Y91A 2JMCA 4C0DC 4BE2A 3L2UA 3QZ9B 4PJOF 1WYXA 1LPLA 1UG1A 5GJVB 3QWXX 3EFOA 3SFMA 5FWBA 2XD0A 4PJNA 4HA8A 3CBMA 2QDLA 1OV3A 4BI4A 1RAGB 4BDYA 2VV5A 3UA7A 2PNIA 4C5GA 2EKOA 4OVAA 3MEWA 3NTKA 3OYMA 2F2XA 3CCQQ 3KUFA 1YJNT 2QTVA 4IKFA 1HYOA 2LNHB 4QVDA 4J9HA 1QVGP 1VOMA 3QPHA 3MJXA 3VS5A 3PTAA 3NMZC 1N8RU 4JLIA 2J6OA 3MO8A 2X3WD 2Y4YA 3JRZA 1PKTA 2E65A 2GTJA 5FU7B 3G6EQ 1VQ5T 2E10A 2AZSA 4FW2A 1M2VA 2EPDA 1Q86U 2PU9B 4M7AG 2MK5A 2CSQA 4M78E 1CKBA 4XAXB 3EG2A 1WJQA 5KYYB 4BE0A 4NS5A 4EMGA 3CCJT 1YHQT 3SD4A 1VQ9A 2W0ZA 1QCNA 2AKKA 3OYYA 1QW1A 3CCEQ 3O5ZA 4HCZA 2JMAA 1G83A 3A8MB 2Y4XA 4IUPA 2ZCFB 1RL2A 2QQ9A 2WACA 4Z89A 1O9SA 5FRMA 3UDCA 2LCCA 1OU9A 4M7AE 4A54A 2LJ1A 1M1FA 3TCJA 4FYWB 4C92C 2QEXQ 4M77C 4FL6A 4PNOA 4J9IA 2AZVA 4Q5WA 1YJ9A 1H92A 2VWFA 2KSSA 3EGDA 2D9TA 4BUGA 2O88A 1K0SA 2FPEA 4JRKA 2QA4Q 1M2VB 1K9MU 4KBMB 1RLPC 1G2BA 4ZNXA 3L2ZA 1EFNA 1CKAA 3RUXA 2PQWA 3LLRA 3VS0A 1X27A 3OS0A 1I5LA 5FROA 1BI2A 1Z9ZA 4JRQA 3MEVA 1WHGA 3T9NA 1BCOA 1B34B 2RJEA 1UGQB 1YITQ 3QIIA 1KHCA 3OW2S 2QG9B 5GAN3 3MCAB 3S3MA 2CYZB 2RJDA 4M7AB 1TS9A 1Y0MA 1D1CA 2QA4T 4HVUA 5A2QE 1ZSZB 1IB8A 2GQVA 4N4GA 5AYFA 3LX7A 3F70A 2LNVA 2YLBA 1ZUKA 3CC4T 2LTOA 2V26A 3OYKA 2DL7A 3ZFJA 1RLQC 1VQPQ 5GJWB 1OZ3A 1QP2A 3SB2A 1HSQA 4AFSC 2OTJQ 4RCBA 2NLUA 4JS5A 3QZ5B 4MMKA 3VS7A 4KGXB 3URGA 3VS3A 1N8RC 3CC7T 2O9SA 5GAMj 4LDYA 1W2BS 2HSEB 1JJ2A 2M0YA 2KXCA 4J7IA 5D7UA 2E41A 3MEAA 2OAUA 4XTYA 1E7OA 4J9BA 3CPWS 3N5BB 1SSHA 1OZ2A 2CP3A 4N0AA 1SG5A 2GFAA 4E7KA 1ZX6A 1WHHA 4PFOA 4ELZC 4KT0E 5GAOr 4JZ3A 2RMOA 2ZZDA 1B7TA 1YWOA 4AMCA 1V29B 4E2FB 3G4ST 4X9DA 2DF6A 5M9OA 4D8DA 3R6NA 3A1PA 2DZ9A 2KDSA 2MPXC 5GAMe 1QKWA 4DBFA 5LJ5j 4M77D 3EFOB 3WVEB 3CC2Q 5GMKl 2ESWA 2QQBA 3WVDB 3PE0A 3L2WA 4F7UE 4DOWA 2IPOB 4IURA 4QQDA 2DEUA 1Q7YC 2HMAA 1G8XA 1FYNA 4A4KA 5IHIA 1PRLC 2XMFA 5GANh 2MYSA 4FCYA 4LD9K 3I56Q 2GFUA 3M58A 3M4YA 3PGGA 4DOVA 5GMKe 4FYYB 1T3LA 1Q86C 2COWA 2JOYA 3QJ6A 1SSFA 2FZCB 4VUBA 1MNEA 1Q7YR 3INZA 4LXCA 2BZXA 1JO8A 2DZCA 4M7AD 4L59A 2BTTA 3JCMV 3D7SB 1D3BB 5EC7A 3M53A 2KXDA 1M1KU 2DJQA 2DLPA 4JLGA 2L89A 4OB2B 3RDVA 1VQ9T 4A4FA 1YHQA 1S72A 3EG1A 5CVIA 4LN2A 2KRNA 1NYGA 3M0SA 1VQLT 1YI2T 3OB9A 4PLLA 4M78D 4E7HA 1YBYA 3HRUA 1GBRA 3L42A 2V8JA 5FLXE 5IHKA 1S72T 2EYXA 4C5HA 2EWNA 3G4SA 3OSSC 2HSPA 2A37A 2ENMA 2JT4A 3VRZA 1YCSB 3EG9B 3VYHB 2V1QA 1Y7XA 5GAN8 2CREA 4PJOE 2F1LA 2GCXA 3PMTA 4FYVB 2VVKA 3H9NA 1X75C 1T0JA 2ZPGB 1YP5A 2CUDA 2JM8A 5FW9A 3J80E 1ABQA 4M7AC 5GAN2 2Y90A 4FW1A 4QW2A 1UECA 1N27A 5GANg 2V1RA 4EMHA 2XKOC 1BIAA 2OAWA 2GQIA 2QGFB 5GMKj 2HBWA 4M7DA 2CP2A 3OYNA 1RUWA 3FB9A 1FX7A 4E7SA 2JXBA 4LDXA 1X6GA 2KVQG 2NUTA 1G3YA 3H0FA 4FT2A 4JJDA 3CC2T 1LJOA 2RHIA 4ZGDB 3OYFA 4A4EA 3BDUA 3ZBDA 5LJ5g 2DD5A 3SWNC 2MI6A 1DJ7B 1I0CA 4M4ZA 3CCLT 1Q81U 1X6BA 1JRIA 2KEAA 3S6WA 1NYFA 4AG1C 3G4SQ 1NEGA 1D1BA 4CC3A 4RG8A 1VA7A 1ARKA 4Y92A 4C8QF 2RNAA 2J6KA 4JJBA 3G7ZA 2NUPA 4DA4A 3H0IA 1YI2A 1ZLMA 1AOJA 3JCMh 4ANJA 5LL6S 4LDWA 1VQ8T 2NWMA 1IZ6A 2EKHA 1VQ9Q 1UJYA 1MGQA 4LUDA 1VQ4Q 3VS1A 5GAMh 3PFSA 5FU6C 4OF1A 5GANj 4XU3A 2AHJB 2WSCE 2FRWA 1EX4A 8ATCB 4BY6B 1UUEA 2O4XB 3H0HA 1RAEB 2CS7A 3LWIA 4JRPA 1VUBA 2NYSA 2A7YA 1BBZA 2OJ2A 1PD0A 3LGFA 3TU4K 2E70A 4HVWA 3RKYA 1G3WA 1NJIC 1UFFA 1JJ2P 1FMVA 4ZGJB 3JCMW 2JTFA 5FWCA 3FDRA 1RAAB 2IVWA 2V8IA 3TSZA 4ESRA 1YIJQ 5A0LA 4C0GA 2LQWA 2QXFA 2BE7D 2EQUA 2XG8D 3VS2A 2NUPB 1D0YA 2D8JA 2EBPA 1ZA1B 1KQSA 3BE3A 2RN8A 1AD5A 5GANe 4BE1A 3CD6Q 3I5RA 5KCOA 1VQ7A 1KIKA 1QVPA 1G3SA 4ATOA 1Q82R 3I5SA 1GCQA 2LT1A 2MWPA 1VQMT 1H3HA 2G3RA 3GBQA 3UF4A 1IRXA 3J81E 2DIQA 1NZ9A 1R0CB 1AHJB 4J6YA 4DBHA 4QQGA 5I22A 1RADB 4C0FA 1IXDA 1FXXA 2D1XA 1M1KR 3DB3A 4OMFB 3E9FA 2KQWA 1Q81R 1M4ZA 2DXUA 1KJWA 4KUIA 1O75A 5HK3A 2XDDA 2A08A 3LH0A 4EDUA 4CRIA 1M9SA 1T0HA 3O8VA 1KSWA 1VIEA 1WXUA 2BZ8A 4C92E 4IUTA 2DIGA 2JUFA 1NLPC 3CC7A 2K3BA 3MHXA 3X26B 3SEMA 2E64A 4M75G 3VS4A 1FWZA 2LC4A 2KR3A 4KH0B 5GAN5 1UTIA 1KC8C 1JJ2S 5D6YA 2KT8A 2QQRA 1BK2A 2K4YA 2P0KA 1Y07A 3PMIA 5KYUA 1WQ7A 2QQAA 3EG9A 2C06A 1ZUYA 1KD1U 2RI2A 4OMNA 2DFUA 4M75A 2YT6A 2HBPA 4M78C 2FL7A 3JCMJ 2HQXA 4OGCA 2YRVA 3QUIA 2J06A 4RUGA 1M27C 4FIBA 4R0KA 3CBPA 5KYXB 2JS0A 4M78F 3CCLA 4B6MA 1XNIA 3M0RA 2X4YA 4FYXB 1MNDA 3RR6A 4F7UF 5KCHA 5GAMg 2COYA 1VYUA 1X69A 4N4HA 3JCMg 3L2QA 3PVQA 1S1NA 1K8AR 5GANf 1X43A 2EQKA 2EQJA 5KYWB 3QO3A 4C5EA 4WTOB 3QWYA 4EMKA 1BI1A 2CT3A 2EW3A 1M90R 2RQRA 2KROA 4XQ3A 1U06A 3OYAA 2EYZA 1KC8U 2RQUA 2F69A 3MP6A 2HKNA 1UB4A 3FLGA 5IT9E 2MMPA 2VGNA 2G6FX 4B9WA 1G3TA 2EYWA 4C8QA 1WXBA 4PJOA 1I5OB 4C5IA 3UT1A 9ATCB 1IHWA 2ZAEA 1S72Q 4ORZA 3JSCA 1N9SA 3A8OB 1X01A 5A0GA 3OYEA 3CCVA 2ED1A 3M0UA 1TUGB 1V1CA 3REBB 1WGSA 5CR2A 4X1VA 2ED0A 3G6ET 1YITT 2WSFE 2FEIA 1QKXA 2DKGA 3MPUB 4DBQA 2QDYB 2X4XA 4QVZA 3RMQA 3CCQA 1KG1A 1BCMA 2ZPIB 3CCUT 4HCKA 3OYCA 3CCVT 1WPYA 1KFZA 2CZ7B 4PFPA 4V2SA 1W2BP 4E7IA 1JQQA 1D0ZA 1J3TA 1VQ6A 4C8QD 5IXFA 2F5KA 3QJYA 1WFWA 2FB7A 1QWFA 3C12A 2FHDA 3CQTA 2J7IA 3JCMP 2K5FA 4JJNK 2CGHA 3CMAQ 2MOXA 4CC7A 2VXEA 1D0XA 5J39A 2RHZA 1MMAA 2DPPB 2E6ZA 2DYBA 2DM1A 3MEUA 1TSFA 1KQ1A 1MMGA 3LYIA 3I9QA 2A0FB 3P8HA 2CZ1B 2FG0A 1VQ6T 1R77A 5I2SA 2QASA 1M90C 5IN1A 4M77E 1U8RA 1GL5A 2LZ6B 3CCMQ 2CDTA 2KNBB 5D6WA 4E7ZA 5IAYA 1NPPA 4F7UB 1VQNQ 1B3QA 5GAOq 4QVCA 3RNJA 5GANd 1SKUB 4DQ2A 5HKCA 4R55A 3J7AF 2B8AA 2WSEE 4MMLA 4M78G 2OTLQ 2QEXA 3MP1A 5HCKA 1M90U 2DVEA 2DX1A 2YRDA 1D1AA 3HFOA 2A36A 2OTLT 1YJ9Q 2VYTA 5LJ5e 4J83A 3EHRA 3QYHB 3JB9H 4C0DB 2X4JA 1H641 1K9MR 5CKBA 1BI0A 3CCRA 4DEYA 3P8DA 2K57A 4C92D 2EJ9A 3CXCP 1YI2Q 1YITA 1W4SA 1I1JA 3JB9F 2BUDA 3ME9A 5L23A 4LDUA 3L2RA 2CP7A 3M4GA 2O01E 2M51A 3EGXB 3MKDA 2A28A 3V8KA 3VUBA 1HJDA 4OB3B 1UJ0A 4M75B 3I56T 2DBMA 2MWOA 3CEYA 1WHJA 2J6FA 4WCIA 2M9UA 2CP6A 2EGCA 2DK3A 4XU1A 5C6SA 2P4TA 2DL5A 1VQPA 1EZZB 2YWWA 3H41A 2XK0A 3HRTA 2OTJA 3HTRA 1M30A 3CCJQ 4KGVB 4OB1B 1QVGS 3GP8A 3CD6A 2FPFA 3EHQA 4M78B 4L5GA 2ATCB 2GNCA 4TVRA 1QVFP 4A53A 1QP3A 3DB4A 4N0AC 1WHKA 1ZHIA 4OMLA 2E5KA 3EGXA 3M0TA 2L3PA 3R6OA 5CO7A 1VQOQ 4ELYC 1VQNT 2CZ6B 1UGSB 3MP8A 1SHFA 3VS6A 3EFRA 5LJ5f 3A8GB 2FO0A 5CIUA 3REAB 3X24B 2P0PA 4FSXA 2OTJT 3QHSA 4KGZB 4PLIA 3ASKA 3CC2A 1ZSZC 1LOJA 2EGAA 2DL3A 4RTZA 2GGRA 3NTIA 2E3HA 2GF7A 2RQTA 1M1GA 2GTOA 4PKCC 2HEQA 3L2VA 2VC8A 2DL4A 4OMMA 4JRIA 2J05A 2QI2A 1RAIB 2CP0A 1GFDA 3QBYA 3M55A 1BYMA 4E47A 4XU2A 4BB7A 3PT9A 1VYVA 4J8OA 4EPCA 1B34A 2DYIA 1PRMC 5LJ3f 2W10A 2DE0X 1UDLA 2K6DA 1VQMQ 4PJOC 3V7RA 2DNUA 4M75F 1ZSZA 1QWEA 2DETA 3JCMf 5CQXA 1Z9QA 3CCLQ 4BD3A 1NJIU 3OW2P 5J26A 2DVJA 2YLCA 2EYYA 2H8HA 3HL8A 3C95A 3A8HB 3HHTB 1PSEA 2DRMA 2YDLA 4M7DE 1KQ2A 4F7UA 4OMPA 3V8LA 3OYIA 2CUBA 3E9GA 3RKXA 1K9MC 2XDBA 3RKWA 1VQPT 4M77B 3ZEHA 2DBKA 1WA7A 1PG5B 5KYYA 3S3OA 5LJ5d 3JCMc 3CCET 1I8FA 3I55T 5FU7C 5KE3A 4E7LA 3I35A 1WIEA 3VKIA 1BU1A 4J6WA 4F7UG 1VQMA 5I11A 2EAYA 2LCSA 3HP9A 2L8DA 1TG0A 2E12A 5A0DA 4ZN3A 1SF9A 4NOYA 1SRMA 1TU0B 4ME7A 4AG2C 2AT1B 4AFUC 3CCSA 3EG3A 2HL5C 1VQ4T 1MMNA 2D8HA 4KRTA 1UEBA 3FRNA 2FRYA 4AT1B 1BB9A 1RAFB 3THKA 1CSKA 3M54A 3QG1A 1K76A 1NE8A 4O5VA 4EMKC 3RBBB 3JAME 3BDLA 3IQLA 4KUDK 2XU8A 3M59A 1K0XA 3OYJA 3CCST 1YNZA 2IIMA 1H3ZA 3KXTA 4XK8E 1YCYA 2HQHA 1AWXA 2JW4A 4F14A 1OPKA 2PVOB 1QVFA 1E6GA 3JB9I 1I07A 2FVUA 3NHNA 4M7DG 1AEYA 4M75E 3WXMB 3ZL7C 3I55Q 3I56A 1SEMA 1Q95G 3JB9D 1IREB 5LJ5h 1VIFA 2PUOB 3NTHA 2DTOA 1X2QA 2RM4A 4C92G 3NPFA 1X6OA 1NEBA 4HVVA 1YJWQ 2XHCA 5D6XA 2L3SA 1VQNA 2L5QA 4FM4B 1ZBJA 1U5SA 4PJMA 4KULA 1OU8A 4Z88A 4C92A 3TQ7P 1TH7A 1M3BA 2M0OA 1Q7YU 4Z02A 3L1AA 4HXJA 1YWPA 4JPBW 2K3XA 3EH1A 4M7AA 4IIMA 2FZGB 4MZTA 4RG2A 1YIJA 1NBEB 2KMTA 2COZA 4NL2A 2OTLA 5ECAA 1PD1A 3E1SA 2FZKB 2RQWA 5CAIA 2C0TA 4D8KA 1TTHB 2JM9A 3CCUA 1TUCA 4IUVA 3PVLA 1PCXA 5GMKi 1V76A 2QK0A 2YHTA 2RQVA 3OYDA 4RTVA 2RJFA 4LD6A 2DMOA 3I55A 4GBQA 1WHLA 4XTUA 2RK1A 4M7DB 3PNWC 4Y28E 2K2MA 4CI0C 2LJ3A 4C92B 5GAN4 2ROLA 2C0OA 4IUQA 5I2MA 3V7SA 3OS5A 2HKQB 3TREA 1AWOA 2ZPHB 3A8LB 3OMCA 1AWWA 4CC4B 4RCCA 4J9EA 1VQKQ 3OQ5A 1C0MA 2PZ1A 1W1FA 4F17A 3LW5E 4M75D 1PHTA 1M1KC 2Z0WA 2RH2A 4CC2A 3M0QA 3JCMQ 2O2OA 5GAMd 3CBOA 2LRQA 3QDRB 2LQ8A 4B9XA 2YUNA 3TEEA 4Z8AA 2D0QB 4J5YA 4C8QE 4WF2A 1FMWA 1KK7A 1I81A 1VQ4A 1UGVA 2RO0A 4MZPA 4JZ4A 4M77A 2JTEA 2IG0A 1K73R 3G71Q 2KGTA 3HFNA 4XTZA 1VQOA 3CCMT 4XU0A 5CQYA 1U1SA 2DRKA 1GCPA 3UATA 1GXIE 4HT8A 1WNLA 1LVKA 5GAMf 4HT9A 2LVMA 2XI9A 4OMQA 2CZ0B 3X25B 4HCCA 2OX7A 1ACMB 1WJRA 2D6FA 3GNFB 4M77G 3EG0A 2DXTA 1D3BA 5CKHA 1Q82C 1KD1C 2YSQA 1TUDA 1M2OA 2AK5A 2DAQA 2PTKA 1QMCA 3C4SA 2DTHA 3X20B 1M5Q1 1IGUA 3E19A 1WDXA 2SRCA 2DD4A 1YN8A 4M77F 4GLKA 2JS2A 1JU5C 3JCMd 3JCMb 3EFSA 2YRCA 3NFCA 4M7DD 1XQHA 3C94A 2NUTB 1M3CA 2X51A 2JJ9A 2RK2A 1MV0B 1OI1A 5LJ3j 1MHNA 5DLQE 1AVZC 2RD1A 1VQLQ 2MIOA 3E2UA 4MDWA 3VJPA 2MCNA 4OGEA 1KC8R 3ER0A 3VU3C 4YTLA 4MZMA 4QT7A 2JN0A 1MUZA 2I0NA 4BDZA 2L3QA 3CPWA 2EJGA 3META 2OI3A 2KK4A 1Q86R 2EQIA 1OYXA 3U23A 4DBRA 2RHYA 3CXCS 4QKUA 4M7DF 2K7AA 2HAXA 1RACB 1WXTA 1JXOA 1WHMA 1VQ6Q 1OX8A 1OOTA 4JJCA 2DTIA 4C92F 4J9GA 4JUVA 2A3LA 1RI9A 5CK9A 1Y71A 3RERA 2O9VA 3DLMA 2ZPFB 1ZA2B 2JVVA 5CKDA 1ZSGA 3GOXA 2JNGA 4J9CA 3H8ZA 1TWBA 3M0PA 5KE2A 1U3OA 2QA4A 5KYUB 4A4GA 1WJSA 2RHUA 5GAN6 4OMOA 2DO3A 2GBQA 1RABB 2HZYA 3CCSQ 3X28B 4GY5A 4NL3A 2L2PA 2X35A 2KYMA 5DY9A 2H3JA 2K5IA 4F04B 1IO6A 4BACA 1H8KA 1BKBA 2HDAA 5DLOA 3FJPA 4BI3A 5KYXA 2QYZA 2HQEA 1U1TA 1SRLA 4LDVA 2F5TX 4D6WA 2K5LA 1VQ7T 3AHUA 2F2VA 1PNJA 3PIOA 1NPRA 3GLXA 2QGGA 2MF2A 5EG2A 4QQ6A 2VB6A 3OYBA 5KYWA 2P0QA 2ECZA 1WQWA 1T3SA 3KBGA 3QSUA 2EQMA 3CPFA 4A63B 1AZEA 3EH2A 4HCBA 1TXQA 2P84A 2VASA 3BY7A 1K73U 2LMJA 3KFVA 2VUBA 2H3EB 2KYBA 1M8MA 2RHXA 1C6VX 3GNGA 5I21A 4XTWA 1HK9A 2DILA 1JBMA 2K79A 1YJWA 2F2WA 4PJOB 4AFZC 1JB0E 3CCVQ 5LJ3e 3M9QA 1VQ8Q 4IIOA 5HY6A 1N5ZA 2E3IA 5KH6A 2CH4A 3V7CA 3LH5A 3CMAT 1OULA 2K3YA 3OBYA 3UA6A 5LJ3h 3V8JA 3RMSA 4JDSA 5FRNA 2X4WA 1Y96B 2YXYA 4RTTA 3SDZA 2LCLA 4K11A 3RESA 1BI3A 2KRMA 3CCUQ 2LJ0A 3QKJA 4J9DA 4M7DC 3GF5A 1YIJT 4KH1B 2BIVA 1K4US 3EAEA 5GAOp 5GAOn 1UHCA 4LE9A 4E6RA 2HL3A 3M57A 3OBWA 3OYHA 3SWNA 3DKMA 2I2LA 3CMAA 3A98A 3BW1A 5L8RE 3FIFA 3JCMX 4OP0A 3JB9J 2RA2A 1AWJA 3LGLA 2EYQA 3QYGB 3TVTA 3VYGA 1WLPB 5FU6B 3EGUA 4RKUE 1UE9A 2KBTA 2RJCA 3OW2A 1PM3A 1PSFA 3CPWP 2DERA 1A0NB 4GLMA 3VRYA 1X2KA 2O4XA 1SPKA 2R57A 1C1AA 4BI8B 3FEOA 2ZPBB 1AZGB 2VKNA 1VQKA 2FPDA 5GMKh 1JXMA 4E7JA 2KAFA 3LWHA 4FU6A 4HKEA 1XTDA 3OYGA 1YFNA 5GMKm 1QQJA 4RTUA 2HD0A 1OPLA 2SEMA 1KQSP 3CXCA 3VUZA 3G71T 1K8AC 3CCRQ 2RB6A 4JS4A 4FT4A 1ZQ1A 1VQOT 4PJOD 1VQ7Q 5C0MA 2CT4A 2YUPA 3P8BB 4ZN1A 2KT1A 1PWTA 1G5VA 3H6ZA 2MAMA 3HSBA 3CCQT 5IXBA 4II1A 3G1JA 5GAOl 5CKEA 3G71A 2XIDA 1MV3A
chains in the Genus database with same CATH topology
3G6EA 1OZ3A 1QP2A 3SB2A 4PJOA 4MZTA 4RG2A 4C5IA 2KMTA 4NL2A 1YIJA 2OTLA 3UT1A 4N4IA 4RCBA 2RI5A 4X9CA 3GPLA 3E1SA 3JSCA 1N9SA 2NLUA 1LNXA 1X01A 3A8OB 2R58A 4IUUA 3VV0A 5A0GA 2QQSA 5CAIA 3QZ5B 4MMKA 3OYEA 3CCVA 4JS5A 3URGA 3CCUA 1WGSA 1N8RC 3CC7T 5CR2A 4IUVA 1N9RA 5GAMj 4LDYA 1W2BS 3G6ET 1KHIA 3HRSA 1JJ2A 4M7AF 1YITT 4J7IA 4A4HA 5GMKi 2E41A 2YHTA 3MEAA 2WSFE 2OAUA 4OB0B 4XTYA 3CPWS 3OYDA 3N5BB 2DKGA 4C8QB 2PVGB 2QDYB 2X4XA 1OZ2A 2RJFA 3OMGA 4LD6A 4QVZA 3RMQA 3CCQA 1KG1A 4UC4A 4N0AA 4XTVA 3CCJA 3CCEA 2GFAA 3I55A 4E7KA 2ZPIB 3CCUT 3OYCA 3CCVT 4ELZC 1WPYA 2CZ7B 4KT0E 5GAOr 4V2SA 4C0ZA 4XTUA 4E7IA 2RK1A 4M7DB 2V8KA 2ZZDA 3FC3A 2E1HA 1V29B 3PNWC 4Y28E 3G4ST 1VQ6A 4C8QD 2F5KA 4X9DA 3QJYA 4CI0C 5M9OA 2FB7A 4C92B 3C12A 2FHDA 5GAN4 2DZ9A 2KDSA 4IUQA 2VGMA 3JCMP 2K5FA 5I2MA 5GAMe 3V7SA 2ZPEB 3OS5A 4JJNK 3TREA 2CGHA 3QXEB 3CMET 2ZPHB 5LJ5j 2VXEA 3A8LB 2LQKA 5J39A 2RHZA 3OMCA 4M77D 2DPPB 4C8QC 1VQLA 2E6ZA 3WVEB 5GAOm 4RCCA 5GMKl 4J7FA 3MEUA 2QQBA 1QVGA 3WVDB 3L2WA 3PIPA 4F7UE 1KQ1A 4DOWA 3OQ5A 3CD6T 1I4K1 2L3RA 4IURA 4QQDA 3LYIA 2VXFA 3LW5E 2FYKA 1Q7YC 4M75D 5J3BA 3P8HA 1M1KC 2CZ1B 5HK0A 2RH2A 1VQ6T 3A5ZB 5I2SA 1RI0A 1M90C 5IN1A 4A4KA 4M77E 1XOVA 3JCMQ 1U8RA 5GANh 2DEQA 4LD9K 2GFUA 5GAMd 3M58A 3CBOA 2LRQA 3M4YA 2LQ8A 3PGGA 3QDRB 5D6WA 4DOVA 5IAYA 1NPPA 4F7UB 4B9XA 5GMKe 5GAOq 1Q86C 3TEEA 2JZ2A 3OYLA 4QVCA 2JOYA 3QJ6A 5GANd 1SSFA 4VUBA 2D0QB 2R5AA 4J5YA 4C8QE 4WF2A 4DQ2A 5HKCA 4R56A 4R55A 3INZA 1I81A 1VQ4A 4M75C 2DZCA 3J7AF 4M7AD 4L59A 2KY9A 2RO0A 2B8AA 2WSEE 4MMLA 4MZPA 3JCMV 4M78G 4M77A 2QEXA 3MP1A 3OS2A 1M90U 2DVEA 2IG0A 1D3BB 3HFNA 3M53A 4XTZA 1VQOA 3CCMT 4XU0A 5CQYA 2BKDN 1M1KU 4XTXA 3HFOA 3UPUA 4X34A 1U1SA 4JLGA 2L89A 4C8QG 4OB2B 2OTLT 1VQ9T 4PJOG 2VYTA 4A4FA 1K73C 1YHQA 2LX9A 5LJ5e 1S72A 1GXIE 3GIBA 1K8AU 4HT8A 1WNLA 4J83A 5GAMf 4HT9A 1YJWT 2LVMA 5CVIA 3QYHB 1Y96A 2XI9A 3JB9H 4C0DB 2X4JA 1H641 2CZ0B 3X25B 4HCCA 1W2BA 1BIBA 4EMKB 4RMOA 1VQLT 1WJRA 5CKBA 5CCAA 1Q82U 2D6FA 1BI0A 3S3NA 3GNFB 4M77G 3CCRA 1YI2T 3OB9A 4PLLA 2DXTA 1D3BA 3P8DA 2K2VA 4M78D 5CKHA 4E7HA 1YBYA 2EFIA 3HRUA 2K57A 3L42A 2V8JA 4C92D 5FLXE 2PVDB 2EJFA 2EJ9A 1Q81C 1Q82C 1KQSS 4ZGEB 3OA6A 1KD1C 1S72T 1YJNA 1M8VA 1YITA 3JB9G 1W4SA 4C5HA 2EWNA 2DAQA 3OSSC 3G4SA 2BUDA 3JB9F 3ME9A 3C4SA 2DTHA 4LDUA 1N6AA 2EIFA 3M4GA 3L2RA 2O01E 3HPWA 4ZTFA 2LT4A 3VYHB 3X20B 1M5Q1 3E19A 3SWNB 1Y7XA 1UGPB 5GAN8 2DD4A 4M77F 4GLKA 4PJOE 3V8KA 3VUBA 1P92A 2GCXA 4OB3B 3JCMd 3PMTA 3JCMb 4M75B 3I56T 3EFSA 2MWOA 3NFCA 4M7DD 1X75C 2ZPGB 3CEYA 1XQHA 2HNIA 2JTMA 2M9UA 2DJZA 3C94A 3RIRA 2DK3A 2RK2A 3J80E 1OI1A 4XU1A 5C6SA 1MHNA 5LJ3j 5GAN2 2Y90A 4M7AC 5DLQE 2P4TA 3CMEA 4QW2A 1VQPA 1N27A 3BFMA 2XK0A 5GANg 4BY6C 2RD1A 4EMHA 3HRTA 2OTJA 2XKOC 1BIAA 4MDWA 3M56A 4OB1B 3VJPA 3OS1A 5GMKj 1QVGS 4M7DA 3OSVA 3OYNA 1EIFA 3FB9A 3GP8A 4OGEA 3CD6A 3ER0A 5LJ3g 3VU3C 4YTLA 3CC4A 1FX7A 4M78B 4MZMA 4LDXA 5GAN7 4L5GA 4ZTJA 2JN0A 2KVQG 3JCMe 4TVRA 1G3YA 4FT2A 4BDZA 2E6NA 4A53A 2RI3A 3CPWA 1QP3A 2EJGA 3DB4A 3META 3CC2T 3OY9A 1LJOA 2KK4A 2E5QA 2RHIA 4N0AC 4A4EA 4ZGDB 3BDUA 3OYFA 1OYXA 3ZBDA 1ZHIA 2RHYA 5LJ5g 5DM7R 3CXCS 2DD5A 1R8OB 3SWNC 1VQKT 4M7DF 2MI6A 3HKSA 1DJ7B 2M1HA 3CCLT 2HAXA 3CCMA 1Q81U 4O6JA 2DTIA 3R6OA 4M78A 4C92F 1JRIA 5CO7A 4ELYC 4JUVA 3UWNA 1VQNT 2CZ6B 2DXBA 1VQ8A 3S6WA 1UGSB 2A3LA 5CK9A 3MP8A 1Y71A 3RERA 3DLMA 2ZPFB 5CKDA 2JVVA 3M5AA 3EFRA 5LJ5f 3GOXA 3A8GB 2PUKB 5CIUA 2JNGA 4RG8A 3H8ZA 3X24B 2P0PA 4J6XA 4FSXA 4C8QF 2OTJT 5KE2A 2QTXA 2QA4A 3QHSA 1QVFS 3G7ZA 4PLIA 4PL6A 4A4GA 1WJSA 2RHUA 2DXCA 3ASKA 5GAN6 4DA4A 4L6V5 2DO3A 3CC2A 1VQ5A 3X28B 3CCRT 1YI2A 4GY5A 3JCMh 1UGRB 2LDMA 4NL3A 2CKKA 1LOJA 2X35A 2ZGWA 4LDWA 5DY9A 5LL6S 1VQ8T 1IZ6A 4MDXA 2H3JA 2K5IA 1YJ9T 4BACA 4P5NA 1MGQA 5LJ3d 1BKBA 2XICA 1ZBXA 3NTIA 5GAMh 5DLOA 2GF7A 3FJPA 4BI3A 3Q1JA 1M1GA 4PKCC 3L2VA 3PFSA 5CKFA 4OF1A 2VC8A 4XU3A 5FU6C 5GANj 2AHJB 1HXDA 2HQEA 4JRIA 1U1TA 2WSCE 2QI2A 4LDVA 2F5TX 3DLLA 2XDPA 4D6WA 4BY6B 2QEXT 2K5LA 3QBYA 1VQ7T 3AHUA 3M55A 1BYMA 2O4XB 4E47A 4XU2A 2CS7A 3LWIA 2M16A 4JRPA 3PIOA 1VUBA 2R5MA 4Y91A 2A7YA 4BB7A 4C0DC 1NPRA 3GLXA 3PT9A 4BE2A 3L2UA 3QZ9B 4PJOF 3LGFA 3TU4K 2MF2A 2E70A 5EG2A 4J8OA 3RKYA 4EPCA 1G3WA 1B34A 1NJIC 5LJ3f 4QQ6A 3OYBA 4ZGJB 3JCMW 2JTFA 2P0QA 3FDRA 2IVWA 2V8IA 4PJOC 3V7RA 1WQWA 5A0LA 3KBGA 3SFMA 4C0GA 2EQMA 3CPFA 3QSUA 4M75F 2QXFA 2XD0A 2EQUA 2XG8D 4HCBA 3BY7A 4HA8A 3CBMA 1K73U 2VUBA 3JCMf 5CQXA 4BI4A 4BDYA 2VV5A 2RHXA 4C5GA 3GNGA 4BD3A 5I21A 1NJIU 1KQSA 4XTWA 2YLCA 1HK9A 2EKOA 5J26A 5GANe 4BE1A 4OVAA 1JBMA 3MEWA 3NTKA 5KCOA 1VQ7A 3OYMA 1QVPA 1G3SA 3HL8A 4ATOA 3KUFA 1YJWA 3C95A 4PJOB 3A8HB 3HHTB 1PSEA 1JB0E 5LJ3e 3M9QA 1YJNT 4M7DE 1KQ2A 4F7UA 5HY6A 2LT1A 5KH6A 3V8LA 3OYIA 2MWPA 1VQMT 4IKFA 2G3RA 3E9GA 3RKXA 4QVDA 1K9MC 3J81E 3V7CA 2DIQA 1NZ9A 1AHJB 4J6YA 2XDBA 4QQGA 3RKWA 1VQPT 3QPHA 4M77B 3ZEHA 4C0FA 1FXXA 3PTAA 3CMAT 3S3OA 1N8RU 3DB3A 4OMFB 5LJ5d 3E9FA 2KQWA 4JLIA 1I8FA 3JCMc 3I55T 3CCET 1M4ZA 2K3YA 3MO8A 5FU7C 2DXUA 2Y4YA 3OBYA 5KE3A 4E7LA 3JRZA 4KUIA 1O75A 2E65A 5HK3A 5FU7B 2XDDA 1VQ5T 3VKIA 3LH0A 4EDUA 4CRIA 2E10A 1M9SA 3O8VA 4J6WA 5LJ3h 1Q86U 4F7UG 2PU9B 3RMSA 3V8JA 1VQMA 4JDSA 1VIEA 5FRNA 4M7AG 2X4WA 1Y96B 4C92E 2EAYA 3SDZA 3HP9A 4IUTA 2LCLA 4M78E 2DIGA 2JUFA 2L8DA 4XAXB 3RESA 2E12A 5A0DA 4ZN3A 1BI3A 3CC7A 4NOYA 3QKJA 3MHXA 4M7DC 3X26B 1WJQA 4BE0A 3GF5A 4ME7A 4NS5A 3CCSA 1YIJT 2E64A 4M75G 4EMGA 3CCJT 1YHQT 3SD4A 1VQ4T 1FWZA 2BIVA 2LC4A 3EAEA 5GAOp 5GAOn 1VQ9A 3OYYA 1QW1A 1UEBA 4HCZA 5GAN5 1KC8C 3FRNA 1JJ2S 5D6YA 2QQRA 2K4YA 3M57A 2P0KA 1Y07A 3OBWA 3M54A 3A8MB 3PMIA 2Y4XA 4IUPA 3QG1A 2ZCFB 1NE8A 1RL2A 2QQ9A 3OYHA 2WACA 3SWNA 1O9SA 3DKMA 1WQ7A 5FRMA 4O5VA 3UDCA 2QQAA 4EMKC 2I2LA 2LCCA 4M7AE 4A54A 3CMAA 2C06A 3JAME 1M1FA 3BDLA 3TCJA 1KD1U 2RI2A 3BW1A 5L8RE 3FIFA 4M75A 4C92C 3JCMX 2HBPA 4M78C 2FL7A 4OP0A 2RA2A 3JB9J 3JCMJ 3LGLA 2HQXA 4OGCA 4KUDK 2YRVA 2EYQA 3QYGB 2XU8A 3M59A 4M77C 3OYJA 3QUIA 3VYGA 4FL6A 5FU6B 3CCST 4PNOA 4RKUE 4FIBA 1H3ZA 3CBPA 4Q5WA 3KXTA 4XK8E 1YJ9A 2RJCA 3OW2A 1YCYA 1PSFA 2KSSA 2D9TA 4M78F 4BUGA 4JRKA 1QVFA 2PVOB 3JB9I 1K9MU 3CCLA 4KBMB 2FVUA 3L2ZA 1XNIA 2O4XA 4M7DG 2X4YA 4M75E 3RUXA 3WXMB 2PQWA 3I56A 2R57A 3LLRA 4BI8B 4F7UF 5KCHA 5GAMg 3JB9D 1IREB 3FEOA 5LJ5h 1VIFA 2PUOB 2ZPBB 3NTHA 1VQKA 2DTOA 3OS0A 1I5LA 5FROA 2RM4A 4C92G 5GMKh 1BI2A 4N4HA 4E7JA 1X6OA 2KAFA 3LWHA 3JCMg 4JRQA 4FU6A 3MEVA 1XTDA 4HKEA 3OYGA 2XHCA 5D6XA 3T9NA 1VQNA 5GMKm 3L2QA 2L5QA 1B34B 2RJEA 1UGQB 3QIIA 1KHCA 5GANf 2EQKA 2HD0A 5GAN3 2EQJA 3OW2S 3MCAB 3CXCA 3S3MA 2CYZB 2RJDA 4FM4B 4M7AB 3VUZA 3QO3A 4C5EA 3G71T 1K8AC 4JS4A 2RB6A 4EMKA 2QA4T 4FT4A 1BI1A 1ZQ1A 5A2QE 1VQOT 4PJOD 4KULA 5C0MA 4C92A 2GQVA 4N4GA 4XQ3A 5AYFA 3P8BB 3OYAA 4ZN1A 1TH7A 1KC8U 3LX7A 2F69A 3MP6A 2M0OA 3F70A 3H6ZA 1Q7YU 2LNVA 2MAMA 1G5VA 3HSBA 1UB4A 3FLGA 2YLBA 4Z02A 3CCQT 5IT9E 2MMPA 3L1AA 4II1A 3CC4T 2LTOA 2VGNA 4B9WA 1G3TA 2K3XA 5CKEA 5GAOl 3G71A 3OYKA 4M7AA 2XIDA 3ZFJA 4C8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ3 A;  4PLI A;  4PL6 A;  2X4W A;  4A4G A;  1WJS A;  2RHU A;  4RG2 A;  4C5I A;  5FRN A;  3ASK A;  4IUT A;  3UT1 A;  2DIG A;  2L8D A;  2LVM A;  4N4I A;  2RI5 A;  2NLU A;  2R58 A;  4GY5 A;  4IUU A;  2LDM A;  2QQS A;  3QKJ A;  3OYE A;  2CKK A;  2X35 A;  1WJR A;  1WJQ A;  4BE0 A;  4NS5 A;  3S3N A;  1WGS A;  3OB9 A;  4IUV A;  4PLL A;  3P8D A;  4BAC A;  4E7H A;  2EFI A;  3SD4 A;  3L42 A;  2BIV A;  3EAE A;  4A4H A;  3MEA A;  3NTI A;  2GF7 A;  3OA6 A;  3Q1J A;  3OYD A;  3L2V A;  3PFS A;  4HCZ A;  5D6Y A;  3OMG A;  2QQR A;  2HQE A;  1OZ2 A;  2RJF A;  2X4X A;  4LD6 A;  4QVZ A;  2P0K A;  2DAQ A;  4C5H A;  2BUD A;  2XDP A;  3ME9 A;  4UC4 A;  2GFA A;  3PMI A;  3QBY A;  3C4S A;  4IUP A;  3L2R A;  4E7K A;  4ZTF A;  3OYC A;  3OYH A;  2WAC A;  2O4X B;  5FRM A;  4E7I A;  2LCC A;  2M16 A;  3FC3 A;  2R5M A;  3PNW C;  3BDL A;  2RI2 A;  4BE2 A;  2F5K A;  3L2U A;  5M9O A;  3LGL A;  3PMT A;  2HQX A;  3LGF A;  2FHD A;  2YRV A;  2MWO A;  4IUQ A;  3OYJ A;  3CEY A;  4FL6 A;  4QQ6 A;  1H3Z A;  3OYB A;  4Q5W A;  1OI1 A;  2JTF A;  2RJC A;  3FDR A;  5C6S A;  1MHN A;  5J39 A;  1G5V A;  2RHZ A;  3OMC A;  2D9T A;  4QW2 A;  1N27 A;  2XK0 A;  2EQM A;  3MEU A;  3L2W A;  2EQU A;  1XNI A;  2O4X A;  2X4Y A;  3OQ5 A;  2PQW A;  2L3R A;  2R57 A;  3LLR A;  4IUR A;  4QQD A;  5KCH A;  3LYI A;  3OS1 A;  3FEO A;  3OYN A;  4A4F A;  3NTH A;  3OS0 A;  3P8H A;  5FRO A;  4BDY A;  4N4H A;  2RHX A;  4E7J A;  4C5G A;  4BD3 A;  1RI0 A;  4FU6 A;  4ZTJ A;  3MEV A;  3OYG A;  5IN1 A;  5J26 A;  4BE1 A;  2EKO A;  5D6X A;  2E6N A;  4BDZ A;  4OVA A;  2RI3 A;  3MEW A;  3NTK A;  5KCO A;  2RJE A;  3OYM A;  3DB4 A;  3L2Q A;  2GFU A;  3KUF A;  3QII A;  3MET A;  1KHC A;  2LRQ A;  5D6W A;  2EQK A;  5IAY A;  3OY9 A;  2EQJ A;  2RHI A;  2E5Q A;  3OYF A;  4B9X A;  4A4E A;  3S3M A;  1OYX A;  3M9Q A;  2RJD A;  2RHY A;  2JZ2 A;  4C5E A;  3OYL A;  3QJ6 A;  5KH6 A;  1SSF A;  3OYI A;  2MWP A;  2R5A A;  4IKF A;  2G3R A;  3E9G A;  2M1H A;  5C0M A;  2DIQ A;  4N4G A;  4QQG A;  3ZEH A;  4L59 A;  2RO0 A;  3OYA A;  2B8A A;  3LX7 A;  3S3O A;  3DB3 A;  3UWN A;  3E9F A;  3MP6 A;  2M0O A;  3F70 A;  3H6Z A;  3MP1 A;  3S6W A;  2K3Y A;  3MO8 A;  2IG0 A;  3OS2 A;  3FLG A;  3MP8 A;  4Z02 A;  5KE3 A;  4E7L A;  3DLM A;  2BKD N;  4II1 A;  2LTO A;  3GOX A;  4B9W A;  5CIU A;  4X34 A;  3LH0 A;  4EDU A;  4CRI A;  2K3X A;  2L89 A;  3H8Z A;  3O8V A;  3OYK A;  2VYT A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 2P4R A;  3G6E A;  2EVR A;  4RTX A;  2RF0 A;  4N4I A;  2RI5 A;  4X9C A;  3GPL A;  2E4H A;  1LNX A;  2R58 A;  4IUU A;  3VV0 A;  2DL8 A;  2QQS A;  1N9R A;  1PC0 A;  1KHI A;  3HRS A;  4M7A F;  4A4H A;  4OB0 B;  3CC7 Q;  1FMK A;  4LUE A;  4C8Q B;  2PVG B;  3OMG A;  1F1B B;  4UC4 A;  3CCJ A;  4XTV A;  3CCE A;  1HD3 A;  1GCQ C;  4PFZ A;  1OQK A;  1SHG A;  4C0Z A;  2V8K A;  3FC3 A;  4AFQ C;  2E1H A;  1QCF A;  2BZY A;  5AT1 B;  2LP5 A;  2VGM A;  2ZPE B;  4PJJ A;  3QXE B;  3CME T;  2LQK A;  1VQL A;  4C8Q C;  5IH2 A;  1AT1 B;  5GAO m;  4J7F A;  1QVG A;  3PIP A;  3SHW A;  3CD6 T;  1I4K 1;  2L3R A;  2VXF A;  2FYK A;  5J3B A;  5HK0 A;  3A5Z B;  1RI0 A;  7AT1 B;  1MMD A;  1XOV A;  2DEQ A;  2LQN A;  1YJN Q;  1XJW B;  1NM7 A;  2JZ2 A;  3OYL A;  1WI7 A;  2RPN A;  4FSS A;  2R5A A;  2L0A A;  2HCK A;  4R56 A;  4M75 C;  4EIK A;  1NJI R;  2KY9 A;  2C0I A;  3OS2 A;  1QCO A;  1IHV A;  2BKD N;  1N8R R;  4XTX A;  3UPU A;  4X34 A;  2CP5 A;  4C8Q G;  1B07 A;  4PJO G;  1K73 C;  2LX9 A;  3GIB A;  1GRI A;  1K8A U;  2EGE A;  1YJW T;  1Y96 A;  2BE9 B;  1NG2 A;  1RAH B;  1UHF A;  1ZUU A;  2LX7 A;  1W2B A;  1BIB A;  1R0B G;  1Y57 A;  4EMK B;  4RMO A;  1Q82 U;  5CCA A;  3S3N A;  4PJL A;  4J9F A;  2ABL A;  2K2V A;  4RTY A;  2EFI A;  3CC4 Q;  1KQS S;  2PVD B;  2EJF A;  1Q81 C;  3C0C A;  2B86 A;  4ZGE B;  3OA6 A;  1M3A A;  1JEG A;  1W6X A;  3JV3 A;  1K1Z A;  1YJN A;  1M8V A;  2D0N A;  3JB9 G;  4ZTF A;  1N6A A;  2EIF A;  8AT1 B;  1KD1 R;  3HPW A;  2LT4 A;  1GBQ A;  3SWN B;  1UGP B;  1W70 A;  3FJ5 A;  2KRS A;  1P92 A;  1VQ5 Q;  3AT1 B;  2KE9 A;  2CSI A;  2HNI A;  1OEB A;  2JTM A;  2AIR B;  5IHN A;  2DJZ A;  3RIR A;  1QLY A;  3EGD B;  1TOV A;  1LCK A;  1D09 B;  3CME A;  3BFM A;  4BY6 C;  2QAZ A;  3M56 A;  3OS1 A;  3OSV A;  1EIF A;  2NUZ A;  3NGP A;  1OX9 A;  2YUO A;  1WX6 A;  5LJ3 g;  3CC4 A;  5GAN 7;  4ZTJ A;  3JCM e;  1VYT A;  2E6N A;  1WZO A;  2RI3 A;  4LNP A;  1K9A A;  3OY9 A;  2E5Q A;  2M02 A;  5DM7 R;  1VQK T;  1R8O B;  1E6H A;  3HKS A;  4RTW A;  2M1H A;  3CCM A;  4O6J A;  4M78 A;  1NLO C;  2X3X D;  3UWN A;  2DXB A;  2O31 A;  1VQ8 A;  3M5A A;  1YHQ Q;  2PUK B;  4PK4 A;  4J6X A;  2QTX A;  3ULR B;  1QVF S;  4PL6 A;  2DXC A;  3TSW A;  2KI7 A;  4L6V 5;  1VQ5 A;  3CCR T;  2CH4 W;  1UGR B;  2LDM A;  6AT1 B;  2CKK A;  2ZGW A;  4MDX A;  2AKL A;  1YJ9 T;  4P5N A;  5LJ3 d;  2XIC A;  1ZBX A;  5KYN A;  1GFC A;  4F16 A;  2X9H A;  3CME Q;  3Q1J A;  1PKS A;  5CKF A;  2K9G A;  1HXD A;  3DLL A;  1IGQ A;  2DA9 A;  2XDP A;  2QEX T;  2YUQ A;  1ABO A;  2ROT A;  4DEX A;  2M16 A;  3QDF A;  2R5M A;  4Y91 A;  2JMC A;  4C0D C;  4BE2 A;  3L2U A;  3QZ9 B;  4PJO F;  1WYX A;  1LPL A;  1UG1 A;  5GJV B;  3QWX X;  3EFO A;  3SFM A;  5FWB A;  2XD0 A;  4PJN A;  4HA8 A;  3CBM A;  2QDL A;  1OV3 A;  4BI4 A;  1RAG B;  4BDY A;  2VV5 A;  3UA7 A;  2PNI A;  4C5G A;  2EKO A;  4OVA A;  3MEW A;  3NTK A;  3OYM A;  2F2X A;  3CCQ Q;  3KUF A;  1YJN T;  2QTV A;  4IKF A;  1HYO A;  2LNH B;  4QVD A;  4J9H A;  1QVG P;  1VOM A;  3QPH A;  3MJX A;  3VS5 A;  3PTA A;  3NMZ C;  1N8R U;  4JLI A;  2J6O A;  3MO8 A;  2X3W D;  2Y4Y A;  3JRZ A;  1PKT A;  2E65 A;  2GTJ A;  5FU7 B;  3G6E Q;  1VQ5 T;  2E10 A;  2AZS A;  4FW2 A;  1M2V A;  2EPD A;  1Q86 U;  2PU9 B;  4M7A G;  2MK5 A;  2CSQ A;  4M78 E;  1CKB A;  4XAX B;  3EG2 A;  1WJQ A;  5KYY B;  4BE0 A;  4NS5 A;  4EMG A;  3CCJ T;  1YHQ T;  3SD4 A;  1VQ9 A;  2W0Z A;  1QCN A;  2AKK A;  3OYY A;  1QW1 A;  3CCE Q;  3O5Z A;  4HCZ A;  2JMA A;  1G83 A;  3A8M B;  2Y4X A;  4IUP A;  2ZCF B;  1RL2 A;  2QQ9 A;  2WAC A;  4Z89 A;  1O9S A;  5FRM A;  3UDC A;  2LCC A;  1OU9 A;  4M7A E;  4A54 A;  2LJ1 A;  1M1F A;  3TCJ A;  4FYW B;  4C92 C;  2QEX Q;  4M77 C;  4FL6 A;  4PNO A;  4J9I A;  2AZV A;  4Q5W A;  1YJ9 A;  1H92 A;  2VWF A;  2KSS A;  3EGD A;  2D9T A;  4BUG A;  2O88 A;  1K0S A;  2FPE A;  4JRK A;  2QA4 Q;  1M2V B;  1K9M U;  4KBM B;  1RLP C;  1G2B A;  4ZNX A;  3L2Z A;  1EFN A;  1CKA A;  3RUX A;  2PQW A;  3LLR A;  3VS0 A;  1X27 A;  3OS0 A;  1I5L A;  5FRO A;  1BI2 A;  1Z9Z A;  4JRQ A;  3MEV A;  1WHG A;  3T9N A;  1BCO A;  1B34 B;  2RJE A;  1UGQ B;  1YIT Q;  3QII A;  1KHC A;  3OW2 S;  2QG9 B;  5GAN 3;  3MCA B;  3S3M A;  2CYZ B;  2RJD A;  4M7A B;  1TS9 A;  1Y0M A;  1D1C A;  2QA4 T;  4HVU A;  5A2Q E;  1ZSZ B;  1IB8 A;  2GQV A;  4N4G A;  5AYF A;  3LX7 A;  3F70 A;  2LNV A;  2YLB A;  1ZUK A;  3CC4 T;  2LTO A;  2V26 A;  3OYK A;  2DL7 A;  3ZFJ A;  1RLQ C;  1VQP Q;  5GJW B;  1OZ3 A;  1QP2 A;  3SB2 A;  1HSQ A;  4AFS C;  2OTJ Q;  4RCB A;  2NLU A;  4JS5 A;  3QZ5 B;  4MMK A;  3VS7 A;  4KGX B;  3URG A;  3VS3 A;  1N8R C;  3CC7 T;  2O9S A;  5GAM j;  4LDY A;  1W2B S;  2HSE B;  1JJ2 A;  2M0Y A;  2KXC A;  4J7I A;  5D7U A;  2E41 A;  3MEA A;  2OAU A;  4XTY A;  1E7O A;  4J9B A;  3CPW S;  3N5B B;  1SSH A;  1OZ2 A;  2CP3 A;  4N0A A;  1SG5 A;  2GFA A;  4E7K A;  1ZX6 A;  1WHH A;  4PFO A;  4ELZ C;  4KT0 E;  5GAO r;  4JZ3 A;  2RMO A;  2ZZD A;  1B7T A;  1YWO A;  4AMC A;  1V29 B;  4E2F B;  3G4S T;  4X9D A;  2DF6 A;  5M9O A;  4D8D A;  3R6N A;  3A1P A;  2DZ9 A;  2KDS A;  2MPX C;  5GAM e;  1QKW A;  4DBF A;  5LJ5 j;  4M77 D;  3EFO B;  3WVE B;  3CC2 Q;  5GMK l;  2ESW A;  2QQB A;  3WVD B;  3PE0 A;  3L2W A;  4F7U E;  4DOW A;  2IPO B;  4IUR A;  4QQD A;  2DEU A;  1Q7Y C;  2HMA A;  1G8X A;  1FYN A;  4A4K A;  5IHI A;  1PRL C;  2XMF A;  5GAN h;  2MYS A;  4FCY A;  4LD9 K;  3I56 Q;  2GFU A;  3M58 A;  3M4Y A;  3PGG A;  4DOV A;  5GMK e;  4FYY B;  1T3L A;  1Q86 C;  2COW A;  2JOY A;  3QJ6 A;  1SSF A;  2FZC B;  4VUB A;  1MNE A;  1Q7Y R;  3INZ A;  4LXC A;  2BZX A;  1JO8 A;  2DZC A;  4M7A D;  4L59 A;  2BTT A;  3JCM V;  3D7S B;  1D3B B;  5EC7 A;  3M53 A;  2KXD A;  1M1K U;  2DJQ A;  2DLP A;  4JLG A;  2L89 A;  4OB2 B;  3RDV A;  1VQ9 T;  4A4F A;  1YHQ A;  1S72 A;  3EG1 A;  5CVI A;  4LN2 A;  2KRN A;  1NYG A;  3M0S A;  1VQL T;  1YI2 T;  3OB9 A;  4PLL A;  4M78 D;  4E7H A;  1YBY A;  3HRU A;  1GBR A;  3L42 A;  2V8J A;  5FLX E;  5IHK A;  1S72 T;  2EYX A;  4C5H A;  2EWN A;  3G4S A;  3OSS C;  2HSP A;  2A37 A;  2ENM A;  2JT4 A;  3VRZ A;  1YCS B;  3EG9 B;  3VYH B;  2V1Q A;  1Y7X A;  5GAN 8;  2CRE A;  4PJO E;  2F1L A;  2GCX A;  3PMT A;  4FYV B;  2VVK A;  3H9N A;  1X75 C;  1T0J A;  2ZPG B;  1YP5 A;  2CUD A;  2JM8 A;  5FW9 A;  3J80 E;  1ABQ A;  4M7A C;  5GAN 2;  2Y90 A;  4FW1 A;  4QW2 A;  1UEC A;  1N27 A;  5GAN g;  2V1R A;  4EMH A;  2XKO C;  1BIA A;  2OAW A;  2GQI A;  2QGF B;  5GMK j;  2HBW A;  4M7D A;  2CP2 A;  3OYN A;  1RUW A;  3FB9 A;  1FX7 A;  4E7S A;  2JXB A;  4LDX A;  1X6G A;  2KVQ G;  2NUT A;  1G3Y A;  3H0F A;  4FT2 A;  4JJD A;  3CC2 T;  1LJO A;  2RHI A;  4ZGD B;  3OYF A;  4A4E A;  3BDU A;  3ZBD A;  5LJ5 g;  2DD5 A;  3SWN C;  2MI6 A;  1DJ7 B;  1I0C A;  4M4Z A;  3CCL T;  1Q81 U;  1X6B A;  1JRI A;  2KEA A;  3S6W A;  1NYF A;  4AG1 C;  3G4S Q;  1NEG A;  1D1B A;  4CC3 A;  4RG8 A;  1VA7 A;  1ARK A;  4Y92 A;  4C8Q F;  2RNA A;  2J6K A;  4JJB A;  3G7Z A;  2NUP A;  4DA4 A;  3H0I A;  1YI2 A;  1ZLM A;  1AOJ A;  3JCM h;  4ANJ A;  5LL6 S;  4LDW A;  1VQ8 T;  2NWM A;  1IZ6 A;  2EKH A;  1VQ9 Q;  1UJY A;  1MGQ A;  4LUD A;  1VQ4 Q;  3VS1 A;  5GAM h;  3PFS A;  5FU6 C;  4OF1 A;  5GAN j;  4XU3 A;  2AHJ B;  2WSC E;  2FRW A;  1EX4 A;  8ATC B;  4BY6 B;  1UUE A;  2O4X B;  3H0H A;  1RAE B;  2CS7 A;  3LWI A;  4JRP A;  1VUB A;  2NYS A;  2A7Y A;  1BBZ A;  2OJ2 A;  1PD0 A;  3LGF A;  3TU4 K;  2E70 A;  4HVW A;  3RKY A;  1G3W A;  1NJI C;  1UFF A;  1JJ2 P;  1FMV A;  4ZGJ B;  3JCM W;  2JTF A;  5FWC A;  3FDR A;  1RAA B;  2IVW A;  2V8I A;  3TSZ A;  4ESR A;  1YIJ Q;  5A0L A;  4C0G A;  2LQW A;  2QXF A;  2BE7 D;  2EQU A;  2XG8 D;  3VS2 A;  2NUP B;  1D0Y A;  2D8J A;  2EBP A;  1ZA1 B;  1KQS A;  3BE3 A;  2RN8 A;  1AD5 A;  5GAN e;  4BE1 A;  3CD6 Q;  3I5R A;  5KCO A;  1VQ7 A;  1KIK A;  1QVP A;  1G3S A;  4ATO A;  1Q82 R;  3I5S A;  1GCQ A;  2LT1 A;  2MWP A;  1VQM T;  1H3H A;  2G3R A;  3GBQ A;  3UF4 A;  1IRX A;  3J81 E;  2DIQ A;  1NZ9 A;  1R0C B;  1AHJ B;  4J6Y A;  4DBH A;  4QQG A;  5I22 A;  1RAD B;  4C0F A;  1IXD A;  1FXX A;  2D1X A;  1M1K R;  3DB3 A;  4OMF B;  3E9F A;  2KQW A;  1Q81 R;  1M4Z A;  2DXU A;  1KJW A;  4KUI A;  1O75 A;  5HK3 A;  2XDD A;  2A08 A;  3LH0 A;  4EDU A;  4CRI A;  1M9S A;  1T0H A;  3O8V A;  1KSW A;  1VIE A;  1WXU A;  2BZ8 A;  4C92 E;  4IUT A;  2DIG A;  2JUF A;  1NLP C;  3CC7 A;  2K3B A;  3MHX A;  3X26 B;  3SEM A;  2E64 A;  4M75 G;  3VS4 A;  1FWZ A;  2LC4 A;  2KR3 A;  4KH0 B;  5GAN 5;  1UTI A;  1KC8 C;  1JJ2 S;  5D6Y A;  2KT8 A;  2QQR A;  1BK2 A;  2K4Y A;  2P0K A;  1Y07 A;  3PMI A;  5KYU A;  1WQ7 A;  2QQA A;  3EG9 A;  2C06 A;  1ZUY A;  1KD1 U;  2RI2 A;  4OMN A;  2DFU A;  4M75 A;  2YT6 A;  2HBP A;  4M78 C;  2FL7 A;  3JCM J;  2HQX A;  4OGC A;  2YRV A;  3QUI A;  2J06 A;  4RUG A;  1M27 C;  4FIB A;  4R0K A;  3CBP A;  5KYX B;  2JS0 A;  4M78 F;  3CCL A;  4B6M A;  1XNI A;  3M0R A;  2X4Y A;  4FYX B;  1MND A;  3RR6 A;  4F7U F;  5KCH A;  5GAM g;  2COY A;  1VYU A;  1X69 A;  4N4H A;  3JCM g;  3L2Q A;  3PVQ A;  1S1N A;  1K8A R;  5GAN f;  1X43 A;  2EQK A;  2EQJ A;  5KYW B;  3QO3 A;  4C5E A;  4WTO B;  3QWY A;  4EMK A;  1BI1 A;  2CT3 A;  2EW3 A;  1M90 R;  2RQR A;  2KRO A;  4XQ3 A;  1U06 A;  3OYA A;  2EYZ A;  1KC8 U;  2RQU A;  2F69 A;  3MP6 A;  2HKN A;  1UB4 A;  3FLG A;  5IT9 E;  2MMP A;  2VGN A;  2G6F X;  4B9W A;  1G3T A;  2EYW A;  4C8Q A;  1WXB A;  4PJO A;  1I5O B;  4C5I A;  3UT1 A;  9ATC B;  1IHW A;  2ZAE A;  1S72 Q;  4ORZ A;  3JSC A;  1N9S A;  3A8O B;  1X01 A;  5A0G A;  3OYE A;  3CCV A;  2ED1 A;  3M0U A;  1TUG B;  1V1C A;  3REB B;  1WGS A;  5CR2 A;  4X1V A;  2ED0 A;  3G6E T;  1YIT T;  2WSF E;  2FEI A;  1QKX A;  2DKG A;  3MPU B;  4DBQ A;  2QDY B;  2X4X A;  4QVZ A;  3RMQ A;  3CCQ A;  1KG1 A;  1BCM A;  2ZPI B;  3CCU T;  4HCK A;  3OYC A;  3CCV T;  1WPY A;  1KFZ A;  2CZ7 B;  4PFP A;  4V2S A;  1W2B P;  4E7I A;  1JQQ A;  1D0Z A;  1J3T A;  1VQ6 A;  4C8Q D;  5IXF A;  2F5K A;  3QJY A;  1WFW A;  2FB7 A;  1QWF A;  3C12 A;  2FHD A;  3CQT A;  2J7I A;  3JCM P;  2K5F A;  4JJN K;  2CGH A;  3CMA Q;  2MOX A;  4CC7 A;  2VXE A;  1D0X A;  5J39 A;  2RHZ A;  1MMA A;  2DPP B;  2E6Z A;  2DYB A;  2DM1 A;  3MEU A;  1TSF A;  1KQ1 A;  1MMG A;  3LYI A;  3I9Q A;  2A0F B;  3P8H A;  2CZ1 B;  2FG0 A;  1VQ6 T;  1R77 A;  5I2S A;  2QAS A;  1M90 C;  5IN1 A;  4M77 E;  1U8R A;  1GL5 A;  2LZ6 B;  3CCM Q;  2CDT A;  2KNB B;  5D6W A;  4E7Z A;  5IAY A;  1NPP A;  4F7U B;  1VQN Q;  1B3Q A;  5GAO q;  4QVC A;  3RNJ A;  5GAN d;  1SKU B;  4DQ2 A;  5HKC A;  4R55 A;  3J7A F;  2B8A A;  2WSE E;  4MML A;  4M78 G;  2OTL Q;  2QEX A;  3MP1 A;  5HCK A;  1M90 U;  2DVE A;  2DX1 A;  2YRD A;  1D1A A;  3HFO A;  2A36 A;  2OTL T;  1YJ9 Q;  2VYT A;  5LJ5 e;  4J83 A;  3EHR A;  3QYH B;  3JB9 H;  4C0D B;  2X4J A;  1H64 1;  1K9M R;  5CKB A;  1BI0 A;  3CCR A;  4DEY A;  3P8D A;  2K57 A;  4C92 D;  2EJ9 A;  3CXC P;  1YI2 Q;  1YIT A;  1W4S A;  1I1J A;  3JB9 F;  2BUD A;  3ME9 A;  5L23 A;  4LDU A;  3L2R A;  2CP7 A;  3M4G A;  2O01 E;  2M51 A;  3EGX B;  3MKD A;  2A28 A;  3V8K A;  3VUB A;  1HJD A;  4OB3 B;  1UJ0 A;  4M75 B;  3I56 T;  2DBM A;  2MWO A;  3CEY A;  1WHJ A;  2J6F A;  4WCI A;  2M9U A;  2CP6 A;  2EGC A;  2DK3 A;  4XU1 A;  5C6S A;  2P4T A;  2DL5 A;  1VQP A;  1EZZ B;  2YWW A;  3H41 A;  2XK0 A;  3HRT A;  2OTJ A;  3HTR A;  1M30 A;  3CCJ Q;  4KGV B;  4OB1 B;  1QVG S;  3GP8 A;  3CD6 A;  2FPF A;  3EHQ A;  4M78 B;  4L5G A;  2ATC B;  2GNC A;  4TVR A;  1QVF P;  4A53 A;  1QP3 A;  3DB4 A;  4N0A C;  1WHK A;  1ZHI A;  4OML A;  2E5K A;  3EGX A;  3M0T A;  2L3P A;  3R6O A;  5CO7 A;  1VQO Q;  4ELY C;  1VQN T;  2CZ6 B;  1UGS B;  3MP8 A;  1SHF A;  3VS6 A;  3EFR A;  5LJ5 f;  3A8G B;  2FO0 A;  5CIU A;  3REA B;  3X24 B;  2P0P A;  4FSX A;  2OTJ T;  3QHS A;  4KGZ B;  4PLI A;  3ASK A;  3CC2 A;  1ZSZ C;  1LOJ A;  2EGA A;  2DL3 A;  4RTZ A;  2GGR A;  3NTI A;  2E3H A;  2GF7 A;  2RQT A;  1M1G A;  2GTO A;  4PKC C;  2HEQ A;  3L2V A;  2VC8 A;  2DL4 A;  4OMM A;  4JRI A;  2J05 A;  2QI2 A;  1RAI B;  2CP0 A;  1GFD A;  3QBY A;  3M55 A;  1BYM A;  4E47 A;  4XU2 A;  4BB7 A;  3PT9 A;  1VYV A;  4J8O A;  4EPC A;  1B34 A;  2DYI A;  1PRM C;  5LJ3 f;  2W10 A;  2DE0 X;  1UDL A;  2K6D A;  1VQM Q;  4PJO C;  3V7R A;  2DNU A;  4M75 F;  1ZSZ A;  1QWE A;  2DET A;  3JCM f;  5CQX A;  1Z9Q A;  3CCL Q;  4BD3 A;  1NJI U;  3OW2 P;  5J26 A;  2DVJ A;  2YLC A;  2EYY A;  2H8H A;  3HL8 A;  3C95 A;  3A8H B;  3HHT B;  1PSE A;  2DRM A;  2YDL A;  4M7D E;  1KQ2 A;  4F7U A;  4OMP A;  3V8L A;  3OYI A;  2CUB A;  3E9G A;  3RKX A;  1K9M C;  2XDB A;  3RKW A;  1VQP T;  4M77 B;  3ZEH A;  2DBK A;  1WA7 A;  1PG5 B;  5KYY A;  3S3O A;  5LJ5 d;  3JCM c;  3CCE T;  1I8F A;  3I55 T;  5FU7 C;  5KE3 A;  4E7L A;  3I35 A;  1WIE A;  3VKI A;  1BU1 A;  4J6W A;  4F7U G;  1VQM A;  5I11 A;  2EAY A;  2LCS A;  3HP9 A;  2L8D A;  1TG0 A;  2E12 A;  5A0D A;  4ZN3 A;  1SF9 A;  4NOY A;  1SRM A;  1TU0 B;  4ME7 A;  4AG2 C;  2AT1 B;  4AFU C;  3CCS A;  3EG3 A;  2HL5 C;  1VQ4 T;  1MMN A;  2D8H A;  4KRT A;  1UEB A;  3FRN A;  2FRY A;  4AT1 B;  1BB9 A;  1RAF B;  3THK A;  1CSK A;  3M54 A;  3QG1 A;  1K76 A;  1NE8 A;  4O5V A;  4EMK C;  3RBB B;  3JAM E;  3BDL A;  3IQL A;  4KUD K;  2XU8 A;  3M59 A;  1K0X A;  3OYJ A;  3CCS T;  1YNZ A;  2IIM A;  1H3Z A;  3KXT A;  4XK8 E;  1YCY A;  2HQH A;  1AWX A;  2JW4 A;  4F14 A;  1OPK A;  2PVO B;  1QVF A;  1E6G A;  3JB9 I;  1I07 A;  2FVU A;  3NHN A;  4M7D G;  1AEY A;  4M75 E;  3WXM B;  3ZL7 C;  3I55 Q;  3I56 A;  1SEM A;  1Q95 G;  3JB9 D;  1IRE B;  5LJ5 h;  1VIF A;  2PUO B;  3NTH A;  2DTO A;  1X2Q A;  2RM4 A;  4C92 G;  3NPF A;  1X6O A;  1NEB A;  4HVV A;  1YJW Q;  2XHC A;  5D6X A;  2L3S A;  1VQN A;  2L5Q A;  4FM4 B;  1ZBJ A;  1U5S A;  4PJM A;  4KUL A;  1OU8 A;  4Z88 A;  4C92 A;  3TQ7 P;  1TH7 A;  1M3B A;  2M0O A;  1Q7Y U;  4Z02 A;  3L1A A;  4HXJ A;  1YWP A;  4JPB W;  2K3X A;  3EH1 A;  4M7A A;  4IIM A;  2FZG B;  4MZT A;  4RG2 A;  1YIJ A;  1NBE B;  2KMT A;  2COZ A;  4NL2 A;  2OTL A;  5ECA A;  1PD1 A;  3E1S A;  2FZK B;  2RQW A;  5CAI A;  2C0T A;  4D8K A;  1TTH B;  2JM9 A;  3CCU A;  1TUC A;  4IUV A;  3PVL A;  1PCX A;  5GMK i;  1V76 A;  2QK0 A;  2YHT A;  2RQV A;  3OYD A;  4RTV A;  2RJF A;  4LD6 A;  2DMO A;  3I55 A;  4GBQ A;  1WHL A;  4XTU A;  2RK1 A;  4M7D B;  3PNW C;  4Y28 E;  2K2M A;  4CI0 C;  2LJ3 A;  4C92 B;  5GAN 4;  2ROL A;  2C0O A;  4IUQ A;  5I2M A;  3V7S A;  3OS5 A;  2HKQ B;  3TRE A;  1AWO A;  2ZPH B;  3A8L B;  3OMC A;  1AWW A;  4CC4 B;  4RCC A;  4J9E A;  1VQK Q;  3OQ5 A;  1C0M A;  2PZ1 A;  1W1F A;  4F17 A;  3LW5 E;  4M75 D;  1PHT A;  1M1K C;  2Z0W A;  2RH2 A;  4CC2 A;  3M0Q A;  3JCM Q;  2O2O A;  5GAM d;  3CBO A;  2LRQ A;  3QDR B;  2LQ8 A;  4B9X A;  2YUN A;  3TEE A;  4Z8A A;  2D0Q B;  4J5Y A;  4C8Q E;  4WF2 A;  1FMW A;  1KK7 A;  1I81 A;  1VQ4 A;  1UGV A;  2RO0 A;  4MZP A;  4JZ4 A;  4M77 A;  2JTE A;  2IG0 A;  1K73 R;  3G71 Q;  2KGT A;  3HFN A;  4XTZ A;  1VQO A;  3CCM T;  4XU0 A;  5CQY A;  1U1S A;  2DRK A;  1GCP A;  3UAT A;  1GXI E;  4HT8 A;  1WNL A;  1LVK A;  5GAM f;  4HT9 A;  2LVM A;  2XI9 A;  4OMQ A;  2CZ0 B;  3X25 B;  4HCC A;  2OX7 A;  1ACM B;  1WJR A;  2D6F A;  3GNF B;  4M77 G;  3EG0 A;  2DXT A;  1D3B A;  5CKH A;  1Q82 C;  1KD1 C;  2YSQ A;  1TUD A;  1M2O A;  2AK5 A;  2DAQ A;  2PTK A;  1QMC A;  3C4S A;  2DTH A;  3X20 B;  1M5Q 1;  1IGU A;  3E19 A;  1WDX A;  2SRC A;  2DD4 A;  1YN8 A;  4M77 F;  4GLK A;  2JS2 A;  1JU5 C;  3JCM d;  3JCM b;  3EFS A;  2YRC A;  3NFC A;  4M7D D;  1XQH A;  3C94 A;  2NUT B;  1M3C A;  2X51 A;  2JJ9 A;  2RK2 A;  1MV0 B;  1OI1 A;  5LJ3 j;  1MHN A;  5DLQ E;  1AVZ C;  2RD1 A;  1VQL Q;  2MIO A;  3E2U A;  4MDW A;  3VJP A;  2MCN A;  4OGE A;  1KC8 R;  3ER0 A;  3VU3 C;  4YTL A;  4MZM A;  4QT7 A;  2JN0 A;  1MUZ A;  2I0N A;  4BDZ A;  2L3Q A;  3CPW A;  2EJG A;  3MET A;  2OI3 A;  2KK4 A;  1Q86 R;  2EQI A;  1OYX A;  3U23 A;  4DBR A;  2RHY A;  3CXC S;  4QKU A;  4M7D F;  2K7A A;  2HAX A;  1RAC B;  1WXT A;  1JXO A;  1WHM A;  1VQ6 Q;  1OX8 A;  1OOT A;  4JJC A;  2DTI A;  4C92 F;  4J9G A;  4JUV A;  2A3L A;  1RI9 A;  5CK9 A;  1Y71 A;  3RER A;  2O9V A;  3DLM A;  2ZPF B;  1ZA2 B;  2JVV A;  5CKD A;  1ZSG A;  3GOX A;  2JNG A;  4J9C A;  3H8Z A;  1TWB A;  3M0P A;  5KE2 A;  1U3O A;  2QA4 A;  5KYU B;  4A4G A;  1WJS A;  2RHU A;  5GAN 6;  4OMO A;  2DO3 A;  2GBQ A;  1RAB B;  2HZY A;  3CCS Q;  3X28 B;  4GY5 A;  4NL3 A;  2L2P A;  2X35 A;  2KYM A;  5DY9 A;  2H3J A;  2K5I A;  4F04 B;  1IO6 A;  4BAC A;  1H8K A;  1BKB A;  2HDA A;  5DLO A;  3FJP A;  4BI3 A;  5KYX A;  2QYZ A;  2HQE A;  1U1T A;  1SRL A;  4LDV A;  2F5T X;  4D6W A;  2K5L A;  1VQ7 T;  3AHU A;  2F2V A;  1PNJ A;  3PIO A;  1NPR A;  3GLX A;  2QGG A;  2MF2 A;  5EG2 A;  4QQ6 A;  2VB6 A;  3OYB A;  5KYW A;  2P0Q A;  2ECZ A;  1WQW A;  1T3S A;  3KBG A;  3QSU A;  2EQM A;  3CPF A;  4A63 B;  1AZE A;  3EH2 A;  4HCB A;  1TXQ A;  2P84 A;  2VAS A;  3BY7 A;  1K73 U;  2LMJ A;  3KFV A;  2VUB A;  2H3E B;  2KYB A;  1M8M A;  2RHX A;  1C6V X;  3GNG A;  5I21 A;  4XTW A;  1HK9 A;  2DIL A;  1JBM A;  2K79 A;  1YJW A;  2F2W A;  4PJO B;  4AFZ C;  1JB0 E;  3CCV Q;  5LJ3 e;  3M9Q A;  1VQ8 Q;  4IIO A;  5HY6 A;  1N5Z A;  2E3I A;  5KH6 A;  2CH4 A;  3V7C A;  3LH5 A;  3CMA T;  1OUL A;  2K3Y A;  3OBY A;  3UA6 A;  5LJ3 h;  3V8J A;  3RMS A;  4JDS A;  5FRN A;  2X4W A;  1Y96 B;  2YXY A;  4RTT A;  3SDZ A;  2LCL A;  4K11 A;  3RES A;  1BI3 A;  2KRM A;  3CCU Q;  2LJ0 A;  3QKJ A;  4J9D A;  4M7D C;  3GF5 A;  1YIJ T;  4KH1 B;  2BIV A;  1K4U S;  3EAE A;  5GAO p;  5GAO n;  1UHC A;  4LE9 A;  4E6R A;  2HL3 A;  3M57 A;  3OBW A;  3OYH A;  3SWN A;  3DKM A;  2I2L A;  3CMA A;  3A98 A;  3BW1 A;  5L8R E;  3FIF A;  3JCM X;  4OP0 A;  3JB9 J;  2RA2 A;  1AWJ A;  3LGL A;  2EYQ A;  3QYG B;  3TVT A;  3VYG A;  1WLP B;  5FU6 B;  3EGU A;  4RKU E;  1UE9 A;  2KBT A;  2RJC A;  3OW2 A;  1PM3 A;  1PSF A;  3CPW P;  2DER A;  1A0N B;  4GLM A;  3VRY A;  1X2K A;  2O4X A;  1SPK A;  2R57 A;  1C1A A;  4BI8 B;  3FEO A;  2ZPB B;  1AZG B;  2VKN A;  1VQK A;  2FPD A;  5GMK h;  1JXM A;  4E7J A;  2KAF A;  3LWH A;  4FU6 A;  4HKE A;  1XTD A;  3OYG A;  1YFN A;  5GMK m;  1QQJ A;  4RTU A;  2HD0 A;  1OPL A;  2SEM A;  1KQS P;  3CXC A;  3VUZ A;  3G71 T;  1K8A C;  3CCR Q;  2RB6 A;  4JS4 A;  4FT4 A;  1ZQ1 A;  1VQO T;  4PJO D;  1VQ7 Q;  5C0M A;  2CT4 A;  2YUP A;  3P8B B;  4ZN1 A;  2KT1 A;  1PWT A;  1G5V A;  3H6Z A;  2MAM A;  3HSB A;  3CCQ T;  5IXB A;  4II1 A;  3G1J A;  5GAO l;  5CKE A;  3G71 A;  2XID A;  1MV3 A; 
#chains in the Genus database with same CATH homology
 3G6E A;  1OZ3 A;  1QP2 A;  3SB2 A;  4PJO A;  4MZT A;  4RG2 A;  4C5I A;  2KMT A;  4NL2 A;  1YIJ A;  2OTL A;  3UT1 A;  4N4I A;  4RCB A;  2RI5 A;  4X9C A;  3GPL A;  3E1S A;  3JSC A;  1N9S A;  2NLU A;  1LNX A;  1X01 A;  3A8O B;  2R58 A;  4IUU A;  3VV0 A;  5A0G A;  2QQS A;  5CAI A;  3QZ5 B;  4MMK A;  3OYE A;  3CCV A;  4JS5 A;  3URG A;  3CCU A;  1WGS A;  1N8R C;  3CC7 T;  5CR2 A;  4IUV A;  1N9R A;  5GAM j;  4LDY A;  1W2B S;  3G6E T;  1KHI A;  3HRS A;  1JJ2 A;  4M7A F;  1YIT T;  4J7I A;  4A4H A;  5GMK i;  2E41 A;  2YHT A;  3MEA A;  2WSF E;  2OAU A;  4OB0 B;  4XTY A;  3CPW S;  3OYD A;  3N5B B;  2DKG A;  4C8Q B;  2PVG B;  2QDY B;  2X4X A;  1OZ2 A;  2RJF A;  3OMG A;  4LD6 A;  4QVZ A;  3RMQ A;  3CCQ A;  1KG1 A;  4UC4 A;  4N0A A;  4XTV A;  3CCJ A;  3CCE A;  2GFA A;  3I55 A;  4E7K A;  2ZPI B;  3CCU T;  3OYC A;  3CCV T;  4ELZ C;  1WPY A;  2CZ7 B;  4KT0 E;  5GAO r;  4V2S A;  4C0Z A;  4XTU A;  4E7I A;  2RK1 A;  4M7D B;  2V8K A;  2ZZD A;  3FC3 A;  2E1H A;  1V29 B;  3PNW C;  4Y28 E;  3G4S T;  1VQ6 A;  4C8Q D;  2F5K A;  4X9D A;  3QJY A;  4CI0 C;  5M9O A;  2FB7 A;  4C92 B;  3C12 A;  2FHD A;  5GAN 4;  2DZ9 A;  2KDS A;  4IUQ A;  2VGM A;  3JCM P;  2K5F A;  5I2M A;  5GAM e;  3V7S A;  2ZPE B;  3OS5 A;  4JJN K;  3TRE A;  2CGH A;  3QXE B;  3CME T;  2ZPH B;  5LJ5 j;  2VXE A;  3A8L B;  2LQK A;  5J39 A;  2RHZ A;  3OMC A;  4M77 D;  2DPP B;  4C8Q C;  1VQL A;  2E6Z A;  3WVE B;  5GAO m;  4RCC A;  5GMK l;  4J7F A;  3MEU A;  2QQB A;  1QVG A;  3WVD B;  3L2W A;  3PIP A;  4F7U E;  1KQ1 A;  4DOW A;  3OQ5 A;  3CD6 T;  1I4K 1;  2L3R A;  4IUR A;  4QQD A;  3LYI A;  2VXF A;  3LW5 E;  2FYK A;  1Q7Y C;  4M75 D;  5J3B A;  3P8H A;  1M1K C;  2CZ1 B;  5HK0 A;  2RH2 A;  1VQ6 T;  3A5Z B;  5I2S A;  1RI0 A;  1M90 C;  5IN1 A;  4A4K A;  4M77 E;  1XOV A;  3JCM Q;  1U8R A;  5GAN h;  2DEQ A;  4LD9 K;  2GFU A;  5GAM d;  3M58 A;  3CBO A;  2LRQ A;  3M4Y A;  2LQ8 A;  3PGG A;  3QDR B;  5D6W A;  4DOV A;  5IAY A;  1NPP A;  4F7U B;  4B9X A;  5GMK e;  5GAO q;  1Q86 C;  3TEE A;  2JZ2 A;  3OYL A;  4QVC A;  2JOY A;  3QJ6 A;  5GAN d;  1SSF A;  4VUB A;  2D0Q B;  2R5A A;  4J5Y A;  4C8Q E;  4WF2 A;  4DQ2 A;  5HKC A;  4R56 A;  4R55 A;  3INZ A;  1I81 A;  1VQ4 A;  4M75 C;  2DZC A;  3J7A F;  4M7A D;  4L59 A;  2KY9 A;  2RO0 A;  2B8A A;  2WSE E;  4MML A;  4MZP A;  3JCM V;  4M78 G;  4M77 A;  2QEX A;  3MP1 A;  3OS2 A;  1M90 U;  2DVE A;  2IG0 A;  1D3B B;  3HFN A;  3M53 A;  4XTZ A;  1VQO A;  3CCM T;  4XU0 A;  5CQY A;  2BKD N;  1M1K U;  4XTX A;  3HFO A;  3UPU A;  4X34 A;  1U1S A;  4JLG A;  2L89 A;  4C8Q G;  4OB2 B;  2OTL T;  1VQ9 T;  4PJO G;  2VYT A;  4A4F A;  1K73 C;  1YHQ A;  2LX9 A;  5LJ5 e;  1S72 A;  1GXI E;  3GIB A;  1K8A U;  4HT8 A;  1WNL A;  4J83 A;  5GAM f;  4HT9 A;  1YJW T;  2LVM A;  5CVI A;  3QYH B;  1Y96 A;  2XI9 A;  3JB9 H;  4C0D B;  2X4J A;  1H64 1;  2CZ0 B;  3X25 B;  4HCC A;  1W2B A;  1BIB A;  4EMK B;  4RMO A;  1VQL T;  1WJR A;  5CKB A;  5CCA A;  1Q82 U;  2D6F A;  1BI0 A;  3S3N A;  3GNF B;  4M77 G;  3CCR A;  1YI2 T;  3OB9 A;  4PLL A;  2DXT A;  1D3B A;  3P8D A;  2K2V A;  4M78 D;  5CKH A;  4E7H A;  1YBY A;  2EFI A;  3HRU A;  2K57 A;  3L42 A;  2V8J A;  4C92 D;  5FLX E;  2PVD B;  2EJF A;  2EJ9 A;  1Q81 C;  1Q82 C;  1KQS S;  4ZGE B;  3OA6 A;  1KD1 C;  1S72 T;  1YJN A;  1M8V A;  1YIT A;  3JB9 G;  1W4S A;  4C5H A;  2EWN A;  2DAQ A;  3OSS C;  3G4S A;  2BUD A;  3JB9 F;  3ME9 A;  3C4S A;  2DTH A;  4LDU A;  1N6A A;  2EIF A;  3M4G A;  3L2R A;  2O01 E;  3HPW A;  4ZTF A;  2LT4 A;  3VYH B;  3X20 B;  1M5Q 1;  3E19 A;  3SWN B;  1Y7X A;  1UGP B;  5GAN 8;  2DD4 A;  4M77 F;  4GLK A;  4PJO E;  3V8K A;  3VUB A;  1P92 A;  2GCX A;  4OB3 B;  3JCM d;  3PMT A;  3JCM b;  4M75 B;  3I56 T;  3EFS A;  2MWO A;  3NFC A;  4M7D D;  1X75 C;  2ZPG B;  3CEY A;  1XQH A;  2HNI A;  2JTM A;  2M9U A;  2DJZ A;  3C94 A;  3RIR A;  2DK3 A;  2RK2 A;  3J80 E;  1OI1 A;  4XU1 A;  5C6S A;  1MHN A;  5LJ3 j;  5GAN 2;  2Y90 A;  4M7A C;  5DLQ E;  2P4T A;  3CME A;  4QW2 A;  1VQP A;  1N27 A;  3BFM A;  2XK0 A;  5GAN g;  4BY6 C;  2RD1 A;  4EMH A;  3HRT A;  2OTJ A;  2XKO C;  1BIA A;  4MDW A;  3M56 A;  4OB1 B;  3VJP A;  3OS1 A;  5GMK j;  1QVG S;  4M7D A;  3OSV A;  3OYN A;  1EIF A;  3FB9 A;  3GP8 A;  4OGE A;  3CD6 A;  3ER0 A;  5LJ3 g;  3VU3 C;  4YTL A;  3CC4 A;  1FX7 A;  4M78 B;  4MZM A;  4LDX A;  5GAN 7;  4L5G A;  4ZTJ A;  2JN0 A;  2KVQ G;  3JCM e;  4TVR A;  1G3Y A;  4FT2 A;  4BDZ A;  2E6N A;  4A53 A;  2RI3 A;  3CPW A;  1QP3 A;  2EJG A;  3DB4 A;  3MET A;  3CC2 T;  3OY9 A;  1LJO A;  2KK4 A;  2E5Q A;  2RHI A;  4N0A C;  4A4E A;  4ZGD B;  3BDU A;  3OYF A;  1OYX A;  3ZBD A;  1ZHI A;  2RHY A;  5LJ5 g;  5DM7 R;  3CXC S;  2DD5 A;  1R8O B;  3SWN C;  1VQK T;  4M7D F;  2MI6 A;  3HKS A;  1DJ7 B;  2M1H A;  3CCL T;  2HAX A;  3CCM A;  1Q81 U;  4O6J A;  2DTI A;  3R6O A;  4M78 A;  4C92 F;  1JRI A;  5CO7 A;  4ELY C;  4JUV A;  3UWN A;  1VQN T;  2CZ6 B;  2DXB A;  1VQ8 A;  3S6W A;  1UGS B;  2A3L A;  5CK9 A;  3MP8 A;  1Y71 A;  3RER A;  3DLM A;  2ZPF B;  5CKD A;  2JVV A;  3M5A A;  3EFR A;  5LJ5 f;  3GOX A;  3A8G B;  2PUK B;  5CIU A;  2JNG A;  4RG8 A;  3H8Z A;  3X24 B;  2P0P A;  4J6X A;  4FSX A;  4C8Q F;  2OTJ T;  5KE2 A;  2QTX A;  2QA4 A;  3QHS A;  1QVF S;  3G7Z A;  4PLI A;  4PL6 A;  4A4G A;  1WJS A;  2RHU A;  2DXC A;  3ASK A;  5GAN 6;  4DA4 A;  4L6V 5;  2DO3 A;  3CC2 A;  1VQ5 A;  3X28 B;  3CCR T;  1YI2 A;  4GY5 A;  3JCM h;  1UGR B;  2LDM A;  4NL3 A;  2CKK A;  1LOJ A;  2X35 A;  2ZGW A;  4LDW A;  5DY9 A;  5LL6 S;  1VQ8 T;  1IZ6 A;  4MDX A;  2H3J A;  2K5I A;  1YJ9 T;  4BAC A;  4P5N A;  1MGQ A;  5LJ3 d;  1BKB A;  2XIC A;  1ZBX A;  3NTI A;  5GAM h;  5DLO A;  2GF7 A;  3FJP A;  4BI3 A;  3Q1J A;  1M1G A;  4PKC C;  3L2V A;  3PFS A;  5CKF A;  4OF1 A;  2VC8 A;  4XU3 A;  5FU6 C;  5GAN j;  2AHJ B;  1HXD A;  2HQE A;  4JRI A;  1U1T A;  2WSC E;  2QI2 A;  4LDV A;  2F5T X;  3DLL A;  2XDP A;  4D6W A;  4BY6 B;  2QEX T;  2K5L A;  3QBY A;  1VQ7 T;  3AHU A;  3M55 A;  1BYM A;  2O4X B;  4E47 A;  4XU2 A;  2CS7 A;  3LWI A;  2M16 A;  4JRP A;  3PIO A;  1VUB A;  2R5M A;  4Y91 A;  2A7Y A;  4BB7 A;  4C0D C;  1NPR A;  3GLX A;  3PT9 A;  4BE2 A;  3L2U A;  3QZ9 B;  4PJO F;  3LGF A;  3TU4 K;  2MF2 A;  2E70 A;  5EG2 A;  4J8O A;  3RKY A;  4EPC A;  1G3W A;  1B34 A;  1NJI C;  5LJ3 f;  4QQ6 A;  3OYB A;  4ZGJ B;  3JCM W;  2JTF A;  2P0Q A;  3FDR A;  2IVW A;  2V8I A;  4PJO C;  3V7R A;  1WQW A;  5A0L A;  3KBG A;  3SFM A;  4C0G A;  2EQM A;  3CPF A;  3QSU A;  4M75 F;  2QXF A;  2XD0 A;  2EQU A;  2XG8 D;  4HCB A;  3BY7 A;  4HA8 A;  3CBM A;  1K73 U;  2VUB A;  3JCM f;  5CQX A;  4BI4 A;  4BDY A;  2VV5 A;  2RHX A;  4C5G A;  3GNG A;  4BD3 A;  5I21 A;  1NJI U;  1KQS A;  4XTW A;  2YLC A;  1HK9 A;  2EKO A;  5J26 A;  5GAN e;  4BE1 A;  4OVA A;  1JBM A;  3MEW A;  3NTK A;  5KCO A;  1VQ7 A;  3OYM A;  1QVP A;  1G3S A;  3HL8 A;  4ATO A;  3KUF A;  1YJW A;  3C95 A;  4PJO B;  3A8H B;  3HHT B;  1PSE A;  1JB0 E;  5LJ3 e;  3M9Q A;  1YJN T;  4M7D E;  1KQ2 A;  4F7U A;  5HY6 A;  2LT1 A;  5KH6 A;  3V8L A;  3OYI A;  2MWP A;  1VQM T;  4IKF A;  2G3R A;  3E9G A;  3RKX A;  4QVD A;  1K9M C;  3J81 E;  3V7C A;  2DIQ A;  1NZ9 A;  1AHJ B;  4J6Y A;  2XDB A;  4QQG A;  3RKW A;  1VQP T;  3QPH A;  4M77 B;  3ZEH A;  4C0F A;  1FXX A;  3PTA A;  3CMA T;  3S3O A;  1N8R U;  3DB3 A;  4OMF B;  5LJ5 d;  3E9F A;  2KQW A;  4JLI A;  1I8F A;  3JCM c;  3I55 T;  3CCE T;  1M4Z A;  2K3Y A;  3MO8 A;  5FU7 C;  2DXU A;  2Y4Y A;  3OBY A;  5KE3 A;  4E7L A;  3JRZ A;  4KUI A;  1O75 A;  2E65 A;  5HK3 A;  5FU7 B;  2XDD A;  1VQ5 T;  3VKI A;  3LH0 A;  4EDU A;  4CRI A;  2E10 A;  1M9S A;  3O8V A;  4J6W A;  5LJ3 h;  1Q86 U;  4F7U G;  2PU9 B;  3RMS A;  3V8J A;  1VQM A;  4JDS A;  1VIE A;  5FRN A;  4M7A G;  2X4W A;  1Y96 B;  4C92 E;  2EAY A;  3SDZ A;  3HP9 A;  4IUT A;  2LCL A;  4M78 E;  2DIG A;  2JUF A;  2L8D A;  4XAX B;  3RES A;  2E12 A;  5A0D A;  4ZN3 A;  1BI3 A;  3CC7 A;  4NOY A;  3QKJ A;  3MHX A;  4M7D C;  3X26 B;  1WJQ A;  4BE0 A;  3GF5 A;  4ME7 A;  4NS5 A;  3CCS A;  1YIJ T;  2E64 A;  4M75 G;  4EMG A;  3CCJ T;  1YHQ T;  3SD4 A;  1VQ4 T;  1FWZ A;  2BIV A;  2LC4 A;  3EAE A;  5GAO p;  5GAO n;  1VQ9 A;  3OYY A;  1QW1 A;  1UEB A;  4HCZ A;  5GAN 5;  1KC8 C;  3FRN A;  1JJ2 S;  5D6Y A;  2QQR A;  2K4Y A;  3M57 A;  2P0K A;  1Y07 A;  3OBW A;  3M54 A;  3A8M B;  3PMI A;  2Y4X A;  4IUP A;  3QG1 A;  2ZCF B;  1NE8 A;  1RL2 A;  2QQ9 A;  3OYH A;  2WAC A;  3SWN A;  1O9S A;  3DKM A;  1WQ7 A;  5FRM A;  4O5V A;  3UDC A;  2QQA A;  4EMK C;  2I2L A;  2LCC A;  4M7A E;  4A54 A;  3CMA A;  2C06 A;  3JAM E;  1M1F A;  3BDL A;  3TCJ A;  1KD1 U;  2RI2 A;  3BW1 A;  5L8R E;  3FIF A;  4M75 A;  4C92 C;  3JCM X;  2HBP A;  4M78 C;  2FL7 A;  4OP0 A;  2RA2 A;  3JB9 J;  3JCM J;  3LGL A;  2HQX A;  4OGC A;  4KUD K;  2YRV A;  2EYQ A;  3QYG B;  2XU8 A;  3M59 A;  4M77 C;  3OYJ A;  3QUI A;  3VYG A;  4FL6 A;  5FU6 B;  3CCS T;  4PNO A;  4RKU E;  4FIB A;  1H3Z A;  3CBP A;  4Q5W A;  3KXT A;  4XK8 E;  1YJ9 A;  2RJC A;  3OW2 A;  1YCY A;  1PSF A;  2KSS A;  2D9T A;  4M78 F;  4BUG A;  4JRK A;  1QVF A;  2PVO B;  3JB9 I;  1K9M U;  3CCL A;  4KBM B;  2FVU A;  3L2Z A;  1XNI A;  2O4X A;  4M7D G;  2X4Y A;  4M75 E;  3RUX A;  3WXM B;  2PQW A;  3I56 A;  2R57 A;  3LLR A;  4BI8 B;  4F7U F;  5KCH A;  5GAM g;  3JB9 D;  1IRE B;  3FEO A;  5LJ5 h;  1VIF A;  2PUO B;  2ZPB B;  3NTH A;  1VQK A;  2DTO A;  3OS0 A;  1I5L A;  5FRO A;  2RM4 A;  4C92 G;  5GMK h;  1BI2 A;  4N4H A;  4E7J A;  1X6O A;  2KAF A;  3LWH A;  3JCM g;  4JRQ A;  4FU6 A;  3MEV A;  1XTD A;  4HKE A;  3OYG A;  2XHC A;  5D6X A;  3T9N A;  1VQN A;  5GMK m;  3L2Q A;  2L5Q A;  1B34 B;  2RJE A;  1UGQ B;  3QII A;  1KHC A;  5GAN f;  2EQK A;  2HD0 A;  5GAN 3;  2EQJ A;  3OW2 S;  3MCA B;  3CXC A;  3S3M A;  2CYZ B;  2RJD A;  4FM4 B;  4M7A B;  3VUZ A;  3QO3 A;  4C5E A;  3G71 T;  1K8A C;  4JS4 A;  2RB6 A;  4EMK A;  2QA4 T;  4FT4 A;  1BI1 A;  1ZQ1 A;  5A2Q E;  1VQO T;  4PJO D;  4KUL A;  5C0M A;  4C92 A;  2GQV A;  4N4G A;  4XQ3 A;  5AYF A;  3P8B B;  3OYA A;  4ZN1 A;  1TH7 A;  1KC8 U;  3LX7 A;  2F69 A;  3MP6 A;  2M0O A;  3F70 A;  3H6Z A;  1Q7Y U;  2LNV A;  2MAM A;  1G5V A;  3HSB A;  1UB4 A;  3FLG A;  2YLB A;  4Z02 A;  3CCQ T;  5IT9 E;  2MMP A;  3L1A A;  4II1 A;  3CC4 T;  2LTO A;  2VGN A;  4B9W A;  1G3T A;  2K3X A;  5CKE A;  5GAO l;  3G71 A;  3OYK A;  4M7A A;  2XID A;  3ZFJ A;  4C8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...