3EAEA

Pwwp domain of human hepatoma-derived growth factor 2 (hdgf2)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
b'PHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3eaeA00
3LGFA 2L3RA 1SSFA 2E6NA 2M16A 2MWPA 5FRNA 4C5IA 2M1HA 3OYFA 3OYMA 5FRMA 2RJFA 2GFAA 2DIGA 3E9FA 5D6WA 2B8AA 3FLGA 2L8DA 4IUUA 4IUVA 2O4XA 3FC3A 2MWOA 3C4SA 3PMTA 5CIUA 2F5KA 2L89A 5J26A 3Q1JA 1WJSA 3S3NA 2PQWA 2YRVA 2DAQA 3OB9A 4FU6A 4LD6A 1XNIA 3L2WA 2EQUA 4GY5A 2RJEA 2D9TA 1WJQA 4Q5WA 3OYNA 4E7IA 3OYHA 3MP8A 3UT1A 4ZTFA 4IKFA 3S3OA 1WGSA 4NS5A 3EAEA 4UC4A 4HCZA 4N4HA 2LVMA 2GF7A 3BDLA 4RG2A 2LCCA 4BDYA 4II1A 2LTOA 3DB4A 3PMIA 2X4XA 3OY9A 3S3MA 2E5QA 4C5GA 2G3RA 4EDUA 2R57A 2GFUA 2BIVA 3LX7A 4X34A 4QQDA 5C6SA 2X4WA 4N4GA 2X4YA 2EQMA 1OYXA 3OYCA 2JZ2A 4Z02A 4IUPA 3ASKA 4QW2A 3OYJA 3ZEHA 3S6WA 3L2QA 1G5VA 3MO8A 2RHXA 3OYKA 3QBYA 1WJRA 2EQKA 3M9QA 4IUTA 3OYLA 3MEWA 4PLIA 4PLLA 1MHNA 2P0KA 3OS2A 3P8DA 2JTFA 3L2UA 3PNWC 3OQ5A 3OYDA 2FHDA 4BE1A 4CRIA 3PFSA 3LH0A 3QIIA 3MEVA 2LRQA 5M9OA 4C5HA 4B9XA 3L2RA 3ME9A 3NTKA 3OYBA 3FEOA 4QVZA 5FROA 5KCOA 3H8ZA 3DLMA 3OYGA 2IG0A 3FDRA 2R5AA 3LLRA 4N4IA 3OYAA 4E7KA 2RHUA 3SD4A 2NLUA 3OS1A 3OA6A 1OZ2A 1OZ3A 2QQSA 2RJDA 2RO0A 4E7JA 2RHZA 2HQXA 2LDMA 5J39A 4BDZA 4A4GA 3OMCA 5D6YA 4OVAA 5KCHA 4L59A 3CEYA 3UWNA 5KE3A 2RI5A 2RJCA 5D6XA 5KH6A 2XK0A 4IURA 5IAYA 3MEUA 3OMGA 3F70A 1N27A 4C5EA 3OYEA 3OYIA 2QQRA 3L42A 1OI1A 2K3YA 2O4XB 5C0MA 2EKOA 3MP6A 3NTHA 5KE2A 3QKJA 4BE0A 2R5MA 4FL6A 5IN1A 2R58A 3KUFA 3QJ6A 2XDPA 4A4EA 2EFIA 1RI0A 1KHCA 2DIQA 2RI3A 3H6ZA 3MP1A 4E7LA 2RHYA 3P8HA 4PL6A 4E7HA 4B9WA 4QQGA 4BACA 3E9GA 4QQ6A 2CKKA 1H3ZA 3META 2EQJA 3LYIA 2VYTA 4A4FA 3NTIA 4BD3A 3OS0A 2RHIA 2BKDN 2BUDA 3O8VA 2WACA 4BE2A 2X35A 3MEAA 3L2VA 4ZTJA 2K3XA 2M0OA 3GOXA 2RI2A 4A4HA 2HQEA 3DB3A 4IUQA 3LGLA
chains in the Genus database with same CATH superfamily
4J7FA 2KR3A 2EGCA 1KSWA 1V1CA 3HKSA 4J5YA 1PKSA 4WF2A 4IIOA 5FRMA 2RJFA 3EFRA 3X28B 3GIBA 1D3BA 1I0CA 4FT2A 1GBQA 4MDXA 2YRVA 2CP3A 2G6FX 4LD6A 1T3LA 5HK0A 1M90R 2DILA 3JCMQ 2CGHA 4Q5WA 4C92D 4E7IA 3TSZA 2FRYA 2KEAA 3EAEA 3OSVA 1E6GA 3A8GB 3PIPA 3WVEB 4BDYA 1YWPA 2P84A 2Y4YA 3V8JA 4RCBA 1M3AA 2WSFE 2K4YA 2QG9B 1UB4A 3VS0A 4X1VA 2QA4T 2COZA 4DOVA 4J9GA 4QW2A 2D6FA 1X01A 1ZA2B 1ACMB 1JU5C 4C8QD 3PTAA 4IUTA 3EHQA 4EMHA 3P8DA 4M75A 1KFZA 1XQHA 4PNOA 4PJOE 1WZOA 4Y92A 1KG1A 2YRDA 2YUPA 4EMKC 3OW2A 2V8KA 2NLUA 3RMQA 1WYXA 2RHZA 1UDLA 4BDZA 5I22A 1V29B 3TSWA 1H641 3OMCA 3CXCA 1YJNA 5D6XA 4FCYA 4ME7A 2Z0WA 1FXXA 5GAN4 2DKGA 2O4XB 4BE0A 3AHUA 1PD1A 1UE9A 2HL3A 5CVIA 4Z89A 2HNIA 2HSPA 1M2VA 5KYNA 3CCQT 4QQGA 5GANd 3EH2A 2YT6A 1QWEA 2FRWA 2PVGB 3L2VA 2VUBA 2OTJA 1GFDA 1WQWA 4TVRA 1VQLA 1QVPA 2E6ZA 1OEBA 5GJVB 1PWTA 1PHTA 1LCKA 4C5IA 3DKMA 2GFAA 5J3BA 2HMAA 4JS5A 2MPXC 3CCLA 3MCAB 4OGEA 1K8AC 3HRSA 3CC7Q 2C0IA 3V8LA 4XK8E 5I21A 4E7ZA 2AT1B 1HXDA 2HAXA 3ULRB 2C0OA 1NYGA 5GAMh 4N4HA 4X9CA 2BZYA 4DBFA 1VQMA 1UHFA 1X75C 3R6NA 7AT1B 3CD6T 3EGXA 1ZSZB 4Z02A 3JCMV 3CMEA 4KH0B 3UF4A 1VIEA 1NZ9A 2OTJT 4FW1A 3CCMQ 1Z9QA 1LJOA 2NUTA 1YI2Q 2ROLA 1W2BP 2DXCA 1K9MC 3HFOA 1W2BS 2JT4A 4PJOA 5GAN5 1KJWA 3CCLT 1PC0A 2KRSA 3M0SA 3UPUA 3GNFB 3PE0A 1AVZC 3M0TA 3U23A 1NJIU 2V8IA 2K5FA 2I2LA 3RESA 2HQXA 2LDMA 5J39A 2A0FB 3VV0A 2EJ9A 2FB7A 1KQSA 4F7UB 2QEXA 2JXBA 1CSKA 3REBB 4M7DB 3RR6A 5AYFA 1M3CA 3CMET 2PTKA 2LQNA 2P0PA 2RI3A 1QQJA 4M7AB 2LT1A 1OU9A 3RBBB 5LJ3f 2HQHA 2YUNA 4BE2A 4HT9A 2CT4A 1SHFA 3M0UA 1UGSB 4LDVA 1YCYA 3DB3A 1VQ6A 4ZGEB 1FYNA 1WIEA 1X69A 5FRNA 1Q7YR 2FG0A 3OYFA 3CC2Q 1M1KR 2DIGA 5ECAA 2L8DA 2XI9A 3ZL7C 2CP2A 3SWNC 1WJSA 1C1AA 3HRUA 2BTTA 3CC7A 4NL2A 2YLCA 2ZPHB 4FT4A 2DVJA 4XAXB 4ZTFA 5CKFA 4NS5A 3RMSA 2HL5C 4HCZA 4M77D 4L5GA 1MV0B 5CAIA 3GP8A 1IGUA 4C5GA 4EDUA 2IPOB 4ZGJB 1AD5A 1GBRA 4JZ3A 2YUQA 4CC7A 5LL6S 2E10A 2K3BA 2EQMA 2DXUA 4LDUA 3MHXA 4R56A 3CCMA 1AWWA 2CUBA 4FYXB 1VUBA 5LJ5d 4WTOB 3PNWC 2XG8D 3OYYA 2FHDA 1YBYA 1N8RU 4F7UF 1Q86R 1ZHIA 1YNZA 2PNIA 4M7DF 2CZ6B 1NBEB 4XU3A 3CC7T 1UTIA 2RF0A 2DL7A 1BCOA 2KYBA 1OZ3A 2RQWA 2F2VA 3BDUA 4M7AF 3JCMf 4A4GA 4E2FB 2ZCFB 2EBPA 1RABB 4GLKA 2XK0A 1M8MA 2OTLA 4JRKA 1X6OA 4M7DG 1M5Q1 4AMCA 2KT1A 3A1PA 4BY6B 1T0HA 2X3WD 2FPFA 3H9NA 1KC8U 3CC4A 3CCMT 4PL6A 2VXFA 1K76A 1B3QA 4KGVB 2MK5A 2EVRA 4RUGA 1AWOA 5HCKA 2GTOA 2DFUA 3MEAA 1SRMA 4ZTJA 1YITA 1BI2A 1MNEA 3EGUA 4Y91A 2NUZA 1K73U 4PJJA 3C12A 4M78B 2QDLA 4ZGDB 3CC2A 2Y90A 2DJZA 2O4XA 4F7UE 1VQ9Q 1Y71A 2EJFA 2ROTA 3EG0A 1IHWA 2YRCA 1WXBA 3OYHA 3M54A 1YN8A 4M7AE 2DEQA 3CC4T 2QASA 1Q81R 3LWIA 2X4JA 4AFZC 2EGAA 5GAMe 1W70A 1BYMA 1XOVA 3L1AA 3FB9A 1QP2A 1YITT 2EQIA 1KD1R 1M8VA 1WJRA 1X2KA 2YWWA 3QO3A 3OYLA 3VS7A 3RUXA 1UECA 4A54A 1IGQA 3H0HA 3PT9A 2QXFA 2CH4W 4Y28E 3CC2T 2QYZA 2JJ9A 2Y4XA 5GANg 1MGQA 1BB9A 3JB9F 4XU2A 4OMNA 3C0CA 1IO6A 2V8JA 2OAUA 5IHIA 1K0XA 2O9SA 2ZZDA 3V7SA 3OA6A 3OS1A 3VKIA 1WHLA 2BZXA 4B6MA 4PFZA 2GCXA 5D6YA 5IXFA 1GRIA 2E3IA 3KBGA 2DXTA 2AZSA 2O2OA 4E7SA 3H0FA 1W6XA 1M2VB 2R5MA 1K1ZA 2GQIA 1VQ8A 4A4EA 3G71A 4V2SA 4HKEA 3P8HA 2J6KA 5GAMf 4QQ6A 1Q82U 1U3OA 2EQJA 1I07A 2JTMA 3RDVA 3OS5A 2LQKA 4F16A 3JAME 3CPWP 4PFPA 2L3RA 1D1CA 2E6NA 3CPWS 1KIKA 3VU3C 2M1HA 1M2OA 4F7UA 3M4GA 4KRTA 3BE3A 4FSXA 4JPBW 3OB9A 3V8KA 3CCJQ 3R6OA 1PSFA 4M7AA 3S3OA 1UJ0A 1PG5B 2QQ9A 4M75F 2DYIA 4ELYC 2P0QA 4II1A 2LT4A 3QDFA 1WLPB 2DVEA 2X4XA 1JJ2P 2J05A 1ZSZC 2AZVA 1ZQ1A 1JJ2S 2CT3A 2RA2A 1W4SA 2EGEA 1N9RA 1KD1U 3J7AF 5GJWB 4M78E 4DBQA 4M75G 3HTRA 2VB6A 1RACB 1OPLA 1RI9A 1HYOA 2RN8A 1KQ2A 4X9DA 2DEUA 3MKDA 4LDYA 4B9XA 3L2RA 4OGCA 2C06A 2R5AA 5L23A 3SD4A 3V7CA 1QWFA 1YJ9Q 3C94A 1AWXA 1UGRB 4OVAA 5KCHA 1ZUYA 5LJ3d 1HSQA 2VXEA 1WDXA 5IAYA 2KXCA 3OMGA 1ZA1B 4ZN3A 1QVFP 3BFMA 4M7DC 3ER0A 2PVOB 1QVFS 2AKLA 3OYEA 5EG2A 3VS6A 2XKOC 4M7AC 2F69A 2KSSA 3M55A 4JLIA 2J7IA 2CKKA 1M27C 1QW1A 1M4ZA 5GAOl 1GCPA 2FZKB 5GANj 5IT9E 3LGFA 3V7RA 1OX8A 8ATCB 3OYMA 4D6WA 3FLGA 2KXDA 5CIUA 5LJ5g 3EGDB 1VQOQ 1U06A 1QVGS 1JB0E 2E3HA 1TUGB 1CKAA 4HCBA 2K2VA 1RLQC 1MUZA 4XU0A 2QK0A 1TSFA 4PJOF 2CP7A 2LVMA 2GF7A 5HKCA 3FIFA 3OY9A 4HXJA 2DD4A 4M78A 1QMCA 1X27A 2RQUA 2L3PA 4OB1B 3VS2A 2XIDA 2RHXA 4XTZA 3JCMd 3VS1A 2M9UA 2YDLA 3MEWA 4PJOG 4LUEA 1MHNA 2OI3A 5CQXA 3QJYA 3LW5E 3VS5A 3QIIA 2DL8A 1Y7XA 2K9GA 2GBQA 3DLMA 4OP0A 2CSIA 2MCNA 1TS9A 2E1HA 1OZ2A 1LPLA 2JTEA 1TU0B 4RTZA 2F5TX 4R55A 3CCQA 2JM9A 4HVWA 1SEMA 3PGGA 4FYVB 3QDRB 2EKOA 2FPEA 3HPWA 2WSEE 2MAMA 1KHCA 3C95A 3URGA 1T3SA 3META 3E19A 3EG1A 1VQ5A 1M1FA 5A2QE 3H0IA 2X35A 1OPKA 3RNJA 4M77B 3CCRQ 3A8LB 1ZX6A 5CR2A 4ZNXA 1S72A 2O01E 1SSFA 4FIBA 2LMJA 4J9BA 1K8AR 4IUVA 2CH4A 1JRIA 2EYYA 2L89A 3QZ5B 1JJ2A 3JB9H 3X24B 4KGXB 3X26B 1D0XA 5FU7C 3CD6A 4OB3B 3MJXA 1D09B 2D0QB 2NWMA 1U1SA 2RK1A 2ESWA 1Y96B 2JW4A 2CP0A 1NE8A 2JMAA 3LX7A 4RCCA 1O9SA 4J8OA 2X4YA 1VQ5T 4M75C 4HCKA 1NJIC 2QTXA 1M90U 3QXEB 1MMGA 1K9MR 1S72T 1MNDA 1SRLA 1VQKQ 3VS3A 4XTYA 3CCSQ 4NL3A 2RD1A 5CK9A 2IVWA 3G4SQ 4ORZA 1GFCA 3M56A 4QVZA 4RTWA 1VQOT 5LJ5j 3OYGA 3M5AA 3LLRA 1YFNA 2DX1A 5GMKl 5GAMd 2LZ6B 3BY7A 1QCOA 2CYZB 1NEBA 3I5SA 3A8MB 2H3JA 1HD3A 3MEUA 5CKBA 1QLYA 5DLQE 4MMKA 1ABQA 1NEGA 5I2SA 1R0CB 4M77F 3QZ9B 2BE9B 2H3EB 4AFQC 2M51A 3QJ6A 2FPDA 4DA4A 4BACA 2O9VA 2KYMA 2HBWA 1P92A 4ZN1A 2KQWA 1ABOA 2DXBA 3M4YA 2MMPA 4KH1B 2COYA 2K7AA 2PZ1A 3EH1A 1N9SA 5FLXE 4F17A 1D1BA 3CCRA 1Y57A 3GBQA 3JB9J 1YP5A 3M57A 3P8BB 2MWPA 3UDCA 4RMOA 1OQKA 2W10A 2KE9A 2FVUA 2MWOA 2PVDB 3T9NA 4CC3A 1J3TA 2HCKA 2EQUA 2A3LA 4XU1A 2DL3A 3JV3A 4DOWA 4BUGA 1JQQA 3CCEQ 2K79A 1N8RC 2LJ0A 2M0YA 3IQLA 2K57A 2KAFA 5LJ3g 1ZUKA 4M77E 1C6VX 2CUDA 3OYCA 3TU4K 3ASKA 3OYJA 4PJOC 2J6FA 3VUZA 1N6AA 3CCRT 2F1LA 3EGDA 4PLIA 2DK3A 4J6WA 4PFOA 1XTDA 3CCSA 4OB0B 4YTLA 2LRQA 3RKYA 2XDBA 1I81A 2MYSA 3EG2A 4MZPA 4OMFB 4N4IA 1I5LA 1KC8C 2RJDA 2RO0A 3NHNA 1VYUA 4L59A 3KXTA 1X43A 1B34B 1NYFA 2DE0X 1YI2A 3ZFJA 2RM4A 8AT1B 2O31A 1G3WA 3QKJA 4HA8A 5LJ5h 2X9HA 1K73C 1NM7A 2HBPA 5KYYB 4J9IA 1BI1A 1WHMA 3EG9B 4K11A 1NG2A 1MMDA 4DBRA 1TUCA 2E65A 1VQKT 4KGZB 2P4RA 3CCST 2KI7A 1G3SA 3G4ST 1RL2A 3G1JA 1UJYA 2CZ0B 4F7UG 3I55Q 4LD9K 1A0NB 3JRZA 2A08A 3JCMg 5GMKj 3QWXX 2ATCB 5GAN2 2MI6A 1YHQQ 4M7AG 2ABLA 2K5LA 1PM3A 2K2MA 3CBPA 4GY5A 2C0TA 1YI2T 5DM7R 1SF9A 3GPLA 2EYZA 4RG2A 2GQVA 1JEGA 1M30A 4PJNA 2XICA 1Q7YU 3VYGA 2JN0A 1D0ZA 4M77A 3S3MA 5GANe 1M1KU 2GFUA 1GCQA 2VC8A 4RKUE 1WFWA 3JCMJ 1LOJA 3OYKA 2K6DA 4VUBA 2H8HA 3M58A 1VIFA 2P0KA 1DJ7B 2ZPEB 5GAN3 1PNJA 2CREA 4J9HA 1U1TA 1AOJA 1W2BA 4J9DA 4D8KA 2E12A 1Y96A 2JVVA 2CS7A 4LN2A 1WQ7A 2DA9A 1SG5A 3L2ZA 5IHKA 1Q82C 2KGTA 4RTVA 3CCET 2CP5A 2J06A 1EZZB 3GLXA 1N27A 1YWOA 2LNHB 4M7DD 1VQ4Q 3L42A 4LDWA 2KBTA 4ANJA 4A4KA 4FM4B 1Q86U 3NGPA 5KE2A 4PKCC 5IN1A 5LJ3j 3SHWA 1X6BA 2EWNA 2FZCB 4E7LA 4EIKA 4M7AD 1Y07A 2RHYA 4E7HA 1M1GA 1H3ZA 2AK5A 2L0AA 2VYTA 3NTIA 4JLGA 2WACA 4M77C 1HK9A 3GOXA 1GCQC 3RIRA 1UGPB 4IUQA 1G83A 3JB9G 1K9AA 2EYXA 3PVLA 4J83A 5GMKm 4XTWA 3JCMb 4IUUA 1RAGB 4QT7A 2F5KA 4M78F 1E6HA 3RERA 1YHQA 1YJWQ 4FU6A 1JXMA 3TVTA 1XNIA 2RJEA 3CMAQ 2ED1A 4C92B 3UT1A 2ECZA 3FRNA 2F2XA 4UC4A 1PD0A 2D8HA 4HVVA 3CCUQ 1AZEA 1VQ7Q 1WA7A 2LCCA 5GAMg 3UATA 4KULA 1U8RA 4M78G 2G3RA 2DD5A 2R57A 4DEXA 3CBMA 2LQ8A 2XHCA 4OMMA 2E64A 3A98A 1VQ9A 4IIMA 4LDXA 5I11A 1OX9A 2FYKA 1B7TA 4HCCA 3M9QA 3TEEA 3X25B 4C8QB 3I55T 4JJCA 1GL5A 2CSQA 1ZLMA 4PK4A 4E47A 3LH0A 1PCXA 3OW2P 1Q81U 1QKXA 2LP5A 2DRMA 3OW2S 1VYVA 3H8ZA 1YHQT 2DBKA 4JJNK 3HSBA 2E41A 2RHUA 4JS4A 3CXCS 1X2QA 1SHGA 1YIJQ 4JZ4A 4CC4B 2RK2A 5KH6A 1YCSB 3HL8A 4C5EA 3JB9D 4AG1C 3M53A 2DZCA 2EKHA 1VQ4A 3QUIA 2LX7A 1VQ9T 2EYQA 4LE9A 1RI0A 4A63B 3SWNB 2VV5A 5LJ5e 4CC2A 5CKEA 3OS0A 3JSCA 4D8DA 1HJDA 4C92F 1WNLA 1MMNA 1K4US 5LJ3h 2M16A 1B34A 4MDWA 1RADB 3E9FA 5D6WA 3TCJA 1G2BA 1FMKA 2LC4A 1BI3A 5DY9A 3Q1JA 2DAQA 1VQNQ 2PUOB 3G6EQ 4JRIA 2JS0A 5KYYA 3J81E 4NOYA 3OYNA 2OJ2A 3EG9A 1VQ4T 5GAN7 1WGSA 4A53A 4C8QF 1SKUB 3CCUA 4EPCA 2LTOA 3DLLA 1RAHB 2DLPA 2DNUA 4N4GA 2X3XD 3VRYA 1QVGP 5A0GA 1G5VA 3MO8A 1G3TA 2DL4A 4M75D 1YJNQ 4KBMB 2EQKA 3CCJA 2GGRA 4PLLA 2JMCA 1SSHA 1QCFA 5IH2A 3OYDA 2RQVA 3CPFA 2FZGB 3NTKA 4XTUA 4C92E 5KCOA 1RAAB 2LX9A 4J9FA 4DEYA 1VOMA 2IG0A 3NFCA 3FDRA 1FX7A 2YUOA 5GAOn 1UG1A 2M02A 4DQ2A 4FW2A 2A28A 5KYUB 1KQSP 1U5SA 1KQSS 3CCUT 3WVDB 3CEYA 1RAFB 1VQ7T 2RI5A 3VJPA 2CP6A 1WXUA 2OTJQ 2ZGWA 1VQLQ 2QQRA 5GAMj 1VQPQ 3JCMh 4EMGA 2PU9B 4C8QE 3CCLQ 4XQ3A 3CCJT 1VA7A 4C0FA 2PUKB 4A4FA 1YJ9A 1ZSGA 1TOVA 2D1XA 2BKDN 1IXDA 3INZA 1SPKA 2RI2A 4A4HA 9ATCB 3GF5A 1TUDA 2HQEA 3LGLA 4BI3A 1VQMQ 4BY6C 2ZAEA 4J6YA 1YIJT 3OBWA 3CPWA 5A0DA 1WHGA 5IXBA 2PQWA 3CMEQ 5HY6A 4PJMA 4BI4A 2D8JA 3E1SA 1VQNA 2B86A 3G6EA 1NLPC 2RQTA 1VYTA 1M90C 4LXCA 5I2MA 4M78C 5GMKi 3EG3A 4GBQA 2DYBA 1D1AA 2JNGA 4O6JA 4JRQA 1YJ9T 3EHRA 3JCMc 1NJIR 5GMKe 2IIMA 5KYXB 2LQWA 2VGNA 1VQOA 3S6WA 2JOYA 4F04B 3QBYA 5HK3A 4PJOD 5FW9A 5IHNA 2QEXQ 2KROA 2JTFA 3QYGB 4R0KA 2DM1A 1BK2A 2SRCA 5GANh 1TXQA 4C92A 2E70A 3ME9A 3FEOA 1Y0MA 2AHJB 3VRZA 1M3BA 2K5IA 3CCVQ 1K0SA 1VQNT 3G6ET 5L8RE 3OYAA 3JCMX 2QQSA 2BE7D 1KK7A 2V26A 4O5VA 1IREB 2P4TA 1LVKA 6AT1B 1UFFA 2DPPB 1IHVA 2QI2A 1VQ6Q 1V76A 3OYIA 1B07A 1UHCA 1OI1A 2K3YA 2VWFA 4C8QA 1VQPA 2DETA 3FJPA 5KYWA 1QVFA 4FL6A 2MF2A 2EYWA 3KUFA 2EFIA 1T0JA 2DIQA 1YJNT 2AKKA 3A5ZB 3UA7A 4B9WA 3E9GA 2HDAA 2BUDA 1AZGB 2CZ7B 2L5QA 1OU8A 4Z88A 3UA6A 3I56Q 4F14A 3EFSA 2L2PA 4XTXA 1EX4A 1S1NA 2FO0A 5LJ3e 2E5KA 2WSCE 3L2WA 4C92C 4OMQA 2VKNA 1VQLT 3JB9I 2QTVA 3LH5A 2V1QA 1QVGA 1VQPT 3SWNA 2YLBA 2VGMA 2RMOA 4J9EA 4M77G 1Q95G 3QSUA 1N8RR 2RPNA 2DTHA 2YSQA 3DB4A 2NYSA 3EFOB 1IZ6A 2E5QA 4LNPA 4OB2B 2D0NA 1K8AU 2ZPBB 4M4ZA 1QP3A 2X4WA 1E7OA 3KFVA 4IUPA 3ZEHA 4C8QC 4RTXA 3G7ZA 5GAN6 4C0DB 1VQMT 2OTLQ 1OOTA 2OAWA 3L2UA 2RQRA 3OQ5A 4PJLA 2DF6A 3PFSA 1PSEA 4RTTA 5FWBA 2DTOA 4L6V5 5CO7A 4ESRA 2KRNA 3CC4Q 3CCVA 1QKWA 1ZBXA 1KC8R 3A8HB 4QVDA 5CQYA 4E7KA 3O5ZA 1BIBA 5GAOm 3RKXA 1UGQB 1K9MU 4IURA 1YITQ 2FL7A 2NUPB 4CI0C 3M59A 4QKUA 1KQ1A 2RH2A 1VQKA 5FWCA 1K73R 1WHHA 3G4SA 1AWJA 2L3QA 3HRTA 2R58A 3X20B 1BI0A 2XDDA 3QYHB 3MP1A 3H6ZA 3JCMe 3QHSA 2A37A 5FU6B 2EIFA 2QEXT 5GAOr 2QGGA 4BD3A 1W1FA 2ENMA 4GLMA 5KYUA 1Z9ZA 2QGFB 1RLPC 1UEBA 3CCVT 4BB7A 4BI8B 3I35A 2YXYA 5CKHA 3I56A 3ZBDA 2V1RA 2ED0A 1Q7YC 1TG0A 1RAIB 1JXOA 1BIAA 1M1KC 3S3NA 1RAEB 1OULA 2HSEB 4AG2C 2LNVA 3HFNA 2JUFA 1VQ6T 2DO3A 2KK4A 4J6XA 4IKFA 2VASA 1C0MA 2LCLA 3D7SB 4FYYB 3QWYA 1FMWA 3CQTA 1O75A 4ATOA 2EPDA 2DZ9A 3GNGA 3N5BB 2GNCA 5C6SA 2QAZA 3LWHA 3OSSC 1FWZA 2KVQG 3VUBA 1EFNA 2KMTA 3L2QA 1R77A 2X51A 1WX6A 5D7UA 3OS2A 3I56T 4BE1A 4CRIA 2DERA 3MEVA 4C5HA 4MMLA 4JJDA 2QQAA 5CCAA 3OYBA 3CCEA 4KUDK 2CDTA 2GTJA 1VQ8Q 3THKA 2HEQA 1Q86C 3G71Q 2KDSA 1WHKA 4XTVA 1UUEA 4OMLA 1Q82R 2DTIA 4EMKB 4E7JA 1R8OB 1WHJA 2HKQB 1LNXA 5KYXA 3I5RA 2LCSA 1BCMA 1D3BB 3PVQA 2E4HA 4J9CA 4C0GA 1RUWA 4HT8A 2MOXA 4M7DE 2ZPIB 1H3HA 1AEYA 4AFUC 2OTLT 1BU1A 4C0ZA 5GAOq 3BW1A 5FU7B 2O88A 3TQ7P 2KNBB 4LUDA 1I8FA 4WCIA 3FJ5A 1WXTA 3OBYA 3PIOA 2KT8A 3CBOA 1MMAA 1X6GA 2DL5A 1ZUUA 5J26A 1N5ZA 4OF1A 5GANf 4RG8A 4OMPA 1R0BG 4M75B 3HHTB 1WJQA 3TREA 1IRXA 4J7IA 4RTYA 2XD0A 2BZ8A 1G3YA 2XU8A 5GAN8 3I55A 2EAYA 4AT1B 4RTUA 2HKNA 1Q81C 2COWA 3MPUB 4JUVA 1F1BB 4FSSA 1XJWB 1PKTA 2JZ2A 4JRPA 1ZSZA 1KD1C 1OV3A 2ZPFB 1ZBJA 1TH7A 3J80E 2J6OA 5M9OA 3VS4A 5GMKh 2JM8A 2F2WA 3JCMW 2RB6A 1PRLC 1WI7A 2EJGA 1G8XA 2A7YA 3EFOA 5DLOA 2I0NA 1D0YA 5KE3A 3I9QA 3SDZA 3A8OB 1PRMC 5KYWB 3F70A 2FEIA 1NLOC 2KY9A 3RKWA 4KT0E 2QQBA 5C0MA 3NTHA 1CKBA 1KHIA 4M7DA 2XDPA 5A0LA 3CXCP 2YHTA 3HP9A 3SFMA 1M9SA 2XMFA 3LYIA 1WPYA 2KRMA 2QA4Q 2RHIA 3O8VA 1EIFA 2VVKA 1AT1B 4E6RA 2K3XA 1VQ8T 3EGXB 3G71T 4JDSA 2NUPA 4MZMA 3H41A 3SB2A 4HVUA 2B8AA 2DBMA 2HD0A 3FC3A 3C4SA 3PMTA 4N0AA 4Z8AA 4MZTA 2NUTB 2QDYB 2DRKA 2LJ3A 2D9TA 4PJOB 1ARKA 1NPRA 1JO8A 3MP8A 2W0ZA 2DJQA 4OMOA 1I4K1 3BDLA 5GAOp 2DMOA 3E2UA 4FYWB 3PMIA 1BKBA 4M78D 3AT1B 3REAB 4AFSC 2BIVA 4X34A 2OX7A 4QQDA 3JCMP 1BBZA 4P5NA 1OYXA 1TTHB 3NMZC 2MIOA 1YJWA 4C0DC 3CCQQ 3CMAA 4C92G 3WXMB 2EW3A 4ELZC 3QPHA 2SEMA 1UGVA 1H92A 4DBHA 1VQ7A 1NPPA 4M75E 3M0RA 1QCNA 3VYHB 5FROA 4JJBA 5AT1B 3M0QA 1VQ5Q 1MV3A 5EC7A 4QVCA 3UWNA 2RJCA 1GXIE 4C8QG 5LJ5f 1H8KA 2RNAA 3SEMA 1I1JA 1IB8A 3M0PA 1S72Q 4N0AC 1I5OB 2A36A 1FMVA 3MP6A 2L3SA 4KUIA 2AIRB 3NPFA 5FU6C 1AHJB 1YJWT 3CMAT 1JBMA 1TWBA 5CKDA 3CD6Q 1YIJA 2JS2A 2QA4A 2LJ1A 2CZ1B 2M0OA 4EMKA 2ZPGB 3QG1A 2HZYA
chains in the Genus database with same CATH topology
4J7FA 2L3RA 2E6NA 3CPWS 3HKSA 3JRZA 4J5YA 4WF2A 3VU3C 2M1HA 3JCMg 4F7UA 5GMKj 5FRMA 2RJFA 3EFRA 3M4GA 3X28B 3GIBA 3EFSA 1D3BA 4XTXA 4FSXA 4FT2A 5GAN2 2MI6A 5LJ3e 4MDXA 2YRVA 4M7AG 3OB9A 3V8KA 2K5LA 3CBPA 3R6OA 2WSCE 4LD6A 4GY5A 4C92C 5HK0A 1PSFA 3L2WA 1YI2T 3JCMQ 2CGHA 4Q5WA 1VQLT 4C92D 3JB9I 4E7IA 4M7AA 5DM7R 1VQPT 1QVGA 3SWNA 2YLBA 3S3OA 2VGMA 3EAEA 2QQ9A 4M75F 3GPLA 3OSVA 3A8GB 4M77G 4RG2A 3PIPA 3QSUA 4ELYC 3WVEB 2P0QA 4BDYA 4II1A 2DTHA 2GQVA 2LT4A 2Y4YA 3DB4A 4RCBA 3V8JA 2XICA 2DVEA 2WSFE 2K4YA 2X4XA 1Q7YU 3VYGA 1UB4A 2JN0A 1IZ6A 2E5QA 4M77A 5GANe 3S3MA 1M1KU 1ZQ1A 2GFUA 4OB2B 2RA2A 1JJ2S 1K8AU 2ZPBB 2VC8A 1QP3A 1W4SA 2X4WA 4RKUE 4M7DG 2QA4T 1N9RA 4IUPA 3JCMJ 4DOVA 4QW2A 2D6FA 1LOJA 3ZEHA 1X01A 4C8QC 1KD1U 3J7AF 3OYKA 4M78E 3G7ZA 4C8QD 4M75G 4IUTA 4VUBA 3PTAA 4EMHA 3M58A 1VIFA 5GAN6 4C0DB 1VQMT 2P0KA 3P8DA 3L2UA 3OQ5A 1DJ7B 2ZPEB 5GAN3 4M75A 1KQ2A 3PFSA 4X9DA 1PSEA 1XQHA 4PNOA 4LDYA 4B9XA 3L2RA 1U1TA 4PJOE 1W2BA 2DTOA 4L6V5 5CO7A 3JAME 1KG1A 4OGCA 3CCVA 2C06A 1ZBXA 3A8HB 2R5AA 4QVDA 2E12A 5CQYA 4EMKC 4E7KA 3OW2A 2V8KA 2NLUA 3SD4A 3RMQA 1Y96A 3V7CA 2JVVA 2RHZA 1BIBA 2CS7A 1WQ7A 3C94A 3L2ZA 1V29B 5GAOm 4BDZA 1H641 3RKXA 1UGRB 3OMCA 4OVAA 5KCHA 3CXCA 1Q82C 5LJ3d 5D6XA 1UGQB 2VXEA 1YJNA 1K9MU 4IURA 2FL7A 4CI0C 5IAYA 4ME7A 3OMGA 3CCET 3M59A 4ZN3A 3BFMA 3GLXA 4M7DC 1KQ1A 1FXXA 1N27A 3ER0A 5GAN4 2PVOB 1QVFS 2RH2A 4M7DD 3OYEA 3L42A 2DKGA 2O4XB 1VQKA 4LDWA 5EG2A 4A4KA 4FM4B 1Q86U 3G4SA 5KE2A 4PKCC 4BE0A 3AHUA 5IN1A 5LJ3j 3HRTA 2R58A 2XKOC 1BI0A 5CVIA 3X20B 4M7AC 2XDDA 2EWNA 2HNIA 3QYHB 2F69A 3H6ZA 3MP1A 3JCMe 3QHSA 1Y07A 4E7LA 4M7AD 2KSSA 3CCQT 2RHYA 5FU6B 4E7HA 2EIFA 4QQGA 3M55A 5GANd 4JLIA 1M1GA 2CKKA 1H3ZA 2QEXT 5GAOr 1QW1A 2VYTA 3NTIA 4BD3A 1M4ZA 4JLGA 2WACA 4M77C 1HK9A 2PVGB 5GAOl 3L2VA 2VUBA 3GOXA 2OTJA 3RIRA 1UGPB 1WQWA 5GANj 1UEBA 4IUQA 4TVRA 3CCVT 5IT9E 3LGFA 3V7RA 1VQLA 4BB7A 1QVPA 4BI8B 3JB9G 2E6ZA 5CKHA 4C5IA 3I56A 3ZBDA 4J83A 4D6WA 3OYMA 3DKMA 2GFAA 5GMKm 5J3BA 4XTWA 3FLGA 3JCMb 4IUUA 1Q7YC 4JS5A 5CIUA 5LJ5g 4M78F 2F5KA 1BIAA 1M1KC 3CCLA 3MCAB 3S3NA 4OGEA 1K8AC 3HRSA 3RERA 1YHQA 4FU6A 1QVGS 1XNIA 1JB0E 2RJEA 4HCBA 2LNVA 3HFNA 2JUFA 4XK8E 3V8LA 5I21A 2DO3A 1VQ6T 2K2VA 2KK4A 4J6XA 4C92B 3UT1A 4XU0A 4IKFA 1HXDA 2HAXA 3FRNA 4UC4A 4PJOF 2LCLA 5GAMh 4N4HA 4X9CA 2LVMA 2GF7A 1O75A 4ATOA 2LCCA 5GAMg 1VQMA 4KULA 1X75C 2DZ9A 5HKCA 3GNGA 3FIFA 3OY9A 1U8RA 4M78G 2G3RA 3N5BB 2DD5A 2R57A 2DD4A 3CBMA 3CD6T 2LQ8A 5C6SA 2XHCA 3LWHA 3OSSC 1FWZA 4M78A 2E64A 2KVQG 4OB1B 4Z02A 3VUBA 1VQ9A 3JCMV 3CMEA 2KMTA 3L2QA 4LDXA 1VIEA 1NZ9A 2XIDA 2RHXA 4XTZA 2OTJT 2FYKA 3JCMd 4HCCA 2M9UA 3M9QA 3TEEA 3X25B 4C8QB 3MEWA 3I55T 1LJOA 4PJOG 1MHNA 3OS2A 5CQXA 3QJYA 2DXCA 4E47A 3I56T 3LW5E 1K9MC 3HFOA 1W2BS 4BE1A 4CRIA 4PJOA 3LH0A 3QIIA 5GAN5 3MEVA 4C5HA 4MMLA 1Y7XA 3CCLT 2QQAA 5CCAA 3OYBA 3CCEA 1Q81U 4KUDK 3OW2S 3H8ZA 1YHQT 3UPUA 1Q86C 3GNFB 2KDSA 3DLMA 4OP0A 4JJNK 4XTVA 3HSBA 2E41A 2RHUA 4JS4A 1NJIU 3CXCS 2E1HA 1OZ2A 2V8IA 2DTIA 4EMKB 2K5FA 2I2LA 3RESA 4E7JA 1R8OB 2HQXA 2LDMA 5J39A 2F5TX 2RK2A 3VV0A 5KH6A 4R55A 2EJ9A 3CCQA 1LNXA 2FB7A 1KQSA 4F7UB 3HL8A 2QEXA 3PGGA 4C5EA 3JB9D 3M53A 2DZCA 4M7DB 1D3BB 1VQ4A 3QDRB 2EKOA 5AYFA 3QUIA 3HPWA 1VQ9T 3CMET 2WSEE 4C0GA 2EYQA 2P0PA 1RI0A 1KHCA 2MAMA 2RI3A 4HT8A 4M7DE 4M7AB 2LT1A 2ZPIB 3C95A 3SWNB 3URGA 2VV5A 5LJ5e 2OTLT 3META 3E19A 5CKEA 4C0ZA 3OS0A 5GAOq 3JSCA 5LJ3f 1VQ5A 1M1FA 3BW1A 5FU7B 5A2QE 4BE2A 2X35A 4HT9A 4M77B 4C92F 1WNLA 1UGSB 1I8FA 3A8LB 4LDVA 1YCYA 3DB3A 1VQ6A 5CR2A 1S72A 2O01E 4ZGEB 1SSFA 4FIBA 5LJ3h 2M16A 5FRNA 1B34A 3OYFA 3OBYA 3PIOA 4MDWA 3E9FA 2DIGA 5D6WA 3TCJA 3CBOA 2L8DA 2XI9A 4IUVA 1JRIA 2L89A 2LC4A 1BI3A 3QZ5B 5DY9A 3Q1JA 1WJSA 5J26A 4OF1A 3SWNC 1JJ2A 3JB9H 3X24B 5GANf 2DAQA 3HRUA 4RG8A 2PUOB 4JRIA 3CC7A 4NL2A 4M75B 3J81E 4NOYA 3X26B 2YLCA 3HHTB 1WJQA 2ZPHB 4FT4A 5FU7C 4OB3B 3TREA 4XAXB 3OYNA 3CD6A 1VQ4T 4ZTFA 5GAN7 5CKFA 1WGSA 2D0QB 4A53A 4NS5A 4J7IA 3RMSA 4C8QF 4HCZA 4M77D 4L5GA 2XD0A 3CCUA 1G3YA 4EPCA 2XU8A 5GAN8 3I55A 1U1SA 2EAYA 2RK1A 5CAIA 2LTOA 3GP8A 3DLLA 1Y96B 4C5GA 4EDUA 4ZGJB 1Q81C 1NE8A 3LX7A 4JUVA 4RCCA 5LL6S 1O9SA 2E10A 4N4GA 4J8OA 2X4YA 2EQMA 1VQ5T 2JZ2A 2DXUA 4LDUA 4M75C 5A0GA 4JRPA 1G5VA 3MO8A 1G3TA 2QTXA 4M75D 1NJIC 1M90U 4KBMB 2EQKA 3CCJA 3QXEB 3MHXA 4R56A 4PLLA 3QG1A 3CCMA 1KD1C 1S72T 1VUBA 5LJ5d 3PNWC 2XG8D 3OYDA 2ZPFB 3OYYA 4XTYA 2FHDA 1TH7A 4NL3A 2RD1A 3CPFA 1YBYA 2IVWA 5CK9A 3J80E 1N8RU 4F7UF 5M9OA 1ZHIA 3NTKA 3M56A 5GMKh 4XTUA 4M7DF 2CZ6B 4QVZA 4C92E 5KCOA 1VQOT 2LX9A 4XU3A 5LJ5j 3JCMW 2RB6A 3OYGA 2IG0A 3NFCA 3FDRA 1FX7A 3CC7T 3LLRA 3M5AA 5GAOn 2EJGA 2A7YA 5GMKl 4DQ2A 1OZ3A 5DLOA 5GAMd 3BY7A 3BDUA 4M7AF 3JCMf 4A4GA 1KQSS 2ZCFB 2CYZB 3CCUT 3WVDB 3CEYA 1VQ7T 5KE3A 2RI5A 4GLKA 3SDZA 2XK0A 3VJPA 3A8MB 2H3JA 3MEUA 3A8OB 5CKBA 2ZGWA 3F70A 2OTLA 5DLQE 4JRKA 4MMKA 1X6OA 2KY9A 2QQRA 3RKWA 4KT0E 3JCMh 4EMGA 5I2SA 1M5Q1 5GAMj 2QQBA 4M77F 5C0MA 3NTHA 3QZ9B 4BY6B 1KHIA 2PU9B 4C8QE 4M7DA 4XQ3A 3QJ6A 2XDPA 4DA4A 5A0LA 1KC8U 3CC4A 3CCJT 4C0FA 2YHTA 4PL6A 3CCMT 4BACA 2VXFA 2PUKB 3HP9A 1P92A 1M9SA 3SFMA 4ZN1A 2KQWA 3LYIA 4A4FA 1WPYA 2DXBA 3M4YA 2MMPA 1YJ9A 2RHIA 2BKDN 1EIFA 3O8VA 3MEAA 4ZTJA 2K3XA 3INZA 1N9SA 2RI2A 1BI2A 4A4HA 5FLXE 1YITA 3GF5A 2HQEA 1VQ8T 3CCRA 3LGLA 4Y91A 4BI3A 3G71T 4BY6C 3JB9J 4JDSA 1K73U 3M57A 3C12A 3P8BB 2MWPA 4J6YA 4M78B 4MZMA 3UDCA 4RMOA 3SB2A 4ZGDB 2Y90A 2DJZA 3CC2A 2B8AA 1YIJT 2HD0A 2O4XA 3OBWA 2FVUA 2MWOA 3C4SA 3PMTA 4F7UE 3FC3A 5A0DA 3CPWA 4N0AA 2PVDB 1Y71A 2EJFA 2PQWA 4MZTA 5HY6A 3T9NA 4BI4A 2QDYB 1VQNA 3E1SA 2EQUA 3G6EA 2D9TA 4PJOB 1NPRA 2A3LA 4XU1A 4F7UG 3OYHA 3MP8A 1M90C 3M54A 4M7AE 2DEQA 4DOWA 1I4K1 3BDLA 4BUGA 5I2MA 5GAOp 4M78C 5GMKi 3CC4T 3PMIA 1BKBA 4M78D 1N8RC 3LWIA 2X4JA 2K57A 2KAFA 2JNGA 4O6JA 5GAMe 2BIVA 5LJ3g 4JRQA 4X34A 4QQDA 4M77E 1YJ9T 1BYMA 3JCMc 3JCMP 5GMKe 4P5NA 1OYXA 3OYCA 3TU4K 1XOVA 3ASKA 2VGNA 3L1AA 3OYJA 1VQOA 3S6WA 2JOYA 1QP2A 3FB9A 1YITT 4PJOC 1YJWA 3QBYA 1M8VA 1WJRA 4C0DC 3VUZA 5HK3A 1N6AA 4PJOD 3QO3A 3OYLA 3CCRT 4PLIA 3CMAA 2DK3A 4J6WA 3RUXA 4C92G 3WXMB 4A54A 2JTFA 3PT9A 4ELZC 1XTDA 3QYGB 3QPHA 2QXFA 5GANh 4Y28E 3CC2T 3CCSA 2Y4XA 4OB0B 4YTLA 2LRQA 3RKYA 1MGQA 2E70A 4C92A 1NPPA 4M75E 3ME9A 5GANg 1VQ7A 3FEOA 2XDBA 3JB9F 2AHJB 4XU2A 3VYHB 5FROA 2K5IA 1I81A 1VQNT 2V8JA 2OAUA 4MZPA 4OMFB 3G6ET 5L8RE 3OYAA 4N4IA 2ZZDA 3V7SA 1I5LA 3OA6A 3JCMX 3OS1A 1KC8C 2QQSA 2RO0A 2RJDA 3VKIA 4O5VA 2GCXA 5D6YA 4L59A 3KXTA 4QVCA 3UWNA 1IREB 2P4TA 2RJCA 1GXIE 4C8QG 5LJ5f 3KBGA 2DXTA 1B34B 2DPPB 2QI2A 1YI2A 4N0AC 3ZFJA 3OYIA 1OI1A 2K3YA 4C8QA 1VQPA 2RM4A 3MP6A 3FJPA 1G3WA 3QKJA 4HA8A 2R5MA 4FL6A 5LJ5h 1QVFA 4KUIA 2MF2A 1K73C 2HBPA 3KUFA 1VQ8A 5FU6C 1AHJB 2EFIA 4A4EA 2DIQA 1YJWT 3G71A 4V2SA 1YJNT 1BI1A 4HKEA 3P8HA 1JBMA 3A5ZB 4B9WA 5GAMf 3CMAT 3E9GA 5CKDA 4QQ6A 1Q82U 2EQJA 1YIJA 2E65A 2QA4A 1VQKT 2BUDA 3CCST 1G3SA 2CZ7B 3G4ST 1RL2A 2CZ1B 2JTMA 2L5QA 2M0OA 4EMKA 2ZPGB 3OS5A 2LQKA 2CZ0B 4LD9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGF A;  2L3R A;  1SSF A;  2E6N A;  2M16 A;  2MWP A;  5FRN A;  4C5I A;  2M1H A;  3OYF A;  3OYM A;  5FRM A;  2RJF A;  2GFA A;  2DIG A;  3E9F A;  5D6W A;  2B8A A;  3FLG A;  2L8D A;  4IUU A;  4IUV A;  2O4X A;  3FC3 A;  2MWO A;  3C4S A;  3PMT A;  5CIU A;  2F5K A;  2L89 A;  5J26 A;  3Q1J A;  1WJS A;  3S3N A;  2PQW A;  2YRV A;  2DAQ A;  3OB9 A;  4FU6 A;  4LD6 A;  1XNI A;  3L2W A;  2EQU A;  4GY5 A;  2RJE A;  2D9T A;  1WJQ A;  4Q5W A;  3OYN A;  4E7I A;  3OYH A;  3MP8 A;  3UT1 A;  4ZTF A;  4IKF A;  3S3O A;  1WGS A;  4NS5 A;  3EAE A;  4UC4 A;  4HCZ A;  4N4H A;  2LVM A;  2GF7 A;  3BDL A;  4RG2 A;  2LCC A;  4BDY A;  4II1 A;  2LTO A;  3DB4 A;  3PMI A;  2X4X A;  3OY9 A;  3S3M A;  2E5Q A;  4C5G A;  2G3R A;  4EDU A;  2R57 A;  2GFU A;  2BIV A;  3LX7 A;  4X34 A;  4QQD A;  5C6S A;  2X4W A;  4N4G A;  2X4Y A;  2EQM A;  1OYX A;  3OYC A;  2JZ2 A;  4Z02 A;  4IUP A;  3ASK A;  4QW2 A;  3OYJ A;  3ZEH A;  3S6W A;  3L2Q A;  1G5V A;  3MO8 A;  2RHX A;  3OYK A;  3QBY A;  1WJR A;  2EQK A;  3M9Q A;  4IUT A;  3OYL A;  3MEW A;  4PLI A;  4PLL A;  1MHN A;  2P0K A;  3OS2 A;  3P8D A;  2JTF A;  3L2U A;  3PNW C;  3OQ5 A;  3OYD A;  2FHD A;  4BE1 A;  4CRI A;  3PFS A;  3LH0 A;  3QII A;  3MEV A;  2LRQ A;  5M9O A;  4C5H A;  4B9X A;  3L2R A;  3ME9 A;  3NTK A;  3OYB A;  3FEO A;  4QVZ A;  5FRO A;  5KCO A;  3H8Z A;  3DLM A;  3OYG A;  2IG0 A;  3FDR A;  2R5A A;  3LLR A;  4N4I A;  3OYA A;  4E7K A;  2RHU A;  3SD4 A;  2NLU A;  3OS1 A;  3OA6 A;  1OZ2 A;  1OZ3 A;  2QQS A;  2RJD A;  2RO0 A;  4E7J A;  2RHZ A;  2HQX A;  2LDM A;  5J39 A;  4BDZ A;  4A4G A;  3OMC A;  5D6Y A;  4OVA A;  5KCH A;  4L59 A;  3CEY A;  3UWN A;  5KE3 A;  2RI5 A;  2RJC A;  5D6X A;  5KH6 A;  2XK0 A;  4IUR A;  5IAY A;  3MEU A;  3OMG A;  3F70 A;  1N27 A;  4C5E A;  3OYE A;  3OYI A;  2QQR A;  3L42 A;  1OI1 A;  2K3Y A;  2O4X B;  5C0M A;  2EKO A;  3MP6 A;  3NTH A;  5KE2 A;  3QKJ A;  4BE0 A;  2R5M A;  4FL6 A;  5IN1 A;  2R58 A;  3KUF A;  3QJ6 A;  2XDP A;  4A4E A;  2EFI A;  1RI0 A;  1KHC A;  2DIQ A;  2RI3 A;  3H6Z A;  3MP1 A;  4E7L A;  2RHY A;  3P8H A;  4PL6 A;  4E7H A;  4B9W A;  4QQG A;  4BAC A;  3E9G A;  4QQ6 A;  2CKK A;  1H3Z A;  3MET A;  2EQJ A;  3LYI A;  2VYT A;  4A4F A;  3NTI A;  4BD3 A;  3OS0 A;  2RHI A;  2BKD N;  2BUD A;  3O8V A;  2WAC A;  4BE2 A;  2X35 A;  3MEA A;  3L2V A;  4ZTJ A;  2K3X A;  2M0O A;  3GOX A;  2RI2 A;  4A4H A;  2HQE A;  3DB3 A;  4IUQ A;  3LGL A; 
#chains in the Genus database with same CATH topology
 4J7F A;  2KR3 A;  2EGC A;  1KSW A;  1V1C A;  3HKS A;  4J5Y A;  1PKS A;  4WF2 A;  4IIO A;  5FRM A;  2RJF A;  3EFR A;  3X28 B;  3GIB A;  1D3B A;  1I0C A;  4FT2 A;  1GBQ A;  4MDX A;  2YRV A;  2CP3 A;  2G6F X;  4LD6 A;  1T3L A;  5HK0 A;  1M90 R;  2DIL A;  3JCM Q;  2CGH A;  4Q5W A;  4C92 D;  4E7I A;  3TSZ A;  2FRY A;  2KEA A;  3EAE A;  3OSV A;  1E6G A;  3A8G B;  3PIP A;  3WVE B;  4BDY A;  1YWP A;  2P84 A;  2Y4Y A;  3V8J A;  4RCB A;  1M3A A;  2WSF E;  2K4Y A;  2QG9 B;  1UB4 A;  3VS0 A;  4X1V A;  2QA4 T;  2COZ A;  4DOV A;  4J9G A;  4QW2 A;  2D6F A;  1X01 A;  1ZA2 B;  1ACM B;  1JU5 C;  4C8Q D;  3PTA A;  4IUT A;  3EHQ A;  4EMH A;  3P8D A;  4M75 A;  1KFZ A;  1XQH A;  4PNO A;  4PJO E;  1WZO A;  4Y92 A;  1KG1 A;  2YRD A;  2YUP A;  4EMK C;  3OW2 A;  2V8K A;  2NLU A;  3RMQ A;  1WYX A;  2RHZ A;  1UDL A;  4BDZ A;  5I22 A;  1V29 B;  3TSW A;  1H64 1;  3OMC A;  3CXC A;  1YJN A;  5D6X A;  4FCY A;  4ME7 A;  2Z0W A;  1FXX A;  5GAN 4;  2DKG A;  2O4X B;  4BE0 A;  3AHU A;  1PD1 A;  1UE9 A;  2HL3 A;  5CVI A;  4Z89 A;  2HNI A;  2HSP A;  1M2V A;  5KYN A;  3CCQ T;  4QQG A;  5GAN d;  3EH2 A;  2YT6 A;  1QWE A;  2FRW A;  2PVG B;  3L2V A;  2VUB A;  2OTJ A;  1GFD A;  1WQW A;  4TVR A;  1VQL A;  1QVP A;  2E6Z A;  1OEB A;  5GJV B;  1PWT A;  1PHT A;  1LCK A;  4C5I A;  3DKM A;  2GFA A;  5J3B A;  2HMA A;  4JS5 A;  2MPX C;  3CCL A;  3MCA B;  4OGE A;  1K8A C;  3HRS A;  3CC7 Q;  2C0I A;  3V8L A;  4XK8 E;  5I21 A;  4E7Z A;  2AT1 B;  1HXD A;  2HAX A;  3ULR B;  2C0O A;  1NYG A;  5GAM h;  4N4H A;  4X9C A;  2BZY A;  4DBF A;  1VQM A;  1UHF A;  1X75 C;  3R6N A;  7AT1 B;  3CD6 T;  3EGX A;  1ZSZ B;  4Z02 A;  3JCM V;  3CME A;  4KH0 B;  3UF4 A;  1VIE A;  1NZ9 A;  2OTJ T;  4FW1 A;  3CCM Q;  1Z9Q A;  1LJO A;  2NUT A;  1YI2 Q;  2ROL A;  1W2B P;  2DXC A;  1K9M C;  3HFO A;  1W2B S;  2JT4 A;  4PJO A;  5GAN 5;  1KJW A;  3CCL T;  1PC0 A;  2KRS A;  3M0S A;  3UPU A;  3GNF B;  3PE0 A;  1AVZ C;  3M0T A;  3U23 A;  1NJI U;  2V8I A;  2K5F A;  2I2L A;  3RES A;  2HQX A;  2LDM A;  5J39 A;  2A0F B;  3VV0 A;  2EJ9 A;  2FB7 A;  1KQS A;  4F7U B;  2QEX A;  2JXB A;  1CSK A;  3REB B;  4M7D B;  3RR6 A;  5AYF A;  1M3C A;  3CME T;  2PTK A;  2LQN A;  2P0P A;  2RI3 A;  1QQJ A;  4M7A B;  2LT1 A;  1OU9 A;  3RBB B;  5LJ3 f;  2HQH A;  2YUN A;  4BE2 A;  4HT9 A;  2CT4 A;  1SHF A;  3M0U A;  1UGS B;  4LDV A;  1YCY A;  3DB3 A;  1VQ6 A;  4ZGE B;  1FYN A;  1WIE A;  1X69 A;  5FRN A;  1Q7Y R;  2FG0 A;  3OYF A;  3CC2 Q;  1M1K R;  2DIG A;  5ECA A;  2L8D A;  2XI9 A;  3ZL7 C;  2CP2 A;  3SWN C;  1WJS A;  1C1A A;  3HRU A;  2BTT A;  3CC7 A;  4NL2 A;  2YLC A;  2ZPH B;  4FT4 A;  2DVJ A;  4XAX B;  4ZTF A;  5CKF A;  4NS5 A;  3RMS A;  2HL5 C;  4HCZ A;  4M77 D;  4L5G A;  1MV0 B;  5CAI A;  3GP8 A;  1IGU A;  4C5G A;  4EDU A;  2IPO B;  4ZGJ B;  1AD5 A;  1GBR A;  4JZ3 A;  2YUQ A;  4CC7 A;  5LL6 S;  2E10 A;  2K3B A;  2EQM A;  2DXU A;  4LDU A;  3MHX A;  4R56 A;  3CCM A;  1AWW A;  2CUB A;  4FYX B;  1VUB A;  5LJ5 d;  4WTO B;  3PNW C;  2XG8 D;  3OYY A;  2FHD A;  1YBY A;  1N8R U;  4F7U F;  1Q86 R;  1ZHI A;  1YNZ A;  2PNI A;  4M7D F;  2CZ6 B;  1NBE B;  4XU3 A;  3CC7 T;  1UTI A;  2RF0 A;  2DL7 A;  1BCO A;  2KYB A;  1OZ3 A;  2RQW A;  2F2V A;  3BDU A;  4M7A F;  3JCM f;  4A4G A;  4E2F B;  2ZCF B;  2EBP A;  1RAB B;  4GLK A;  2XK0 A;  1M8M A;  2OTL A;  4JRK A;  1X6O A;  4M7D G;  1M5Q 1;  4AMC A;  2KT1 A;  3A1P A;  4BY6 B;  1T0H A;  2X3W D;  2FPF A;  3H9N A;  1KC8 U;  3CC4 A;  3CCM T;  4PL6 A;  2VXF A;  1K76 A;  1B3Q A;  4KGV B;  2MK5 A;  2EVR A;  4RUG A;  1AWO A;  5HCK A;  2GTO A;  2DFU A;  3MEA A;  1SRM A;  4ZTJ A;  1YIT A;  1BI2 A;  1MNE A;  3EGU A;  4Y91 A;  2NUZ A;  1K73 U;  4PJJ A;  3C12 A;  4M78 B;  2QDL A;  4ZGD B;  3CC2 A;  2Y90 A;  2DJZ A;  2O4X A;  4F7U E;  1VQ9 Q;  1Y71 A;  2EJF A;  2ROT A;  3EG0 A;  1IHW A;  2YRC A;  1WXB A;  3OYH A;  3M54 A;  1YN8 A;  4M7A E;  2DEQ A;  3CC4 T;  2QAS A;  1Q81 R;  3LWI A;  2X4J A;  4AFZ C;  2EGA A;  5GAM e;  1W70 A;  1BYM A;  1XOV A;  3L1A A;  3FB9 A;  1QP2 A;  1YIT T;  2EQI A;  1KD1 R;  1M8V A;  1WJR A;  1X2K A;  2YWW A;  3QO3 A;  3OYL A;  3VS7 A;  3RUX A;  1UEC A;  4A54 A;  1IGQ A;  3H0H A;  3PT9 A;  2QXF A;  2CH4 W;  4Y28 E;  3CC2 T;  2QYZ A;  2JJ9 A;  2Y4X A;  5GAN g;  1MGQ A;  1BB9 A;  3JB9 F;  4XU2 A;  4OMN A;  3C0C A;  1IO6 A;  2V8J A;  2OAU A;  5IHI A;  1K0X A;  2O9S A;  2ZZD A;  3V7S A;  3OA6 A;  3OS1 A;  3VKI A;  1WHL A;  2BZX A;  4B6M A;  4PFZ A;  2GCX A;  5D6Y A;  5IXF A;  1GRI A;  2E3I A;  3KBG A;  2DXT A;  2AZS A;  2O2O A;  4E7S A;  3H0F A;  1W6X A;  1M2V B;  2R5M A;  1K1Z A;  2GQI A;  1VQ8 A;  4A4E A;  3G71 A;  4V2S A;  4HKE A;  3P8H A;  2J6K A;  5GAM f;  4QQ6 A;  1Q82 U;  1U3O A;  2EQJ A;  1I07 A;  2JTM A;  3RDV A;  3OS5 A;  2LQK A;  4F16 A;  3JAM E;  3CPW P;  4PFP A;  2L3R A;  1D1C A;  2E6N A;  3CPW S;  1KIK A;  3VU3 C;  2M1H A;  1M2O A;  4F7U A;  3M4G A;  4KRT A;  3BE3 A;  4FSX A;  4JPB W;  3OB9 A;  3V8K A;  3CCJ Q;  3R6O A;  1PSF A;  4M7A A;  3S3O A;  1UJ0 A;  1PG5 B;  2QQ9 A;  4M75 F;  2DYI A;  4ELY C;  2P0Q A;  4II1 A;  2LT4 A;  3QDF A;  1WLP B;  2DVE A;  2X4X A;  1JJ2 P;  2J05 A;  1ZSZ C;  2AZV A;  1ZQ1 A;  1JJ2 S;  2CT3 A;  2RA2 A;  1W4S A;  2EGE A;  1N9R A;  1KD1 U;  3J7A F;  5GJW B;  4M78 E;  4DBQ A;  4M75 G;  3HTR A;  2VB6 A;  1RAC B;  1OPL A;  1RI9 A;  1HYO A;  2RN8 A;  1KQ2 A;  4X9D A;  2DEU A;  3MKD A;  4LDY A;  4B9X A;  3L2R A;  4OGC A;  2C06 A;  2R5A A;  5L23 A;  3SD4 A;  3V7C A;  1QWF A;  1YJ9 Q;  3C94 A;  1AWX A;  1UGR B;  4OVA A;  5KCH A;  1ZUY A;  5LJ3 d;  1HSQ A;  2VXE A;  1WDX A;  5IAY A;  2KXC A;  3OMG A;  1ZA1 B;  4ZN3 A;  1QVF P;  3BFM A;  4M7D C;  3ER0 A;  2PVO B;  1QVF S;  2AKL A;  3OYE A;  5EG2 A;  3VS6 A;  2XKO C;  4M7A C;  2F69 A;  2KSS A;  3M55 A;  4JLI A;  2J7I A;  2CKK A;  1M27 C;  1QW1 A;  1M4Z A;  5GAO l;  1GCP A;  2FZK B;  5GAN j;  5IT9 E;  3LGF A;  3V7R A;  1OX8 A;  8ATC B;  3OYM A;  4D6W A;  3FLG A;  2KXD A;  5CIU A;  5LJ5 g;  3EGD B;  1VQO Q;  1U06 A;  1QVG S;  1JB0 E;  2E3H A;  1TUG B;  1CKA A;  4HCB A;  2K2V A;  1RLQ C;  1MUZ A;  4XU0 A;  2QK0 A;  1TSF A;  4PJO F;  2CP7 A;  2LVM A;  2GF7 A;  5HKC A;  3FIF A;  3OY9 A;  4HXJ A;  2DD4 A;  4M78 A;  1QMC A;  1X27 A;  2RQU A;  2L3P A;  4OB1 B;  3VS2 A;  2XID A;  2RHX A;  4XTZ A;  3JCM d;  3VS1 A;  2M9U A;  2YDL A;  3MEW A;  4PJO G;  4LUE A;  1MHN A;  2OI3 A;  5CQX A;  3QJY A;  3LW5 E;  3VS5 A;  3QII A;  2DL8 A;  1Y7X A;  2K9G A;  2GBQ A;  3DLM A;  4OP0 A;  2CSI A;  2MCN A;  1TS9 A;  2E1H A;  1OZ2 A;  1LPL A;  2JTE A;  1TU0 B;  4RTZ A;  2F5T X;  4R55 A;  3CCQ A;  2JM9 A;  4HVW A;  1SEM A;  3PGG A;  4FYV B;  3QDR B;  2EKO A;  2FPE A;  3HPW A;  2WSE E;  2MAM A;  1KHC A;  3C95 A;  3URG A;  1T3S A;  3MET A;  3E19 A;  3EG1 A;  1VQ5 A;  1M1F A;  5A2Q E;  3H0I A;  2X35 A;  1OPK A;  3RNJ A;  4M77 B;  3CCR Q;  3A8L B;  1ZX6 A;  5CR2 A;  4ZNX A;  1S72 A;  2O01 E;  1SSF A;  4FIB A;  2LMJ A;  4J9B A;  1K8A R;  4IUV A;  2CH4 A;  1JRI A;  2EYY A;  2L89 A;  3QZ5 B;  1JJ2 A;  3JB9 H;  3X24 B;  4KGX B;  3X26 B;  1D0X A;  5FU7 C;  3CD6 A;  4OB3 B;  3MJX A;  1D09 B;  2D0Q B;  2NWM A;  1U1S A;  2RK1 A;  2ESW A;  1Y96 B;  2JW4 A;  2CP0 A;  1NE8 A;  2JMA A;  3LX7 A;  4RCC A;  1O9S A;  4J8O A;  2X4Y A;  1VQ5 T;  4M75 C;  4HCK A;  1NJI C;  2QTX A;  1M90 U;  3QXE B;  1MMG A;  1K9M R;  1S72 T;  1MND A;  1SRL A;  1VQK Q;  3VS3 A;  4XTY A;  3CCS Q;  4NL3 A;  2RD1 A;  5CK9 A;  2IVW A;  3G4S Q;  4ORZ A;  1GFC A;  3M56 A;  4QVZ A;  4RTW A;  1VQO T;  5LJ5 j;  3OYG A;  3M5A A;  3LLR A;  1YFN A;  2DX1 A;  5GMK l;  5GAM d;  2LZ6 B;  3BY7 A;  1QCO A;  2CYZ B;  1NEB A;  3I5S A;  3A8M B;  2H3J A;  1HD3 A;  3MEU A;  5CKB A;  1QLY A;  5DLQ E;  4MMK A;  1ABQ A;  1NEG A;  5I2S A;  1R0C B;  4M77 F;  3QZ9 B;  2BE9 B;  2H3E B;  4AFQ C;  2M51 A;  3QJ6 A;  2FPD A;  4DA4 A;  4BAC A;  2O9V A;  2KYM A;  2HBW A;  1P92 A;  4ZN1 A;  2KQW A;  1ABO A;  2DXB A;  3M4Y A;  2MMP A;  4KH1 B;  2COY A;  2K7A A;  2PZ1 A;  3EH1 A;  1N9S A;  5FLX E;  4F17 A;  1D1B A;  3CCR A;  1Y57 A;  3GBQ A;  3JB9 J;  1YP5 A;  3M57 A;  3P8B B;  2MWP A;  3UDC A;  4RMO A;  1OQK A;  2W10 A;  2KE9 A;  2FVU A;  2MWO A;  2PVD B;  3T9N A;  4CC3 A;  1J3T A;  2HCK A;  2EQU A;  2A3L A;  4XU1 A;  2DL3 A;  3JV3 A;  4DOW A;  4BUG A;  1JQQ A;  3CCE Q;  2K79 A;  1N8R C;  2LJ0 A;  2M0Y A;  3IQL A;  2K57 A;  2KAF A;  5LJ3 g;  1ZUK A;  4M77 E;  1C6V X;  2CUD A;  3OYC A;  3TU4 K;  3ASK A;  3OYJ A;  4PJO C;  2J6F A;  3VUZ A;  1N6A A;  3CCR T;  2F1L A;  3EGD A;  4PLI A;  2DK3 A;  4J6W A;  4PFO A;  1XTD A;  3CCS A;  4OB0 B;  4YTL A;  2LRQ A;  3RKY A;  2XDB A;  1I81 A;  2MYS A;  3EG2 A;  4MZP A;  4OMF B;  4N4I A;  1I5L A;  1KC8 C;  2RJD A;  2RO0 A;  3NHN A;  1VYU A;  4L59 A;  3KXT A;  1X43 A;  1B34 B;  1NYF A;  2DE0 X;  1YI2 A;  3ZFJ A;  2RM4 A;  8AT1 B;  2O31 A;  1G3W A;  3QKJ A;  4HA8 A;  5LJ5 h;  2X9H A;  1K73 C;  1NM7 A;  2HBP A;  5KYY B;  4J9I A;  1BI1 A;  1WHM A;  3EG9 B;  4K11 A;  1NG2 A;  1MMD A;  4DBR A;  1TUC A;  2E65 A;  1VQK T;  4KGZ B;  2P4R A;  3CCS T;  2KI7 A;  1G3S A;  3G4S T;  1RL2 A;  3G1J A;  1UJY A;  2CZ0 B;  4F7U G;  3I55 Q;  4LD9 K;  1A0N B;  3JRZ A;  2A08 A;  3JCM g;  5GMK j;  3QWX X;  2ATC B;  5GAN 2;  2MI6 A;  1YHQ Q;  4M7A G;  2ABL A;  2K5L A;  1PM3 A;  2K2M A;  3CBP A;  4GY5 A;  2C0T A;  1YI2 T;  5DM7 R;  1SF9 A;  3GPL A;  2EYZ A;  4RG2 A;  2GQV A;  1JEG A;  1M30 A;  4PJN A;  2XIC A;  1Q7Y U;  3VYG A;  2JN0 A;  1D0Z A;  4M77 A;  3S3M A;  5GAN e;  1M1K U;  2GFU A;  1GCQ A;  2VC8 A;  4RKU E;  1WFW A;  3JCM J;  1LOJ A;  3OYK A;  2K6D A;  4VUB A;  2H8H A;  3M58 A;  1VIF A;  2P0K A;  1DJ7 B;  2ZPE B;  5GAN 3;  1PNJ A;  2CRE A;  4J9H A;  1U1T A;  1AOJ A;  1W2B A;  4J9D A;  4D8K A;  2E12 A;  1Y96 A;  2JVV A;  2CS7 A;  4LN2 A;  1WQ7 A;  2DA9 A;  1SG5 A;  3L2Z A;  5IHK A;  1Q82 C;  2KGT A;  4RTV A;  3CCE T;  2CP5 A;  2J06 A;  1EZZ B;  3GLX A;  1N27 A;  1YWO A;  2LNH B;  4M7D D;  1VQ4 Q;  3L42 A;  4LDW A;  2KBT A;  4ANJ A;  4A4K A;  4FM4 B;  1Q86 U;  3NGP A;  5KE2 A;  4PKC C;  5IN1 A;  5LJ3 j;  3SHW A;  1X6B A;  2EWN A;  2FZC B;  4E7L A;  4EIK A;  4M7A D;  1Y07 A;  2RHY A;  4E7H A;  1M1G A;  1H3Z A;  2AK5 A;  2L0A A;  2VYT A;  3NTI A;  4JLG A;  2WAC A;  4M77 C;  1HK9 A;  3GOX A;  1GCQ C;  3RIR A;  1UGP B;  4IUQ A;  1G83 A;  3JB9 G;  1K9A A;  2EYX A;  3PVL A;  4J83 A;  5GMK m;  4XTW A;  3JCM b;  4IUU A;  1RAG B;  4QT7 A;  2F5K A;  4M78 F;  1E6H A;  3RER A;  1YHQ A;  1YJW Q;  4FU6 A;  1JXM A;  3TVT A;  1XNI A;  2RJE A;  3CMA Q;  2ED1 A;  4C92 B;  3UT1 A;  2ECZ A;  3FRN A;  2F2X A;  4UC4 A;  1PD0 A;  2D8H A;  4HVV A;  3CCU Q;  1AZE A;  1VQ7 Q;  1WA7 A;  2LCC A;  5GAM g;  3UAT A;  4KUL A;  1U8R A;  4M78 G;  2G3R A;  2DD5 A;  2R57 A;  4DEX A;  3CBM A;  2LQ8 A;  2XHC A;  4OMM A;  2E64 A;  3A98 A;  1VQ9 A;  4IIM A;  4LDX A;  5I11 A;  1OX9 A;  2FYK A;  1B7T A;  4HCC A;  3M9Q A;  3TEE A;  3X25 B;  4C8Q B;  3I55 T;  4JJC A;  1GL5 A;  2CSQ A;  1ZLM A;  4PK4 A;  4E47 A;  3LH0 A;  1PCX A;  3OW2 P;  1Q81 U;  1QKX A;  2LP5 A;  2DRM A;  3OW2 S;  1VYV A;  3H8Z A;  1YHQ T;  2DBK A;  4JJN K;  3HSB A;  2E41 A;  2RHU A;  4JS4 A;  3CXC S;  1X2Q A;  1SHG A;  1YIJ Q;  4JZ4 A;  4CC4 B;  2RK2 A;  5KH6 A;  1YCS B;  3HL8 A;  4C5E A;  3JB9 D;  4AG1 C;  3M53 A;  2DZC A;  2EKH A;  1VQ4 A;  3QUI A;  2LX7 A;  1VQ9 T;  2EYQ A;  4LE9 A;  1RI0 A;  4A63 B;  3SWN B;  2VV5 A;  5LJ5 e;  4CC2 A;  5CKE A;  3OS0 A;  3JSC A;  4D8D A;  1HJD A;  4C92 F;  1WNL A;  1MMN A;  1K4U S;  5LJ3 h;  2M16 A;  1B34 A;  4MDW A;  1RAD B;  3E9F A;  5D6W A;  3TCJ A;  1G2B A;  1FMK A;  2LC4 A;  1BI3 A;  5DY9 A;  3Q1J A;  2DAQ A;  1VQN Q;  2PUO B;  3G6E Q;  4JRI A;  2JS0 A;  5KYY A;  3J81 E;  4NOY A;  3OYN A;  2OJ2 A;  3EG9 A;  1VQ4 T;  5GAN 7;  1WGS A;  4A53 A;  4C8Q F;  1SKU B;  3CCU A;  4EPC A;  2LTO A;  3DLL A;  1RAH B;  2DLP A;  2DNU A;  4N4G A;  2X3X D;  3VRY A;  1QVG P;  5A0G A;  1G5V A;  3MO8 A;  1G3T A;  2DL4 A;  4M75 D;  1YJN Q;  4KBM B;  2EQK A;  3CCJ A;  2GGR A;  4PLL A;  2JMC A;  1SSH A;  1QCF A;  5IH2 A;  3OYD A;  2RQV A;  3CPF A;  2FZG B;  3NTK A;  4XTU A;  4C92 E;  5KCO A;  1RAA B;  2LX9 A;  4J9F A;  4DEY A;  1VOM A;  2IG0 A;  3NFC A;  3FDR A;  1FX7 A;  2YUO A;  5GAO n;  1UG1 A;  2M02 A;  4DQ2 A;  4FW2 A;  2A28 A;  5KYU B;  1KQS P;  1U5S A;  1KQS S;  3CCU T;  3WVD B;  3CEY A;  1RAF B;  1VQ7 T;  2RI5 A;  3VJP A;  2CP6 A;  1WXU A;  2OTJ Q;  2ZGW A;  1VQL Q;  2QQR A;  5GAM j;  1VQP Q;  3JCM h;  4EMG A;  2PU9 B;  4C8Q E;  3CCL Q;  4XQ3 A;  3CCJ T;  1VA7 A;  4C0F A;  2PUK B;  4A4F A;  1YJ9 A;  1ZSG A;  1TOV A;  2D1X A;  2BKD N;  1IXD A;  3INZ A;  1SPK A;  2RI2 A;  4A4H A;  9ATC B;  3GF5 A;  1TUD A;  2HQE A;  3LGL A;  4BI3 A;  1VQM Q;  4BY6 C;  2ZAE A;  4J6Y A;  1YIJ T;  3OBW A;  3CPW A;  5A0D A;  1WHG A;  5IXB A;  2PQW A;  3CME Q;  5HY6 A;  4PJM A;  4BI4 A;  2D8J A;  3E1S A;  1VQN A;  2B86 A;  3G6E A;  1NLP C;  2RQT A;  1VYT A;  1M90 C;  4LXC A;  5I2M A;  4M78 C;  5GMK i;  3EG3 A;  4GBQ A;  2DYB A;  1D1A A;  2JNG A;  4O6J A;  4JRQ A;  1YJ9 T;  3EHR A;  3JCM c;  1NJI R;  5GMK e;  2IIM A;  5KYX B;  2LQW A;  2VGN A;  1VQO A;  3S6W A;  2JOY A;  4F04 B;  3QBY A;  5HK3 A;  4PJO D;  5FW9 A;  5IHN A;  2QEX Q;  2KRO A;  2JTF A;  3QYG B;  4R0K A;  2DM1 A;  1BK2 A;  2SRC A;  5GAN h;  1TXQ A;  4C92 A;  2E70 A;  3ME9 A;  3FEO A;  1Y0M A;  2AHJ B;  3VRZ A;  1M3B A;  2K5I A;  3CCV Q;  1K0S A;  1VQN T;  3G6E T;  5L8R E;  3OYA A;  3JCM X;  2QQS A;  2BE7 D;  1KK7 A;  2V26 A;  4O5V A;  1IRE B;  2P4T A;  1LVK A;  6AT1 B;  1UFF A;  2DPP B;  1IHV A;  2QI2 A;  1VQ6 Q;  1V76 A;  3OYI A;  1B07 A;  1UHC A;  1OI1 A;  2K3Y A;  2VWF A;  4C8Q A;  1VQP A;  2DET A;  3FJP A;  5KYW A;  1QVF A;  4FL6 A;  2MF2 A;  2EYW A;  3KUF A;  2EFI A;  1T0J A;  2DIQ A;  1YJN T;  2AKK A;  3A5Z B;  3UA7 A;  4B9W A;  3E9G A;  2HDA A;  2BUD A;  1AZG B;  2CZ7 B;  2L5Q A;  1OU8 A;  4Z88 A;  3UA6 A;  3I56 Q;  4F14 A;  3EFS A;  2L2P A;  4XTX A;  1EX4 A;  1S1N A;  2FO0 A;  5LJ3 e;  2E5K A;  2WSC E;  3L2W A;  4C92 C;  4OMQ A;  2VKN A;  1VQL T;  3JB9 I;  2QTV A;  3LH5 A;  2V1Q A;  1QVG A;  1VQP T;  3SWN A;  2YLB A;  2VGM A;  2RMO A;  4J9E A;  4M77 G;  1Q95 G;  3QSU A;  1N8R R;  2RPN A;  2DTH A;  2YSQ A;  3DB4 A;  2NYS A;  3EFO B;  1IZ6 A;  2E5Q A;  4LNP A;  4OB2 B;  2D0N A;  1K8A U;  2ZPB B;  4M4Z A;  1QP3 A;  2X4W A;  1E7O A;  3KFV A;  4IUP A;  3ZEH A;  4C8Q C;  4RTX A;  3G7Z A;  5GAN 6;  4C0D B;  1VQM T;  2OTL Q;  1OOT A;  2OAW A;  3L2U A;  2RQR A;  3OQ5 A;  4PJL A;  2DF6 A;  3PFS A;  1PSE A;  4RTT A;  5FWB A;  2DTO A;  4L6V 5;  5CO7 A;  4ESR A;  2KRN A;  3CC4 Q;  3CCV A;  1QKW A;  1ZBX A;  1KC8 R;  3A8H B;  4QVD A;  5CQY A;  4E7K A;  3O5Z A;  1BIB A;  5GAO m;  3RKX A;  1UGQ B;  1K9M U;  4IUR A;  1YIT Q;  2FL7 A;  2NUP B;  4CI0 C;  3M59 A;  4QKU A;  1KQ1 A;  2RH2 A;  1VQK A;  5FWC A;  1K73 R;  1WHH A;  3G4S A;  1AWJ A;  2L3Q A;  3HRT A;  2R58 A;  3X20 B;  1BI0 A;  2XDD A;  3QYH B;  3MP1 A;  3H6Z A;  3JCM e;  3QHS A;  2A37 A;  5FU6 B;  2EIF A;  2QEX T;  5GAO r;  2QGG A;  4BD3 A;  1W1F A;  2ENM A;  4GLM A;  5KYU A;  1Z9Z A;  2QGF B;  1RLP C;  1UEB A;  3CCV T;  4BB7 A;  4BI8 B;  3I35 A;  2YXY A;  5CKH A;  3I56 A;  3ZBD A;  2V1R A;  2ED0 A;  1Q7Y C;  1TG0 A;  1RAI B;  1JXO A;  1BIA A;  1M1K C;  3S3N A;  1RAE B;  1OUL A;  2HSE B;  4AG2 C;  2LNV A;  3HFN A;  2JUF A;  1VQ6 T;  2DO3 A;  2KK4 A;  4J6X A;  4IKF A;  2VAS A;  1C0M A;  2LCL A;  3D7S B;  4FYY B;  3QWY A;  1FMW A;  3CQT A;  1O75 A;  4ATO A;  2EPD A;  2DZ9 A;  3GNG A;  3N5B B;  2GNC A;  5C6S A;  2QAZ A;  3LWH A;  3OSS C;  1FWZ A;  2KVQ G;  3VUB A;  1EFN A;  2KMT A;  3L2Q A;  1R77 A;  2X51 A;  1WX6 A;  5D7U A;  3OS2 A;  3I56 T;  4BE1 A;  4CRI A;  2DER A;  3MEV A;  4C5H A;  4MML A;  4JJD A;  2QQA A;  5CCA A;  3OYB A;  3CCE A;  4KUD K;  2CDT A;  2GTJ A;  1VQ8 Q;  3THK A;  2HEQ A;  1Q86 C;  3G71 Q;  2KDS A;  1WHK A;  4XTV A;  1UUE A;  4OML A;  1Q82 R;  2DTI A;  4EMK B;  4E7J A;  1R8O B;  1WHJ A;  2HKQ B;  1LNX A;  5KYX A;  3I5R A;  2LCS A;  1BCM A;  1D3B B;  3PVQ A;  2E4H A;  4J9C A;  4C0G A;  1RUW A;  4HT8 A;  2MOX A;  4M7D E;  2ZPI B;  1H3H A;  1AEY A;  4AFU C;  2OTL T;  1BU1 A;  4C0Z A;  5GAO q;  3BW1 A;  5FU7 B;  2O88 A;  3TQ7 P;  2KNB B;  4LUD A;  1I8F A;  4WCI A;  3FJ5 A;  1WXT A;  3OBY A;  3PIO A;  2KT8 A;  3CBO A;  1MMA A;  1X6G A;  2DL5 A;  1ZUU A;  5J26 A;  1N5Z A;  4OF1 A;  5GAN f;  4RG8 A;  4OMP A;  1R0B G;  4M75 B;  3HHT B;  1WJQ A;  3TRE A;  1IRX A;  4J7I A;  4RTY A;  2XD0 A;  2BZ8 A;  1G3Y A;  2XU8 A;  5GAN 8;  3I55 A;  2EAY A;  4AT1 B;  4RTU A;  2HKN A;  1Q81 C;  2COW A;  3MPU B;  4JUV A;  1F1B B;  4FSS A;  1XJW B;  1PKT A;  2JZ2 A;  4JRP A;  1ZSZ A;  1KD1 C;  1OV3 A;  2ZPF B;  1ZBJ A;  1TH7 A;  3J80 E;  2J6O A;  5M9O A;  3VS4 A;  5GMK h;  2JM8 A;  2F2W A;  3JCM W;  2RB6 A;  1PRL C;  1WI7 A;  2EJG A;  1G8X A;  2A7Y A;  3EFO A;  5DLO A;  2I0N A;  1D0Y A;  5KE3 A;  3I9Q A;  3SDZ A;  3A8O B;  1PRM C;  5KYW B;  3F70 A;  2FEI A;  1NLO C;  2KY9 A;  3RKW A;  4KT0 E;  2QQB A;  5C0M A;  3NTH A;  1CKB A;  1KHI A;  4M7D A;  2XDP A;  5A0L A;  3CXC P;  2YHT A;  3HP9 A;  3SFM A;  1M9S A;  2XMF A;  3LYI A;  1WPY A;  2KRM A;  2QA4 Q;  2RHI A;  3O8V A;  1EIF A;  2VVK A;  1AT1 B;  4E6R A;  2K3X A;  1VQ8 T;  3EGX B;  3G71 T;  4JDS A;  2NUP A;  4MZM A;  3H41 A;  3SB2 A;  4HVU A;  2B8A A;  2DBM A;  2HD0 A;  3FC3 A;  3C4S A;  3PMT A;  4N0A A;  4Z8A A;  4MZT A;  2NUT B;  2QDY B;  2DRK A;  2LJ3 A;  2D9T A;  4PJO B;  1ARK A;  1NPR A;  1JO8 A;  3MP8 A;  2W0Z A;  2DJQ A;  4OMO A;  1I4K 1;  3BDL A;  5GAO p;  2DMO A;  3E2U A;  4FYW B;  3PMI A;  1BKB A;  4M78 D;  3AT1 B;  3REA B;  4AFS C;  2BIV A;  4X34 A;  2OX7 A;  4QQD A;  3JCM P;  1BBZ A;  4P5N A;  1OYX A;  1TTH B;  3NMZ C;  2MIO A;  1YJW A;  4C0D C;  3CCQ Q;  3CMA A;  4C92 G;  3WXM B;  2EW3 A;  4ELZ C;  3QPH A;  2SEM A;  1UGV A;  1H92 A;  4DBH A;  1VQ7 A;  1NPP A;  4M75 E;  3M0R A;  1QCN A;  3VYH B;  5FRO A;  4JJB A;  5AT1 B;  3M0Q A;  1VQ5 Q;  1MV3 A;  5EC7 A;  4QVC A;  3UWN A;  2RJC A;  1GXI E;  4C8Q G;  5LJ5 f;  1H8K A;  2RNA A;  3SEM A;  1I1J A;  1IB8 A;  3M0P A;  1S72 Q;  4N0A C;  1I5O B;  2A36 A;  1FMV A;  3MP6 A;  2L3S A;  4KUI A;  2AIR B;  3NPF A;  5FU6 C;  1AHJ B;  1YJW T;  3CMA T;  1JBM A;  1TWB A;  5CKD A;  3CD6 Q;  1YIJ A;  2JS2 A;  2QA4 A;  2LJ1 A;  2CZ1 B;  2M0O A;  4EMK A;  2ZPG B;  3QG1 A;  2HZY A; 
#chains in the Genus database with same CATH homology
 4J7F A;  2L3R A;  2E6N A;  3CPW S;  3HKS A;  3JRZ A;  4J5Y A;  4WF2 A;  3VU3 C;  2M1H A;  3JCM g;  4F7U A;  5GMK j;  5FRM A;  2RJF A;  3EFR A;  3M4G A;  3X28 B;  3GIB A;  3EFS A;  1D3B A;  4XTX A;  4FSX A;  4FT2 A;  5GAN 2;  2MI6 A;  5LJ3 e;  4MDX A;  2YRV A;  4M7A G;  3OB9 A;  3V8K A;  2K5L A;  3CBP A;  3R6O A;  2WSC E;  4LD6 A;  4GY5 A;  4C92 C;  5HK0 A;  1PSF A;  3L2W A;  1YI2 T;  3JCM Q;  2CGH A;  4Q5W A;  1VQL T;  4C92 D;  3JB9 I;  4E7I A;  4M7A A;  5DM7 R;  1VQP T;  1QVG A;  3SWN A;  2YLB A;  3S3O A;  2VGM A;  3EAE A;  2QQ9 A;  4M75 F;  3GPL A;  3OSV A;  3A8G B;  4M77 G;  4RG2 A;  3PIP A;  3QSU A;  4ELY C;  3WVE B;  2P0Q A;  4BDY A;  4II1 A;  2DTH A;  2GQV A;  2LT4 A;  2Y4Y A;  3DB4 A;  4RCB A;  3V8J A;  2XIC A;  2DVE A;  2WSF E;  2K4Y A;  2X4X A;  1Q7Y U;  3VYG A;  1UB4 A;  2JN0 A;  1IZ6 A;  2E5Q A;  4M77 A;  5GAN e;  3S3M A;  1M1K U;  1ZQ1 A;  2GFU A;  4OB2 B;  2RA2 A;  1JJ2 S;  1K8A U;  2ZPB B;  2VC8 A;  1QP3 A;  1W4S A;  2X4W A;  4RKU E;  4M7D G;  2QA4 T;  1N9R A;  4IUP A;  3JCM J;  4DOV A;  4QW2 A;  2D6F A;  1LOJ A;  3ZEH A;  1X01 A;  4C8Q C;  1KD1 U;  3J7A F;  3OYK A;  4M78 E;  3G7Z A;  4C8Q D;  4M75 G;  4IUT A;  4VUB A;  3PTA A;  4EMH A;  3M58 A;  1VIF A;  5GAN 6;  4C0D B;  1VQM T;  2P0K A;  3P8D A;  3L2U A;  3OQ5 A;  1DJ7 B;  2ZPE B;  5GAN 3;  4M75 A;  1KQ2 A;  3PFS A;  4X9D A;  1PSE A;  1XQH A;  4PNO A;  4LDY A;  4B9X A;  3L2R A;  1U1T A;  4PJO E;  1W2B A;  2DTO A;  4L6V 5;  5CO7 A;  3JAM E;  1KG1 A;  4OGC A;  3CCV A;  2C06 A;  1ZBX A;  3A8H B;  2R5A A;  4QVD A;  2E12 A;  5CQY A;  4EMK C;  4E7K A;  3OW2 A;  2V8K A;  2NLU A;  3SD4 A;  3RMQ A;  1Y96 A;  3V7C A;  2JVV A;  2RHZ A;  1BIB A;  2CS7 A;  1WQ7 A;  3C94 A;  3L2Z A;  1V29 B;  5GAO m;  4BDZ A;  1H64 1;  3RKX A;  1UGR B;  3OMC A;  4OVA A;  5KCH A;  3CXC A;  1Q82 C;  5LJ3 d;  5D6X A;  1UGQ B;  2VXE A;  1YJN A;  1K9M U;  4IUR A;  2FL7 A;  4CI0 C;  5IAY A;  4ME7 A;  3OMG A;  3CCE T;  3M59 A;  4ZN3 A;  3BFM A;  3GLX A;  4M7D C;  1KQ1 A;  1FXX A;  1N27 A;  3ER0 A;  5GAN 4;  2PVO B;  1QVF S;  2RH2 A;  4M7D D;  3OYE A;  3L42 A;  2DKG A;  2O4X B;  1VQK A;  4LDW A;  5EG2 A;  4A4K A;  4FM4 B;  1Q86 U;  3G4S A;  5KE2 A;  4PKC C;  4BE0 A;  3AHU A;  5IN1 A;  5LJ3 j;  3HRT A;  2R58 A;  2XKO C;  1BI0 A;  5CVI A;  3X20 B;  4M7A C;  2XDD A;  2EWN A;  2HNI A;  3QYH B;  2F69 A;  3H6Z A;  3MP1 A;  3JCM e;  3QHS A;  1Y07 A;  4E7L A;  4M7A D;  2KSS A;  3CCQ T;  2RHY A;  5FU6 B;  4E7H A;  2EIF A;  4QQG A;  3M55 A;  5GAN d;  4JLI A;  1M1G A;  2CKK A;  1H3Z A;  2QEX T;  5GAO r;  1QW1 A;  2VYT A;  3NTI A;  4BD3 A;  1M4Z A;  4JLG A;  2WAC A;  4M77 C;  1HK9 A;  2PVG B;  5GAO l;  3L2V A;  2VUB A;  3GOX A;  2OTJ A;  3RIR A;  1UGP B;  1WQW A;  5GAN j;  1UEB A;  4IUQ A;  4TVR A;  3CCV T;  5IT9 E;  3LGF A;  3V7R A;  1VQL A;  4BB7 A;  1QVP A;  4BI8 B;  3JB9 G;  2E6Z A;  5CKH A;  4C5I A;  3I56 A;  3ZBD A;  4J83 A;  4D6W A;  3OYM A;  3DKM A;  2GFA A;  5GMK m;  5J3B A;  4XTW A;  3FLG A;  3JCM b;  4IUU A;  1Q7Y C;  4JS5 A;  5CIU A;  5LJ5 g;  4M78 F;  2F5K A;  1BIA A;  1M1K C;  3CCL A;  3MCA B;  3S3N A;  4OGE A;  1K8A C;  3HRS A;  3RER A;  1YHQ A;  4FU6 A;  1QVG S;  1XNI A;  1JB0 E;  2RJE A;  4HCB A;  2LNV A;  3HFN A;  2JUF A;  4XK8 E;  3V8L A;  5I21 A;  2DO3 A;  1VQ6 T;  2K2V A;  2KK4 A;  4J6X A;  4C92 B;  3UT1 A;  4XU0 A;  4IKF A;  1HXD A;  2HAX A;  3FRN A;  4UC4 A;  4PJO F;  2LCL A;  5GAM h;  4N4H A;  4X9C A;  2LVM A;  2GF7 A;  1O75 A;  4ATO A;  2LCC A;  5GAM g;  1VQM A;  4KUL A;  1X75 C;  2DZ9 A;  5HKC A;  3GNG A;  3FIF A;  3OY9 A;  1U8R A;  4M78 G;  2G3R A;  3N5B B;  2DD5 A;  2R57 A;  2DD4 A;  3CBM A;  3CD6 T;  2LQ8 A;  5C6S A;  2XHC A;  3LWH A;  3OSS C;  1FWZ A;  4M78 A;  2E64 A;  2KVQ G;  4OB1 B;  4Z02 A;  3VUB A;  1VQ9 A;  3JCM V;  3CME A;  2KMT A;  3L2Q A;  4LDX A;  1VIE A;  1NZ9 A;  2XID A;  2RHX A;  4XTZ A;  2OTJ T;  2FYK A;  3JCM d;  4HCC A;  2M9U A;  3M9Q A;  3TEE A;  3X25 B;  4C8Q B;  3MEW A;  3I55 T;  1LJO A;  4PJO G;  1MHN A;  3OS2 A;  5CQX A;  3QJY A;  2DXC A;  4E47 A;  3I56 T;  3LW5 E;  1K9M C;  3HFO A;  1W2B S;  4BE1 A;  4CRI A;  4PJO A;  3LH0 A;  3QII A;  5GAN 5;  3MEV A;  4C5H A;  4MML A;  1Y7X A;  3CCL T;  2QQA A;  5CCA A;  3OYB A;  3CCE A;  1Q81 U;  4KUD K;  3OW2 S;  3H8Z A;  1YHQ T;  3UPU A;  1Q86 C;  3GNF B;  2KDS A;  3DLM A;  4OP0 A;  4JJN K;  4XTV A;  3HSB A;  2E41 A;  2RHU A;  4JS4 A;  1NJI U;  3CXC S;  2E1H A;  1OZ2 A;  2V8I A;  2DTI A;  4EMK B;  2K5F A;  2I2L A;  3RES A;  4E7J A;  1R8O B;  2HQX A;  2LDM A;  5J39 A;  2F5T X;  2RK2 A;  3VV0 A;  5KH6 A;  4R55 A;  2EJ9 A;  3CCQ A;  1LNX A;  2FB7 A;  1KQS A;  4F7U B;  3HL8 A;  2QEX A;  3PGG A;  4C5E A;  3JB9 D;  3M53 A;  2DZC A;  4M7D B;  1D3B B;  1VQ4 A;  3QDR B;  2EKO A;  5AYF A;  3QUI A;  3HPW A;  1VQ9 T;  3CME T;  2WSE E;  4C0G A;  2EYQ A;  2P0P A;  1RI0 A;  1KHC A;  2MAM A;  2RI3 A;  4HT8 A;  4M7D E;  4M7A B;  2LT1 A;  2ZPI B;  3C95 A;  3SWN B;  3URG A;  2VV5 A;  5LJ5 e;  2OTL T;  3MET A;  3E19 A;  5CKE A;  4C0Z A;  3OS0 A;  5GAO q;  3JSC A;  5LJ3 f;  1VQ5 A;  1M1F A;  3BW1 A;  5FU7 B;  5A2Q E;  4BE2 A;  2X35 A;  4HT9 A;  4M77 B;  4C92 F;  1WNL A;  1UGS B;  1I8F A;  3A8L B;  4LDV A;  1YCY A;  3DB3 A;  1VQ6 A;  5CR2 A;  1S72 A;  2O01 E;  4ZGE B;  1SSF A;  4FIB A;  5LJ3 h;  2M16 A;  5FRN A;  1B34 A;  3OYF A;  3OBY A;  3PIO A;  4MDW A;  3E9F A;  2DIG A;  5D6W A;  3TCJ A;  3CBO A;  2L8D A;  2XI9 A;  4IUV A;  1JRI A;  2L89 A;  2LC4 A;  1BI3 A;  3QZ5 B;  5DY9 A;  3Q1J A;  1WJS A;  5J26 A;  4OF1 A;  3SWN C;  1JJ2 A;  3JB9 H;  3X24 B;  5GAN f;  2DAQ A;  3HRU A;  4RG8 A;  2PUO B;  4JRI A;  3CC7 A;  4NL2 A;  4M75 B;  3J81 E;  4NOY A;  3X26 B;  2YLC A;  3HHT B;  1WJQ A;  2ZPH B;  4FT4 A;  5FU7 C;  4OB3 B;  3TRE A;  4XAX B;  3OYN A;  3CD6 A;  1VQ4 T;  4ZTF A;  5GAN 7;  5CKF A;  1WGS A;  2D0Q B;  4A53 A;  4NS5 A;  4J7I A;  3RMS A;  4C8Q F;  4HCZ A;  4M77 D;  4L5G A;  2XD0 A;  3CCU A;  1G3Y A;  4EPC A;  2XU8 A;  5GAN 8;  3I55 A;  1U1S A;  2EAY A;  2RK1 A;  5CAI A;  2LTO A;  3GP8 A;  3DLL A;  1Y96 B;  4C5G A;  4EDU A;  4ZGJ B;  1Q81 C;  1NE8 A;  3LX7 A;  4JUV A;  4RCC A;  5LL6 S;  1O9S A;  2E10 A;  4N4G A;  4J8O A;  2X4Y A;  2EQM A;  1VQ5 T;  2JZ2 A;  2DXU A;  4LDU A;  4M75 C;  5A0G A;  4JRP A;  1G5V A;  3MO8 A;  1G3T A;  2QTX A;  4M75 D;  1NJI C;  1M90 U;  4KBM B;  2EQK A;  3CCJ A;  3QXE B;  3MHX A;  4R56 A;  4PLL A;  3QG1 A;  3CCM A;  1KD1 C;  1S72 T;  1VUB A;  5LJ5 d;  3PNW C;  2XG8 D;  3OYD A;  2ZPF B;  3OYY A;  4XTY A;  2FHD A;  1TH7 A;  4NL3 A;  2RD1 A;  3CPF A;  1YBY A;  2IVW A;  5CK9 A;  3J80 E;  1N8R U;  4F7U F;  5M9O A;  1ZHI A;  3NTK A;  3M56 A;  5GMK h;  4XTU A;  4M7D F;  2CZ6 B;  4QVZ A;  4C92 E;  5KCO A;  1VQO T;  2LX9 A;  4XU3 A;  5LJ5 j;  3JCM W;  2RB6 A;  3OYG A;  2IG0 A;  3NFC A;  3FDR A;  1FX7 A;  3CC7 T;  3LLR A;  3M5A A;  5GAO n;  2EJG A;  2A7Y A;  5GMK l;  4DQ2 A;  1OZ3 A;  5DLO A;  5GAM d;  3BY7 A;  3BDU A;  4M7A F;  3JCM f;  4A4G A;  1KQS S;  2ZCF B;  2CYZ B;  3CCU T;  3WVD B;  3CEY A;  1VQ7 T;  5KE3 A;  2RI5 A;  4GLK A;  3SDZ A;  2XK0 A;  3VJP A;  3A8M B;  2H3J A;  3MEU A;  3A8O B;  5CKB A;  2ZGW A;  3F70 A;  2OTL A;  5DLQ E;  4JRK A;  4MMK A;  1X6O A;  2KY9 A;  2QQR A;  3RKW A;  4KT0 E;  3JCM h;  4EMG A;  5I2S A;  1M5Q 1;  5GAM j;  2QQB A;  4M77 F;  5C0M A;  3NTH A;  3QZ9 B;  4BY6 B;  1KHI A;  2PU9 B;  4C8Q E;  4M7D A;  4XQ3 A;  3QJ6 A;  2XDP A;  4DA4 A;  5A0L A;  1KC8 U;  3CC4 A;  3CCJ T;  4C0F A;  2YHT A;  4PL6 A;  3CCM T;  4BAC A;  2VXF A;  2PUK B;  3HP9 A;  1P92 A;  1M9S A;  3SFM A;  4ZN1 A;  2KQW A;  3LYI A;  4A4F A;  1WPY A;  2DXB A;  3M4Y A;  2MMP A;  1YJ9 A;  2RHI A;  2BKD N;  1EIF A;  3O8V A;  3MEA A;  4ZTJ A;  2K3X A;  3INZ A;  1N9S A;  2RI2 A;  1BI2 A;  4A4H A;  5FLX E;  1YIT A;  3GF5 A;  2HQE A;  1VQ8 T;  3CCR A;  3LGL A;  4Y91 A;  4BI3 A;  3G71 T;  4BY6 C;  3JB9 J;  4JDS A;  1K73 U;  3M57 A;  3C12 A;  3P8B B;  2MWP A;  4J6Y A;  4M78 B;  4MZM A;  3UDC A;  4RMO A;  3SB2 A;  4ZGD B;  2Y90 A;  2DJZ A;  3CC2 A;  2B8A A;  1YIJ T;  2HD0 A;  2O4X A;  3OBW A;  2FVU A;  2MWO A;  3C4S A;  3PMT A;  4F7U E;  3FC3 A;  5A0D A;  3CPW A;  4N0A A;  2PVD B;  1Y71 A;  2EJF A;  2PQW A;  4MZT A;  5HY6 A;  3T9N A;  4BI4 A;  2QDY B;  1VQN A;  3E1S A;  2EQU A;  3G6E A;  2D9T A;  4PJO B;  1NPR A;  2A3L A;  4XU1 A;  4F7U G;  3OYH A;  3MP8 A;  1M90 C;  3M54 A;  4M7A E;  2DEQ A;  4DOW A;  1I4K 1;  3BDL A;  4BUG A;  5I2M A;  5GAO p;  4M78 C;  5GMK i;  3CC4 T;  3PMI A;  1BKB A;  4M78 D;  1N8R C;  3LWI A;  2X4J A;  2K57 A;  2KAF A;  2JNG A;  4O6J A;  5GAM e;  2BIV A;  5LJ3 g;  4JRQ A;  4X34 A;  4QQD A;  4M77 E;  1YJ9 T;  1BYM A;  3JCM c;  3JCM P;  5GMK e;  4P5N A;  1OYX A;  3OYC A;  3TU4 K;  1XOV A;  3ASK A;  2VGN A;  3L1A A;  3OYJ A;  1VQO A;  3S6W A;  2JOY A;  1QP2 A;  3FB9 A;  1YIT T;  4PJO C;  1YJW A;  3QBY A;  1M8V A;  1WJR A;  4C0D C;  3VUZ A;  5HK3 A;  1N6A A;  4PJO D;  3QO3 A;  3OYL A;  3CCR T;  4PLI A;  3CMA A;  2DK3 A;  4J6W A;  3RUX A;  4C92 G;  3WXM B;  4A54 A;  2JTF A;  3PT9 A;  4ELZ C;  1XTD A;  3QYG B;  3QPH A;  2QXF A;  5GAN h;  4Y28 E;  3CC2 T;  3CCS A;  2Y4X A;  4OB0 B;  4YTL A;  2LRQ A;  3RKY A;  1MGQ A;  2E70 A;  4C92 A;  1NPP A;  4M75 E;  3ME9 A;  5GAN g;  1VQ7 A;  3FEO A;  2XDB A;  3JB9 F;  2AHJ B;  4XU2 A;  3VYH B;  5FRO A;  2K5I A;  1I81 A;  1VQN T;  2V8J A;  2OAU A;  4MZP A;  4OMF B;  3G6E T;  5L8R E;  3OYA A;  4N4I A;  2ZZD A;  3V7S A;  1I5L A;  3OA6 A;  3JCM X;  3OS1 A;  1KC8 C;  2QQS A;  2RO0 A;  2RJD A;  3VKI A;  4O5V A;  2GCX A;  5D6Y A;  4L59 A;  3KXT A;  4QVC A;  3UWN A;  1IRE B;  2P4T A;  2RJC A;  1GXI E;  4C8Q G;  5LJ5 f;  3KBG A;  2DXT A;  1B34 B;  2DPP B;  2QI2 A;  1YI2 A;  4N0A C;  3ZFJ A;  3OYI A;  1OI1 A;  2K3Y A;  4C8Q A;  1VQP A;  2RM4 A;  3MP6 A;  3FJP A;  1G3W A;  3QKJ A;  4HA8 A;  2R5M A;  4FL6 A;  5LJ5 h;  1QVF A;  4KUI A;  2MF2 A;  1K73 C;  2HBP A;  3KUF A;  1VQ8 A;  5FU6 C;  1AHJ B;  2EFI A;  4A4E A;  2DIQ A;  1YJW T;  3G71 A;  4V2S A;  1YJN T;  1BI1 A;  4HKE A;  3P8H A;  1JBM A;  3A5Z B;  4B9W A;  5GAM f;  3CMA T;  3E9G A;  5CKD A;  4QQ6 A;  1Q82 U;  2EQJ A;  1YIJ A;  2E65 A;  2QA4 A;  1VQK T;  2BUD A;  3CCS T;  1G3S A;  2CZ7 B;  3G4S T;  1RL2 A;  2CZ1 B;  2JTM A;  2L5Q A;  2M0O A;  4EMK A;  2ZPG B;  3OS5 A;  2LQK A;  2CZ0 B;  4LD9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...