3EAJA

Crystal structure of sars-cov main protease quadruple mutant stif/a with two molecules in one asymmetric unit
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
302
structure length
302
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQCSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of SARS-CoV Mpro mutant with two molecules one ASU
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 81
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3eajA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3eajA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3eajA02
4UFEH 1SG8B 1FLEE 3M7TA 3PWCA 1ESAA 5GXPA 1UVTH 1ETSH 4X6MA 2BLOA 3MH7A 4DW2U 3ZZ4A 1TGCA 1DDJA 2FM2A 3GDUA 4M7GA 1SGTA 1D9IA 2BD8A 2Z7FE 2TRMA 3P92A 3UY9A 1RTKA 1ZZZA 2HWLB 3W95A 3MH6A 2LIZA 4X1NU 2CF8H 4MPVA 1G3CA 4NZLA 5DPAA 4ZAEA 1PPCE 2VB0A 4X8SH 1MQ5A 3BEUA 1FUJA 3D65E 4CRGA 7GCHG 1GJ6A 5EW2H 1D6RA 2Y7XA 4HGCA 1FI8A 2BDBA 1HAVB 2ZFPH 3M3VA 5CHAC 3T26A 1P3EA 2Z3CA 3SJOA 3RXKA 5JB8S 3ZYEA 4MLFB 3GCHB 2WUBA 1YGCH 2ZF0H 4H6SB 1VCWA 1PPHE 1LPKB 1GBKA 3FAOA 1S85A 3LT3A 3A89A 3GOVB 1TFXA 2SNVA 2Q6FA 2YNAA 2W3KA 2B9LA 2QV1A 1TRNA 4MNWA 5F03A 5JBBS 1LVMA 3EYDA 1LTOA 1TGSZ 4TPIZ 2ANKH 3QTOH 2BD4A 2VGCC 4Z6AH 3ATIA 3I29A 2A5AA 4HFPB 2F9PA 3HATH 2ZP0H 1KLJH 5L6NH 1MAYA 1DWCH 1GBEA 2F9BH 1KSNA 3PLBA 2FLRH 3FP7E 1GHYH 1KDQA 2PR3A 1CE5A 1EZXC 5T6FA 2TIOA 1YPGH 1O2KA 3AW1A 1MKXH 2OBOA 5EG4A 4BTIB 1DX5M 1NY22 1YP9A 3LIWA 4MPWA 3CS0A 2ZGXH 3M7QA 1W8BH 1MTSA 3RMNH 1EPTA 1ORFA 1OS8A 5DKMA 1OPHB 4AOQA 4GUXA 1S83A 3KL6A 4OGYA 3PTBA 2ZU2A 1IHTH 4FU9A 4FUJA 2BMGB 3ZZ6A 5FPTA 1RTFB 4BXWA 2Z3EA 3FP8E 1O3OA 3NXPA 3RXUA 4O97A 3V0XA 1BOQA 1GJ9B 2HVXA 2FDAA 5ETXA 1IQHA 1O5AB 4U32A 1O0DH 4Y71A 1VITH 1TABE 1ZTLA 1AUTC 2VJ1A 3MI4A 1K1IA 2FS8A 5CE1A 3ZYDA 2H5DA 1FJSA 5ABWA 1G30B 1BT7A 3RC5A 2VVUA 2ZU1A 4X8UH 4O03A 3KHVA 2ZGCA 4AN7A 2QIQA 3U1JB 5EPNA 4B73A 5EXMA 3S69A 3NZIA 1DS2E 1O2NA 3UREA 1RFNA 5EW1H 2H1UA 3VFEA 2BDHA 3BF6H 3RMLH 3TJVA 2TGPZ 2Z9IA 4OS2A 4MG3A 5C67A 1CVWH 4FUCA 1NZQH 2D2DA 3A7TA 3VGCB 4F4OC 3P8FA 1EAWA 2G52A 4SGBE 4X8VH 3E6PH 3D49H 4E7NA 1C5OH 1ZSKA 1BMMH 1UMAH 4HTCH 3ZVBA 1GDUA 1W3CA 1PQAA 2BHGA 4ABJA 2BY6X 1C5PA 1ELFA 5B6OA 1IQMA 2WPHS 5E0GA 2AMQA 1DUAA 4DJZB 7ESTE 4D9QA 1XM1A 1TMUH 3OX7U 8KME2 4KELA 3R0FA 4BTTB 2IOTA 4LZ1H 1O3GA 1BTUA 3QLPH 1P8VC 3ZVAA 1Z7KA 1D3PB 1O2SA 5EGMA 5K7RA 1ELAA 1ARBA 2W3IA 4IN2A 1SOZA 1PQ5A 3LPRA 2ZIQH 4KTCA 1L1GA 2VIDA 1GI5A 2C8XB 4K3JA 1XKBC 1GMHG 2WYJA 3M61U 3LKWA 4OS5A 3EA9A 3SU6A 3STJA 2A2XH 1BB0B 4UE7H 2YNBA 1OKXA 3F9GA 4ASHA 2ZQ2A 2QA9E 4WMDA 1TBRH 2BX4A 2Y80A 1FZZA 1O2VA 1VGCC 1XUFA 1W2KH 1A5IA 4A6LA 2B7DH 1NFYA 1Q2WA 4OS4A 3VB6A 2GV7A 2VGCB 1JBUH 4NA8A 2ZTXA 2A4GA 1Q3XA 8GCHG 3BTDE 4GHQA 4Y7AA 3RXRA 2BD3A 4INLA 4LZ4B 2FTMA 2Y5FA 4TY7A 3SU1A 3DUXH 1P12E 4XOJA 2OC0A 1QJ1B 1QJ6B 3TH3H 2ANMH 4NWKA 4DGJA 2JH6D 1MQ6A 1FY3A 1T4VH 1KTTB 1HIAA 3PO1B 2JETB 3SNEA 3E91A 1BTZA 2BY8X 2ODPA 2CXVA 1AU8A 3SGQE 1V2WT 1GHBG 1GHZA 2GV6A 5JBCS 1E36B 3UNRA 1C1TA 1UVOA 2W5EA 2FO9A 1AZ8A 3URCA 1C2DA 1O34A 4ISNA 3Q3KA 3P8NA 3E90B 4WMFA 1WBGB 2G81E 2HGTH 4TY6A 2HALA 1IQJA 2G5NA 2ZGHA 4B76A 3GY2A 1N8OC 2SGFE 1GMHF 5A2MH 1HAGE 3NK8A 4B71A 5FPSA 4X2XA 3TGJE 4XE4A 1TPSA 2ZGBH 4ZMAH 2BLVA 2FS9A 2ZHWH 2BX3A 2QXJA 2H9TH 5CHAB 1Y5BT 1O2IA 1F0UA 1C2HA 1ZRBA 4YESB 3A7WA 1V2JT 3M37A 2LPRA 1UVPA 1YPMH 2F9OA 1MD7A 1AHTH 1HNEE 1ANDA 1MUEB 3M5LA 1ELDE 4DT7B 1C9TA 4IN1A 1ZLRA 2ZEBA 1PPZA 1LQEA 1BRAA 3TJUA 3SU2A 1JXPA 5LPEA 5FBEA 3FVFB 1S6FA 2BQ7B 2ZG0H 4D76A 1KDQB 1C2MA 3KF2A 2Z9GA 5CMXH 1GVLA 4IMQA 4GLYA 3P6ZB 1OX1A 3GCNA 1PJPA 2HNTF 2AGEX 1EAUA 3E0PB 5EQQA 1TPOA 4AG2A 4ABIA 3BTHE 2A5KA 1BBRH 5AVDA 4WVPE 1GI9B 2FOGA 3BTTE 1GJAB 4IMZA 1E37B 1O3PB 4ABHA 1QFKH 3O8CA 4CH2B 3WY8A 2BY9X 4UFFH 1AD8H 2A4RA 4RKJB 2FTLE 2FYQA 2XC0A 1O3JA 2ZDLA 1H9IE 3ATMA 1DSTA 3A82A 1OOKB 2FZZA 3ZVFA 1QBNA 2GKVE 3UNSA 3QGJA 3QZRA 1O39A 4Y7BA 3BG4C 2V3HH 2ZC9H 3UQVA 3SORA 1C5LH 1SGNE 4ISIH 3PMJA 4BAHB 1NPMA 1TA2A 4CRBA 5LH8A 2OD3B 2XBWA 3EA7A 4FU7A 1NT1A 5G4BA 3F9HA 3LOXA 1AN1E 2EC9H 1S6HA 3SUGA 3BEIB 4UONA 2BOHB 4Z0KA 2A7HA 2HOBA 1V2LT 1P01A 2BQWB 3ZZ7A 2XBXA 1BTYA 4Y11E 4YOJA 1IQIA 1OWJA 2Y6TA 3BTQE 2ASUB 1CA8B 4A1VA 5DP3A 1SFIA 1XX9A 3AASA 2PTNA 1UCYH 2Q6GA 1P05A 1Y3YA 2DE8A 2TGDA 1DSUA 1Z8JB 1J8AA 1O3FA 2NWNA 1DFPA 1T8OA 1O3LA 1TBZH 2GT7A 5C5NA 2VH0A 4LOYH 2P3UB 2G00A 1AUJA 1C5YB 1KLTA 3OSYA 3SV9A 3T25A 3CENA 3BIVH 1ZGIA 1GWAA 6LPRA 2SGPE 4AG1A 1GCTB 1EQ9A 2Q1JA 3A7YA 4WY3A 1V2RT 1LVOA 2PWXA 2UUKB 5DJ7A 2OC8A 1KIGH 1Z6JH 1KXBA 3RU4T 2Q6DA 1YPEH 3K6ZA 3SN8A 1L0ZA 4CR5A 1EZUC 1ZHMA 5HM2A 4A92A 2OC7A 1ELBA 1LHDH 1P2NA 3UNQA 2P59A 4BANB 5LPFA 1QNJA 5FCKA 4X2YA 1U6QA 3SJIA 3H7OA 3ZVCA 1TPPA 4D9RA 1ANCA 4R0IA 1HB0B 1E38B 1K21H 1O32A 1MTWA 1KXCA 1EPTB 1ZPZA 4JZ1A 1C2IA 2JETC 3A88A 1BMAA 2H9EH 2XWBI 1K1MA 2ZWLH 4ZKSU 3UWIA 3RM2H 5GDSH 1HBTH 2RCEA 1HAIH 1P04A 1HCGA 2ZU5A 2P16A 1AGJA 3BEFB 1CBWC 4Y0YE 2BD5A 4Q7YA 1BZXE 2KAIB 4FUGA 2B5TB 5FXLA 1AB9B 1F5LA 3U8RH 5JDUB 2KAIA 2ZFFH 3SGAE 2Z6BD 1HDTH 2NU3E 1Z1JA 2H5CA 3A8DA 3OY6U 2UWLA 1HAOH 1GHXH 4ZKNU 4GVUA 1T31A 2ODYB 1DLKB 1EP6A 1SLWB 1QBVH 1ELCA 3GICB 1VITG 3MH4A 1VCPA 4MTBA 4B2CA 2A4OA 1MTVA 1SBWA 3LC3A 1SFQB 1GI1A 2ZFTA 3ELAH 1IOEA 1O36A 3IG6B 4ZHAA 1P11E 2A0QB 1UHBB 1SB1H 1TRMA 1CGHA 1C5NH 4NIVA 1P02A 1AVGH 1GBBA 1TQ0B 2VH6A 4OS6A 1O2XA 2LNCA 2BVRH 3SV6A 2PFEA 1VGCB 1W11U 5JBTA 1ZMNA 2BB4A 2GT8A 1O38A 2ZU4A 2F9NA 4FU8A 1HGTH 2ALVA 1CT2E 3ZZCA 1P3CA 3LGUA 1A5HA 3VPKA 2AGIX 1GL1A 4O3TA 5BPEA 3TLOA 3KEEA 3ZZDA 2G4TA 4R8TB 3QO6A 3T28A 4AFZA 1F0SA 3GCTF 2P8OC 1OP8A 3TK9A 4A1XA 3SO3A 1F0TA 4NIXA 3RXQA 3JZ1B 3KCGH 4X6OA 1W7GH 3GCTG 3ZZBA 2OBQA 2GX4A 1Y3XA 1ACBE 1GMDF 4I8LA 1QRZA 5GWZA 1O3IA 4WXIA 3H5CB 2CV3A 4BXSA 4E06H 3DFJA 7KMEH 1G3BA 1Z6EA 3MO6A 3SV2H 2BVSH 5AHGH 3BIUH 1GBCA 2XBYA 2HNTE 3LGWA 2FI5E 4JMYA 4ABGA 3GYLB 5HMAA 3SU4A 1MKWH 1UCYE 1MU8B 1YC0A 5F8ZA 1H1BA 2AERH 3E1XB 3LH3A 3LJJA 1HJAC 4WJG2 1ZPCA 2G8TA 1GG6C 1SGEE 1W7XH 1FNIA 2SGAA 1C1QA 2P3FH 1XUHA 1HJ9A 2JH0D 4E7RG 1O3NA 1UTQA 1C4V2 1C1VH 1EOJA 2BM2A 2F9UA 3TU7H 5HXFA 2GDEH 1WTGH 2ZCLP 1A4WH 4Q7XA 1V2VT 4VGCC 1SGFA 2P94A 2FMJA 2GD4B 1AE5A 1SLVB 3W94A 1JWTA 3A8BA 4LK4A 2P95A 2FOEA 1FN8A 4BAOB 3TJNA 1ESTA 1CO7E 2DUCA 1C2JA 2YOLA 1FQ3A 2M5TA 3TJOA 3UWJH 1AE8H 1HJAB 4ISOA 4K1EA 2IN2A 3DD2H 3M35A 2OP9A 1O2TA 3L33A 1IQFA 1GL0E 1WQSA 3U98H 4E05H 1H9HE 2QF0A 1BCUH 3E8LA 4CRCA 1P10A 3Q3YA 2PV9B 1BHXB 2OCVB 5DGJA 5FBIA 1YKTA 2GCTC 4ISHH 1UVSH 4DY7B 1YPHC 3V13A 1UK4A 2V6NA 2FODA 4RKOB 1Y3UA 3VB7A 1K1LA 1ARCA 1A46H 1LO6A 1TGBA 1CA0C 2FPZA 1B0EA 5GCHF 3LU9B 3R3GB 3UIRA 4B1TA 1AQ7A 1SC8U 4YTAA 1FY8E 2NU4E 1FMGA 4D7FA 1HAPH 1HRTH 3GCHC 4RN6A 1ELVA 1V2OT 1V2MT 1N1LA 2RG3A 5BRRE 3Q77A 1G37A 4JK6A 4CREA 3PM3A 2C3SA 3LC5A 1BA8B 3M7UA 3MU1A 3OTJE 1FAXA 5ESBA 3SNCA 1IQKA 1SHHB 2BDCA 3S7KB 1OWIA 1OWHA 4U01A 2DE9A 4H6TA 4INKA 2C90B 1TGNA 3VGCC 1HAYB 4B74A 2XC4A 4NSYA 4Y8YA 5TCAA 3D62A 3F9EA 1AWHB 1K2I1 4ZKRU 3RXPA 1NS3A 3NCLA 1GBHA 4DVAU 3QX5H 1JIMA 1JRSA 3C1KA 5E0HA 1N6YA 1X7AC 1QHRB 2A2QH 3BG8A 3BTEE 3UTUH 1OP2A 2PSYA 2P3TB 1A0HB 4IW4E 4K69A 4NSVA 2FXRA 1VJAU 4A1TA 1KLIH 3BTWE 1JIRA 3JZ2B 1C1RA 3TIUA 1G32B 2GP9B 2EI8A 2C8WB 1JOUB 3DHKH 4JK5A 3O8RA 3ODFA 1OWDA 1P06A 1Q31A 2UUFB 2ILNA 5DK1A 4CR9A 1SLXB 5F8TA 3S0NA 1C1UH 3FFGA 1AIXH 1SQAA 2WPKS 2D1JA 3UOUA 1FONA 2BD7A 2BXTH 1O5FH 2Y7ZA 4AGKA 1NU9A 4DOQA 2QGRA 1RIWB 2XBVA 3M5NA 3QGNB 3RXLA 1THSH 1HXEH 1GI2A 1C5VA 1OWEA 4NG9H 5E0JA 4OS7A 3RXOA 2J9NA 1FY1A 1F2SE 1O2PA 3SNAA 2VU8E 1Y5UT 5E2OA 1EPTC 1PQ8A 1ZTKA 2HLCA 1MTNB 2A31A 2O8TA 1QL7A 1PYTC 1C2EA 1O2HA 2ZNKH 1GJDB 2J95A 1GBLA 1AKSB 1GJ8B 2NU0E 3EQ0H 1P03A 2ZCKP 3B23B 1GJ4H 1G2MA 2VIPA 1VITF 3GY7A 4NFFA 4Y79A 5K0HA 3M5OA 1O2UA 1AFEH 4UEHH 3URDA 3SHCH 3BSQA 2BYAX 4X6PA 1V2QT 1BJUA 3BV9B 3ATLA 3ZZ8A 1HYLA 1KYNA 3RXAA 3KIDU 1B5GH 5C1YA 1P2OA 4DURA 1O2MA 1QBOA 1TNJA 1DLEA 1BRUP 3EGKH 3QWCH 2WINI 1C5QA 4YT7H 1ID5H 2ZDKA 4CHAB 2BY7X 1N8OB 2O9QA 4TPYA 1T32A 5HM9A 2AEIH 1A0LA 1P0SH 4HI3A 3ZVGA 3MH5A 4Y10E 2XRCA 4ABEA 1NROH 2PKSB 1GG6B 3SV7A 2ANWA 1DUEA 1BJVA 2OTVA 1O3MA 5C2ZA 5A0AE 1FDPA 1A7SA 1BMLA 3SUDA 5J4SA 3ATWA 3KQEA 3F9FA 2FLBH 1DY9A 3MNSA 2ZFRH 3DFLA 3MU8A 1L4DA 4ABBA 1HLTH 1DPOA 4IBLH 3QZQA 4YOGA 3PYHA 1UTKA 3RLWH 2J38A 1QR3E 2C8ZB 1EATA 2H9HA 3HKJB 3A7ZA 2O8WA 3B9FH 3BTGE 1ELGA 3I77A 4WMEA 3GCOA 2A5IA 5FHTA 1WCZA 3Q3XA 1ZSLA 2OINA 4AB8A 1ZMJA 1NFXA 1XKAC 1A1RA 2WV4A 5T6DA 1EB1H 5C1UA 1GBFA 1GBIA 3SBKA 2Y5GA 4U2WA 3RXHA 1C5ZB 1OYTH 4THNH 4BAQB 4XFQA 2OQ5A 2PW8H 3KQDA 1TAWA 3HK3B 2AYWA 3E3TA 4XBDA 1C5WB 3T2NA 1LMWB 2BD9A 1S81A 7GCHF 2ZDAH 1ABJH 4IGDA 1UK3A 4NZQA 2BDGA 1O31A 2HRVA 1B7XB 1QGFA 3V3MA 5HGGA 3FZDA 1P9SA 2GCHG 5E8EH 1LHGH 1O3HA 4YM9A 3K2UA 1K1PA 2R3YA 1EZQA 2QY0B 1QY6A 4A7IB 3LGVA 2CN0H 4A5TS 1S0RA 4CBNA 3P95A 2FESH 4WF8A 1OXGA 3SJKA 3VB4A 2R2WU 3MFJA 5DP9A 2V35A 2B8OH 2AS9A 3M3TA 4Q2KA 4ZUHA 1MBQA 1QTFA 1W14U 5DP8A 1QIXB 4YT6H 2H2ZA 1L1JA 4I8KA 1F5KU 3PWBA 2PKAA 1GHWH 1UHBA 1GI8B 2VWLA 4JZEH 1XXFA 1YBWA 2AIQA 1MKXK 2WPLS 2FOFA 1ZTJA 4JYUH 4X2VA 4MNXA 3U8OH 5GIBA 1C9PA 2F3CE 3ZZ9A 4XSKU 4AORA 2BZ6H 1KXEA 1GI6A 1DANH 2UWOA 1QJ7B 1CT0E 3P17H 4X2WA 4OS1A 2ZQ1A 1AY6H 2XTTB 4MNYA 1HPGA 2V0BA 3SNBA 1NO9H 2R0KA 1TRYA 2XXLA 1L2EA 1MAXA 3MHWU 2BQ6B 3GYMA 3A8AA 4GCHG 3TH4H 3PV4A 3M5MA 1O35A 2TGAA 1CA0B 1VZQH 2ZHFH 1AVWA 2FX4A 1YYY1 3ESTA 2BD2A 1HAHH 3A7VA 1OSSA 4X1SU 1ETTH 3PLPA 2BTCE 1DITH 4B75A 1IQGA 2J92A 4UFGH 2XCFA 1P9UA 1BUIA 2BDAA 4MVNA 3ODDA 1RRKA 2BOKA 5DP7A 3SGBE 1CSOE 1H9LB 1WQVH 1O5EH 4NWLA 1RXPA 1ZRKA 3FZZA 3DA9B 3OU0A 3CP7A 3PO1C 1EAIA 2RA3A 1IQNA 5JPMH 3L6PA 1ZR0A 3TK6A 4BNRA 3EBNA 1LCYA 3PB1E 4AFSA 2R2MB 5L30H 1L4ZA 1UVUH 1QB9A 2FOMB 2AMPA 1AI8H 1ZSJA 1C1PA 1WU1A 4U30A 1YCPM 1K1OA 2ZDMA 2F91A 1CQQA 3MNXA 3P8GA 1FV9A 1EP5A 1F5RA 2Z94A 1GHVH 1QCPA 1SGFG 1C2FA 1GGDB 2C8YB 3K65B 3SV8A 5GJ4B 2ZZUH 1AVXA 1V6DA 3SUEA 3SJ8A 2STAE 4B2AA 1C1OA 5I25A 3QN7A 1RIWC 1O3DA 3H7TA 1MH0A 1KXDA 4X1RU 3SOSA 2GMTB 1C2KA 4LXBH 3GY6A 1HUTH 3LGIA 2Y82A 1NTPA 1SR5C 1EUFA 4GCHF 3SU3A 3UR6A 2FYRA 2PTCE 1PPGE 2ODQA 1MD8A 1QB6A 1O5GH 2J34A 3SJ9A 4K5ZA 1AKSA 1O2JA 1LHEH 5J4QA 1B0FA 1WYKA 1AFQC 4IC6A 5GCHG 4GHTA 3GISB 3MTYA 5AF9H 5JYIA 1C2GA 2VWMA 3MU4A 4JCNA 1C5TA 1BBRE 1D3DB 2F9VA 1FAKH 3MO3A 4FUIA 1G3DA 2CJIA 4I8HA 1P2QA 1THPB 4QT8C 1EX3A 2STBE 4WWYA 1EXFA 1WTHD 1BQYA 4AYYB 1EAXA 1TE0A 3TNTA 3P8OA 1NRRH 1O2OA 1P57B 1S5SA 4WH6A 2EEKA 3QDZB 1LKBA 1SVPA 2A7JA 1MCTA 3PMHB 1GBTA 4K8YA 3D23A 3ZVEA 1DWBH 2VWNA 4I32A 4JZDH 1TBQH 2C93B 3MU5A 3A84A 1DY8A 1SPJA 4CHAC 1D6WA 1FPHH 2F83A 4CRDA 8LPRA 3MYWA 3VB3A 1C5SA 2SNWA 4K60A 4NCYA 1SL3A 2PHBA 3S9AA 1BTWA 2BLWA 2IPHA 3UUZA 1GJCB 4NIYA 1WUNH 2QYIA 1O2QA 4YZUA 1GI4A 2CMYA 2THFB 3RXFA 3RC6A 3RU4E 2G51A 3BTME 3A8CA 2GVFA 2Z9KA 1O37A 3GY3A 4CRFA 3ZZ3A 2P93A 2XCNA 2H6MA 3T29A 4FUDA 1HXFH 1TPAE 1RS0A 1SGPE 2FX6A 4SGAE 3RC4A 2EA3A 4BAMB 3RM0H 5I46H 2W26A 3A80A 3N7OA 5T3HA 5EQRA 4ZXYH 4YLUA 1TWXB 2VNTA 1Y8TA 1YLDA 4F49A 3SU0A 3K9XB 2CGAA 5DP6A 3ITIA 1FPCH 1GHAF 1SGRE 2J94A 4CRAA 2NU2E 2G4UA 2QXIA 4X6NA 1UTLM 2FP7B 1V3XA 5FAHA 3OYPA 1CGIE 1UCYK 1TMTH 1KXAA 5EPYA 2XNIA 3PMAB 4K8BA 3LGYA 1FY5A 6ESTA 4I33A 2D8WA 4B2BA 4D8NA 4K2YA 2O8UA 2WV5A 1TQ7B 3ATKA 3ZZ5A 5LGOA 1V2PT 3RLYH 4NIWA 3RXSA 4ZH8A 1F92A 4GAWA 4Y76A 5EOKA 5AFYH 2VIOA 1HIAB 1MU6B 2ZCHP 1C5UA 3SUFA 1C1MA 3V12A 4KTSA 5LPRA 1A5GH 2PKAB 1BIOA 1YM0A 2PGBB 2BXUH 2CHAB 3AAVA 4H4FA 2RDLA 1VCQA 3STIA 1RGQA 3BTKE 3G01A 3KQCA 1XVMA 2B0FA 1C1SA 3ZV8A 3HK6B 1O3CA 3UPEA 1MTUA 1ZYOA 5ESTE 1EKBB 2QC2A 3M36A 2ZA5A 1YCPH 3HGNA 1O5DH 1HAXB 5GPIB 4HZHA 1P2MA 5IDKA 1O2LA 1GPZA 1T8MA 1LKAA 4FUFA 4YOIA 2UUJB 1MMJN 1GMCF 5IYTA 2WPJS 1Z8IB 1C5RA 3B8JA 1EJNA 2IJOB 1Y3WA 4FUEA 1DOJA 1QB1A 1WOFA 1WV7H 9LPRA 4YO9A 1O30A 2ZFSA 5T6GA 2FI4E 3TVJB 1CU1A 4KKDA 3UFAA 2P8OB 4UDWH 1SOTA 1NRQH 2K1QA 5EU8A 3EE0B 2JKHA 3RMOH 1RTLA 2GCTB 2HPQH 1A3BH 2AIPA 1ZGVA 1BTHH 3EDXB 3RUOA 1K1NA 1UTMA 2ZPQA 2QN5T 5C20A 5HYOA 3A85A 4AFQA 1TYNA 2FIRH 1NFUA 4TYDA 3EAJA 1BDAA 1FY4A 1QQ4A 1IQEA 1OYQA 2VIVA 2XWAA 3O8DA 4Q80A 9ESTA 2UUYA 3CS7A 1BRBE 3KN2A 1DM4B 4X0WU 3TH2H 1H8DH 2GTBA 3SZNA 1QL8A 2ZDVH 5FX5A 4VGCB 1DWEH 3RXJA 5A8YA 4JZIA 1GVKB 1ANBA 3PMBB 1SQTA 4I7YH 1EASA 4J1YA 4JYTA 3RXMA 1O3AA 1SQOA 2PLXA 2ANYA 2G55A 3QUMP 1OWKA 2D26C 3T27A 3T5FH 1DXWA 7LPRA 1D3TB 3SI4H 1GGDC 1O33A 1TALA 1H8IH 1Z8RA 3F6UH 3PLKA 1NFWA 1O2GH 1SHYA 3LONA 1J9CH 3SNDA 2OXSA 1O3KA 2O8MA 3RXGA 1S84A 1ZHPA 5FPYA 2BLQA 1TLDA 2AMDA 1P2JA 2QAAA 1TGTA 1V2KT 1DXPA 1UK2A 1DICA 2ZU3A 3V7TA 3S9CA 1ZJDA 4Q7ZA 2FOAA 1A61H 2W7UA 3OY5U 1TX7A 1DE7H 2OC1A 4NGAH 4DCDA 1GI3A 3A86A 4FVDA 1INCA 2WUCA 1IAUA 3UQOA 1C1NA 4O3UA 2GZ9A 2QXHA 1YPLH 5TJXA 1XVOA 1UJ1A 4X1PU 2SFAA 3MU0A 2PKSC 1CHOG 5EODA 1CHGA 1UTJA 4PROA 4JZFH 1TNIA 5TCCA 1RJXB 3MNCA 1ANEA 3RXEA 4MNVA 2J4IA 3TK5A 1UTOA 1EB2A 3S9BA 2ZTYA 1IHSH 2R9PA 1PQ7A 4D7GA 3NPSA 1SSXA 4X8TH 2XYAA 3BN9A 3ZVDA 2R0LA 4KGAA 5A8ZA 3NUMA 1LQDB 2AFQB 2TBSA 1HAVA 1YF4A 3VXFH 2GZ8A 4FUHA 4ISLA 2V3OH 1GBJA 1A3EH 1W10U 1TX8A 4GPGA 3RXDA 3RXTA 1NESE 1HAZB 2Z3DA 1PPFE 2XW9A 1SGYE 1ELTA 1PPBH 2ZDNA 1J17T 4Y8XA 3L3TA 1LDTT 4OGXA 1EZSC 4AYVB 3BG4B 1NM6A 1K9OE 2VIQA 2A32A 2PGQB 1QRXA 1KY9A 1NU7B 1NRPH 1GI7B 4TWWA 6CHAB 2NU1E 4ABFA 1XXDA 1TONA 3VB5A 1A0JA 1CBWB 3VXEH 1P2IA 4ZKOU 1O2WA 4BTUB 3LDXH 1O3EA 4K1SA 1MTNC 1SI5H 1AB9C 2ESTE 4BAKB 3TPIZ 1E0FD 2ALPA 1G9IE 1SGQE 1LPZB 2FI3E 3K6YA 4FUBA 5DO4H 3RP2A 5A0CA 1HJ8A 1AO5A 4Y0ZE 1ELEE 2GDDA 1O2YA 1QRWA 1Y59T 1T4UH 2J2UA 3SU5A 1KTSB 3BTFE 1O5BB 1MKWK 4I8GA 1FN6A 1C4Y2 2ZPRA 2FEQH 4J2YB 2OLGA 3PTNA 3TGIE 5EXLA 3SHAH 4Y6DA 4AZ2B 1D4PB 3A87A 2VINA 1SLUB 3GY4A 4YLQH 5EQSA 1NC6A 1T7CA 1VJ9U 1VR1H 5F8XA 4ABAA 2GZ7A 2ZI2H 2GGVB 1TIOA 1PYTD 1HV7A 1AZZA 1SGCA 1H4WA 2R3UA 1YCPK 1NRSH 1XUJA 1GCDA 3MMGA 3MO9A 1RD3B 1W0YH 2I6SA 2UWPA 1MCVA 3VEQB 5L2ZH 1J14A 2A45B 2OUAA 4DIIH 2ZECA 1MZDA 1ABIH 1YPJH 1YLCA 1GMCG 2RA0A 2ZHEH 1C2LA 4CH8B 3GY8A 1HFDA 1JMOH 1MZAA 3TGKE 3TITA 1WAYB 1AWFH 8ESTE 3Q76A 1J16A 5A0BA 1K22H 2WPIS 4XBCA 1PPEE 1ZJKA 5L2YH 1P2KA 1C4U2 1F0RA 2WPMS 4RSPA 3PROA 1FXYA 1DWDH 1G36A 2VWOA 5C5OA 3F68H 4ZROA 4INHA 2W7SA 2ULLA 2Z9LA 1MBMA 1GHBF 1ZOMA 4KTUA 1W0ZU 2ZHDA 2Y81A 3U69H 4ZHLU 6GCHG 2SGDE 1G3EA 1GBMA 3U8TH 5DP5A 1O5CB 1TMBH 1GCTC 1DT2A 4ESTE 4ZHMU 2WYGA 1S82A 4WXVA 3SW2B 4GSOA 1XMNB 1QQUA 3A7XA 4Y8ZA 1OP0A 1LHCH 2SGEE 1BHXF 5A09A 3HGPA 4X1QU 1TB6H 1Z71A 1BITA 2K7XA 2QF3A 3LH1A 3RDZA 1BMNH 4O9VA 1TX6A 1BTPA 1BRCE 4DIHH 1W12U 3EA8A 1GI0A 1THRH 2CHAC 2PUQH 5C1XA 1IQLA 3GDVA 5F6MA 1TNKA 3RXVA 4AB9A 4XBBA 4I8JA 4FXGH 1TOMH 3FP6E 4JYVH 4MQAA 1E35B 1E34B 4KP0A 4IC5A 2BDIA 1GHAG 4BOHA 2G5VA 1J15A 2BZAA 1L1NA 3UR9A 1D3QB 3U9AH 4NA7A 3HPTB 1FIZA 1Z1IA 4WH8A 3T62A 3S7HB 2ZTZA 1K1JA 2GMTC 5JBAS 1ETRH 1V2ST 1SMFE 3E16B 1TNLA 3NKKA 4UFDH 5SGAE 1NN6A 1Y3VA 3O8BA 6CHAC 3NWUA 1SGIB 4NFEA 4K1TA 1O2RA 5DG6A 4IS5A 1C5MD 3E0NB 3AVZA 2EI6A 3RXCA 2PSXA 5JB9S 2FOHA 1O2ZA 3IWMA 3I78A 4FVBA 1C5XB 3SQEE 3C27B 3RU4D 1FIWA 1QL9A 2CF9H 3HKIB 3AW0A 2ZO3H 3SQHE 1GBAA 2VVCA 1EJMA 2XC5A 3DT0H 1QA7A 3GY5A 2AGGX 3RXBA 2AH4X 2FOBA 6GCHF 1ZHRA 1T8LA 5E2PA 1P09A 1XUKA 1S0QA 4DG4A 1LVBA 4MDSA 2VVVA 2A1DB 2HNTC 2BVXH 4MPXA 3RMMH 1GMDG 3U1IB 1F7ZA 3UOPA 2BDYA 3QTVH 2A7CA 2PUXB 4I31A 4CBOA 1EOLA 2QCYA 4ZXXH 1V2UT 1KXFA 5DP4A 1XUIA 4MPUA 2Z9JA 1GBDA 4AX9H 1K28D 3FANA 1TOCB 1UO6A 1ZMLA 1UTPA 5H4IB 1NRNH 1GDQA 5FCRA 1GJ5H 4AFUA 2VIWA 3A83A 3GDSA 3QK1A 1A2CH 1YPHE 2GCHF 1QA0A 2FWWA 1GJBB 1T8NA 1ESBA 1V2NT 3MWIU 3KQBA 1GJ7B 2O8LA 1GDNA 3ZZAA 3TNSA 5AFZH 4H42U 1CGJE 1TNHA 2EI7A 2JH5D 2ZFQH 1GVZA 2ZHQH 3A81A 5A8XA 1TNGA 2FOCA 1AMHA 1SGDE 1BBRK 3ZV9A 2SGQE 3AAUA 4XDEA 2TPIZ 3LJOA 2ZKSA 4TWYA 3KGPA 1JRTA 3MOCA 3RXIA 1DVAH 1ZPBA 5EXNA 2OQUA 2A4QA 1BTXA 2BY5X 1N6XA 1W13U 1PFXC 1LVYA 1Z8GA 1LHFH 1UTNA 1C1WH 1CT4E 1YPKH 2ZPSA 3ENSB 3F1SB 2TGTA 2Y5HA 3Q00A 5C3NA 4NA9H 2I6QA 3KNXA 1AFQB 2C4FH 4UD9H 3LGTA 1Y5AT 1O3BA 3M3SA 1WSSH 5PTPA 1V2TT 1XUGA 1M9UA 3P70B 2QXGA 3SI3H 1EJAA 2ZGJA 5FX6A 4AGJA 8GCHF 1TA6A 3IITA 1CHOF 1G2LA 3MNBA 1LPGB 4ABDA 2HPPH 1QURH
chains in the Genus database with same CATH superfamily
2QE7D 4UFEH 1SG8B 1FLEE 3M7TA 3PWCA 1ESAA 5GXPA 1UVTH 2F4LA 1ETSH 4X6MA 2BLOA 1E79D 3MH7A 4DW2U 3ZZ4A 1TGCA 1DDJA 2FM2A 3GDUA 4M7GA 1SGTA 1D9IA 2BD8A 2Z7FE 2TRMA 3P92A 3UY9A 1RTKA 1ZZZA 2HWLB 3W95A 2IJD1 2LIZA 3MH6A 4X1NU 5C0TA 5B6LA 2CF8H 4MPVA 1G3CA 4NZLA 5DPAA 4ZAEA 3W1EA 1PPCE 3UB0A 2VB0A 4X8SH 1MQ5A 3BEUA 1FUJA 3D65E 4CRGA 7GCHG 1GJ6A 5EW2H 1D6RA 2Y7XA 4HGCA 1FI8A 2BDBA 1HAVB 2ZFPH 3M3VA 5CHAC 3T26A 1P3EA 2Z3CA 3SJOA 3RXKA 5JB8S 3ZYEA 4MLFB 3GCHB 2EQNA 1NBME 2WUBA 1YGCH 2ZF0H 4H6SB 1VCWA 1PPHE 1LPKB 1GBKA 3FAOA 1OHHD 1S85A 3DCLA 3LT3A 4AC9A 2LELA 3A89A 3GOVB 1TFXA 2SNVA 2Q6FA 2YNAA 2W3KA 2B9LA 2QV1A 1TRNA 4MNWA 5F03A 5JBBS 1LVMA 3EYDA 1LTOA 1TGSZ 4TPIZ 2ANKH 2WZQA 3QTOH 2BD4A 2VGCC 4F48B 4Z6AH 3ATIA 3I29A 2LP6A 2A5AA 4HFPB 2F9PA 3HATH 2ZP0H 1KLJH 5L6NH 1MAYA 1DWCH 1GBEA 2F9BH 1KSNA 3PLBA 2FLRH 3FP7E 1GHYH 1KDQA 2PR3A 1CE5A 1EZXC 5T6FA 2TIOA 1YPGH 1O2KA 3AW1A 1H8HD 1MKXH 2OBOA 2RFKC 5EG4A 4BTIB 1DX5M 1NY22 1YP9A 3LIWA 4MPWA 3CS0A 2ZGXH 3M7QA 1W8BH 1MTSA 3RMNH 1EPTA 1ORFA 1OS8A 5DKMA 1OPHB 4AOQA 4GUXA 1S83A 3KL6A 4OGYA 3PTBA 2ZU2A 1IHTH 4FU9A 4FUJA 2BMGB 3ZZ6A 5FPTA 1RTFB 4BXWA 2Z3EA 3FP8E 1O3OA 3NXPA 3RXUA 4O97A 3V0XA 1BOQA 1GJ9B 2HVXA 2FDAA 5ETXA 1IQHA 1O5AB 4U32A 1O0DH 4Y71A 1VITH 1TABE 1ZTLA 1AUTC 2VJ1A 3MI4A 1K1IA 2FS8A 5CE1A 3ZYDA 2H5DA 1FJSA 2WSSD 5ABWA 1G30B 1BT7A 3RC5A 3PV5A 2VVUA 2ZU1A 4X8UH 4O03A 3KHVA 2ZGCA 4AN7A 2QIQA 3U1JB 5EPNA 4B73A 5EXMA 3S69A 3NZIA 1DS2E 1O2NA 3UREA 1RFNA 5EW1H 4TT3D 2OK5A 2H1UA 3VFEA 2BDHA 3BF6H 3RMLH 3TJVA 2TGPZ 2Z9IA 4OS2A 4MG3A 3H09A 5C67A 1CVWH 2V3MA 4FUCA 1NZQH 2D2DA 3A7TA 3VGCB 4F4OC 3F2FA 3P8FA 1EAWA 2G52A 4SGBE 4X8VH 3E6PH 3D49H 4E7NA 1C5OH 1ZSKA 1BMMH 1UMAH 4HTCH 3ZVBA 1GDUA 1W3CA 1PQAA 2BHGA 4ABJA 2BY6X 1C5PA 1ELFA 5B6OA 4RT0A 1IQMA 2WPHS 5E0GA 2AMQA 1DUAA 4DJZB 3DSPA 4D9QA 1XM1A 1TMUH 3OX7U 7ESTE 8KME2 4KELA 3R0FA 4BTTB 2IOTA 4LZ1H 1O3GA 1BTUA 3QLPH 1P8VC 3ZVAA 1Z7KA 1D3PB 1O2SA 5EGMA 3PRBA 5K7RA 1ELAA 1ARBA 2W3IA 4IN2A 1SOZA 1PQ5A 3LPRA 2ZIQH 4KTCA 1L1GA 2VIDA 5FL7D 1GI5A 2C8XB 4K3JA 1XKBC 1GMHG 2WYJA 3M61U 3LKWA 4OS5A 3EA9A 3SU6A 3STJA 2A2XH 1BB0B 4UE7H 2YNBA 1OKXA 3F9GA 4ASHA 2ZQ2A 2QA9E 3DSOA 4WMDA 1TBRH 2BX4A 2Y80A 3OEED 1FZZA 1O2VA 1VGCC 1XUFA 1W2KH 1A5IA 4A6LA 2B7DH 1NFYA 1Q2WA 4OS4A 3VB6A 2GV7A 2VGCB 1JBUH 4NA8A 2ZTXA 2A4GA 1Q3XA 8GCHG 3BTDE 4GHQA 4Y7AA 3RXRA 2BD3A 4INLA 4LZ4B 2FTMA 2Y5FA 4TY7A 3FKSD 3SU1A 3DUXH 1P12E 4XOJA 2OC0A 1QJ1B 1QJ6B 3TH3H 2ANMH 4NWKA 2GJGA 4DGJA 2JH6D 1MQ6A 1FY3A 1T4VH 1KTTB 1HIAA 4F55A 3PO1B 2JETB 3SNEA 3E91A 1BTZA 2BY8X 2ODPA 2CXVA 1AU8A 3SGQE 1V2WT 1GHBG 1GHZA 2GV6A 5JBCS 1E36B 3UNRA 1C1TA 1UVOA 2W5EA 2FO9A 1AZ8A 3URCA 1C2DA 1O34A 2KFWA 4ISNA 3Q3KA 3P8NA 3E90B 4WMFA 1WBGB 2G81E 2HGTH 4TY6A 2HALA 1IQJA 2G5NA 2ZGHA 4B76A 3GY2A 1N8OC 2SGFE 1GMHF 5A2MH 1HAGE 3NK8A 4B71A 5FPSA 4X2XA 3TGJE 4XE4A 1TPSA 2ZGBH 4ZMAH 2BLVA 2FS9A 2ZHWH 2BX3A 2QXJA 2H9TH 5CHAB 1Y5BT 1O2IA 1F0UA 1C2HA 1ZRBA 2J98B 4YESB 4ASUD 3A7WA 1V2JT 3M37A 2LPRA 1UVPA 1YPMH 2F9OA 1MD7A 1AHTH 1HNEE 1ANDA 1MUEB 3M5LA 1ELDE 4DT7B 1C9TA 4IN1A 3MQKC 1ZLRA 2ZEBA 1PPZA 1LQEA 1BRAA 3TJUA 3SU2A 1JXPA 5LPEA 5FBEA 3FVFB 1S6FA 2BQ7B 2ZG0H 4D76A 1KDQB 1C2MA 3KF2A 2Z9GA 5CMXH 1GVLA 4IMQA 4GLYA 3P6ZB 5EJZA 1OX1A 2KM0A 3GCNA 1PJPA 2HNTF 2AGEX 1EAUA 3E0PB 5EQQA 1TPOA 4AG2A 4ABIA 3BTHE 2A5KA 1BBRH 5AVDA 4WVPE 1GI9B 2FOGA 3BTTE 1GJAB 4IMZA 3KYFA 1E37B 3VG8A 1O3PB 4Q4LA 1QFKH 4ABHA 3O8CA 4CH2B 3WY8A 2BY9X 4UFFH 1AD8H 2A4RA 4RKJB 2FTLE 2FYQA 2XC0A 1O3JA 2ZDLA 1H9IE 3ATMA 1DSTA 3A82A 1OOKB 2FZZA 3ZVFA 1QBNA 2GKVE 3UNSA 3QGJA 3QZRA 1O39A 4Y7BA 3BG4C 2V3HH 2ZC9H 3UQVA 3SORA 1C5LH 1SGNE 4ISIH 3PMJA 2JIZD 4BAHB 3WWBA 1NPMA 1TA2A 4CRBA 5LH8A 2OD3B 2XBWA 3EA7A 4FU7A 1NT1A 5G4BA 3F9HA 3LOXA 1AN1E 2EC9H 1S6HA 3SUGA 3BEIB 4UONA 2BOHB 4Z0KA 2A7HA 2HOBA 1V2LT 1P01A 2BQWB 3ZZ7A 2XBXA 1BTYA 4Y11E 4YOJA 1IQIA 1OWJA 2Y6TA 3BTQE 2ASUB 1CA8B 4A1VA 5DP3A 1SFIA 1XX9A 2KX4A 3AASA 4OM9A 2PTNA 1UCYH 2Q6GA 1P05A 1Y3YA 2DE8A 2TGDA 1DSUA 1Z8JB 1J8AA 1O3FA 2NWNA 1DFPA 1T8OA 1O3LA 1TBZH 2GT7A 5C5NA 2VH0A 4LOYH 3WWFA 2P3UB 2G00A 1AUJA 1C5YB 1KLTA 3OSYA 3SV9A 3T25A 2J98A 3CENA 3BIVH 1ZGIA 1NBMD 1GWAA 6LPRA 2SGPE 4AG1A 1GCTB 1EQ9A 2Q1JA 3A7YA 4WY3A 1V2RT 3F2HA 1LVOA 2PWXA 2UUKB 5DJ7A 1H8ED 2OC8A 1KIGH 1Z6JH 1KXBA 3RU4T 2Q6DA 1YPEH 2JJ1D 3K6ZA 5CHBA 3SN8A 1L0ZA 5DN6D 4CR5A 1EZUC 1ZHMA 5HM2A 4A92A 4B6EA 2OC7A 1ELBA 1LHDH 1P2NA 3UNQA 2P59A 4BANB 5LPFA 1QNJA 5FCKA 4X2YA 1U6QA 3SJIA 3H7OA 3ZVCA 1TPPA 4D9RA 1ANCA 4R0IA 1HB0B 1E38B 1K21H 1O32A 1MTWA 1KXCA 1EPTB 1ZPZA 4JZ1A 1C2IA 2JETC 3A88A 1BMAA 2H9EH 2XWBI 1K1MA 2ZWLH 4ZKSU 3UWIA 3RM2H 5GDSH 1HBTH 2RCEA 1HAIH 1P04A 1HCGA 2ZU5A 5CDFE 2P16A 1AGJA 3BEFB 1CBWC 2WPDD 4Y0YE 2BD5A 4Q7YA 1BZXE 2KAIB 4FUGA 2B5TB 5FXLA 1AB9B 1F5LA 3U8RH 5JDUB 4RI0A 2KAIA 2ZFFH 3SGAE 2Z6BD 1HDTH 2NU3E 1Z1JA 2H5CA 3A8DA 3OY6U 2UWLA 1HAOH 1GHXH 4ZKNU 4GVUA 4Z1MD 1T31A 2ODYB 1DLKB 1EP6A 1SLWB 1QBVH 1ELCA 3GICB 1VITG 3MH4A 1VCPA 4MTBA 4B2CA 2A4OA 1MTVA 1SBWA 3LC3A 1SFQB 1GI1A 2ZFTA 3ELAH 1IOEA 1O36A 2XOKD 3IG6B 4ZHAA 1P11E 2A0QB 1UHBB 1SB1H 1TRMA 1CGHA 1C5NH 4NIVA 1P02A 1AVGH 1GBBA 1TQ0B 2VH6A 4OS6A 1O2XA 2LNCA 2BVRH 3SV6A 2PFEA 1VGCB 1W11U 5JBTA 1ZMNA 2BB4A 2GT8A 1O38A 2ZU4A 2F9NA 4FU8A 1HGTH 2ALVA 1CT2E 3ZZCA 1P3CA 3LGUA 1A5HA 3VPKA 2AGIX 1GL1A 4O3TA 5BPEA 3TLOA 3WW7A 3KEEA 3ZZDA 2G4TA 4R8TB 3QO6A 3T28A 4AFZA 1F0SA 3GCTF 2P8OC 1OP8A 3TK9A 4A1XA 3SO3A 1F0TA 4NIXA 3RXQA 3JZ1B 3KCGH 4X6OA 1W7GH 3GCTG 3ZZBA 2OBQA 2GX4A 1Y3XA 1ACBE 1GMDF 4I86A 4I8LA 1QRZA 5GWZA 1O3IA 4WXIA 3H5CB 2CV3A 4BXSA 4E06H 3DFJA 7KMEH 1G3BA 1Z6EA 3MO6A 3SV2H 2BVSH 5AHGH 3BIUH 1GBCA 2XBYA 2HNTE 3LGWA 2FI5E 4JMYA 4ABGA 3GYLB 5HMAA 3SU4A 1MKWH 1UCYE 1MU8B 1YC0A 5F8ZA 1H1BA 2AERH 3E1XB 3LH3A 3LJJA 1HJAC 4WJG2 1ZPCA 2G8TA 1GG6C 1SGEE 1W7XH 1FNIA 2SGAA 1C1QA 2P3FH 1XUHA 1HJ9A 2JH0D 4E7RG 1O3NA 3DSGA 1UTQA 1C4V2 1C1VH 1EOJA 2BM2A 2F9UA 3TU7H 5HXFA 2GDEH 1WTGH 2ZCLP 4FOUC 1A4WH 4Q7XA 1V2VT 4VGCC 1SGFA 2P94A 4HG6A 2FMJA 2GD4B 1AE5A 1SLVB 3W94A 1JWTA 3A8BA 4LK4A 2P95A 2FOEA 1FN8A 4BAOB 3TJNA 1ESTA 1CO7E 2DUCA 1C2JA 2YOLA 1FQ3A 2M5TA 3TJOA 3UWJH 3AK5A 1AE8H 1HJAB 4ISOA 4K1EA 2IN2A 3DD2H 3M35A 2OP9A 1O2TA 3N7DA 3L33A 1IQFA 1GL0E 1WQSA 3U98H 1QZ8A 4E05H 1H9HE 2QF0A 1BCUH 3E8LA 4CRCA 1P10A 3Q3YA 2PV9B 1BHXB 2OCVB 5DGJA 5FBIA 4XD7D 1YKTA 2GCTC 4ISHH 1UVSH 2L6OA 4DY7B 1YPHC 3V13A 1UK4A 2V6NA 2FODA 2W6ID 4RKOB 1Y3UA 3VB7A 1K1LA 1ARCA 1A46H 1LO6A 1TGBA 1CA0C 2FPZA 1B0EA 5GCHF 3LU9B 3R3GB 3UIRA 4B1TA 1AQ7A 1SC8U 4YTAA 1FY8E 2NU4E 1FMGA 4D7FA 1HAPH 1HRTH 3GCHC 4RN6A 1ELVA 1V2OT 1V2MT 1N1LA 2RG3A 4B6FA 5BRRE 3Q77A 1G37A 4JK6A 4CREA 3PM3A 2C3SA 3LC5A 1BA8B 3M7UA 3MU1A 3OTJE 4FETA 1FAXA 5ESBA 3SNCA 1IQKA 1SHHB 2BDCA 3S7KB 1OWIA 1OWHA 4U01A 2DE9A 4H6TA 4INKA 2C90B 1TGNA 3VGCC 1HAYB 3PV2A 2XC4A 4NSYA 4Y8YA 4B74A 5TCAA 3D62A 3F9EA 1AWHB 2KR7A 1K2I1 4ZKRU 3RXPA 1NS3A 3NCLA 1GBHA 4DVAU 3QX5H 1JIMA 1JRSA 3C1KA 5E0HA 1N6YA 1X7AC 1QHRB 2A2QH 3BG8A 3BTEE 3UTUH 5DSFA 1OP2A 2PSYA 2P3TB 1A0HB 4IW4E 4K69A 4NSVA 2FXRA 1VJAU 4A1TA 1KLIH 3BTWE 1JIRA 3JZ2B 1C1RA 3TIUA 1G32B 2GP9B 2EI8A 2C8WB 1JOUB 3DHKH 4JK5A 3O8RA 3ODFA 1OWDA 1P06A 1Q31A 2UUFB 2ILNA 5DK1A 4CR9A 1SLXB 5F8TA 3S0NA 1C1UH 3FFGA 1AIXH 1SQAA 2WPKS 5HKKD 2D1JA 3UOUA 1FONA 2BD7A 2BXTH 1O5FH 2Y7ZA 4AGKA 1NU9A 4DOQA 2QGRA 1RIWB 2KCOA 2XBVA 3M5NA 3QGNB 3RXLA 1THSH 1HXEH 1GI2A 1C5VA 1OWEA 4NG9H 5E0JA 4OS7A 3RXOA 2J9NA 1FY1A 1F2SE 1O2PA 3SNAA 2VU8E 2XNDD 1Y5UT 1E1QD 1EPTC 1PQ8A 5E2OA 1ZTKA 2HLCA 1MTNB 2A31A 2O8TA 1QL7A 1PYTC 1C2EA 1O2HA 2ZNKH 2K8IA 1GJDB 2J95A 1GBLA 1AKSB 1GJ8B 2NU0E 3EQ0H 1P03A 2ZCKP 3B23B 1GJ4H 1G2MA 2VIPA 1VITF 3GY7A 4NFFA 4Y79A 5K0HA 3M5OA 1O2UA 1AFEH 4UEHH 3URDA 3SHCH 3BSQA 2BYAX 4X6PA 1V2QT 1BJUA 3BV9B 3ATLA 3ZZ8A 1HYLA 1KYNA 3RXAA 3KIDU 1B5GH 5C1YA 1P2OA 4DURA 1O2MA 1QBOA 1TNJA 1DLEA 1BRUP 2HLDD 3EGKH 3QWCH 1UW7A 2WINI 1C5QA 4YT7H 1ID5H 2ZDKA 4CHAB 2BY7X 1N8OB 2O9QA 4TPYA 1T32A 5HM9A 2AEIH 1A0LA 1P0SH 4HI3A 3ZVGA 3MH5A 4Y10E 2XRCA 4ABEA 1NROH 2PKSB 1GG6B 3SV7A 2ANWA 1DUEA 2EY4C 1BJVA 2OTVA 1O3MA 5C2ZA 3FOAA 5A0AE 1FDPA 1A7SA 1BMLA 3SUDA 5J4SA 3ATWA 3KQEA 3F9FA 2FLBH 2KCPA 1DY9A 3MNSA 2ZFRH 3DFLA 3MU8A 1L4DA 4ABBA 1HLTH 1DPOA 4IBLH 3QZQA 4YOGA 3PYHA 1UTKA 3RLWH 2J38A 1QR3E 2C8ZB 1EATA 2H9HA 3HKJB 3A7ZA 2O8WA 3B9FH 3BTGE 1ELGA 3I77A 4WMEA 2K0QA 2A5IA 3GCOA 1KMHB 5FHTA 1WCZA 3Q3XA 1ZSLA 2OINA 4AB8A 1ZMJA 1NFXA 1XKAC 1A1RA 2WV4A 5T6DA 1EB1H 5C1UA 1GBFA 1GBIA 3SBKA 2Y5GA 4U2WA 3RXHA 1C5ZB 1OYTH 4THNH 4BAQB 4XFQA 2OQ5A 2PW8H 3KQDA 1TAWA 3HK3B 2AYWA 3E3TA 4XBDA 1C5WB 3T2NA 1LMWB 5KGOA 2BD9A 1S81A 7GCHF 2ZDAH 1ABJH 4IGDA 1UK3A 4NZQA 2BDGA 1O31A 2HRVA 1B7XB 1QGFA 3V3MA 2QF4A 5HGGA 3FZDA 1P9SA 2GCHG 5E8EH 1LHGH 2W6JD 1O3HA 4YM9A 3K2UA 1K1PA 2R3YA 1EZQA 2QY0B 1QY6A 4A7IB 5EIYA 3LGVA 2CN0H 4A5TS 1S0RA 4CBNA 3P95A 2FESH 4WF8A 1OXGA 3SJKA 3VB4A 2R2WU 3MFJA 5DP9A 2V35A 2B8OH 2AS9A 3M3TA 4Q2KA 4ZUHA 1MBQA 1QTFA 1W14U 5DP8A 1QIXB 4YT6H 2H2ZA 1L1JA 4I8KA 1F5KU 3PWBA 2PKAA 1GHWH 2AHME 1UHBA 1GI8B 2VWLA 4JZEH 1XXFA 1YBWA 2AIQA 1MKXK 2WPLS 2FOFA 1ZTJA 4JYUH 4X2VA 4MNXA 3U8OH 5GIBA 1C9PA 2F3CE 3ZZ9A 4XSKU 4AORA 2BZ6H 3OEHD 1KXEA 1GI6A 1DANH 2UWOA 1QJ7B 1CT0E 3P17H 4X2WA 4OS1A 2ZQ1A 4P02A 1AY6H 2XTTB 4MNYA 5EJ1A 1HPGA 2V0BA 3SNBA 1NO9H 2R0KA 1TRYA 2XXLA 1L2EA 1MAXA 3MHWU 2BQ6B 3GYMA 3A8AA 4GCHG 3TH4H 3PV4A 3M5MA 1O35A 2TGAA 1CA0B 1VZQH 2HVYB 2ZHFH 1AVWA 2FX4A 1MABB 1YYY1 3ESTA 2BD2A 1HAHH 3A7VA 1OSSA 4X1SU 1ETTH 3PLPA 2BTCE 1DITH 4B75A 1IQGA 2J92A 4UFGH 2XCFA 1P9UA 1BUIA 2BDAA 4MVNA 3ODDA 1RRKA 2BOKA 5DP7A 3SGBE 1CSOE 1H9LB 4DT4A 1WQVH 1O5EH 4NWLA 1RXPA 1ZRKA 3FZZA 3DA9B 3OU0A 3CP7A 3PO1C 1EAIA 2RA3A 1IQNA 5JPMH 3L6PA 1ZR0A 3CNRA 3TK6A 4BNRA 3EBNA 1LCYA 1W0JD 2L74A 3PB1E 4AFSA 2R2MB 5L30H 1L4ZA 1UVUH 1QB9A 2FOMB 3SYJA 2AMPA 1AI8H 1ZSJA 1C1PA 1WU1A 4U30A 1YCPM 1K1OA 2ZDMA 2F91A 1CQQA 3MNXA 3P8GA 1FV9A 1EP5A 1F5RA 2Z94A 1GHVH 1QCPA 1SGFG 1C2FA 1GGDB 2C8YB 3K65B 3SV8A 5GJ4B 2ZZUH 1AVXA 1V6DA 3SUEA 3SJ8A 2STAE 5KECA 4B2AA 1C1OA 5I25A 3QN7A 1RIWC 1O3DA 3H7TA 1MH0A 1KXDA 4X1RU 3SOSA 2GMTB 1C2KA 4LXBH 3GY6A 1HUTH 3LGIA 2Y82A 1NTPA 1SR5C 1EUFA 4GCHF 3SU3A 3UR6A 2FYRA 2PTCE 1PPGE 2ODQA 1MD8A 1QB6A 1O5GH 2J34A 3SJ9A 4K5ZA 1AKSA 1O2JA 1LHEH 2KZ4A 1B0FA 5J4QA 1WYKA 1AFQC 4IC6A 5GCHG 5C94A 4GHTA 3GISB 3MTYA 2F43B 5AF9H 5JYIA 1C2GA 2VWMA 3MU4A 4JCNA 1C5TA 5C17A 1BBRE 1D3DB 2F9VA 1FAKH 3MO3A 4FUIA 1G3DA 2CJIA 4I8HA 1W0KD 1P2QA 1THPB 4QT8C 1EX3A 2STBE 1BMFD 4WWYA 1EXFA 1WTHD 1BQYA 4AYYB 1EAXA 1TE0A 3TNTA 3P8OA 1NRRH 1O2OA 1P57B 1S5SA 4WH6A 2EEKA 3QDZB 1LKBA 1SVPA 2A7JA 1MCTA 3PMHB 1GBTA 4K8YA 3D23A 3ZVEA 1YLNA 1DWBH 2VWNA 4I32A 4JZDH 1TBQH 2C93B 3MU5A 3A84A 1DY8A 1SPJA 4CHAC 1D6WA 1FPHH 2F83A 4CRDA 8LPRA 3MYWA 3VB3A 1C5SA 2SNWA 4K60A 4NCYA 1SL3A 2PHBA 3S9AA 1BTWA 2BLWA 2IPHA 3UUZA 1GJCB 4NIYA 1WUNH 2QYIA 5GNDA 1O2QA 4YZUA 1GI4A 2CMYA 2THFB 3RXFA 3RC6A 3RU4E 2G51A 3BTME 3A8CA 2GVFA 2Z9KA 4XRNA 1O37A 3GY3A 4CRFA 3ZZ3A 2P93A 2XCNA 2H6MA 3T29A 4FUDA 1HXFH 1TPAE 1RS0A 1SGPE 2FX6A 4SGAE 3RC4A 2EA3A 1E1RD 4BAMB 3RM0H 5I46H 2W26A 3A80A 3N7OA 5T3HA 5EQRA 4ZXYH 4YLUA 1TWXB 4YXWD 2VNTA 1Y8TA 2CK3D 1YLDA 3KQ5A 4F49A 3SU0A 3K9XB 2CGAA 5DP6A 3ITIA 1FPCH 1GHAF 1SGRE 2J94A 4CRAA 2NU2E 2G4UA 2QXIA 4X6NA 1UTLM 2FP7B 1V3XA 5FAHA 3OYPA 1WDIA 1CGIE 1UCYK 1TMTH 1KXAA 5EPYA 2XNIA 3PMAB 4K8BA 3LGYA 1FY5A 6ESTA 4I33A 2D8WA 4B2BA 4D8NA 4K2YA 2O8UA 2WV5A 1TQ7B 3ATKA 3ZZ5A 5LGOA 1V2PT 3RLYH 5EJLA 4NIWA 3RXSA 4ZH8A 1F92A 2M2AA 2J97A 4GAWA 4Y76A 5EOKA 5AFYH 2VIOA 4ZCNA 1HIAB 1MU6B 2ZCHP 1C5UA 3SUFA 1C1MA 3V12A 4KTSA 5LPRA 1A5GH 5C0UA 2PKAB 1BIOA 1YM0A 2PGBB 3OAAD 2BXUH 2CHAB 3AAVA 4H4FA 4Q63A 2RDLA 1VCQA 3STIA 1RGQA 3BTKE 3G01A 3KQCA 1XVMA 2B0FA 1C1SA 3ZV8A 3HK6B 4ACAA 1O3CA 3UPEA 1MTUA 1ZYOA 5ESTE 1EKBB 2QC2A 3M36A 2ZA5A 1YCPH 3HGNA 1O5DH 1HAXB 5GPIB 4HZHA 1P2MA 5IDKA 1O2LA 1GPZA 1T8MA 1LKAA 4FUFA 4YOIA 2UUJB 1MMJN 1GMCF 5IYTA 2WPJS 1Z8IB 1C5RA 3B8JA 1EJNA 2IJOB 1WXRA 1Y3WA 4FUEA 1DOJA 1QB1A 1WOFA 1WV7H 9LPRA 4YO9A 1O30A 2ZFSA 5T6GA 2FI4E 3TVJB 1CU1A 4KKDA 3UFAA 2P8OB 4UDWH 1SOTA 1NRQH 2K1QA 4M9FA 5EU8A 3EE0B 2JKHA 3RMOH 1RTLA 2GCTB 2HPQH 1A3BH 2AIPA 1ZGVA 1BTHH 3EDXB 3RUOA 1K1NA 1UTMA 2ZPQA 2QN5T 5C20A 5HYOA 3A85A 4AFQA 1TYNA 5T1VA 2FIRH 1NFUA 4TYDA 3EAJA 1BDAA 1FY4A 2J5UA 1QQ4A 1IQEA 1OYQA 2VIVA 2XWAA 3O8DA 4Q80A 9ESTA 2UUYA 3CS7A 1BRBE 3KN2A 1DM4B 4X0WU 3TH2H 1H8DH 2GTBA 3SZNA 1QL8A 2ZDVH 5FX5A 4VGCB 1DWEH 3RXJA 5A8YA 4JZIA 1GVKB 1ANBA 3PMBB 1SQTA 4I7YH 1EASA 4J1YA 2KCYA 4JYTA 3RXMA 1O3AA 1SQOA 2PLXA 2ANYA 2G55A 3QUMP 1OWKA 2D26C 3T27A 3T5FH 1DXWA 7LPRA 1D3TB 3SI4H 1GGDC 1O33A 1TALA 1H8IH 2YMSD 1Z8RA 3GS9A 3F6UH 3PLKA 1NFWA 1O2GH 1SHYA 3LONA 1J9CH 3SNDA 2OXSA 1O3KA 2O8MA 3RXGA 1S84A 1ZHPA 5FPYA 2BLQA 1TLDA 2AMDA 1P2JA 2QAAA 1TGTA 1V2KT 1DXPA 1UK2A 2IPQX 1DICA 2ZU3A 3V7TA 3S9CA 1ZJDA 4Q7ZA 2FOAA 1A61H 2W7UA 3OY5U 1TX7A 1DE7H 2OC1A 4NGAH 4DCDA 1GI3A 3A86A 4FVDA 1INCA 2WUCA 1IAUA 3UQOA 1C1NA 4O3UA 2GZ9A 2QXHA 1YPLH 5TJXA 1XVOA 1UJ1A 4X1PU 3F0PA 2SFAA 3MU0A 5HIYA 2PKSC 1CHOG 5EODA 1CHGA 1UTJA 4PROA 4JZFH 1TNIA 5TCCA 1RJXB 3MNCA 1ANEA 3RXEA 4MNVA 2J4IA 3TK5A 1UTOA 1EB2A 3S9BA 2ZTYA 1IHSH 2R9PA 1PQ7A 4D7GA 3NPSA 1SSXA 4X8TH 2XYAA 3BN9A 3ZVDA 2R0LA 4KGAA 5A8ZA 3NUMA 1LQDB 2AFQB 2TBSA 1HAVA 2WV9A 1YF4A 5F53A 3VXFH 2GZ8A 4FUHA 4ISLA 2V3OH 1GBJA 1A3EH 1W10U 1TX8A 4GPGA 3RXDA 3RXTA 5IK2D 1NESE 1HAZB 2Z3DA 1PPFE 2XW9A 1SGYE 1ELTA 1PPBH 2ZDNA 1J17T 1SKYE 4Y8XA 3L3TA 1LDTT 3OTPA 4OGXA 1EZSC 4AYVB 3BG4B 1NM6A 1K9OE 2VIQA 2A32A 2PGQB 1EFRD 1QRXA 1KY9A 1NU7B 1NRPH 1GI7B 4TWWA 6CHAB 2NU1E 4ABFA 1XXDA 1TONA 3VB5A 1A0JA 1CBWB 3VXEH 1P2IA 4ZKOU 1O2WA 4BTUB 3LDXH 1O3EA 2JJ2D 4K1SA 3FO8D 1MTNC 1SI5H 1AB9C 2ESTE 4BAKB 3TPIZ 1E0FD 2ALPA 1G9IE 1SGQE 1LPZB 2FI3E 3K6YA 4FUBA 5DO4H 3RP2A 5A0CA 1HJ8A 1AO5A 4Y0ZE 1ELEE 2GDDA 1O2YA 1QRWA 1Y59T 1T4UH 2J2UA 3SU5A 1KTSB 3F0OA 3BTFE 1O5BB 1MKWK 4I8GA 1FN6A 1C4Y2 2ZPRA 2FEQH 4J2YB 2OLGA 2V7QD 3PTNA 3TGIE 5EXLA 3SHAH 2JDID 4Y6DA 4AZ2B 1D4PB 3A87A 2VINA 1SLUB 3F3BA 3GY4A 4YLQH 5EQSA 1NC6A 1T7CA 1VJ9U 1VR1H 5F8XA 4ABAA 2GZ7A 2ZI2H 2GGVB 3ZIAD 1TIOA 1PYTD 1HV7A 3NRLA 1AZZA 1SGCA 1H4WA 2R3UA 1YCPK 1NRSH 1XUJA 1GCDA 3MMGA 3MO9A 1RD3B 1W0YH 2I6SA 2UWPA 1MCVA 3VEQB 5L2ZH 1J14A 1FX0B 2OUAA 2A45B 4DIIH 2ZECA 1MZDA 1ABIH 1YPJH 1YLCA 1GMCG 2RA0A 2ZHEH 1C2LA 4CH8B 3GY8A 1HFDA 1JMOH 1MZAA 3TGKE 3TITA 1WAYB 1AWFH 8ESTE 3Q76A 1J16A 5A0BA 1K22H 2WPIS 4XBCA 2KCAA 1PPEE 1ZJKA 5L2YH 1P2KA 1C4U2 1F0RA 2WPMS 4RSPA 3OFND 3PROA 1FXYA 1DWDH 1G36A 2VWOA 5C5OA 3F68H 4ZROA 4INHA 2W7SA 2ULLA 2Z9LA 1MBMA 1GHBF 1ZOMA 4KTUA 1W0ZU 3UAIC 3FN8A 2ZHDA 2Y81A 3U69H 4ZHLU 6GCHG 2SGDE 1G3EA 1GBMA 3U8TH 5DP5A 1O5CB 1TMBH 1GCTC 1DT2A 4ESTE 2WHXA 4ZHMU 2WYGA 1S82A 4WXVA 3SW2B 4GSOA 1XMNB 1QQUA 3A7XA 4Y8ZA 1OP0A 1LHCH 2SGEE 1BHXF 5A09A 3HGPA 4X1QU 1TB6H 1Z71A 1BITA 2K7XA 2QF3A 3KYGA 3LH1A 5HIZA 3RDZA 1BMNH 4O9VA 1TX6A 1BTPA 1BRCE 4DIHH 1W12U 3EA8A 1GI0A 1THRH 2CHAC 2PUQH 1S6LA 1IQLA 5C1XA 3GDVA 5F6MA 1TNKA 1K0HA 3RXVA 4AB9A 4XBBA 4I8JA 4FXGH 1TOMH 3FP6E 4JYVH 4MQAA 1E35B 1E34B 4KP0A 3U28C 4IC5A 2BDIA 1GHAG 4BOHA 2G5VA 1J15A 2BZAA 1L1NA 3UR9A 1D3QB 3U9AH 4NA7A 3N7EA 3HPTB 1FIZA 1Z1IA 4WH8A 1VKYA 3T62A 3S7HB 2ZTZA 1K1JA 2GMTC 5JBAS 1ETRH 1V2ST 1SMFE 3E16B 1TNLA 3NKKA 4UFDH 5SGAE 1NN6A 1Y3VA 3O8BA 6CHAC 3NWUA 1SGIB 4NFEA 4K1TA 1O2RA 5DG6A 4IS5A 4ACBA 1C5MD 3E0NB 3AVZA 2EI6A 3RXCA 2PSXA 5JB9S 2FOHA 1O2ZA 3IWMA 3I78A 4FVBA 1C5XB 3SQEE 3C27B 3RU4D 1FIWA 1QL9A 2CF9H 3HKIB 3AW0A 2ZO3H 3SQHE 1GBAA 2VVCA 1EJMA 2XC5A 3DT0H 1QA7A 3GY5A 2AGGX 2VBCA 3RXBA 2AH4X 2FOBA 6GCHF 1ZHRA 1T8LA 5E2PA 1P09A 1XUKA 1S0QA 4DG4A 1LVBA 4MDSA 2VVVA 2A1DB 3SZEA 2HNTC 2BVXH 4MPXA 3RMMH 1GMDG 3U1IB 1F7ZA 3UOPA 2YMSB 2BDYA 2PP6A 3QTVH 2RDEA 3N99A 2A7CA 2PUXB 4I31A 4CBOA 1EOLA 2QCYA 4ZXXH 1V2UT 1KXFA 5DP4A 1XUIA 4MPUA 2Z9JA 1GBDA 4AX9H 1K28D 4P00A 3FANA 1TOCB 3PRDA 1UO6A 1ZMLA 1UTPA 5H4IB 4RT1A 1NRNH 1GDQA 5FCRA 1GJ5H 4AFUA 2VIWA 3A83A 3GDSA 3QK1A 1A2CH 1YPHE 2GCHF 1QA0A 2FWWA 1GJBB 1T8NA 1ESBA 1V2NT 2QF5A 3MWIU 3KQBA 1GJ7B 2O8LA 1GDNA 3ZZAA 3TNSA 5AFZH 5KEDA 4TSFD 4H42U 1CGJE 1TNHA 3OE7D 2EI7A 2JH5D 2YMSC 1GVZA 2ZFQH 2ZHQH 3A81A 1TNGA 2FOCA 3F2GA 5A8XA 1AMHA 1SGDE 1BBRK 3ZV9A 2SGQE 3AAUA 4XDEA 2TPIZ 3LJOA 2ZKSA 4TWYA 3KGPA 1JRTA 3MOCA 1YY3A 3RXIA 1DVAH 1ZPBA 5EXNA 2OQUA 2A4QA 1BTXA 2BY5X 1N6XA 1YWUA 1W13U 1PFXC 1LVYA 1Z8GA 1LHFH 1COWD 1UTNA 1C1WH 1CT4E 1YPKH 2ZPSA 3ENSB 3F1SB 2TGTA 2Y5HA 3Q00A 5C3NA 4NA9H 2I6QA 3KNXA 1AFQB 2C4FH 4UD9H 3LGTA 1SQRA 1Y5AT 1O3BA 3M3SA 1WSSH 5PTPA 1V2TT 1XUGA 1M9UA 3P70B 2QXGA 3EE7A 3SI3H 1EJAA 2ZGJA 5FX6A 4AGJA 8GCHF 1TA6A 3IITA 1CHOF 1G2LA 3MNBA 1LPGB 4ABDA 2HPPH 1QURH
chains in the Genus database with same CATH topology
4UFEH 1SG8B 1FLEE 3M7TA 3PWCA 1ESAA 5GXPA 1UVTH 1ETSH 4X6MA 2BLOA 3MH7A 4DW2U 3ZZ4A 1TGCA 1DDJA 2FM2A 3GDUA 4M7GA 1SGTA 1D9IA 2BD8A 2Z7FE 2TRMA 3P92A 3UY9A 1RTKA 1ZZZA 2HWLB 3W95A 3MH6A 2LIZA 4X1NU 2CF8H 4MPVA 1G3CA 4NZLA 5DPAA 4ZAEA 1PPCE 2VB0A 4X8SH 1MQ5A 3BEUA 1FUJA 3D65E 4CRGA 7GCHG 1GJ6A 5EW2H 1D6RA 2Y7XA 4HGCA 1FI8A 2BDBA 1HAVB 2ZFPH 3M3VA 5CHAC 3T26A 1P3EA 2Z3CA 3SJOA 3RXKA 5JB8S 3ZYEA 4MLFB 3GCHB 2WUBA 1YGCH 2ZF0H 4H6SB 1VCWA 1PPHE 1LPKB 1GBKA 3FAOA 1S85A 3LT3A 3A89A 3GOVB 1TFXA 2SNVA 2Q6FA 2YNAA 2W3KA 2B9LA 2QV1A 1TRNA 4MNWA 5F03A 5JBBS 1LVMA 3EYDA 1LTOA 1TGSZ 4TPIZ 2ANKH 3QTOH 2BD4A 2VGCC 4Z6AH 3ATIA 3I29A 2A5AA 4HFPB 2F9PA 3HATH 2ZP0H 1KLJH 5L6NH 1MAYA 1DWCH 1GBEA 2F9BH 1KSNA 3PLBA 2FLRH 3FP7E 1GHYH 1KDQA 2PR3A 1CE5A 1EZXC 5T6FA 2TIOA 1YPGH 1O2KA 3AW1A 1MKXH 2OBOA 5EG4A 4BTIB 1DX5M 1NY22 1YP9A 3LIWA 4MPWA 3CS0A 2ZGXH 3M7QA 1W8BH 1MTSA 3RMNH 1EPTA 1ORFA 1OS8A 5DKMA 1OPHB 4AOQA 4GUXA 1S83A 3KL6A 4OGYA 3PTBA 2ZU2A 1IHTH 4FU9A 4FUJA 2BMGB 3ZZ6A 5FPTA 1RTFB 4BXWA 2Z3EA 3FP8E 1O3OA 3NXPA 3RXUA 4O97A 3V0XA 1BOQA 1GJ9B 2HVXA 2FDAA 5ETXA 1IQHA 1O5AB 4U32A 1O0DH 4Y71A 1VITH 1TABE 1ZTLA 1AUTC 2VJ1A 3MI4A 1K1IA 2FS8A 5CE1A 3ZYDA 2H5DA 1FJSA 5ABWA 1G30B 1BT7A 3RC5A 2VVUA 2ZU1A 4X8UH 4O03A 3KHVA 2ZGCA 4AN7A 2QIQA 3U1JB 5EPNA 4B73A 5EXMA 3S69A 3NZIA 1DS2E 1O2NA 3UREA 1RFNA 5EW1H 2H1UA 3VFEA 2BDHA 3BF6H 3RMLH 3TJVA 2TGPZ 2Z9IA 4OS2A 4MG3A 5C67A 1CVWH 4FUCA 1NZQH 2D2DA 3A7TA 3VGCB 4F4OC 3P8FA 1EAWA 2G52A 4SGBE 4X8VH 3E6PH 3D49H 4E7NA 1C5OH 1ZSKA 1BMMH 1UMAH 4HTCH 3ZVBA 1GDUA 1W3CA 1PQAA 2BHGA 4ABJA 2BY6X 1C5PA 1ELFA 5B6OA 1IQMA 2WPHS 5E0GA 2AMQA 1DUAA 4DJZB 7ESTE 4D9QA 1XM1A 1TMUH 3OX7U 8KME2 4KELA 3R0FA 4BTTB 2IOTA 4LZ1H 1O3GA 1BTUA 3QLPH 1P8VC 3ZVAA 1Z7KA 1D3PB 1O2SA 5EGMA 5K7RA 1ELAA 1ARBA 2W3IA 4IN2A 1SOZA 1PQ5A 3LPRA 2ZIQH 4KTCA 1L1GA 2VIDA 1GI5A 2C8XB 4K3JA 1XKBC 1GMHG 2WYJA 3M61U 3LKWA 4OS5A 3EA9A 3SU6A 3STJA 2A2XH 1BB0B 4UE7H 2YNBA 1OKXA 3F9GA 4ASHA 2ZQ2A 2QA9E 4WMDA 1TBRH 2BX4A 2Y80A 1FZZA 1O2VA 1VGCC 1XUFA 1W2KH 1A5IA 4A6LA 2B7DH 1NFYA 1Q2WA 4OS4A 3VB6A 2GV7A 2VGCB 1JBUH 4NA8A 2ZTXA 2A4GA 1Q3XA 8GCHG 3BTDE 4GHQA 4Y7AA 3RXRA 2BD3A 4INLA 4LZ4B 2FTMA 2Y5FA 4TY7A 3SU1A 3DUXH 1P12E 4XOJA 2OC0A 1QJ1B 1QJ6B 3TH3H 2ANMH 4NWKA 4DGJA 2JH6D 1MQ6A 1FY3A 1T4VH 1KTTB 1HIAA 3PO1B 2JETB 3SNEA 3E91A 1BTZA 2BY8X 2ODPA 2CXVA 1AU8A 3SGQE 1V2WT 1GHBG 1GHZA 2GV6A 5JBCS 1E36B 3UNRA 1C1TA 1UVOA 2W5EA 2FO9A 1AZ8A 3URCA 1C2DA 1O34A 4ISNA 3Q3KA 3P8NA 3E90B 4WMFA 1WBGB 2G81E 2HGTH 4TY6A 2HALA 1IQJA 2G5NA 2ZGHA 4B76A 3GY2A 1N8OC 2SGFE 1GMHF 5A2MH 1HAGE 3NK8A 4B71A 5FPSA 4X2XA 3TGJE 4XE4A 1TPSA 2ZGBH 4ZMAH 2BLVA 2FS9A 2ZHWH 2BX3A 2QXJA 2H9TH 5CHAB 1Y5BT 1O2IA 1F0UA 1C2HA 1ZRBA 4YESB 3A7WA 1V2JT 3M37A 2LPRA 1UVPA 1YPMH 2F9OA 1MD7A 1AHTH 1HNEE 1ANDA 1MUEB 3M5LA 1ELDE 4DT7B 1C9TA 4IN1A 1ZLRA 2ZEBA 1PPZA 1LQEA 1BRAA 3TJUA 3SU2A 1JXPA 5LPEA 5FBEA 3FVFB 1S6FA 2BQ7B 2ZG0H 4D76A 1KDQB 1C2MA 3KF2A 2Z9GA 5CMXH 1GVLA 4IMQA 4GLYA 3P6ZB 1OX1A 3GCNA 1PJPA 2HNTF 2AGEX 1EAUA 3E0PB 5EQQA 1TPOA 4AG2A 4ABIA 3BTHE 2A5KA 1BBRH 5AVDA 4WVPE 1GI9B 2FOGA 3BTTE 1GJAB 4IMZA 1E37B 1O3PB 4ABHA 1QFKH 3O8CA 4CH2B 3WY8A 2BY9X 4UFFH 1AD8H 2A4RA 4RKJB 2FTLE 2FYQA 2XC0A 1O3JA 2ZDLA 1H9IE 3ATMA 1DSTA 3A82A 1OOKB 2FZZA 3ZVFA 1QBNA 2GKVE 3UNSA 3QGJA 3QZRA 1O39A 4Y7BA 3BG4C 2V3HH 2ZC9H 3UQVA 3SORA 1C5LH 1SGNE 4ISIH 3PMJA 4BAHB 1NPMA 1TA2A 4CRBA 5LH8A 2OD3B 2XBWA 3EA7A 4FU7A 1NT1A 5G4BA 3F9HA 3LOXA 1AN1E 2EC9H 1S6HA 3SUGA 3BEIB 4UONA 2BOHB 4Z0KA 2A7HA 2HOBA 1V2LT 1P01A 2BQWB 3ZZ7A 2XBXA 1BTYA 4Y11E 4YOJA 1IQIA 1OWJA 2Y6TA 3BTQE 2ASUB 1CA8B 4A1VA 5DP3A 1SFIA 1XX9A 3AASA 2PTNA 1UCYH 2Q6GA 1P05A 1Y3YA 2DE8A 2TGDA 1DSUA 1Z8JB 1J8AA 1O3FA 2NWNA 1DFPA 1T8OA 1O3LA 1TBZH 2GT7A 5C5NA 2VH0A 4LOYH 2P3UB 2G00A 1AUJA 1C5YB 1KLTA 3OSYA 3SV9A 3T25A 3CENA 3BIVH 1ZGIA 1GWAA 6LPRA 2SGPE 4AG1A 1GCTB 1EQ9A 2Q1JA 3A7YA 4WY3A 1V2RT 1LVOA 2PWXA 2UUKB 5DJ7A 2OC8A 1KIGH 1Z6JH 1KXBA 3RU4T 2Q6DA 1YPEH 3K6ZA 3SN8A 1L0ZA 4CR5A 1EZUC 1ZHMA 5HM2A 4A92A 2OC7A 1ELBA 1LHDH 1P2NA 3UNQA 2P59A 4BANB 5LPFA 1QNJA 5FCKA 4X2YA 1U6QA 3SJIA 3H7OA 3ZVCA 1TPPA 4D9RA 1ANCA 4R0IA 1HB0B 1E38B 1K21H 1O32A 1MTWA 1KXCA 1EPTB 1ZPZA 4JZ1A 1C2IA 2JETC 3A88A 1BMAA 2H9EH 2XWBI 1K1MA 2ZWLH 4ZKSU 3UWIA 3RM2H 5GDSH 1HBTH 2RCEA 1HAIH 1P04A 1HCGA 2ZU5A 2P16A 1AGJA 3BEFB 1CBWC 4Y0YE 2BD5A 4Q7YA 1BZXE 2KAIB 4FUGA 2B5TB 5FXLA 1AB9B 1F5LA 3U8RH 5JDUB 2KAIA 2ZFFH 3SGAE 2Z6BD 1HDTH 2NU3E 1Z1JA 2H5CA 3A8DA 3OY6U 2UWLA 1HAOH 1GHXH 4ZKNU 4GVUA 1T31A 2ODYB 1DLKB 1EP6A 1SLWB 1QBVH 1ELCA 3GICB 1VITG 3MH4A 1VCPA 4MTBA 4B2CA 2A4OA 1MTVA 1SBWA 3LC3A 1SFQB 1GI1A 2ZFTA 3ELAH 1IOEA 1O36A 3IG6B 4ZHAA 1P11E 2A0QB 1UHBB 1SB1H 1TRMA 1CGHA 1C5NH 4NIVA 1P02A 1AVGH 1GBBA 1TQ0B 2VH6A 4OS6A 1O2XA 2LNCA 2BVRH 3SV6A 2PFEA 1VGCB 1W11U 5JBTA 1ZMNA 2BB4A 2GT8A 1O38A 2ZU4A 2F9NA 4FU8A 1HGTH 2ALVA 1CT2E 3ZZCA 1P3CA 3LGUA 1A5HA 3VPKA 2AGIX 1GL1A 4O3TA 5BPEA 3TLOA 3KEEA 3ZZDA 2G4TA 4R8TB 3QO6A 3T28A 4AFZA 1F0SA 3GCTF 2P8OC 1OP8A 3TK9A 4A1XA 3SO3A 1F0TA 4NIXA 3RXQA 3JZ1B 3KCGH 4X6OA 1W7GH 3GCTG 3ZZBA 2OBQA 2GX4A 1Y3XA 1ACBE 1GMDF 4I8LA 1QRZA 5GWZA 1O3IA 4WXIA 3H5CB 2CV3A 4BXSA 4E06H 3DFJA 7KMEH 1G3BA 1Z6EA 3MO6A 3SV2H 2BVSH 5AHGH 3BIUH 1GBCA 2XBYA 2HNTE 3LGWA 2FI5E 4JMYA 4ABGA 3GYLB 5HMAA 3SU4A 1MKWH 1UCYE 1MU8B 1YC0A 5F8ZA 1H1BA 2AERH 3E1XB 3LH3A 3LJJA 1HJAC 4WJG2 1ZPCA 2G8TA 1GG6C 1SGEE 1W7XH 1FNIA 2SGAA 1C1QA 2P3FH 1XUHA 1HJ9A 2JH0D 4E7RG 1O3NA 1UTQA 1C4V2 1C1VH 1EOJA 2BM2A 2F9UA 3TU7H 5HXFA 2GDEH 1WTGH 2ZCLP 1A4WH 4Q7XA 1V2VT 4VGCC 1SGFA 2P94A 2FMJA 2GD4B 1AE5A 1SLVB 3W94A 1JWTA 3A8BA 4LK4A 2P95A 2FOEA 1FN8A 4BAOB 3TJNA 1ESTA 1CO7E 2DUCA 1C2JA 2YOLA 1FQ3A 2M5TA 3TJOA 3UWJH 1AE8H 1HJAB 4ISOA 4K1EA 2IN2A 3DD2H 3M35A 2OP9A 1O2TA 3L33A 1IQFA 1GL0E 1WQSA 3U98H 4E05H 1H9HE 2QF0A 1BCUH 3E8LA 4CRCA 1P10A 3Q3YA 2PV9B 1BHXB 2OCVB 5DGJA 5FBIA 1YKTA 2GCTC 4ISHH 1UVSH 4DY7B 1YPHC 3V13A 1UK4A 2V6NA 2FODA 4RKOB 1Y3UA 3VB7A 1K1LA 1ARCA 1A46H 1LO6A 1TGBA 1CA0C 2FPZA 1B0EA 5GCHF 3LU9B 3R3GB 3UIRA 4B1TA 1AQ7A 1SC8U 4YTAA 1FY8E 2NU4E 1FMGA 4D7FA 1HAPH 1HRTH 3GCHC 4RN6A 1ELVA 1V2OT 1V2MT 1N1LA 2RG3A 5BRRE 3Q77A 1G37A 4JK6A 4CREA 3PM3A 2C3SA 3LC5A 1BA8B 3M7UA 3MU1A 3OTJE 1FAXA 5ESBA 3SNCA 1IQKA 1SHHB 2BDCA 3S7KB 1OWIA 1OWHA 4U01A 2DE9A 4H6TA 4INKA 2C90B 1TGNA 3VGCC 1HAYB 4B74A 2XC4A 4NSYA 4Y8YA 5TCAA 3D62A 3F9EA 1AWHB 1K2I1 4ZKRU 3RXPA 1NS3A 3NCLA 1GBHA 4DVAU 3QX5H 1JIMA 1JRSA 3C1KA 5E0HA 1N6YA 1X7AC 1QHRB 2A2QH 3BG8A 3BTEE 3UTUH 1OP2A 2PSYA 2P3TB 1A0HB 4IW4E 4K69A 4NSVA 2FXRA 1VJAU 4A1TA 1KLIH 3BTWE 1JIRA 3JZ2B 1C1RA 3TIUA 1G32B 2GP9B 2EI8A 2C8WB 1JOUB 3DHKH 4JK5A 3O8RA 3ODFA 1OWDA 1P06A 1Q31A 2UUFB 2ILNA 5DK1A 4CR9A 1SLXB 5F8TA 3S0NA 1C1UH 3FFGA 1AIXH 1SQAA 2WPKS 2D1JA 3UOUA 1FONA 2BD7A 2BXTH 1O5FH 2Y7ZA 4AGKA 1NU9A 4DOQA 2QGRA 1RIWB 2XBVA 3M5NA 3QGNB 3RXLA 1THSH 1HXEH 1GI2A 1C5VA 1OWEA 4NG9H 5E0JA 4OS7A 3RXOA 2J9NA 1FY1A 1F2SE 1O2PA 3SNAA 2VU8E 1Y5UT 5E2OA 1EPTC 1PQ8A 1ZTKA 2HLCA 1MTNB 2A31A 2O8TA 1QL7A 1PYTC 1C2EA 1O2HA 2ZNKH 1GJDB 2J95A 1GBLA 1AKSB 1GJ8B 2NU0E 3EQ0H 1P03A 2ZCKP 3B23B 1GJ4H 1G2MA 2VIPA 1VITF 3GY7A 4NFFA 4Y79A 5K0HA 3M5OA 1O2UA 1AFEH 4UEHH 3URDA 3SHCH 3BSQA 2BYAX 4X6PA 1V2QT 1BJUA 3BV9B 3ATLA 3ZZ8A 1HYLA 1KYNA 3RXAA 3KIDU 1B5GH 5C1YA 1P2OA 4DURA 1O2MA 1QBOA 1TNJA 1DLEA 1BRUP 3EGKH 3QWCH 2WINI 1C5QA 4YT7H 1ID5H 2ZDKA 4CHAB 2BY7X 1N8OB 2O9QA 4TPYA 1T32A 5HM9A 2AEIH 1A0LA 1P0SH 4HI3A 3ZVGA 3MH5A 4Y10E 2XRCA 4ABEA 1NROH 2PKSB 1GG6B 3SV7A 2ANWA 1DUEA 1BJVA 2OTVA 1O3MA 5C2ZA 5A0AE 1FDPA 1A7SA 1BMLA 3SUDA 5J4SA 3ATWA 3KQEA 3F9FA 2FLBH 1DY9A 3MNSA 2ZFRH 3DFLA 3MU8A 1L4DA 4ABBA 1HLTH 1DPOA 4IBLH 3QZQA 4YOGA 3PYHA 1UTKA 3RLWH 2J38A 1QR3E 2C8ZB 1EATA 2H9HA 3HKJB 3A7ZA 2O8WA 3B9FH 3BTGE 1ELGA 3I77A 4WMEA 3GCOA 2A5IA 5FHTA 1WCZA 3Q3XA 1ZSLA 2OINA 4AB8A 1ZMJA 1NFXA 1XKAC 1A1RA 2WV4A 5T6DA