3EAEA

Pwwp domain of human hepatoma-derived growth factor 2 (hdgf2)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
PHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3eaeA00
3OY9A 1OI1A 2R58A 3FC3A 4BD3A 2X35A 3FLGA 3NTKA 2EQJA 3O8VA 4QQ6A 3L2WA 2DIGA 2RJFA 5KCOA 2RHIA 3E9GA 4A4EA 1RI0A 3DLMA 3NTIA 3C4SA 2K3XA 3EAEA 5D6XA 3QBYA 3L2QA 2DAQA 2RO0A 3L2UA 2M0OA 2RHZA 2RHYA 4E7HA 4HCZA 3NTHA 5IAYA 3OYEA 3PFSA 3MEUA 3QIIA 1OYXA 2EQKA 2GF7A 4PLIA 5J39A 1MHNA 5FRNA 4C5EA 4QW2A 4OVAA 3OS2A 4N4HA 2FHDA 3PMIA 4BE1A 3OYLA 4ZTJA 3LGLA 2K3YA 3OYKA 3Q1JA 2VYTA 3OYIA 4BDZA 4B9WA 5IN1A 2LCCA 3LH0A 2O4XA 4B9XA 3OA6A 3L42A 2BIVA 3OYHA 3CEYA 3LX7A 2IG0A 4BE2A 3MEAA 4Z02A 2XDPA 2E5QA 2EKOA 2YRVA 4CRIA 2RJEA 2RHUA 3MP8A 2L89A 2X4XA 2RI2A 4IUQA 5D6WA 2RJDA 3S6WA 3OYAA 3L2VA 4A4FA 1WJRA 3PMTA 5C6SA 4PL6A 3OMCA 2JZ2A 4QQDA 2RHXA 5M9OA 2L3RA 4E7LA 2BUDA 4RG2A 3OYNA 4IUTA 3E9FA 3UT1A 2QQSA 4C5HA 3MEVA 4ZTFA 3OYJA 4Q5WA 4NS5A 2GFUA 1WJQA 3OB9A 5C0MA 2BKDN 4E7JA 2LTOA 3M9QA 4QQGA 3ZEHA 4A4GA 1KHCA 4GY5A 2G3RA 5KE3A 1G5VA 2DIQA 3META 3DB3A 5KE2A 2F5KA 3H8ZA 2PQWA 2L8DA 2EQUA 3LGFA 4PLLA 2XK0A 3H6ZA 3LYIA 3SD4A 2GFAA 2P0KA 2EQMA 3MEWA 4II1A 3P8DA 2X4YA 2LVMA 4L59A 3BDLA 3MO8A 3QJ6A 2M1HA 1WGSA 3OMGA 4X34A 3GOXA 3S3MA 1OZ2A 3LLRA 3OYGA 3L2RA 3F70A 4QVZA 2M16A 4FL6A 3OQ5A 4IUUA 3MP1A 2MWOA 5FRMA 3OYBA 2CKKA 5J26A 2D9TA 3DB4A 5KH6A 2EFIA 4IKFA 5FROA 2LRQA 2WACA 3P8HA 4EDUA 4E7KA 4N4GA 2B8AA 4FU6A 3OYFA 2MWPA 3FEOA 4BE0A 3MP6A 4N4IA 4BDYA 3OYMA 3S3OA 2O4XB 3FDRA 1XNIA 3ASKA 4IUVA 2R5MA 3OYDA 5KCHA 1N27A 3OS1A 1OZ3A 3S3NA 2RI3A 4IURA 4A4HA 2JTFA 4IUPA 3QKJA 3OYCA 3KUFA 5D6YA 2HQXA 1WJSA 2QQRA 4UC4A 2R57A 3UWNA 4C5GA 2R5AA 2E6NA 2NLUA 2RJCA 1H3ZA 2RI5A 2HQEA 3PNWC 4E7IA 5CIUA 1SSFA 2X4WA 4C5IA 2LDMA 3ME9A 3OS0A 4LD6A 4BACA
chains in the Genus database with same CATH superfamily
8AT1B 4AG1C 1VQMA 4RTWA 4HXJA 3SHWA 1N6AA 2RHIA 1WQ7A 3I9QA 2YUOA 2DETA 1RI0A 3CCLT 3CCRQ 3CC2Q 2CT3A 1X69A 3CPWA 3VYGA 3QIIA 3QWYA 4GLMA 1D1BA 4N0AC 3SWNC 1FMWA 3PT9A 1K0XA 3OS2A 4C8QG 1SF9A 2VYTA 4NOYA 3SDZA 4NL2A 1NLOC 3OYHA 3T9NA 3SWNB 1WXBA 1KQSA 2MCNA 3MP8A 2L89A 2JUFA 4LUEA 1WI7A 9ATCB 4KUIA 5IHNA 1Q81U 1LJOA 4JLIA 2JOYA 4PJLA 3JB9F 2CH4A 1VQNQ 4E2FB 4AG2C 2GFUA 1HYOA 2NUTA 1K8AU 4E6RA 1RL2A 3JAME 2D8HA 5KYYA 2H8HA 4PLLA 3V7RA 3GF5A 2JS2A 1WPYA 2MAMA 2E64A 2EQMA 1X6GA 1JJ2P 3OYGA 1Q7YR 1M3AA 2OTLA 1N8RC 2LQNA 4FL6A 1YHQT 1VQ7A 1LNXA 1VA7A 1YBYA 2EFIA 4RKUE 1RAAB 1YJNA 1D1AA 5LJ3d 1KC8U 2CH4W 2EPDA 5GAN3 1ZBJA 2R5MA 3OBWA 1OU9A 4ESRA 2RI3A 2HMAA 1J3TA 3EFSA 1YJWQ 3PGGA 3FRNA 5DLQE 3UWNA 1Z9QA 2R5AA 2DEUA 2Z0WA 1U1TA 4AFZC 3BDUA 2LQWA 3NMZC 3VKIA 4IIOA 1Q82U 2KXCA 1VQ9T 5IHIA 1TXQA 4FT4A 3L2WA 2YSQA 4OMQA 2AZSA 4MMLA 1VQMT 1K9MR 4HCZA 1PSEA 4PFZA 2RK2A 1BI0A 3CD6Q 1ZX6A 4JS4A 3PMIA 4BE1A 1BIAA 1QWEA 5GAOl 1M1KR 1VQKQ 1U06A 4BI8B 2QA4Q 4A54A 3GIBA 1AWWA 3M0TA 2M51A 3A98A 2X4XA 2K5FA 4XTWA 1OULA 2H3JA 3M0UA 4PJNA 4OB0B 3G71A 2CSIA 2NYSA 3CC4Q 1IHWA 4M78F 2D1XA 5KYNA 4F7UB 1WXTA 4NS5A 2BKDN 4GLKA 1A0NB 2DYBA 1C6VX 4RTUA 1TG0A 2ROLA 3EG2A 5CKDA 2MOXA 3MO8A 3GOXA 1M3BA 1ABOA 2FPFA 1S1NA 4D6WA 1B34A 2KK4A 4JPBW 1RAEB 2X51A 5J26A 4F7UE 2OTLT 2FB7A 1BKBA 4M7AA 2E5KA 5GANf 4BDYA 3S3OA 1VQ7T 3FDRA 2QEXT 1W2BA 1YJNT 4ZGJB 3CCVA 3VS2A 4P5NA 5LJ5h 2XU8A 5GAN5 4C0GA 2PNIA 2RJCA 1VQLT 2OAWA 4M75C 2LCLA 1NJIU 1VQ5Q 3TVTA 4M7AC 3OW2A 4FYXB 4C5IA 5ECAA 2CDTA 5DM7R 2KT1A 4BACA 1JJ2S 1GFCA 5A0GA 4BD3A 1EFNA 1BIBA 4M75B 1V29B 3M4GA 4M7AB 3DLMA 3NTIA 1GBRA 2K3XA 3J81E 3CCLQ 4XTUA 5A0LA 4OMFB 1OYXA 4PFPA 2L3PA 1OEBA 3INZA 3FJPA 2E3HA 2FHDA 1NPRA 4Z89A 2NUPA 1M8MA 3TSZA 3I56A 1E6GA 3HFNA 2ATCB 3G7ZA 3VYHB 1RABB 4M75E 5FW9A 1QLYA 2KBTA 2AKKA 4M7AE 3BW1A 2OI3A 2KQWA 1QVFS 2DXCA 5I2SA 4PL6A 3OMCA 1F1BB 1TH7A 4ATOA 4C0DB 3HL8A 3G71T 3MEVA 3MCAB 3CC7T 3HHTB 2ED0A 2KE9A 1NYFA 2BE9B 2KRSA 2PQWA 3QHSA 4LXCA 5GANd 1TSFA 2X3WD 3P8DA 1OZ2A 3X24B 1YFNA 1YHQQ 5FROA 2QDLA 1X6BA 3U23A 2LT4A 2WACA 2KRNA 4FU6A 5L23A 2DRKA 5I11A 4N4IA 4JUVA 1TUCA 2O4XB 3OYDA 2VVKA 4DEXA 2E41A 2V1QA 2RQWA 5HKCA 4IURA 2ESWA 4UC4A 1PM3A 1WXUA 5HY6A 1E6HA 1R77A 2CUBA 5LJ3g 1EZZB 4E7IA 3CCVT 1Z9ZA 3R6OA 1JBMA 1JEGA 3C95A 2R58A 1U5SA 3RDVA 1VQ9Q 2LJ0A 1M1FA 4FSSA 2EYWA 4J9HA 2YLBA 4PK4A 1Q7YC 3M56A 1AEYA 3CPWS 1NG2A 2RO0A 1VQMQ 5IAYA 3NTHA 2FEIA 3QYGB 3JCMb 4F7UG 1TS9A 4FSXA 4HKEA 2LNVA 1D0XA 1M2VA 1PRMC 4QKUA 2VUBA 4ORZA 3OYIA 3PIOA 1JQQA 4WCIA 1X6OA 1KQSS 5LJ3e 4BE2A 3MEAA 2Y90A 1G3WA 1W4SA 3CCRT 2K7AA 3CC2T 1D0ZA 4F14A 2ROTA 2SRCA 4C92D 2OJ2A 1X01A 2JZ2A 1PD0A 4K11A 2DKGA 1M27C 3CCMA 1X43A 1WJQA 1M2VB 1OU8A 4LDXA 3M9QA 1P92A 3JCMd 1K0SA 2KT8A 3N5BB 2DXUA 2CT4A 5DY9A 4KGZB 1LPLA 3MEWA 1MNEA 2DL5A 2LJ3A 4R55A 1QP3A 4WTOB 4XU2A 2QK0A 3M59A 1NEBA 1UECA 2QGGA 5GJVB 4M75G 1VQNT 1ACMB 4IUUA 1VQOA 1I8FA 2GNCA 3UA7A 4M7AG 4QVCA 2HKNA 4M78A 4N4GA 3OYFA 3FEOA 4BE0A 3EGUA 1VQ7Q 1WHGA 1ZA2B 2IPOB 2JNGA 1GCPA 4IUPA 1JXOA 5LJ3j 1YJNQ 5GAN6 1UGSB 2HQEA 2ZPIB 3VS0A 4BB7A 4PJOD 1SRMA 2X4WA 4LDYA 1YJ9A 2Y4YA 1N5ZA 1RUWA 2YUNA 2DBKA 1OX9A 2QQBA 3WVDB 2A08A 3EH2A 3NPFA 1WLPB 3G6EA 3L2QA 3HP9A 2M0OA 2MMPA 3VS6A 1YJWT 4LNPA 1WIEA 4ZGDB 2EQKA 1QCFA 2YXYA 4LUDA 2HSPA 5FWBA 3JCMP 1QCOA 2HNIA 2DMOA 1JJ2A 2O88A 4Z02A 2HQHA 4M7DC 2RHUA 3G4SA 1UGPB 2RMOA 2IVWA 1UDLA 2JXBA 2KXDA 4IUQA 2COYA 1N8RU 4M77F 4XTXA 3NFCA 4RTZA 1TUDA 4M7DB 3RMSA 3OYJA 2DXTA 2ZPBB 4FYVB 3G71Q 2E4HA 3MJXA 1ZSZA 2M0YA 3EG3A 2DM1A 2GQIA 5IXFA 3A1PA 2DVEA 1KIKA 3H0HA 2XG8D 3EH1A 2G6FX 3P8BB 3HRSA 2JW4A 4HCCA 3QDFA 4OMOA 3UDCA 2O31A 1R0CB 1ZBXA 3HRUA 2V8IA 3ZBDA 1E7OA 4HVWA 4M7DE 1FYNA 1NBEB 1K4US 4HCKA 1NYGA 5EG2A 1KD1C 2QASA 3KXTA 1VQOT 3ASKA 3QJYA 2RNAA 4J9CA 2YUQA 1QVGP 4C92C 5D7UA 1G8XA 3AT1B 2AZVA 1C0MA 3OW2S 2EYYA 2F2VA 3CCVQ 2YLCA 3AHUA 4C92B 3LH5A 1GCQA 1Y96B 4JLGA 3JCMc 2K5LA 1I4K1 2ZPGB 1Q81R 5L8RE 5GANe 2PUOB 3M58A 3C4SA 1BB9A 2DAQA 1YCYA 1K8AR 4BI4A 4FYYB 3V7SA 2GF7A 3HRTA 1FX7A 1IB8A 4J8OA 3G6ET 2OTJA 2CS7A 3OYLA 3LGLA 3OYKA 3Q1JA 1YITA 1UTIA 4C92E 1R0BG 3L42A 5LJ3f 2XKOC 3RESA 1H92A 2VB6A 1TOVA 1M90R 3I56Q 2M02A 5M9OA 4PJOC 1KC8R 4IUTA 3E9FA 4KH0B 4DBQA 4C5HA 5GMKm 2C0OA 4MZTA 5CCAA 4GY5A 4PJOB 5A0DA 2L8DA 1I5OB 2YWWA 2K5IA 1Q82R 4YTLA 2DNUA 2W0ZA 5IXBA 3S3MA 5GANj 1WHKA 3L2ZA 1UHCA 4FIBA 4FM4B 1MMDA 4MZMA 3JCMg 3EHQA 4M75D 4X1VA 1T3SA 4M7AD 4IKFA 3D7SB 3OYYA 5CKHA 4EMKA 2HBPA 4A4KA 3HPWA 4R56A 2LQ8A 4PJOE 1QVPA 1BCOA 3S3NA 4WF2A 2EKHA 5AYFA 5GAMh 1WDXA 1BI3A 1M90U 5CIUA 4EMKC 5GAN4 3M0PA 3TREA 1YI2A 3FLGA 3O8VA 1ZSGA 1U3OA 1BI2A 2NUTB 3JCMe 4J6WA 4JRIA 5KCOA 5HK3A 2YT6A 4MMKA 2M9UA 4M7DG 4AFSC 3VS1A 5CQYA 5KYYB 2GCXA 2RD1A 1SEMA 4JZ3A 2E12A 3OSSC 5KYWA 2CYZB 2A37A 1X2KA 2PZ1A 4R0KA 2DL3A 2OTJT 3EGXA 3CQTA 5LJ5g 1YITT 7AT1B 2DTOA 2GGRA 4O6JA 3CMAA 1PHTA 1K73C 1ZUKA 2K79A 2VGNA 2DEQA 4HT8A 2AHJB 1QKWA 2QG9B 3LWIA 5KYWB 1MV0B 1X75C 1KHCA 5KE2A 3ZL7C 3M5AA 3CCMQ 1NJIR 2XK0A 4KRTA 2VV5A 2LQKA 4C8QF 2CGHA 2ZZDA 1ZA1B 4C92G 2CP0A 3M53A 4XU0A 4OB2B 4M77A 1IXDA 4OGEA 3QDRB 3P8HA 3UF4A 1ZQ1A 2BZYA 2E10A 8ATCB 2JMAA 2MWPA 2L0AA 2RF0A 1VQOQ 1AD5A 4AMCA 3X26B 3M54A 2ECZA 3PVQA 1Q95G 3LW5E 3V8JA 1VUBA 4KUDK 1CSKA 5KYXA 3EFOA 1EX4A 5I21A 4J7IA 3NGPA 2FRWA 3NTKA 1RADB 1NLPC 3WVEB 1BYMA 1W70A 5HK0A 1YI2T 1YJ9Q 1O75A 4HVVA 3QBYA 1KJWA 2D6FA 1MMGA 3QZ9B 3V8LA 1LOJA 1W1FA 2F2XA 1D3BA 1Q86C 1OQKA 3G6EQ 1Y7XA 4PJOG 3C0CA 4B9WA 1B34B 4B9XA 1UE9A 3C12A 5GAOm 3H41A 1PRLC 4O5VA 5CQXA 2YRVA 1GFDA 5D6WA 2FZGB 1MGQA 1QMCA 2KEAA 4A53A 2KRMA 2GTOA 4XU3A 1M5Q1 1HSQA 3G4SQ 3CMAT 4RG2A 4E7SA 4FCYA 2A28A 4BUGA 1IHVA 3KBGA 1M1GA 2H3EB 2X4JA 1K8AC 4ELYC 3M55A 2CP6A 2JTEA 2LP5A 2DPPB 2DL8A 2EW3A 2GFAA 1UFFA 4II1A 3EGDA 2ZAEA 2HZYA 3QJ6A 3OS5A 3OMGA 1OPKA 4AFUC 3LWHA 3LLRA 5AT1B 2COWA 2JM9A 2AIRB 3QYHB 2QI2A 1SKUB 2P4RA 1JRIA 4M78D 4XTVA 4DBFA 4E7KA 2NUPB 2DX1A 5CO7A 5GAN7 1MUZA 2ZPEB 1KC8C 2CP7A 2KYMA 2JVVA 4LDVA 2QQRA 3QXEB 4CC2A 5IH2A 3WXMB 4D8DA 1IGQA 2RI5A 4OF1A 3J80E 3PNWC 5GAN2 1SRLA 1MV3A 5EC7A 2BE7D 3VUZA 3E2UA 2C0IA 1M8VA 4OMMA 1Q82C 3SEMA 1UGVA 1BCMA 3A8MB 4QQ6A 2QXFA 3JCMf 2X3XD 3EAEA 5D6XA 4M7DD 4JJDA 3MEUA 3C94A 4QVDA 1VIEA 2RQTA 3J7AF 5J39A 1MHNA 3ZFJA 1SPKA 3JCMW 4F16A 2EWNA 2VASA 2LCCA 4X9CA 2OTJQ 2OAUA 2EKOA 4J83A 2CP2A 1YITQ 2KAFA 1UEBA 2FPEA 1T0JA 2EGCA 2L3RA 2OX7A 1IZ6A 1KSWA 1KD1U 4XTZA 1QVGA 2ZPHB 2EVRA 5CAIA 2NWMA 4CI0C 2DLPA 2B86A 2RH2A 4L5GA 3EG0A 4B6MA 3I56T 1RLQC 2EYZA 2P0KA 4PJJA 2DXBA 2BZ8A 5LJ5f 3KFVA 5KYUA 4QVZA 3EG9A 1SHGA 3GBQA 3DB4A 2Y4XA 1K9MC 3CBOA 2HEQA 2HAXA 1JB0E 1MMNA 1X27A 4CC4B 3OYCA 2QTVA 3QZ5B 2HQXA 1M1KC 1FWZA 3GNFB 2K2VA 4KGXB 1WFWA 1Y0MA 1NJIC 4C8QA 2HBWA 1RAHB 4LDUA 4HA8A 1OI1A 1U1SA 1N8RR 3DKMA 1TWBA 2EQJA 2JN0A 1TU0B 2EGEA 2RQRA 4JZ4A 1YP5A 1H3HA 2IIMA 3IQLA 4ZN3A 1YI2Q 3CCQA 4LN2A 1GXIE 3L2UA 3I5RA 2KMTA 2KI7A 2LX9A 3CXCP 4C0FA 1PWTA 2P0PA 4M78C 5LJ3h 3QUIA 2RB6A 2BIVA 3PIPA 2KROA 5FU7C 2RQUA 2PVOB 2E5QA 1VQ6A 4CC3A 5J3BA 2RJEA 2EYQA 4M78B 4J6XA 3QO3A 3S6WA 1N9SA 2VC8A 2VGMA 1I81A 4J6YA 5FU7B 2J7IA 4QQDA 2KYBA 2LMJA 5LJ5d 3CMAQ 2A3LA 1VQ4A 2WSCE 1Y71A 2C0TA 2DJZA 2DL7A 2DK3A 4E7JA 2O01E 4A4GA 3I5SA 2G3RA 4MZPA 3H0FA 3H8ZA 1VYTA 4F7UF 1WZOA 2CSQA 1WYXA 2CZ7B 2DF6A 4M78E 4RTTA 3UA6A 2J6FA 1VYUA 2LZ6B 4L59A 3VRYA 2HSEB 2PTKA 3F70A 2O9SA 5GAOq 2A0FB 4FYWB 2RQVA 1ZUYA 3H9NA 2BTTA 1BU1A 4LD9K 2B8AA 3MP6A 3CCMT 3A8HB 1QKXA 1UGRB 3X25B 3CBPA 4C5GA 1B7TA 1NE8A 3M0QA 3ULRB 2E6NA 2EBPA 3CCSA 1ZSZC 1KHIA 1SSFA 1KK7A 2PU9B 3GNGA 1WHLA 2X35A 2VXFA 4OMPA 3JB9G 4ZNXA 4HT9A 1VYVA 4XQ3A 1ZSZB 2HL3A 2DERA 1UB4A 1OX8A 1K73U 2PVDB 2VWFA 4E7HA 1AZEA 4OGCA 4M75F 4AT1B 4M7AF 4EMGA 1NZ9A 2XD0A 1OPLA 1YIJA 2PVGB 4ZTJA 1I0CA 2F5TX 4F04B 2KNBB 3I55A 2FL7A 4J5YA 3R6NA 4DA4A 2XDPA 5GAMg 4RCBA 3JB9H 1YJ9T 1S72A 3MPUB 2DD5A 1WHMA 1D09B 4MDWA 4BI3A 2JMCA 4KH1B 4E7LA 1GCQC 1XTDA 2D0NA 4Q5WA 5C0MA 3CXCS 1H641 1V1CA 2XIDA 1WA7A 3GP8A 1HXDA 2MI6A 3DB3A 5GMKj 4MDXA 3FB9A 3A8LB 2X4YA 3G4ST 4M77D 2AT1B 2D9TA 3SWNA 2AKLA 2VKNA 1Y07A 3NHNA 2K6DA 3RKXA 2LX7A 1GBQA 3CCJA 1Q86U 3CCEA 1YWPA 1Y57A 4V2SA 2NLUA 5GAN8 1KQ1A 2EGAA 1RAGB 1JXMA 1ZLMA 4J9GA 3JCMQ 3ME9A 2EQIA 4JS5A 4M78G 4FW1A 3CCST 3FC3A 5GANh 1LCKA 3E19A 2FYKA 2DIGA 1JU5C 1WX6A 1GL5A 3QPHA 2E6ZA 2RHZA 3UPUA 4PLIA 3L1AA 2QGFB 4QW2A 2DYIA 4N4HA 3TCJA 2V1RA 3LH0A 2CZ6B 3A5ZB 5GAMj 1G3SA 2CP5A 2F1LA 4JDSA 2AK5A 3CEYA 3LX7A 1YIJT 3I55T 2CZ1B 4EMKB 3JB9I 4M4ZA 4KBMB 1M9SA 4BY6C 5C6SA 1S72T 1KQ2A 5LL6S 3A8GB 2BUDA 3OYNA 2RA2A 3UT1A 3FJ5A 1QVGS 1ABQA 1KG1A 4OB1B 2F69A 2DJQA 1CKAA 3TSWA 3A8OB 2QEXA 1M2OA 4BY6B 5A2QE 3TU4K 3CCUA 1G5VA 3JV3A 3LGFA 1IRXA 2QQAA 1VQLA 2DZ9A 3LYIA 3X28B 3BFMA 1VOMA 1NPPA 2DO3A 1WGSA 2DRMA 2QTXA 3L2RA 2FZKB 1RAFB 1VQPA 1PKSA 3MP1A 2CKKA 2HDAA 2XMFA 3UATA 2RN8A 2YDLA 5FU6C 2SEMA 1QVFP 1M4ZA 4IUVA 5CVIA 2QAZA 3EGXB 3RNJA 4FW2A 2EAYA 4EMHA 1BBZA 1HK9A 3QWXX 5D6YA 5FU6B 2V26A 4F7UA 1AWXA 4OMLA 4QT7A 5LJ5e 3RBBB 1CKBA 4PNOA 3CCJT 3CCET 2PUKB 2LDMA 5GAOp 3OY9A 3JCMh 1MMAA 3JB9D 4L6V5 1Q7YU 3OBYA 4Y91A 1MNDA 3E9GA 3H0IA 2COZA 3QG1A 2RHYA 1G3YA 3CC7A 3VS7A 2RM4A 4M77C 5CR2A 3CCQQ 3BY7A 1TTHB 3CMEA 2JJ9A 3OA6A 2DBMA 4M77B 4C0ZA 2D8JA 3URGA 4E7ZA 1B07A 3PE0A 1SSHA 3OYAA 2F2WA 3RR6A 3VS4A 2HCKA 3RIRA 1UJYA 1VQ6Q 4EPCA 2RHXA 1WQWA 1JO8A 2CREA 4DQ2A 2HL5C 4ZTFA 2I2LA 1PCXA 3REBB 1K9MU 4M75A 1YCSB 2A7YA 2MK5A 2DE0X 1T3LA 5LJ5j 3CPWP 1FMVA 2O2OA 5KYXB 5KE3A 3EFOB 3E1SA 4M7DF 3HKSA 2YRDA 1SG5A 2F5KA 2ZGWA 2HKQB 1VQ4Q 1QW1A 4M77E 1FMKA 3SD4A 3CCUT 1VQ8A 1M1KU 2QYZA 2ABLA 4XTYA 3CBMA 2J6KA 2K9GA 1U8RA 3THKA 1HJDA 1PSFA 5GAMf 1KQSP 1ZUUA 2FRYA 2M16A 4D8KA 1Q81C 1D3BB 1X2QA 2LC4A 1I5LA 4EDUA 2DVJA 3CXCA 1VQPT 2JM8A 4PJMA 5KCHA 4XK8E 2XDDA 3OS1A 3JCMX 4EIKA 2BZXA 4A4HA 2ZCFB 4XU1A 2MF2A 3ER0A 4XAXB 4C8QD 2KSSA 2DZCA 5GAOr 3V7CA 1M90C 2ENMA 1PD1A 3CCRA 3CC2A 3SB2A 2FPDA 2K57A 3CCSQ 4RTYA 1OOTA 2RJFA 3VS5A 4C0DC 4A4EA 1XJWB 4C92F 3QSUA 1YNZA 1KD1R 2XHCA 1C1AA 3OYEA 2KGTA 3O5ZA 2MYSA 3EGDB 4OVAA 1RAIB 4DOVA 4JJCA 2O4XA 1M30A 2I0NA 1NEGA 1YIJQ 2EYXA 4J9FA 1M3CA 2FZCB 2YRCA 1D1CA 1SHFA 2EJFA 3I55Q 3CMET 4A63B 2RPNA 1LVKA 2P4TA 1VQNA 3PMTA 3JCMV 5HCKA 1S72Q 1HD3A 2DTHA 2JS0A 5GAMd 3RERA 2EIFA 6AT1B 3FIFA 2RK1A 4Y28E 3RKWA 1BK2A 1UG1A 4IIMA 3ZEHA 1R8OB 5CKFA 2DIQA 1K76A 3VRZA 4J9BA 2C06A 1UUEA 4PFOA 2X9HA 3VV0A 4ANJA 2LVMA 4J9IA 1AT1B 4PJOF 2KVQG 2M1HA 1QQJA 1XQHA 1VQ8T 1EIFA 2CZ0B 2E70A 2EJGA 3OYBA 4AFQC 5KH6A 3MHXA 3CPFA 4DEYA 1XOVA 1YJWA 3G1JA 2CP3A 3TQ7P 2K4YA 4KGVB 2GQVA 1N27A 3MKDA 4OMNA 2QDYB 4DBHA 3KUFA 1PC0A 4JRKA 2DILA 1YN8A 3V8KA 4ELZC 1UJ0A 5FLXE 4ZN1A 1PNJA 3TEEA 4M77G 3CCJQ 3CCEQ 3EG1A 4HCBA 5I22A 2LT1A 3SFMA 1BI1A 1KFZA 1K1ZA 5IT9E 4ME7A 2WSEE 2DFUA 1AHJB 4LDWA 1ARKA 2LNHB 3DLLA 3CD6A 3HTRA 3REAB 2QQ9A 1AWJA 1D0YA 3HFOA 4RG8A 1VQKA 1ZHIA 2QA4A 2J06A 2ED1A 1W2BP 2D0QB 4FT2A 5KYUB 5IN1A 4DOWA 3EG9B 2IG0A 2KR3A 3RMQA 3VUBA 4CRIA 3CC4A 4OB3B 2JT4A 2P0QA 5IHKA 1TUGB 2RI2A 4JRQA 3OW2P 4RCCA 2RJDA 1IGUA 3L2VA 4A4FA 4TVRA 1WHHA 2JTMA 4C8QC 3JCMJ 2LJ1A 2VXEA 2DTIA 1QP2A 2OTLQ 2V8KA 3META 3M0RA 4C8QB 4E47A 2HD0A 3GPLA 2EQUA 1PG5B 2FVUA 1GRIA 4KULA 2QEXQ 1YWOA 1IO6A 3H6ZA 3CCUQ 3M0SA 1UGQB 2L3SA 2L5QA 3JB9J 3BDLA 3X20B 1RACB 1VQLQ 1K73R 1G83A 5FRMA 3VJPA 3BE3A 1I07A 3VS3A 2LRQA 1RLPC 2FO0A 4JJNK 3GLXA 1WHJA 1I1JA 3PVLA 4Z8AA 4C8QE 3OYMA 1VQPQ 4RTVA 1VQ5A 2FG0A 2ZPFB 5CKBA 2V8JA 5CK9A 2YHTA 4M7DA 1N9RA 1G3TA 2R57A 4NL3A 4RUGA 2YUPA 4Y92A 1G2BA 2K3BA 4F17A 2A36A 1H3ZA 1UHFA 1VIFA 4ZGEB 4RTXA 4LD6A 3I35A 3CCLA 4Z88A 1WNLA 2E1HA 2XICA 1AZGB 3RUXA 2L3QA 4DBRA 1W6XA 3PFSA 3CD6T 1AOJA 5FRNA 4C5EA 1PKTA 2KY9A 4J9DA 1K9AA 1VQKT 2K3YA 4BDZA 3CC7Q 2GBQA 2QA4T 1T0HA 4PKCC 5GMKe 4OP0A 4HVUA 2DD4A 1IREB 1AWOA 2GTJA 2MIOA 1OV3A 3VU3C 3CMEQ 1WJRA 1H8KA 2DA9A 2MPXC 2L2PA 3CC4T 5GMKl 5CKEA 1QVFA 4LE9A 3RKYA 4X9DA 5GANg 4C92A 3CCQT 2QQSA 1Y96A 1AVZC 3JSCA 2DL4A 3EFRA 3OB9A 1O9SA 2LTOA 4QQGA 1DJ7B 2KDSA 4J7FA 5FWCA 2LCSA 1Q86R 1W2BS 2J6OA 1B3QA 2W10A 3M57A 4VUBA 4GBQA 2K2MA 4JJBA 3JRZA 1RI9A 2CUDA 2NUZA 1VQ6T 4X34A 1YHQA 3M4YA 5I2MA 2O9VA 3PTAA 1VQ8Q 1V76A 2P84A 5GAOn 3OQ5A 2MWOA 2WSFE 1QWFA 3HSBA 2XDBA 1VQ4T 1NM7A 1XNIA 4RMOA 1FXXA 5GJWB 1OZ3A 5GMKi 4KT0E 2JTFA 3EHRA 3QKJA 2XI9A 1WJSA 4CC7A 2EJ9A 5DLOA 4JRPA 3OSVA 1VQ5T 1VQ9A 2J05A 2E3IA 5GAMe 4J9EA 5GMKh 3OS0A 4PJOA 1QCNA 2E65A 4N0AA
chains in the Genus database with same CATH topology
3OY9A 3JCMh 1VQMA 3JB9D 3A8MB 4QQ6A 4L6V5 1Q7YU 1N6AA 3OBYA 2QXFA 4Y91A 2QQBA 2RHIA 1WQ7A 3E9GA 3JCMf 3WVDB 3QG1A 1RI0A 3CCLT 3EAEA 5D6XA 4M7DD 3G6EA 3L2QA 3HP9A 2M0OA 2MMPA 2RHYA 1YJWT 1G3YA 3CPWA 3CC7A 3VYGA 3MEUA 3QIIA 2EQKA 3C94A 4ZGDB 4QVDA 1VIEA 3J7AF 2RM4A 4N0AC 4M77C 3SWNC 1MHNA 5J39A 3ZFJA 5CR2A 3PT9A 3OS2A 4C8QG 3JCMW 2EWNA 2VYTA 3BY7A 4NOYA 3SDZA 4NL2A 2LCCA 3JCMP 4X9CA 2HNIA 3CMEA 3OA6A 1JJ2A 3OYHA 3T9NA 2OAUA 4M77B 3SWNB 4C0ZA 4Z02A 2EKOA 4J83A 3URGA 1KQSA 4M7DC 2RHUA 3G4SA 3MP8A 2L89A 1UGPB 4M7AE 2JUFA 2IVWA 2KAFA 4IUQA 3OYAA 1UEBA 1N8RU 4M77F 4XTXA 3NFCA 3RIRA 4EPCA 4KUIA 1Q81U 1LJOA 2RHXA 2L3RA 4M7DB 4JLIA 1WQWA 2JOYA 4DQ2A 3JB9F 3RMSA 4ZTFA 2I2LA 3OYJA 1K9MU 2DXTA 2ZPBB 1IZ6A 1KD1U 2GFUA 4M75A 4XTZA 2A7YA 2ZPHB 1QVGA 1K8AU 5LJ5j 1RL2A 5CAIA 4CI0C 3E1SA 5KE3A 3JAME 3HKSA 4M7DF 2F5KA 2ZGWA 2DVEA 1QW1A 4M77E 4PLLA 3V7RA 2RH2A 3GF5A 2XG8D 4L5GA 1WPYA 3SD4A 3CCUT 1M1KU 1VQ8A 3P8BB 2MAMA 3HRSA 2P0KA 4XTYA 2E64A 2EQMA 3CBMA 3I56T 4HCCA 3UDCA 1U8RA 2DXBA 5LJ5f 3OYGA 1ZBXA 1PSFA 3HRUA 5GAMf 2OTLA 2V8IA 3ZBDA 1N8RC 4QVZA 2M16A 4M7DE 4FL6A 1Q81C 1D3BB 1YHQT 1VQ7A 3DB4A 1LNXA 2Y4XA 1YBYA 2EFIA 4RKUE 2LC4A 1I5LA 1K9MC 5EG2A 3CBOA 4EDUA 1YJNA 1KD1C 5LJ3d 3KXTA 3CXCA 1VQPT 1VQOT 1KC8U 2HAXA 3ASKA 3QJYA 5GAN3 2R5MA 1JB0E 5KCHA 3OBWA 4XK8E 2XDDA 3OS1A 3JCMX 5GAOp 2RI3A 4A4HA 3OYCA 3EFSA 2ZCFB 3QZ5B 3PGGA 4C92C 2HQXA 3FRNA 4XU1A 1FWZA 3GNFB 2R5AA 5DLQE 3UWNA 1M1KC 2K2VA 1U1TA 2MF2A 3BDUA 3ER0A 4XAXB 4C8QD 2KSSA 2DZCA 3OW2S 1KQSS 5GAOr 3V7CA 3VKIA 1Q82U 1NJIC 1M90C 4C8QA 2YLCA 3AHUA 4LDUA 3CCRA 4C92B 4HA8A 3CC2A 1VQ9T 3SB2A 1OI1A 1U1SA 1Y96B 4JLGA 3JCMc 2K5LA 1I4K1 2JN0A 2EQJA 2K57A 2ZPGB 3DKMA 1YJ9A 4FT4A 3L2WA 2RJFA 4C0DC 5L8RE 5GANe 4MMLA 4A4EA 2PUOB 3M58A 3C4SA 4ZN3A 1VQMT 4C92F 3QSUA 3CCQA 1GXIE 2DAQA 3L2UA 1YCYA 2XHCA 4HCZA 1PSEA 2KMTA 3OYEA 4BI4A 3V7SA 2LX9A 1BI0A 2GF7A 2RK2A 1FX7A 3HRTA 4J8OA 4C0FA 3G6ET 2OTJA 2P0PA 4JS4A 2CS7A 4OVAA 3PMIA 4M78C 1BIAA 4DOVA 3OYLA 3LGLA 4BE1A 3OYKA 3Q1JA 5LJ3h 5GAOl 3QUIA 1YITA 2RB6A 4BI8B 2O4XA 4C92E 3L42A 2BIVA 4A54A 5LJ3f 3GIBA 3PIPA 2XKOC 5FU7C 3RESA 2PVOB 2E5QA 1VQ6A 5J3BA 2RJEA 2EYQA 4M78B 2EJFA 4J6XA 2X4XA 3CMET 3QO3A 2K5FA 4XTWA 1N9SA 3S6WA 2VC8A 2VGMA 1I81A 2H3JA 2P4TA 1VQNA 4OB0B 3G71A 3PMTA 3JCMV 4J6YA 5FU7B 4QQDA 5M9OA 4M78F 5LJ5d 4PJOC 2DTHA 5GAMd 4IUTA 3E9FA 2EIFA 3RERA 4C5HA 2A3LA 3FIFA 2RK1A 4Y28E 5GMKm 1VQ4A 3RKWA 2WSCE 4F7UB 1Y71A 4NS5A 2DJZA 4MZTA 2BKDN 2DK3A 5CCAA 4E7JA 4GLKA 2O01E 3ZEHA 4A4GA 1R8OB 4GY5A 2G3RA 5CKFA 2DIQA 4MZPA 4PJOB 3H8ZA 5A0DA 2L8DA 4F7UF 2C06A 2K5IA 2CZ7B 4M78E 4YTLA 3VV0A 5CKDA 2LVMA 4L59A 4PJOF 3MO8A 2KVQG 2M1HA 3S3MA 5GANj 3GOXA 3L2ZA 1XQHA 1VQ8T 1EIFA 2CZ0B 4FIBA 4FM4B 2E70A 3F70A 4MZMA 3JCMg 4D6WA 5GAOq 1B34A 4M75D 2EJGA 2KK4A 3OYBA 5J26A 4F7UE 5KH6A 4M7AD 4IKFA 2OTLT 3MHXA 3OYYA 2FB7A 3CPFA 5CKHA 1BKBA 4EMKA 2HBPA 1XOVA 2B8AA 1YJWA 4LD9K 4M7AA 4A4KA 3HPWA 3MP6A 2K4YA 5GANf 4BDYA 3S3OA 1VQ7T 3FDRA 2GQVA 4R56A 2LQ8A 3CCMT 4PJOE 2QEXT 1QVPA 1N27A 1UGRB 3A8HB 3X25B 1W2BA 3S3NA 4WF2A 1YJNT 2QDYB 4ZGJB 3CBPA 3CCVA 5AYFA 3KUFA 4P5NA 5LJ5h 2XU8A 5GAMh 4C5GA 1NE8A 5GAN5 1BI3A 4JRKA 2E6NA 3V8KA 4C0GA 2RJCA 1VQLT 4ELZC 4M75C 3CCSA 2LCLA 5FLXE 1NJIU 1M90U 5CIUA 4ZN1A 1KHIA 4EMKC 1SSFA 3TEEA 5GAN4 4M7AC 4M77G 3OW2A 4C5IA 1JJ2S 3TREA 2PU9B 5DM7R 4HCBA 2LT1A 3SFMA 1BI1A 1YI2A 5A0GA 3GNGA 5IT9E 4ME7A 4BD3A 2X35A 2VXFA 2WSEE 3FLGA 3JB9G 3O8VA 4HT9A 1BIBA 4M75B 1BI2A 1AHJB 4LDWA 4XQ3A 1V29B 4J6WA 4JRIA 5KCOA 3JCMe 1UB4A 3M4GA 5HK3A 3DLLA 1K73U 4M7AB 3DLMA 4MMKA 3CD6A 3NTIA 2K3XA 2QQ9A 3J81E 2M9UA 4M7DG 4XTUA 2PVDB 5CQYA 4E7HA 2GCXA 1VQ9A 2RD1A 4OGCA 5A0LA 4M75F 4OMFB 3HFOA 4RG8A 1VQKA 1OYXA 1ZHIA 2E12A 4M7AF 3INZA 4EMGA 2QA4A 1NZ9A 3OSSC 2XD0A 3FJPA 1YIJA 2FHDA 1NPRA 2PVGB 4ZTJA 2D0QB 2F5TX 4FT2A 2CYZB 3I55A 1VQ6T 5IN1A 2FL7A 2OTJT 4J5YA 4DOWA 3I56A 3HFNA 3G7ZA 4DA4A 3VYHB 2IG0A 2XDPA 5LJ5g 4M75E 3RMQA 4RCBA 3VUBA 4CRIA 5GAMg 1YITT 4OB3B 1YJ9T 1S72A 2DD5A 3CC4A 3JB9H 2P0QA 2DTOA 4JRQA 2RI2A 4RCCA 2RJDA 3BW1A 4MDWA 4O6JA 3L2VA 3CMAA 4A4FA 2KQWA 1K73C 1QVFS 2DXCA 4BI3A 5I2SA 4TVRA 2JTMA 4PL6A 3OMCA 4ATOA 1TH7A 2VGNA 4C8QC 2DEQA 4E7LA 4C0DB 4HT8A 1XTDA 3HL8A 3JCMJ 3G71T 3MEVA 2VXEA 2AHJB 2DTIA 3MCAB 3CC7T 3LWIA 3HHTB 1QP2A 4Q5WA 5C0MA 1H641 3CXCS 1X75C 2XIDA 1KHCA 3GP8A 2V8KA 3META 4C8QB 1HXDA 2MI6A 3DB3A 4E47A 5KE2A 2HD0A 2PQWA 3GPLA 2EQUA 3M5AA 3QHSA 2FVUA 5GANd 4KULA 2XK0A 2VV5A 3H6ZA 5GMKj 4MDXA 3FB9A 1UGQB 3A8LB 3P8DA 2L5QA 2LQKA 2X4YA 2CGHA 4C8QF 3JB9J 3BDLA 3X20B 2ZZDA 1OZ2A 3G4ST 4C92G 3M53A 3X24B 4M77D 4XU0A 4OB2B 5FRMA 3VJPA 2D9TA 4M77A 3SWNA 4OGEA 5FROA 2LRQA 2LT4A 3QDRB 2WACA 3P8HA 1ZQ1A 2E10A 3GLXA 4FU6A 4JJNK 2MWPA 1Y07A 4N4IA 4JUVA 4C8QE 3OYMA 2O4XB 3OYDA 3X26B 3M54A 2E41A 1VQ5A 3RKXA 5HKCA 2ZPFB 4IURA 5CKBA 2V8JA 5CK9A 2YHTA 3CCEA 3CCJA 1Q86U 4M7DA 1N9RA 4UC4A 1G3TA 2R57A 4NL3A 3LW5E 5HY6A 4V2SA 2NLUA 5LJ3g 1H3ZA 5GAN8 3V8JA 1VUBA 4E7IA 3CCVT 1KQ1A 4KUDK 1VIFA 4ZGEB 3R6OA 3JCMQ 1JBMA 3ME9A 4LD6A 3C95A 4JS5A 4M78G 3CCLA 2R58A 3CCST 3FC3A 5I21A 5GANh 4J7IA 3NTKA 1WNLA 1M1FA 2E1HA 3E19A 2FYKA 2XICA 2DIGA 2YLBA 3WVEB 1BYMA 5HK0A 1Q7YC 1YI2T 3RUXA 3M56A 3CPWS 1O75A 3QPHA 3QBYA 2E6ZA 2RO0A 2RHZA 3UPUA 2D6FA 5IAYA 3NTHA 3QYGB 3JCMb 3QZ9B 3PFSA 3V8LA 1LOJA 4F7UG 3CD6T 1D3BA 1Q86C 4PLIA 3L1AA 4FSXA 4HKEA 5FRNA 2LNVA 4C5EA 4QW2A 4N4HA 2KY9A 1Y7XA 3TCJA 4PJOG 2VUBA 1VQKT 2K3YA 3OYIA 4BDZA 1Q82C 4B9WA 3PIOA 3LH0A 2QA4T 1B34B 2CZ6B 3A5ZB 4PKCC 1X6OA 4B9XA 5GMKe 5GAMj 4OP0A 1G3SA 3C12A 5LJ3e 4JDSA 3CEYA 3LX7A 5GAOm 1YIJT 4BE2A 3MEAA 4O5VA 5CQXA 2DD4A 2YRVA 1IREB 2Y90A 3I55T 1G3WA 1W4SA 2CZ1B 4EMKB 3CCRT 3JB9I 3CC2T 5D6WA 3VU3C 1MGQA 1WJRA 4A53A 4KBMB 1M9SA 4XU3A 4BY6C 4C92D 3CC4T 5C6SA 1S72T 1M5Q1 1X01A 5CKEA 5GMKl 2JZ2A 5LL6S 1KQ2A 1QVFA 3RKYA 3A8GB 3CMAT 2BUDA 4RG2A 4X9DA 5GANg 4C92A 2DKGA 2RA2A 3UT1A 2QQSA 3OYNA 3CCQT 1QVGS 4PJOA 1Y96A 1KG1A 4OB1B 4BUGA 2F69A 3KBGA 1M1GA 3JSCA 3CCMA 2QEXA 1WJQA 3A8OB 3EFRA 3OB9A 4LDXA 1O9SA 2LTOA 3M9QA 4BY6B 4QQGA 1DJ7B 2KDSA 4J7FA 5A2QE 3CCUA 3TU4K 1G5VA 2X4JA 1W2BS 1K8AC 4ELYC 1P92A 3LGFA 3JCMd 3M55A 3N5BB 2QQAA 1VQLA 2DXUA 2DPPB 2DZ9A 3LYIA 3X28B 5DY9A 3M57A 3BFMA 4VUBA 2GFAA 1NPPA 3JRZA 3MEWA 4II1A 4R55A 2DO3A 3OS5A 1WGSA 3OMGA 1QP3A 3M4YA 3QJ6A 4X34A 4XU2A 3LWHA 3M59A 3LLRA 5I2MA 1YHQA 3PTAA 2QTXA 3L2RA 3QYHB 2QI2A 5GAOn 4M75G 1VQNT 4IUUA 3OQ5A 1VQOA 3MP1A 2MWOA 1JRIA 1VQPA 1M8VA 2CKKA 4M78D 4XTVA 1I8FA 2WSFE 4M7AG 4QVCA 4E7KA 4M78A 4N4GA 5FU6C 3OYFA 2XDBA 3HSBA 3FEOA 5CO7A 4BE0A 1VQ4T 1M4ZA 5GAN7 1XNIA 4IUVA 5CVIA 4RMOA 2ZPEB 1FXXA 1KC8C 1OZ3A 5GMKi 2JNGA 2JVVA 2EAYA 4LDVA 4KT0E 4EMHA 2JTFA 4IUPA 3QKJA 1HK9A 5LJ3j 5D6YA 2XI9A 2QQRA 1WJSA 3QXEB 5GAN6 1UGSB 5FU6B 2EJ9A 3WXMB 5DLOA 4F7UA 5LJ5e 4JRPA 2RI5A 2HQEA 3OSVA 3PNWC 4OF1A 5GAMe 3J80E 5GAN2 1VQ5T 2ZPIB 4PNOA 4BB7A 3CCJT 3CCET 4PJOD 2PUKB 5GMKh 2X4WA 3VUZA 2LDMA 4LDYA 3OS0A 2Y4YA 4BACA 2E65A 4N0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OY9 A;  1OI1 A;  2R58 A;  3FC3 A;  4BD3 A;  2X35 A;  3FLG A;  3NTK A;  2EQJ A;  3O8V A;  4QQ6 A;  3L2W A;  2DIG A;  2RJF A;  5KCO A;  2RHI A;  3E9G A;  4A4E A;  1RI0 A;  3DLM A;  3NTI A;  3C4S A;  2K3X A;  3EAE A;  5D6X A;  3QBY A;  3L2Q A;  2DAQ A;  2RO0 A;  3L2U A;  2M0O A;  2RHZ A;  2RHY A;  4E7H A;  4HCZ A;  3NTH A;  5IAY A;  3OYE A;  3PFS A;  3MEU A;  3QII A;  1OYX A;  2EQK A;  2GF7 A;  4PLI A;  5J39 A;  1MHN A;  5FRN A;  4C5E A;  4QW2 A;  4OVA A;  3OS2 A;  4N4H A;  2FHD A;  3PMI A;  4BE1 A;  3OYL A;  4ZTJ A;  3LGL A;  2K3Y A;  3OYK A;  3Q1J A;  2VYT A;  3OYI A;  4BDZ A;  4B9W A;  5IN1 A;  2LCC A;  3LH0 A;  2O4X A;  4B9X A;  3OA6 A;  3L42 A;  2BIV A;  3OYH A;  3CEY A;  3LX7 A;  2IG0 A;  4BE2 A;  3MEA A;  4Z02 A;  2XDP A;  2E5Q A;  2EKO A;  2YRV A;  4CRI A;  2RJE A;  2RHU A;  3MP8 A;  2L89 A;  2X4X A;  2RI2 A;  4IUQ A;  5D6W A;  2RJD A;  3S6W A;  3OYA A;  3L2V A;  4A4F A;  1WJR A;  3PMT A;  5C6S A;  4PL6 A;  3OMC A;  2JZ2 A;  4QQD A;  2RHX A;  5M9O A;  2L3R A;  4E7L A;  2BUD A;  4RG2 A;  3OYN A;  4IUT A;  3E9F A;  3UT1 A;  2QQS A;  4C5H A;  3MEV A;  4ZTF A;  3OYJ A;  4Q5W A;  4NS5 A;  2GFU A;  1WJQ A;  3OB9 A;  5C0M A;  2BKD N;  4E7J A;  2LTO A;  3M9Q A;  4QQG A;  3ZEH A;  4A4G A;  1KHC A;  4GY5 A;  2G3R A;  5KE3 A;  1G5V A;  2DIQ A;  3MET A;  3DB3 A;  5KE2 A;  2F5K A;  3H8Z A;  2PQW A;  2L8D A;  2EQU A;  3LGF A;  4PLL A;  2XK0 A;  3H6Z A;  3LYI A;  3SD4 A;  2GFA A;  2P0K A;  2EQM A;  3MEW A;  4II1 A;  3P8D A;  2X4Y A;  2LVM A;  4L59 A;  3BDL A;  3MO8 A;  3QJ6 A;  2M1H A;  1WGS A;  3OMG A;  4X34 A;  3GOX A;  3S3M A;  1OZ2 A;  3LLR A;  3OYG A;  3L2R A;  3F70 A;  4QVZ A;  2M16 A;  4FL6 A;  3OQ5 A;  4IUU A;  3MP1 A;  2MWO A;  5FRM A;  3OYB A;  2CKK A;  5J26 A;  2D9T A;  3DB4 A;  5KH6 A;  2EFI A;  4IKF A;  5FRO A;  2LRQ A;  2WAC A;  3P8H A;  4EDU A;  4E7K A;  4N4G A;  2B8A A;  4FU6 A;  3OYF A;  2MWP A;  3FEO A;  4BE0 A;  3MP6 A;  4N4I A;  4BDY A;  3OYM A;  3S3O A;  2O4X B;  3FDR A;  1XNI A;  3ASK A;  4IUV A;  2R5M A;  3OYD A;  5KCH A;  1N27 A;  3OS1 A;  1OZ3 A;  3S3N A;  2RI3 A;  4IUR A;  4A4H A;  2JTF A;  4IUP A;  3QKJ A;  3OYC A;  3KUF A;  5D6Y A;  2HQX A;  1WJS A;  2QQR A;  4UC4 A;  2R57 A;  3UWN A;  4C5G A;  2R5A A;  2E6N A;  2NLU A;  2RJC A;  1H3Z A;  2RI5 A;  2HQE A;  3PNW C;  4E7I A;  5CIU A;  1SSF A;  2X4W A;  4C5I A;  2LDM A;  3ME9 A;  3OS0 A;  4LD6 A;  4BAC A; 
#chains in the Genus database with same CATH topology
 8AT1 B;  4AG1 C;  1VQM A;  4RTW A;  4HXJ A;  3SHW A;  1N6A A;  2RHI A;  1WQ7 A;  3I9Q A;  2YUO A;  2DET A;  1RI0 A;  3CCL T;  3CCR Q;  3CC2 Q;  2CT3 A;  1X69 A;  3CPW A;  3VYG A;  3QII A;  3QWY A;  4GLM A;  1D1B A;  4N0A C;  3SWN C;  1FMW A;  3PT9 A;  1K0X A;  3OS2 A;  4C8Q G;  1SF9 A;  2VYT A;  4NOY A;  3SDZ A;  4NL2 A;  1NLO C;  3OYH A;  3T9N A;  3SWN B;  1WXB A;  1KQS A;  2MCN A;  3MP8 A;  2L89 A;  2JUF A;  4LUE A;  1WI7 A;  9ATC B;  4KUI A;  5IHN A;  1Q81 U;  1LJO A;  4JLI A;  2JOY A;  4PJL A;  3JB9 F;  2CH4 A;  1VQN Q;  4E2F B;  4AG2 C;  2GFU A;  1HYO A;  2NUT A;  1K8A U;  4E6R A;  1RL2 A;  3JAM E;  2D8H A;  5KYY A;  2H8H A;  4PLL A;  3V7R A;  3GF5 A;  2JS2 A;  1WPY A;  2MAM A;  2E64 A;  2EQM A;  1X6G A;  1JJ2 P;  3OYG A;  1Q7Y R;  1M3A A;  2OTL A;  1N8R C;  2LQN A;  4FL6 A;  1YHQ T;  1VQ7 A;  1LNX A;  1VA7 A;  1YBY A;  2EFI A;  4RKU E;  1RAA B;  1YJN A;  1D1A A;  5LJ3 d;  1KC8 U;  2CH4 W;  2EPD A;  5GAN 3;  1ZBJ A;  2R5M A;  3OBW A;  1OU9 A;  4ESR A;  2RI3 A;  2HMA A;  1J3T A;  3EFS A;  1YJW Q;  3PGG A;  3FRN A;  5DLQ E;  3UWN A;  1Z9Q A;  2R5A A;  2DEU A;  2Z0W A;  1U1T A;  4AFZ C;  3BDU A;  2LQW A;  3NMZ C;  3VKI A;  4IIO A;  1Q82 U;  2KXC A;  1VQ9 T;  5IHI A;  1TXQ A;  4FT4 A;  3L2W A;  2YSQ A;  4OMQ A;  2AZS A;  4MML A;  1VQM T;  1K9M R;  4HCZ A;  1PSE A;  4PFZ A;  2RK2 A;  1BI0 A;  3CD6 Q;  1ZX6 A;  4JS4 A;  3PMI A;  4BE1 A;  1BIA A;  1QWE A;  5GAO l;  1M1K R;  1VQK Q;  1U06 A;  4BI8 B;  2QA4 Q;  4A54 A;  3GIB A;  1AWW A;  3M0T A;  2M51 A;  3A98 A;  2X4X A;  2K5F A;  4XTW A;  1OUL A;  2H3J A;  3M0U A;  4PJN A;  4OB0 B;  3G71 A;  2CSI A;  2NYS A;  3CC4 Q;  1IHW A;  4M78 F;  2D1X A;  5KYN A;  4F7U B;  1WXT A;  4NS5 A;  2BKD N;  4GLK A;  1A0N B;  2DYB A;  1C6V X;  4RTU A;  1TG0 A;  2ROL A;  3EG2 A;  5CKD A;  2MOX A;  3MO8 A;  3GOX A;  1M3B A;  1ABO A;  2FPF A;  1S1N A;  4D6W A;  1B34 A;  2KK4 A;  4JPB W;  1RAE B;  2X51 A;  5J26 A;  4F7U E;  2OTL T;  2FB7 A;  1BKB A;  4M7A A;  2E5K A;  5GAN f;  4BDY A;  3S3O A;  1VQ7 T;  3FDR A;  2QEX T;  1W2B A;  1YJN T;  4ZGJ B;  3CCV A;  3VS2 A;  4P5N A;  5LJ5 h;  2XU8 A;  5GAN 5;  4C0G A;  2PNI A;  2RJC A;  1VQL T;  2OAW A;  4M75 C;  2LCL A;  1NJI U;  1VQ5 Q;  3TVT A;  4M7A C;  3OW2 A;  4FYX B;  4C5I A;  5ECA A;  2CDT A;  5DM7 R;  2KT1 A;  4BAC A;  1JJ2 S;  1GFC A;  5A0G A;  4BD3 A;  1EFN A;  1BIB A;  4M75 B;  1V29 B;  3M4G A;  4M7A B;  3DLM A;  3NTI A;  1GBR A;  2K3X A;  3J81 E;  3CCL Q;  4XTU A;  5A0L A;  4OMF B;  1OYX A;  4PFP A;  2L3P A;  1OEB A;  3INZ A;  3FJP A;  2E3H A;  2FHD A;  1NPR A;  4Z89 A;  2NUP A;  1M8M A;  3TSZ A;  3I56 A;  1E6G A;  3HFN A;  2ATC B;  3G7Z A;  3VYH B;  1RAB B;  4M75 E;  5FW9 A;  1QLY A;  2KBT A;  2AKK A;  4M7A E;  3BW1 A;  2OI3 A;  2KQW A;  1QVF S;  2DXC A;  5I2S A;  4PL6 A;  3OMC A;  1F1B B;  1TH7 A;  4ATO A;  4C0D B;  3HL8 A;  3G71 T;  3MEV A;  3MCA B;  3CC7 T;  3HHT B;  2ED0 A;  2KE9 A;  1NYF A;  2BE9 B;  2KRS A;  2PQW A;  3QHS A;  4LXC A;  5GAN d;  1TSF A;  2X3W D;  3P8D A;  1OZ2 A;  3X24 B;  1YFN A;  1YHQ Q;  5FRO A;  2QDL A;  1X6B A;  3U23 A;  2LT4 A;  2WAC A;  2KRN A;  4FU6 A;  5L23 A;  2DRK A;  5I11 A;  4N4I A;  4JUV A;  1TUC A;  2O4X B;  3OYD A;  2VVK A;  4DEX A;  2E41 A;  2V1Q A;  2RQW A;  5HKC A;  4IUR A;  2ESW A;  4UC4 A;  1PM3 A;  1WXU A;  5HY6 A;  1E6H A;  1R77 A;  2CUB A;  5LJ3 g;  1EZZ B;  4E7I A;  3CCV T;  1Z9Z A;  3R6O A;  1JBM A;  1JEG A;  3C95 A;  2R58 A;  1U5S A;  3RDV A;  1VQ9 Q;  2LJ0 A;  1M1F A;  4FSS A;  2EYW A;  4J9H A;  2YLB A;  4PK4 A;  1Q7Y C;  3M56 A;  1AEY A;  3CPW S;  1NG2 A;  2RO0 A;  1VQM Q;  5IAY A;  3NTH A;  2FEI A;  3QYG B;  3JCM b;  4F7U G;  1TS9 A;  4FSX A;  4HKE A;  2LNV A;  1D0X A;  1M2V A;  1PRM C;  4QKU A;  2VUB A;  4ORZ A;  3OYI A;  3PIO A;  1JQQ A;  4WCI A;  1X6O A;  1KQS S;  5LJ3 e;  4BE2 A;  3MEA A;  2Y90 A;  1G3W A;  1W4S A;  3CCR T;  2K7A A;  3CC2 T;  1D0Z A;  4F14 A;  2ROT A;  2SRC A;  4C92 D;  2OJ2 A;  1X01 A;  2JZ2 A;  1PD0 A;  4K11 A;  2DKG A;  1M27 C;  3CCM A;  1X43 A;  1WJQ A;  1M2V B;  1OU8 A;  4LDX A;  3M9Q A;  1P92 A;  3JCM d;  1K0S A;  2KT8 A;  3N5B B;  2DXU A;  2CT4 A;  5DY9 A;  4KGZ B;  1LPL A;  3MEW A;  1MNE A;  2DL5 A;  2LJ3 A;  4R55 A;  1QP3 A;  4WTO B;  4XU2 A;  2QK0 A;  3M59 A;  1NEB A;  1UEC A;  2QGG A;  5GJV B;  4M75 G;  1VQN T;  1ACM B;  4IUU A;  1VQO A;  1I8F A;  2GNC A;  3UA7 A;  4M7A G;  4QVC A;  2HKN A;  4M78 A;  4N4G A;  3OYF A;  3FEO A;  4BE0 A;  3EGU A;  1VQ7 Q;  1WHG A;  1ZA2 B;  2IPO B;  2JNG A;  1GCP A;  4IUP A;  1JXO A;  5LJ3 j;  1YJN Q;  5GAN 6;  1UGS B;  2HQE A;  2ZPI B;  3VS0 A;  4BB7 A;  4PJO D;  1SRM A;  2X4W A;  4LDY A;  1YJ9 A;  2Y4Y A;  1N5Z A;  1RUW A;  2YUN A;  2DBK A;  1OX9 A;  2QQB A;  3WVD B;  2A08 A;  3EH2 A;  3NPF A;  1WLP B;  3G6E A;  3L2Q A;  3HP9 A;  2M0O A;  2MMP A;  3VS6 A;  1YJW T;  4LNP A;  1WIE A;  4ZGD B;  2EQK A;  1QCF A;  2YXY A;  4LUD A;  2HSP A;  5FWB A;  3JCM P;  1QCO A;  2HNI A;  2DMO A;  1JJ2 A;  2O88 A;  4Z02 A;  2HQH A;  4M7D C;  2RHU A;  3G4S A;  1UGP B;  2RMO A;  2IVW A;  1UDL A;  2JXB A;  2KXD A;  4IUQ A;  2COY A;  1N8R U;  4M77 F;  4XTX A;  3NFC A;  4RTZ A;  1TUD A;  4M7D B;  3RMS A;  3OYJ A;  2DXT A;  2ZPB B;  4FYV B;  3G71 Q;  2E4H A;  3MJX A;  1ZSZ A;  2M0Y A;  3EG3 A;  2DM1 A;  2GQI A;  5IXF A;  3A1P A;  2DVE A;  1KIK A;  3H0H A;  2XG8 D;  3EH1 A;  2G6F X;  3P8B B;  3HRS A;  2JW4 A;  4HCC A;  3QDF A;  4OMO A;  3UDC A;  2O31 A;  1R0C B;  1ZBX A;  3HRU A;  2V8I A;  3ZBD A;  1E7O A;  4HVW A;  4M7D E;  1FYN A;  1NBE B;  1K4U S;  4HCK A;  1NYG A;  5EG2 A;  1KD1 C;  2QAS A;  3KXT A;  1VQO T;  3ASK A;  3QJY A;  2RNA A;  4J9C A;  2YUQ A;  1QVG P;  4C92 C;  5D7U A;  1G8X A;  3AT1 B;  2AZV A;  1C0M A;  3OW2 S;  2EYY A;  2F2V A;  3CCV Q;  2YLC A;  3AHU A;  4C92 B;  3LH5 A;  1GCQ A;  1Y96 B;  4JLG A;  3JCM c;  2K5L A;  1I4K 1;  2ZPG B;  1Q81 R;  5L8R E;  5GAN e;  2PUO B;  3M58 A;  3C4S A;  1BB9 A;  2DAQ A;  1YCY A;  1K8A R;  4BI4 A;  4FYY B;  3V7S A;  2GF7 A;  3HRT A;  1FX7 A;  1IB8 A;  4J8O A;  3G6E T;  2OTJ A;  2CS7 A;  3OYL A;  3LGL A;  3OYK A;  3Q1J A;  1YIT A;  1UTI A;  4C92 E;  1R0B G;  3L42 A;  5LJ3 f;  2XKO C;  3RES A;  1H92 A;  2VB6 A;  1TOV A;  1M90 R;  3I56 Q;  2M02 A;  5M9O A;  4PJO C;  1KC8 R;  4IUT A;  3E9F A;  4KH0 B;  4DBQ A;  4C5H A;  5GMK m;  2C0O A;  4MZT A;  5CCA A;  4GY5 A;  4PJO B;  5A0D A;  2L8D A;  1I5O B;  2YWW A;  2K5I A;  1Q82 R;  4YTL A;  2DNU A;  2W0Z A;  5IXB A;  3S3M A;  5GAN j;  1WHK A;  3L2Z A;  1UHC A;  4FIB A;  4FM4 B;  1MMD A;  4MZM A;  3JCM g;  3EHQ A;  4M75 D;  4X1V A;  1T3S A;  4M7A D;  4IKF A;  3D7S B;  3OYY A;  5CKH A;  4EMK A;  2HBP A;  4A4K A;  3HPW A;  4R56 A;  2LQ8 A;  4PJO E;  1QVP A;  1BCO A;  3S3N A;  4WF2 A;  2EKH A;  5AYF A;  5GAM h;  1WDX A;  1BI3 A;  1M90 U;  5CIU A;  4EMK C;  5GAN 4;  3M0P A;  3TRE A;  1YI2 A;  3FLG A;  3O8V A;  1ZSG A;  1U3O A;  1BI2 A;  2NUT B;  3JCM e;  4J6W A;  4JRI A;  5KCO A;  5HK3 A;  2YT6 A;  4MMK A;  2M9U A;  4M7D G;  4AFS C;  3VS1 A;  5CQY A;  5KYY B;  2GCX A;  2RD1 A;  1SEM A;  4JZ3 A;  2E12 A;  3OSS C;  5KYW A;  2CYZ B;  2A37 A;  1X2K A;  2PZ1 A;  4R0K A;  2DL3 A;  2OTJ T;  3EGX A;  3CQT A;  5LJ5 g;  1YIT T;  7AT1 B;  2DTO A;  2GGR A;  4O6J A;  3CMA A;  1PHT A;  1K73 C;  1ZUK A;  2K79 A;  2VGN A;  2DEQ A;  4HT8 A;  2AHJ B;  1QKW A;  2QG9 B;  3LWI A;  5KYW B;  1MV0 B;  1X75 C;  1KHC A;  5KE2 A;  3ZL7 C;  3M5A A;  3CCM Q;  1NJI R;  2XK0 A;  4KRT A;  2VV5 A;  2LQK A;  4C8Q F;  2CGH A;  2ZZD A;  1ZA1 B;  4C92 G;  2CP0 A;  3M53 A;  4XU0 A;  4OB2 B;  4M77 A;  1IXD A;  4OGE A;  3QDR B;  3P8H A;  3UF4 A;  1ZQ1 A;  2BZY A;  2E10 A;  8ATC B;  2JMA A;  2MWP A;  2L0A A;  2RF0 A;  1VQO Q;  1AD5 A;  4AMC A;  3X26 B;  3M54 A;  2ECZ A;  3PVQ A;  1Q95 G;  3LW5 E;  3V8J A;  1VUB A;  4KUD K;  1CSK A;  5KYX A;  3EFO A;  1EX4 A;  5I21 A;  4J7I A;  3NGP A;  2FRW A;  3NTK A;  1RAD B;  1NLP C;  3WVE B;  1BYM A;  1W70 A;  5HK0 A;  1YI2 T;  1YJ9 Q;  1O75 A;  4HVV A;  3QBY A;  1KJW A;  2D6F A;  1MMG A;  3QZ9 B;  3V8L A;  1LOJ A;  1W1F A;  2F2X A;  1D3B A;  1Q86 C;  1OQK A;  3G6E Q;  1Y7X A;  4PJO G;  3C0C A;  4B9W A;  1B34 B;  4B9X A;  1UE9 A;  3C12 A;  5GAO m;  3H41 A;  1PRL C;  4O5V A;  5CQX A;  2YRV A;  1GFD A;  5D6W A;  2FZG B;  1MGQ A;  1QMC A;  2KEA A;  4A53 A;  2KRM A;  2GTO A;  4XU3 A;  1M5Q 1;  1HSQ A;  3G4S Q;  3CMA T;  4RG2 A;  4E7S A;  4FCY A;  2A28 A;  4BUG A;  1IHV A;  3KBG A;  1M1G A;  2H3E B;  2X4J A;  1K8A C;  4ELY C;  3M55 A;  2CP6 A;  2JTE A;  2LP5 A;  2DPP B;  2DL8 A;  2EW3 A;  2GFA A;  1UFF A;  4II1 A;  3EGD A;  2ZAE A;  2HZY A;  3QJ6 A;  3OS5 A;  3OMG A;  1OPK A;  4AFU C;  3LWH A;  3LLR A;  5AT1 B;  2COW A;  2JM9 A;  2AIR B;  3QYH B;  2QI2 A;  1SKU B;  2P4R A;  1JRI A;  4M78 D;  4XTV A;  4DBF A;  4E7K A;  2NUP B;  2DX1 A;  5CO7 A;  5GAN 7;  1MUZ A;  2ZPE B;  1KC8 C;  2CP7 A;  2KYM A;  2JVV A;  4LDV A;  2QQR A;  3QXE B;  4CC2 A;  5IH2 A;  3WXM B;  4D8D A;  1IGQ A;  2RI5 A;  4OF1 A;  3J80 E;  3PNW C;  5GAN 2;  1SRL A;  1MV3 A;  5EC7 A;  2BE7 D;  3VUZ A;  3E2U A;  2C0I A;  1M8V A;  4OMM A;  1Q82 C;  3SEM A;  1UGV A;  1BCM A;  3A8M B;  4QQ6 A;  2QXF A;  3JCM f;  2X3X D;  3EAE A;  5D6X A;  4M7D D;  4JJD A;  3MEU A;  3C94 A;  4QVD A;  1VIE A;  2RQT A;  3J7A F;  5J39 A;  1MHN A;  3ZFJ A;  1SPK A;  3JCM W;  4F16 A;  2EWN A;  2VAS A;  2LCC A;  4X9C A;  2OTJ Q;  2OAU A;  2EKO A;  4J83 A;  2CP2 A;  1YIT Q;  2KAF A;  1UEB A;  2FPE A;  1T0J A;  2EGC A;  2L3R A;  2OX7 A;  1IZ6 A;  1KSW A;  1KD1 U;  4XTZ A;  1QVG A;  2ZPH B;  2EVR A;  5CAI A;  2NWM A;  4CI0 C;  2DLP A;  2B86 A;  2RH2 A;  4L5G A;  3EG0 A;  4B6M A;  3I56 T;  1RLQ C;  2EYZ A;  2P0K A;  4PJJ A;  2DXB A;  2BZ8 A;  5LJ5 f;  3KFV A;  5KYU A;  4QVZ A;  3EG9 A;  1SHG A;  3GBQ A;  3DB4 A;  2Y4X A;  1K9M C;  3CBO A;  2HEQ A;  2HAX A;  1JB0 E;  1MMN A;  1X27 A;  4CC4 B;  3OYC A;  2QTV A;  3QZ5 B;  2HQX A;  1M1K C;  1FWZ A;  3GNF B;  2K2V A;  4KGX B;  1WFW A;  1Y0M A;  1NJI C;  4C8Q A;  2HBW A;  1RAH B;  4LDU A;  4HA8 A;  1OI1 A;  1U1S A;  1N8R R;  3DKM A;  1TWB A;  2EQJ A;  2JN0 A;  1TU0 B;  2EGE A;  2RQR A;  4JZ4 A;  1YP5 A;  1H3H A;  2IIM A;  3IQL A;  4ZN3 A;  1YI2 Q;  3CCQ A;  4LN2 A;  1GXI E;  3L2U A;  3I5R A;  2KMT A;  2KI7 A;  2LX9 A;  3CXC P;  4C0F A;  1PWT A;  2P0P A;  4M78 C;  5LJ3 h;  3QUI A;  2RB6 A;  2BIV A;  3PIP A;  2KRO A;  5FU7 C;  2RQU A;  2PVO B;  2E5Q A;  1VQ6 A;  4CC3 A;  5J3B A;  2RJE A;  2EYQ A;  4M78 B;  4J6X A;  3QO3 A;  3S6W A;  1N9S A;  2VC8 A;  2VGM A;  1I81 A;  4J6Y A;  5FU7 B;  2J7I A;  4QQD A;  2KYB A;  2LMJ A;  5LJ5 d;  3CMA Q;  2A3L A;  1VQ4 A;  2WSC E;  1Y71 A;  2C0T A;  2DJZ A;  2DL7 A;  2DK3 A;  4E7J A;  2O01 E;  4A4G A;  3I5S A;  2G3R A;  4MZP A;  3H0F A;  3H8Z A;  1VYT A;  4F7U F;  1WZO A;  2CSQ A;  1WYX A;  2CZ7 B;  2DF6 A;  4M78 E;  4RTT A;  3UA6 A;  2J6F A;  1VYU A;  2LZ6 B;  4L59 A;  3VRY A;  2HSE B;  2PTK A;  3F70 A;  2O9S A;  5GAO q;  2A0F B;  4FYW B;  2RQV A;  1ZUY A;  3H9N A;  2BTT A;  1BU1 A;  4LD9 K;  2B8A A;  3MP6 A;  3CCM T;  3A8H B;  1QKX A;  1UGR B;  3X25 B;  3CBP A;  4C5G A;  1B7T A;  1NE8 A;  3M0Q A;  3ULR B;  2E6N A;  2EBP A;  3CCS A;  1ZSZ C;  1KHI A;  1SSF A;  1KK7 A;  2PU9 B;  3GNG A;  1WHL A;  2X35 A;  2VXF A;  4OMP A;  3JB9 G;  4ZNX A;  4HT9 A;  1VYV A;  4XQ3 A;  1ZSZ B;  2HL3 A;  2DER A;  1UB4 A;  1OX8 A;  1K73 U;  2PVD B;  2VWF A;  4E7H A;  1AZE A;  4OGC A;  4M75 F;  4AT1 B;  4M7A F;  4EMG A;  1NZ9 A;  2XD0 A;  1OPL A;  1YIJ A;  2PVG B;  4ZTJ A;  1I0C A;  2F5T X;  4F04 B;  2KNB B;  3I55 A;  2FL7 A;  4J5Y A;  3R6N A;  4DA4 A;  2XDP A;  5GAM g;  4RCB A;  3JB9 H;  1YJ9 T;  1S72 A;  3MPU B;  2DD5 A;  1WHM A;  1D09 B;  4MDW A;  4BI3 A;  2JMC A;  4KH1 B;  4E7L A;  1GCQ C;  1XTD A;  2D0N A;  4Q5W A;  5C0M A;  3CXC S;  1H64 1;  1V1C A;  2XID A;  1WA7 A;  3GP8 A;  1HXD A;  2MI6 A;  3DB3 A;  5GMK j;  4MDX A;  3FB9 A;  3A8L B;  2X4Y A;  3G4S T;  4M77 D;  2AT1 B;  2D9T A;  3SWN A;  2AKL A;  2VKN A;  1Y07 A;  3NHN A;  2K6D A;  3RKX A;  2LX7 A;  1GBQ A;  3CCJ A;  1Q86 U;  3CCE A;  1YWP A;  1Y57 A;  4V2S A;  2NLU A;  5GAN 8;  1KQ1 A;  2EGA A;  1RAG B;  1JXM A;  1ZLM A;  4J9G A;  3JCM Q;  3ME9 A;  2EQI A;  4JS5 A;  4M78 G;  4FW1 A;  3CCS T;  3FC3 A;  5GAN h;  1LCK A;  3E19 A;  2FYK A;  2DIG A;  1JU5 C;  1WX6 A;  1GL5 A;  3QPH A;  2E6Z A;  2RHZ A;  3UPU A;  4PLI A;  3L1A A;  2QGF B;  4QW2 A;  2DYI A;  4N4H A;  3TCJ A;  2V1R A;  3LH0 A;  2CZ6 B;  3A5Z B;  5GAM j;  1G3S A;  2CP5 A;  2F1L A;  4JDS A;  2AK5 A;  3CEY A;  3LX7 A;  1YIJ T;  3I55 T;  2CZ1 B;  4EMK B;  3JB9 I;  4M4Z A;  4KBM B;  1M9S A;  4BY6 C;  5C6S A;  1S72 T;  1KQ2 A;  5LL6 S;  3A8G B;  2BUD A;  3OYN A;  2RA2 A;  3UT1 A;  3FJ5 A;  1QVG S;  1ABQ A;  1KG1 A;  4OB1 B;  2F69 A;  2DJQ A;  1CKA A;  3TSW A;  3A8O B;  2QEX A;  1M2O A;  4BY6 B;  5A2Q E;  3TU4 K;  3CCU A;  1G5V A;  3JV3 A;  3LGF A;  1IRX A;  2QQA A;  1VQL A;  2DZ9 A;  3LYI A;  3X28 B;  3BFM A;  1VOM A;  1NPP A;  2DO3 A;  1WGS A;  2DRM A;  2QTX A;  3L2R A;  2FZK B;  1RAF B;  1VQP A;  1PKS A;  3MP1 A;  2CKK A;  2HDA A;  2XMF A;  3UAT A;  2RN8 A;  2YDL A;  5FU6 C;  2SEM A;  1QVF P;  1M4Z A;  4IUV A;  5CVI A;  2QAZ A;  3EGX B;  3RNJ A;  4FW2 A;  2EAY A;  4EMH A;  1BBZ A;  1HK9 A;  3QWX X;  5D6Y A;  5FU6 B;  2V26 A;  4F7U A;  1AWX A;  4OML A;  4QT7 A;  5LJ5 e;  3RBB B;  1CKB A;  4PNO A;  3CCJ T;  3CCE T;  2PUK B;  2LDM A;  5GAO p;  3OY9 A;  3JCM h;  1MMA A;  3JB9 D;  4L6V 5;  1Q7Y U;  3OBY A;  4Y91 A;  1MND A;  3E9G A;  3H0I A;  2COZ A;  3QG1 A;  2RHY A;  1G3Y A;  3CC7 A;  3VS7 A;  2RM4 A;  4M77 C;  5CR2 A;  3CCQ Q;  3BY7 A;  1TTH B;  3CME A;  2JJ9 A;  3OA6 A;  2DBM A;  4M77 B;  4C0Z A;  2D8J A;  3URG A;  4E7Z A;  1B07 A;  3PE0 A;  1SSH A;  3OYA A;  2F2W A;  3RR6 A;  3VS4 A;  2HCK A;  3RIR A;  1UJY A;  1VQ6 Q;  4EPC A;  2RHX A;  1WQW A;  1JO8 A;  2CRE A;  4DQ2 A;  2HL5 C;  4ZTF A;  2I2L A;  1PCX A;  3REB B;  1K9M U;  4M75 A;  1YCS B;  2A7Y A;  2MK5 A;  2DE0 X;  1T3L A;  5LJ5 j;  3CPW P;  1FMV A;  2O2O A;  5KYX B;  5KE3 A;  3EFO B;  3E1S A;  4M7D F;  3HKS A;  2YRD A;  1SG5 A;  2F5K A;  2ZGW A;  2HKQ B;  1VQ4 Q;  1QW1 A;  4M77 E;  1FMK A;  3SD4 A;  3CCU T;  1VQ8 A;  1M1K U;  2QYZ A;  2ABL A;  4XTY A;  3CBM A;  2J6K A;  2K9G A;  1U8R A;  3THK A;  1HJD A;  1PSF A;  5GAM f;  1KQS P;  1ZUU A;  2FRY A;  2M16 A;  4D8K A;  1Q81 C;  1D3B B;  1X2Q A;  2LC4 A;  1I5L A;  4EDU A;  2DVJ A;  3CXC A;  1VQP T;  2JM8 A;  4PJM A;  5KCH A;  4XK8 E;  2XDD A;  3OS1 A;  3JCM X;  4EIK A;  2BZX A;  4A4H A;  2ZCF B;  4XU1 A;  2MF2 A;  3ER0 A;  4XAX B;  4C8Q D;  2KSS A;  2DZC A;  5GAO r;  3V7C A;  1M90 C;  2ENM A;  1PD1 A;  3CCR A;  3CC2 A;  3SB2 A;  2FPD A;  2K57 A;  3CCS Q;  4RTY A;  1OOT A;  2RJF A;  3VS5 A;  4C0D C;  4A4E A;  1XJW B;  4C92 F;  3QSU A;  1YNZ A;  1KD1 R;  2XHC A;  1C1A A;  3OYE A;  2KGT A;  3O5Z A;  2MYS A;  3EGD B;  4OVA A;  1RAI B;  4DOV A;  4JJC A;  2O4X A;  1M30 A;  2I0N A;  1NEG A;  1YIJ Q;  2EYX A;  4J9F A;  1M3C A;  2FZC B;  2YRC A;  1D1C A;  1SHF A;  2EJF A;  3I55 Q;  3CME T;  4A63 B;  2RPN A;  1LVK A;  2P4T A;  1VQN A;  3PMT A;  3JCM V;  5HCK A;  1S72 Q;  1HD3 A;  2DTH A;  2JS0 A;  5GAM d;  3RER A;  2EIF A;  6AT1 B;  3FIF A;  2RK1 A;  4Y28 E;  3RKW A;  1BK2 A;  1UG1 A;  4IIM A;  3ZEH A;  1R8O B;  5CKF A;  2DIQ A;  1K76 A;  3VRZ A;  4J9B A;  2C06 A;  1UUE A;  4PFO A;  2X9H A;  3VV0 A;  4ANJ A;  2LVM A;  4J9I A;  1AT1 B;  4PJO F;  2KVQ G;  2M1H A;  1QQJ A;  1XQH A;  1VQ8 T;  1EIF A;  2CZ0 B;  2E70 A;  2EJG A;  3OYB A;  4AFQ C;  5KH6 A;  3MHX A;  3CPF A;  4DEY A;  1XOV A;  1YJW A;  3G1J A;  2CP3 A;  3TQ7 P;  2K4Y A;  4KGV B;  2GQV A;  1N27 A;  3MKD A;  4OMN A;  2QDY B;  4DBH A;  3KUF A;  1PC0 A;  4JRK A;  2DIL A;  1YN8 A;  3V8K A;  4ELZ C;  1UJ0 A;  5FLX E;  4ZN1 A;  1PNJ A;  3TEE A;  4M77 G;  3CCJ Q;  3CCE Q;  3EG1 A;  4HCB A;  5I22 A;  2LT1 A;  3SFM A;  1BI1 A;  1KFZ A;  1K1Z A;  5IT9 E;  4ME7 A;  2WSE E;  2DFU A;  1AHJ B;  4LDW A;  1ARK A;  2LNH B;  3DLL A;  3CD6 A;  3HTR A;  3REA B;  2QQ9 A;  1AWJ A;  1D0Y A;  3HFO A;  4RG8 A;  1VQK A;  1ZHI A;  2QA4 A;  2J06 A;  2ED1 A;  1W2B P;  2D0Q B;  4FT2 A;  5KYU B;  5IN1 A;  4DOW A;  3EG9 B;  2IG0 A;  2KR3 A;  3RMQ A;  3VUB A;  4CRI A;  3CC4 A;  4OB3 B;  2JT4 A;  2P0Q A;  5IHK A;  1TUG B;  2RI2 A;  4JRQ A;  3OW2 P;  4RCC A;  2RJD A;  1IGU A;  3L2V A;  4A4F A;  4TVR A;  1WHH A;  2JTM A;  4C8Q C;  3JCM J;  2LJ1 A;  2VXE A;  2DTI A;  1QP2 A;  2OTL Q;  2V8K A;  3MET A;  3M0R A;  4C8Q B;  4E47 A;  2HD0 A;  3GPL A;  2EQU A;  1PG5 B;  2FVU A;  1GRI A;  4KUL A;  2QEX Q;  1YWO A;  1IO6 A;  3H6Z A;  3CCU Q;  3M0S A;  1UGQ B;  2L3S A;  2L5Q A;  3JB9 J;  3BDL A;  3X20 B;  1RAC B;  1VQL Q;  1K73 R;  1G83 A;  5FRM A;  3VJP A;  3BE3 A;  1I07 A;  3VS3 A;  2LRQ A;  1RLP C;  2FO0 A;  4JJN K;  3GLX A;  1WHJ A;  1I1J A;  3PVL A;  4Z8A A;  4C8Q E;  3OYM A;  1VQP Q;  4RTV A;  1VQ5 A;  2FG0 A;  2ZPF B;  5CKB A;  2V8J A;  5CK9 A;  2YHT A;  4M7D A;  1N9R A;  1G3T A;  2R57 A;  4NL3 A;  4RUG A;  2YUP A;  4Y92 A;  1G2B A;  2K3B A;  4F17 A;  2A36 A;  1H3Z A;  1UHF A;  1VIF A;  4ZGE B;  4RTX A;  4LD6 A;  3I35 A;  3CCL A;  4Z88 A;  1WNL A;  2E1H A;  2XIC A;  1AZG B;  3RUX A;  2L3Q A;  4DBR A;  1W6X A;  3PFS A;  3CD6 T;  1AOJ A;  5FRN A;  4C5E A;  1PKT A;  2KY9 A;  4J9D A;  1K9A A;  1VQK T;  2K3Y A;  4BDZ A;  3CC7 Q;  2GBQ A;  2QA4 T;  1T0H A;  4PKC C;  5GMK e;  4OP0 A;  4HVU A;  2DD4 A;  1IRE B;  1AWO A;  2GTJ A;  2MIO A;  1OV3 A;  3VU3 C;  3CME Q;  1WJR A;  1H8K A;  2DA9 A;  2MPX C;  2L2P A;  3CC4 T;  5GMK l;  5CKE A;  1QVF A;  4LE9 A;  3RKY A;  4X9D A;  5GAN g;  4C92 A;  3CCQ T;  2QQS A;  1Y96 A;  1AVZ C;  3JSC A;  2DL4 A;  3EFR A;  3OB9 A;  1O9S A;  2LTO A;  4QQG A;  1DJ7 B;  2KDS A;  4J7F A;  5FWC A;  2LCS A;  1Q86 R;  1W2B S;  2J6O A;  1B3Q A;  2W10 A;  3M57 A;  4VUB A;  4GBQ A;  2K2M A;  4JJB A;  3JRZ A;  1RI9 A;  2CUD A;  2NUZ A;  1VQ6 T;  4X34 A;  1YHQ A;  3M4Y A;  5I2M A;  2O9V A;  3PTA A;  1VQ8 Q;  1V76 A;  2P84 A;  5GAO n;  3OQ5 A;  2MWO A;  2WSF E;  1QWF A;  3HSB A;  2XDB A;  1VQ4 T;  1NM7 A;  1XNI A;  4RMO A;  1FXX A;  5GJW B;  1OZ3 A;  5GMK i;  4KT0 E;  2JTF A;  3EHR A;  3QKJ A;  2XI9 A;  1WJS A;  4CC7 A;  2EJ9 A;  5DLO A;  4JRP A;  3OSV A;  1VQ5 T;  1VQ9 A;  2J05 A;  2E3I A;  5GAM e;  4J9E A;  5GMK h;  3OS0 A;  4PJO A;  1QCN A;  2E65 A;  4N0A A; 
#chains in the Genus database with same CATH homology
 3OY9 A;  3JCM h;  1VQM A;  3JB9 D;  3A8M B;  4QQ6 A;  4L6V 5;  1Q7Y U;  1N6A A;  3OBY A;  2QXF A;  4Y91 A;  2QQB A;  2RHI A;  1WQ7 A;  3E9G A;  3JCM f;  3WVD B;  3QG1 A;  1RI0 A;  3CCL T;  3EAE A;  5D6X A;  4M7D D;  3G6E A;  3L2Q A;  3HP9 A;  2M0O A;  2MMP A;  2RHY A;  1YJW T;  1G3Y A;  3CPW A;  3CC7 A;  3VYG A;  3MEU A;  3QII A;  2EQK A;  3C94 A;  4ZGD B;  4QVD A;  1VIE A;  3J7A F;  2RM4 A;  4N0A C;  4M77 C;  3SWN C;  1MHN A;  5J39 A;  3ZFJ A;  5CR2 A;  3PT9 A;  3OS2 A;  4C8Q G;  3JCM W;  2EWN A;  2VYT A;  3BY7 A;  4NOY A;  3SDZ A;  4NL2 A;  2LCC A;  3JCM P;  4X9C A;  2HNI A;  3CME A;  3OA6 A;  1JJ2 A;  3OYH A;  3T9N A;  2OAU A;  4M77 B;  3SWN B;  4C0Z A;  4Z02 A;  2EKO A;  4J83 A;  3URG A;  1KQS A;  4M7D C;  2RHU A;  3G4S A;  3MP8 A;  2L89 A;  1UGP B;  4M7A E;  2JUF A;  2IVW A;  2KAF A;  4IUQ A;  3OYA A;  1UEB A;  1N8R U;  4M77 F;  4XTX A;  3NFC A;  3RIR A;  4EPC A;  4KUI A;  1Q81 U;  1LJO A;  2RHX A;  2L3R A;  4M7D B;  4JLI A;  1WQW A;  2JOY A;  4DQ2 A;  3JB9 F;  3RMS A;  4ZTF A;  2I2L A;  3OYJ A;  1K9M U;  2DXT A;  2ZPB B;  1IZ6 A;  1KD1 U;  2GFU A;  4M75 A;  4XTZ A;  2A7Y A;  2ZPH B;  1QVG A;  1K8A U;  5LJ5 j;  1RL2 A;  5CAI A;  4CI0 C;  3E1S A;  5KE3 A;  3JAM E;  3HKS A;  4M7D F;  2F5K A;  2ZGW A;  2DVE A;  1QW1 A;  4M77 E;  4PLL A;  3V7R A;  2RH2 A;  3GF5 A;  2XG8 D;  4L5G A;  1WPY A;  3SD4 A;  3CCU T;  1M1K U;  1VQ8 A;  3P8B B;  2MAM A;  3HRS A;  2P0K A;  4XTY A;  2E64 A;  2EQM A;  3CBM A;  3I56 T;  4HCC A;  3UDC A;  1U8R A;  2DXB A;  5LJ5 f;  3OYG A;  1ZBX A;  1PSF A;  3HRU A;  5GAM f;  2OTL A;  2V8I A;  3ZBD A;  1N8R C;  4QVZ A;  2M16 A;  4M7D E;  4FL6 A;  1Q81 C;  1D3B B;  1YHQ T;  1VQ7 A;  3DB4 A;  1LNX A;  2Y4X A;  1YBY A;  2EFI A;  4RKU E;  2LC4 A;  1I5L A;  1K9M C;  5EG2 A;  3CBO A;  4EDU A;  1YJN A;  1KD1 C;  5LJ3 d;  3KXT A;  3CXC A;  1VQP T;  1VQO T;  1KC8 U;  2HAX A;  3ASK A;  3QJY A;  5GAN 3;  2R5M A;  1JB0 E;  5KCH A;  3OBW A;  4XK8 E;  2XDD A;  3OS1 A;  3JCM X;  5GAO p;  2RI3 A;  4A4H A;  3OYC A;  3EFS A;  2ZCF B;  3QZ5 B;  3PGG A;  4C92 C;  2HQX A;  3FRN A;  4XU1 A;  1FWZ A;  3GNF B;  2R5A A;  5DLQ E;  3UWN A;  1M1K C;  2K2V A;  1U1T A;  2MF2 A;  3BDU A;  3ER0 A;  4XAX B;  4C8Q D;  2KSS A;  2DZC A;  3OW2 S;  1KQS S;  5GAO r;  3V7C A;  3VKI A;  1Q82 U;  1NJI C;  1M90 C;  4C8Q A;  2YLC A;  3AHU A;  4LDU A;  3CCR A;  4C92 B;  4HA8 A;  3CC2 A;  1VQ9 T;  3SB2 A;  1OI1 A;  1U1S A;  1Y96 B;  4JLG A;  3JCM c;  2K5L A;  1I4K 1;  2JN0 A;  2EQJ A;  2K57 A;  2ZPG B;  3DKM A;  1YJ9 A;  4FT4 A;  3L2W A;  2RJF A;  4C0D C;  5L8R E;  5GAN e;  4MML A;  4A4E A;  2PUO B;  3M58 A;  3C4S A;  4ZN3 A;  1VQM T;  4C92 F;  3QSU A;  3CCQ A;  1GXI E;  2DAQ A;  3L2U A;  1YCY A;  2XHC A;  4HCZ A;  1PSE A;  2KMT A;  3OYE A;  4BI4 A;  3V7S A;  2LX9 A;  1BI0 A;  2GF7 A;  2RK2 A;  1FX7 A;  3HRT A;  4J8O A;  4C0F A;  3G6E T;  2OTJ A;  2P0P A;  4JS4 A;  2CS7 A;  4OVA A;  3PMI A;  4M78 C;  1BIA A;  4DOV A;  3OYL A;  3LGL A;  4BE1 A;  3OYK A;  3Q1J A;  5LJ3 h;  5GAO l;  3QUI A;  1YIT A;  2RB6 A;  4BI8 B;  2O4X A;  4C92 E;  3L42 A;  2BIV A;  4A54 A;  5LJ3 f;  3GIB A;  3PIP A;  2XKO C;  5FU7 C;  3RES A;  2PVO B;  2E5Q A;  1VQ6 A;  5J3B A;  2RJE A;  2EYQ A;  4M78 B;  2EJF A;  4J6X A;  2X4X A;  3CME T;  3QO3 A;  2K5F A;  4XTW A;  1N9S A;  3S6W A;  2VC8 A;  2VGM A;  1I81 A;  2H3J A;  2P4T A;  1VQN A;  4OB0 B;  3G71 A;  3PMT A;  3JCM V;  4J6Y A;  5FU7 B;  4QQD A;  5M9O A;  4M78 F;  5LJ5 d;  4PJO C;  2DTH A;  5GAM d;  4IUT A;  3E9F A;  2EIF A;  3RER A;  4C5H A;  2A3L A;  3FIF A;  2RK1 A;  4Y28 E;  5GMK m;  1VQ4 A;  3RKW A;  2WSC E;  4F7U B;  1Y71 A;  4NS5 A;  2DJZ A;  4MZT A;  2BKD N;  2DK3 A;  5CCA A;  4E7J A;  4GLK A;  2O01 E;  3ZEH A;  4A4G A;  1R8O B;  4GY5 A;  2G3R A;  5CKF A;  2DIQ A;  4MZP A;  4PJO B;  3H8Z A;  5A0D A;  2L8D A;  4F7U F;  2C06 A;  2K5I A;  2CZ7 B;  4M78 E;  4YTL A;  3VV0 A;  5CKD A;  2LVM A;  4L59 A;  4PJO F;  3MO8 A;  2KVQ G;  2M1H A;  3S3M A;  5GAN j;  3GOX A;  3L2Z A;  1XQH A;  1VQ8 T;  1EIF A;  2CZ0 B;  4FIB A;  4FM4 B;  2E70 A;  3F70 A;  4MZM A;  3JCM g;  4D6W A;  5GAO q;  1B34 A;  4M75 D;  2EJG A;  2KK4 A;  3OYB A;  5J26 A;  4F7U E;  5KH6 A;  4M7A D;  4IKF A;  2OTL T;  3MHX A;  3OYY A;  2FB7 A;  3CPF A;  5CKH A;  1BKB A;  4EMK A;  2HBP A;  1XOV A;  2B8A A;  1YJW A;  4LD9 K;  4M7A A;  4A4K A;  3HPW A;  3MP6 A;  2K4Y A;  5GAN f;  4BDY A;  3S3O A;  1VQ7 T;  3FDR A;  2GQV A;  4R56 A;  2LQ8 A;  3CCM T;  4PJO E;  2QEX T;  1QVP A;  1N27 A;  1UGR B;  3A8H B;  3X25 B;  1W2B A;  3S3N A;  4WF2 A;  1YJN T;  2QDY B;  4ZGJ B;  3CBP A;  3CCV A;  5AYF A;  3KUF A;  4P5N A;  5LJ5 h;  2XU8 A;  5GAM h;  4C5G A;  1NE8 A;  5GAN 5;  1BI3 A;  4JRK A;  2E6N A;  3V8K A;  4C0G A;  2RJC A;  1VQL T;  4ELZ C;  4M75 C;  3CCS A;  2LCL A;  5FLX E;  1NJI U;  1M90 U;  5CIU A;  4ZN1 A;  1KHI A;  4EMK C;  1SSF A;  3TEE A;  5GAN 4;  4M7A C;  4M77 G;  3OW2 A;  4C5I A;  1JJ2 S;  3TRE A;  2PU9 B;  5DM7 R;  4HCB A;  2LT1 A;  3SFM A;  1BI1 A;  1YI2 A;  5A0G A;  3GNG A;  5IT9 E;  4ME7 A;  4BD3 A;  2X35 A;  2VXF A;  2WSE E;  3FLG A;  3JB9 G;  3O8V A;  4HT9 A;  1BIB A;  4M75 B;  1BI2 A;  1AHJ B;  4LDW A;  4XQ3 A;  1V29 B;  4J6W A;  4JRI A;  5KCO A;  3JCM e;  1UB4 A;  3M4G A;  5HK3 A;  3DLL A;  1K73 U;  4M7A B;  3DLM A;  4MMK A;  3CD6 A;  3NTI A;  2K3X A;  2QQ9 A;  3J81 E;  2M9U A;  4M7D G;  4XTU A;  2PVD B;  5CQY A;  4E7H A;  2GCX A;  1VQ9 A;  2RD1 A;  4OGC A;  5A0L A;  4M75 F;  4OMF B;  3HFO A;  4RG8 A;  1VQK A;  1OYX A;  1ZHI A;  2E12 A;  4M7A F;  3INZ A;  4EMG A;  2QA4 A;  1NZ9 A;  3OSS C;  2XD0 A;  3FJP A;  1YIJ A;  2FHD A;  1NPR A;  2PVG B;  4ZTJ A;  2D0Q B;  2F5T X;  4FT2 A;  2CYZ B;  3I55 A;  1VQ6 T;  5IN1 A;  2FL7 A;  2OTJ T;  4J5Y A;  4DOW A;  3I56 A;  3HFN A;  3G7Z A;  4DA4 A;  3VYH B;  2IG0 A;  2XDP A;  5LJ5 g;  4M75 E;  3RMQ A;  4RCB A;  3VUB A;  4CRI A;  5GAM g;  1YIT T;  4OB3 B;  1YJ9 T;  1S72 A;  2DD5 A;  3CC4 A;  3JB9 H;  2P0Q A;  2DTO A;  4JRQ A;  2RI2 A;  4RCC A;  2RJD A;  3BW1 A;  4MDW A;  4O6J A;  3L2V A;  3CMA A;  4A4F A;  2KQW A;  1K73 C;  1QVF S;  2DXC A;  4BI3 A;  5I2S A;  4TVR A;  2JTM A;  4PL6 A;  3OMC A;  4ATO A;  1TH7 A;  2VGN A;  4C8Q C;  2DEQ A;  4E7L A;  4C0D B;  4HT8 A;  1XTD A;  3HL8 A;  3JCM J;  3G71 T;  3MEV A;  2VXE A;  2AHJ B;  2DTI A;  3MCA B;  3CC7 T;  3LWI A;  3HHT B;  1QP2 A;  4Q5W A;  5C0M A;  1H64 1;  3CXC S;  1X75 C;  2XID A;  1KHC A;  3GP8 A;  2V8K A;  3MET A;  4C8Q B;  1HXD A;  2MI6 A;  3DB3 A;  4E47 A;  5KE2 A;  2HD0 A;  2PQW A;  3GPL A;  2EQU A;  3M5A A;  3QHS A;  2FVU A;  5GAN d;  4KUL A;  2XK0 A;  2VV5 A;  3H6Z A;  5GMK j;  4MDX A;  3FB9 A;  1UGQ B;  3A8L B;  3P8D A;  2L5Q A;  2LQK A;  2X4Y A;  2CGH A;  4C8Q F;  3JB9 J;  3BDL A;  3X20 B;  2ZZD A;  1OZ2 A;  3G4S T;  4C92 G;  3M53 A;  3X24 B;  4M77 D;  4XU0 A;  4OB2 B;  5FRM A;  3VJP A;  2D9T A;  4M77 A;  3SWN A;  4OGE A;  5FRO A;  2LRQ A;  2LT4 A;  3QDR B;  2WAC A;  3P8H A;  1ZQ1 A;  2E10 A;  3GLX A;  4FU6 A;  4JJN K;  2MWP A;  1Y07 A;  4N4I A;  4JUV A;  4C8Q E;  3OYM A;  2O4X B;  3OYD A;  3X26 B;  3M54 A;  2E41 A;  1VQ5 A;  3RKX A;  5HKC A;  2ZPF B;  4IUR A;  5CKB A;  2V8J A;  5CK9 A;  2YHT A;  3CCE A;  3CCJ A;  1Q86 U;  4M7D A;  1N9R A;  4UC4 A;  1G3T A;  2R57 A;  4NL3 A;  3LW5 E;  5HY6 A;  4V2S A;  2NLU A;  5LJ3 g;  1H3Z A;  5GAN 8;  3V8J A;  1VUB A;  4E7I A;  3CCV T;  1KQ1 A;  4KUD K;  1VIF A;  4ZGE B;  3R6O A;  3JCM Q;  1JBM A;  3ME9 A;  4LD6 A;  3C95 A;  4JS5 A;  4M78 G;  3CCL A;  2R58 A;  3CCS T;  3FC3 A;  5I21 A;  5GAN h;  4J7I A;  3NTK A;  1WNL A;  1M1F A;  2E1H A;  3E19 A;  2FYK A;  2XIC A;  2DIG A;  2YLB A;  3WVE B;  1BYM A;  5HK0 A;  1Q7Y C;  1YI2 T;  3RUX A;  3M56 A;  3CPW S;  1O75 A;  3QPH A;  3QBY A;  2E6Z A;  2RO0 A;  2RHZ A;  3UPU A;  2D6F A;  5IAY A;  3NTH A;  3QYG B;  3JCM b;  3QZ9 B;  3PFS A;  3V8L A;  1LOJ A;  4F7U G;  3CD6 T;  1D3B A;  1Q86 C;  4PLI A;  3L1A A;  4FSX A;  4HKE A;  5FRN A;  2LNV A;  4C5E A;  4QW2 A;  4N4H A;  2KY9 A;  1Y7X A;  3TCJ A;  4PJO G;  2VUB A;  1VQK T;  2K3Y A;  3OYI A;  4BDZ A;  1Q82 C;  4B9W A;  3PIO A;  3LH0 A;  2QA4 T;  1B34 B;  2CZ6 B;  3A5Z B;  4PKC C;  1X6O A;  4B9X A;  5GMK e;  5GAM j;  4OP0 A;  1G3S A;  3C12 A;  5LJ3 e;  4JDS A;  3CEY A;  3LX7 A;  5GAO m;  1YIJ T;  4BE2 A;  3MEA A;  4O5V A;  5CQX A;  2DD4 A;  2YRV A;  1IRE B;  2Y90 A;  3I55 T;  1G3W A;  1W4S A;  2CZ1 B;  4EMK B;  3CCR T;  3JB9 I;  3CC2 T;  5D6W A;  3VU3 C;  1MGQ A;  1WJR A;  4A53 A;  4KBM B;  1M9S A;  4XU3 A;  4BY6 C;  4C92 D;  3CC4 T;  5C6S A;  1S72 T;  1M5Q 1;  1X01 A;  5CKE A;  5GMK l;  2JZ2 A;  5LL6 S;  1KQ2 A;  1QVF A;  3RKY A;  3A8G B;  3CMA T;  2BUD A;  4RG2 A;  4X9D A;  5GAN g;  4C92 A;  2DKG A;  2RA2 A;  3UT1 A;  2QQS A;  3OYN A;  3CCQ T;  1QVG S;  4PJO A;  1Y96 A;  1KG1 A;  4OB1 B;  4BUG A;  2F69 A;  3KBG A;  1M1G A;  3JSC A;  3CCM A;  2QEX A;  1WJQ A;  3A8O B;  3EFR A;  3OB9 A;  4LDX A;  1O9S A;  2LTO A;  3M9Q A;  4BY6 B;  4QQG A;  1DJ7 B;  2KDS A;  4J7F A;  5A2Q E;  3CCU A;  3TU4 K;  1G5V A;  2X4J A;  1W2B S;  1K8A C;  4ELY C;  1P92 A;  3LGF A;  3JCM d;  3M55 A;  3N5B B;  2QQA A;  1VQL A;  2DXU A;  2DPP B;  2DZ9 A;  3LYI A;  3X28 B;  5DY9 A;  3M57 A;  3BFM A;  4VUB A;  2GFA A;  1NPP A;  3JRZ A;  3MEW A;  4II1 A;  4R55 A;  2DO3 A;  3OS5 A;  1WGS A;  3OMG A;  1QP3 A;  3M4Y A;  3QJ6 A;  4X34 A;  4XU2 A;  3LWH A;  3M59 A;  3LLR A;  5I2M A;  1YHQ A;  3PTA A;  2QTX A;  3L2R A;  3QYH B;  2QI2 A;  5GAO n;  4M75 G;  1VQN T;  4IUU A;  3OQ5 A;  1VQO A;  3MP1 A;  2MWO A;  1JRI A;  1VQP A;  1M8V A;  2CKK A;  4M78 D;  4XTV A;  1I8F A;  2WSF E;  4M7A G;  4QVC A;  4E7K A;  4M78 A;  4N4G A;  5FU6 C;  3OYF A;  2XDB A;  3HSB A;  3FEO A;  5CO7 A;  4BE0 A;  1VQ4 T;  1M4Z A;  5GAN 7;  1XNI A;  4IUV A;  5CVI A;  4RMO A;  2ZPE B;  1FXX A;  1KC8 C;  1OZ3 A;  5GMK i;  2JNG A;  2JVV A;  2EAY A;  4LDV A;  4KT0 E;  4EMH A;  2JTF A;  4IUP A;  3QKJ A;  1HK9 A;  5LJ3 j;  5D6Y A;  2XI9 A;  2QQR A;  1WJS A;  3QXE B;  5GAN 6;  1UGS B;  5FU6 B;  2EJ9 A;  3WXM B;  5DLO A;  4F7U A;  5LJ5 e;  4JRP A;  2RI5 A;  2HQE A;  3OSV A;  3PNW C;  4OF1 A;  5GAM e;  3J80 E;  5GAN 2;  1VQ5 T;  2ZPI B;  4PNO A;  4BB7 A;  3CCJ T;  3CCE T;  4PJO D;  2PUK B;  5GMK h;  2X4W A;  3VUZ A;  2LDM A;  4LDY A;  3OS0 A;  2Y4Y A;  4BAC A;  2E65 A;  4N0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...