3EB1A

Crystal structure ptp1b complex with small molecule inhibitor lzp-25
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
283
Chain Sequence
EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting inactive enzyme conformation: aryl diketoacid derivatives as a new class of PTP1B inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 1
total genus 89
structure length 283
sequence length 283
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3eb1A00
1U26A 4ZI4A 5KADA 2I6JA 2I75A 4B04A 3D1QA 3O4TA 1OEVA 3BRHA 1QXKA 3I80A 3ZM1A 1OEMX 4GE2A 2CNIA 2H04A 2NV5A 1KAVA 1G1GA 1Q6MA 1I57A 2FH7A 2VEVA 4HJQA 2H4VA 4JMKA 1R6HA 3MMJA 5KA8A 4IKCA 4I8NA 5KA4A 4R0SA 1NNYA 4GRZA 1G1HA 1PTVA 2I42A 1GWZA 2F6VA 4QAPA 4QBWA 1L8GA 4JMJA 4ERCA 2Y2FA 1MKPA 1RPMA 2CM2A 2A8BA 2PSZA 2QDPA 2BGEA 5KA9A 3OLRA 1YTWA 5KA3A 1M3GA 1NL9A 1OHEA 3CWEA 3V0GA 2H4GA 2GWOA 2QEPA 3V0IA 1Q6JA 3S4OA 4QUMA 2CFVA 1Q6NA 4NWFA 2C7SA 1EENA 1YGUA 2GP0A 1OETA 2RF6A 4J51A 2I5XA 1I9SA 4Y2EA 3MOZA 2HNQA 1GFYA 1T49A 2PT0A 1YPTA 1LQFA 1YWFA 2HVLA 3S4EA 3QCIA 3BM8A 3S3FA 4NNDA 1XM2A 1OHCA 3OMHA 3PS5A 5KA7A 3O5XA 2F6TA 3EZZA 4HRFA 3M4UA 4RI4A 5IBMA 3F9AA 5BZZA 4D3PA 5BX1A 2VEUA 4GE6A 2G6ZA 5KACA 4KYRA 4BJOA 2GJTA 1ZC0A 1ONYA 3QKPA 5KAAA 1V3AA 3NMEA 1D5RA 2PA5A 2B4SA 1G7FA 1WRMA 3SMEA 3QCMA 5AWXA 2J16A 2Q05A 2A3KA 4RDDA 1YGRA 2HNPA 2PQ5A 2B4OA 1BZCA 1ZCLA 5EHRA 3S3KA 1ZCKA 2G59A 2NT7A 2B4UA 3V0EA 2QDCA 5K22A 3QCHA 1YTNA 2OZ5A 1ECVA 5K9WA 4HJPA 2PI7A 3O4SA 4OHLA 4MBBA 4RH5A 1XRIA 4GS0A 1T4JA 2J17A 4PVGA 1NO6A 1Q1MA 2CJZA 2I4GA 4WU2A 3QCCA 1JF7A 3F99A 3MOWA 1G7GA 2BGDA 2IMGA 4GFVA 4NX8A 2I4EA 2VEXA 1WCHA 2QBQA 1LYVA 3U96A 3EU0A 2WGPA 2B07A 1G4US 3EAXA 4R30A 3BLUA 3AWFA 3S3EA 1C84A 1G4WR 4ZN5A 2P4DA 2ZMMA 4ZRTA 1EEOA 5IBSA 1L8KA 5GTJA 4OHHA 3RZ2A 1OEUA 1C86A 3CM3A 3D1HA 3GXHA 4ICZA 5I6VA 3QCKA 1YTSA 4JNBA 1FQ1A 2FJMA 4OHIA 4RH9A 2AHSA 2E0TA 2QCJA 2I6PA 1X24A 4WU3A 2ESBA 1PXHA 1WAXA 4QAHA 2H4KA 4RKKA 4D3QA 2P6XA 2OUDA 3H2XA 5KA2A 4GWFA 1OEOX 4D3RA 2HC2A 3I36A 2C46A 2CNEA 2CM8A 1U25A 5K23A 2F70A 2CNFA 3QCJA 2I6OA 2OOQA 2HCMA 1C83A 2FJNA 2F6YA 5K9VA 1XXVA 5LXQB 2I3UA 1BZHA 4NYHA 4GRYA 2CNGA 2B3OA 4BPCA 1FPRA 3BLTA 3S3HA 3SR9A 2CMCA 3ZV2A 2BZLA 1SUGA 2J16B 5K25A 1P15A 1QZ0A 1PA9A 3D9CA 2B49A 4RI5A 2AZRA 1YN9A 3EB1A 3D42A 2BV5A 4YAAA 4OHDA 4H34A 2BIJA 3GXGA 3D1OA 1C85A 2I6IA 1PTYA 1U24A 1FPZA 1YZ4A 3QKQA 4TVVA 1KAKA 2CMAA 2QBRA 1C88A 1AAXA 3QCEA 4S0GA 1PTUA 3N0AA 3QCLA 3A5JA 5KA0A 2HY3A 2CNHA 4DGXA 2QBSA 3ZMPA 1A5YA 2B4PA 4Y14A 3V0FA 2PBNA 4KI9A 5HDEA 1J4XA 5BZXA 4H1OA 1LARA 1C87A 2NT2A 2CM7A 4R0TA 2VEWA 3AWGA 3B7OA 3O3LA 1NWEA 1BZJA 5BUGA 5KABA 1Q6SA 5K24A 1YFOA 2NTAA 1PA1A 4OHEA 3ZMQA 3EMUA 2JJDA 1I9TA 2NLKA 2I1YA 3F81A 2H02A 2QDMA 3I7ZA 1ONZA 3V0HA 4NWGA 1Q6TA 4YR8B 2H03A 2I4HA 3ZM0A 4WOHA 4QUNA 1NZ7A 2YDUA 5EHPA 3RGOA 2F6FA 2CMBA 3F41A 4QBEA 4DGPA 1Q6PA 3O4UA 1OHDA 2ZN7A 1RXDA 4Z6BA 5KA1A 2MBCA 3V0JA 1G1FA 1ZZWA 2I6MA 3AWEA 5M43A 1VHRA 3QCNA 3V0DA 2F6ZA 2SHPA 2NZ6A 4GE5A 5MMZB 3LJ8A 1OESA 2R0BA 2F71A 2VEYA 3A5KA 2F6WA 2Q47A 3ZM3A 2CM3A 4RHGA 2DXPA 2M3VA 4WTYA 2QCTA 1PTTA 3ZM2A 2HC1A 2HB1A 4PYHA 3RGQA 4GFUA 3QCFA 1XBOA 2I3RA 1NWLA 3QCBA 5J8RA 1JLNA 3QCDA 2F46A 2QBPA 4JBCA 4KYQA 2Y96A 3D44A 1XXPA 3QCGA 4AZ1A 1T48A 3F9BA 3RO1A 2HXPA 1PYNA 2OC3A 1PH0A
chains in the Genus database with same CATH superfamily
1U26A 4ZI4A 5KADA 2I6JA 2I75A 4B04A 3D1QA 3O4TA 1OEVA 3BRHA 1QXKA 3I80A 2GC5A 3ZM1A 1OEMX 4GE2A 2CNIA 3HN7A 1O5ZA 2AM1A 2H04A 2NV5A 1KAVA 1G1GA 1Q6MA 1I57A 2FH7A 2VEVA 4HJQA 2H4VA 4JMKA 1R6HA 3MMJA 5KA8A 4IKCA 2VORA 4I8NA 5KA4A 4R0SA 1NNYA 2Y66A 4GRZA 1G1HA 1PTVA 4QDIA 2I42A 1GWZA 4C13A 2F6VA 4QAPA 4QBWA 1L8GA 4JMJA 4ERCA 2WTZA 2Y2FA 1MKPA 1RPMA 2CM2A 2A8BA 2PSZA 2QDPA 2BGEA 5KA9A 3OLRA 1YTWA 5KA3A 1M3GA 1NL9A 1OHEA 3CWEA 3V0GA 4CVMA 2H4GA 2GWOA 2QEPA 2XJAA 3V0IA 1Q6JA 3S4OA 4QUMA 2CFVA 1Q6NA 4NWFA 2C7SA 1EENA 1YGUA 2GP0A 1OETA 2RF6A 4J51A 2I5XA 1I9SA 2X5OA 4Y2EA 3MOZA 2HNQA 1GFYA 1T49A 2PT0A 1YPTA 1LQFA 1YWFA 2HVLA 3S4EA 3QCIA 3BM8A 3S3FA 2JFGA 4NNDA 1XM2A 1OHCA 3OMHA 3PS5A 5KA7A 3O5XA 2F6TA 3EZZA 1GQQA 3M4UA 1J6UA 2AM2A 4HRFA 4RI4A 5IBMA 3F9AA 5BZZA 3QCZA 4D3PA 5BX1A 2VEUA 2UUPA 4GE6A 2G6ZA 5KACA 4KYRA 4BJOA 2GJTA 1ZC0A 1ONYA 3QKPA 5KAAA 1V3AA 3NMEA 1D5RA 2PA5A 2B4SA 1G7FA 1WRMA 3SMEA 3MVNA 3QCMA 5AWXA 2J16A 2Q05A 2A3KA 4RDDA 1YGRA 2HNPA 5A5FA 2PQ5A 2B4OA 1BZCA 1ZCLA 5EHRA 2F00A 3S3KA 1ZCKA 2G59A 2NT7A 1W78A 2B4UA 3V0EA 2QDCA 5K22A 3QCHA 3PYZA 1YTNA 2OZ5A 1ECVA 5K9WA 4HJPA 2PI7A 3O4SA 4OHLA 4MBBA 4RH5A 1XRIA 4GS0A 1T4JA 2JFFA 1GQYA 2J17A 4PVGA 1NO6A 2UUOA 1Q1MA 2CJZA 2I4GA 4WU2A 3QCCA 2GC6A 2UAGA 1EEHA 4BUBA 1JF7A 3F99A 3MOWA 1G7GA 2BGDA 2IMGA 4GFVA 4NX8A 2I4EA 2VEXA 1WCHA 2VOSA 2QBQA 1LYVA 3U96A 3EU0A 3UAGA 2Y67A 2WGPA 2B07A 1G4US 3EAXA 4R30A 3BLUA 3AWFA 3S3EA 1C84A 1G4WR 4ZN5A 2P4DA 2ZMMA 4ZRTA 1EEOA 5IBSA 1L8KA 5GTJA 4OHHA 3RZ2A 2Y68A 1OEUA 2XPCA 1C86A 3CM3A 3D1HA 3GXHA 4ICZA 2VTDA 5I6VA 3QCKA 1YTSA 4JNBA 1FQ1A 2FJMA 4OHIA 4RH9A 2AHSA 2E0TA 2QCJA 2I6PA 4C12A 1X24A 3N2AA 4WU3A 1GG4A 1PXHA 1WAXA 2ESBA 2H4KA 4QAHA 4RKKA 4D3QA 2Y1OA 2P6XA 2OUDA 3H2XA 5KA2A 4GWFA 1OEOX 4D3RA 2HC2A 3I36A 2C46A 3ZM6A 2CNEA 4UAGA 2CM8A 1U25A 5K23A 2F70A 1UAGA 2CNFA 3QCJA 2I6OA 2OOQA 2HCMA 1C83A 2FJNA 2F6YA 5K9VA 1XXVA 5LXQB 2I3UA 4BUCA 1BZHA 1E8CA 4NYHA 4GRYA 2CNGA 2B3OA 4BPCA 1FPRA 3BLTA 3S3HA 3SR9A 2CMCA 3ZV2A 2BZLA 1SUGA 2J16B 5K25A 1P15A 1QZ0A 2GCBA 1PA9A 3D9CA 2B49A 4RI5A 4CVLA 4CVKA 2AZRA 1YN9A 3EB1A 2JFHA 2BV5A 3D42A 4OHDA 4YAAA 4H34A 2BIJA 3GXGA 1FGSA 3D1OA 1C85A 2I6IA 1P31A 1PTYA 1U24A 1FPZA 1YZ4A 3QKQA 4TVVA 1KAKA 1JBWA 2CMAA 2QBRA 1C88A 1AAXA 3QCEA 4S0GA 4HV4A 1PTUA 3N0AA 3QCLA 3A5JA 5KA0A 1P3DA 2HY3A 2CNHA 4DGXA 4QF5A 2QBSA 3ZMPA 1A5YA 2B4PA 4Y14A 3V0FA 2PBNA 3NRSA 3ZL8A 4KI9A 5HDEA 1J4XA 5BZXA 4H1OA 1LARA 1C87A 2NT2A 2CM7A 4R0TA 2VEWA 3AWGA 3B7OA 1JBVA 3O3LA 1NWEA 1BZJA 5BUGA 5KABA 1Q6SA 5K24A 1YFOA 2NTAA 1PA1A 1W7KA 4OHEA 3ZMQA 3EMUA 2JJDA 1E0DA 1I9TA 2NLKA 2I1YA 3F81A 2H02A 2QDMA 3I7ZA 1ONZA 3V0HA 4NWGA 1Q6TA 4YR8B 2H03A 2I4HA 3ZM0A 4WOHA 4QUNA 1NZ7A 2YDUA 5EHPA 3RGOA 2F6FA 4ZIYA 2CMBA 3F41A 4QBEA 4DGPA 1Q6PA 3O4UA 1OHDA 2ZN7A 1RXDA 4Z6BA 5KA1A 3LK7A 2MBCA 3V0JA 1G1FA 1ZZWA 2I6MA 3AWEA 5M43A 1VHRA 3QCNA 3V0DA 2F6ZA 2SHPA 2NZ6A 4GE5A 5MMZB 3LJ8A 1OESA 2R0BA 2F71A 2VEYA 3A5KA 2F6WA 2Q47A 2VTEA 3ZM3A 2CM3A 4RHGA 2DXPA 2M3VA 4WTYA 2QCTA 1PTTA 3ZM2A 2HC1A 2HB1A 4PYHA 3RGQA 3QCFA 4GFUA 1XBOA 2I3RA 1NWLA 2WJPA 3QCBA 5J8RA 1JLNA 3QCDA 2F46A 2QBPA 2GCAA 5A5EA 4JBCA 4KYQA 2Y96A 3ZM5A 3D44A 1XXPA 3QCGA 4AZ1A 1T48A 3F9BA 3RO1A 2HXPA 1PYNA 2OC3A 1PH0A
chains in the Genus database with same CATH topology
1U26A 4ZI4A 5KADA 2I6JA 2I75A 4B04A 3D1QA 3O4TA 1OEVA 3BRHA 1QXKA 3I80A 3ZM1A 1OEMX 4GE2A 2CNIA 2H04A 2NV5A 1KAVA 1G1GA 1Q6MA 1I57A 2FH7A 2VEVA 4HJQA 2H4VA 4JMKA 1R6HA 3MMJA 5KA8A 4IKCA 4I8NA 5KA4A 4R0SA 1NNYA 4GRZA 1G1HA 1PTVA 2I42A 1GWZA 2F6VA 4QAPA 4QBWA 1L8GA 4JMJA 4ERCA 2Y2FA 1MKPA 1RPMA 2CM2A 2A8BA 2PSZA 2QDPA 2BGEA 5KA9A 3OLRA 1YTWA 5KA3A 1M3GA 1NL9A 1OHEA 3CWEA 3V0GA 2H4GA 2GWOA 2QEPA 3V0IA 1Q6JA 3S4OA 4QUMA 2CFVA 1Q6NA 4NWFA 2C7SA 1EENA 1YGUA 2GP0A 1OETA 2RF6A 4J51A 2I5XA 1I9SA 4Y2EA 3MOZA 2HNQA 1GFYA 1T49A 2PT0A 1YPTA 1LQFA 1YWFA 2HVLA 3S4EA 3QCIA 3BM8A 3S3FA 4NNDA 1XM2A 1OHCA 3OMHA 3PS5A 5KA7A 3O5XA 2F6TA 3EZZA 4HRFA 3M4UA 4RI4A 5IBMA 3F9AA 5BZZA 4D3PA 5BX1A 2VEUA 4GE6A 2G6ZA 5KACA 4KYRA 4BJOA 2GJTA 1ZC0A 1ONYA 3QKPA 5KAAA 1V3AA 3NMEA 1D5RA 2PA5A 2B4SA 1G7FA 1WRMA 3SMEA 3QCMA 5AWXA 2J16A 2Q05A 2A3KA 4RDDA 1YGRA 2HNPA 2PQ5A 2B4OA 1BZCA 1ZCLA 5EHRA 3S3KA 1ZCKA 2G59A 2NT7A 2B4UA 3V0EA 2QDCA 5K22A 3QCHA 1YTNA 2OZ5A 1ECVA 5K9WA 4HJPA 2PI7A 3O4SA 4OHLA 4MBBA 4RH5A 1XRIA 4GS0A 1T4JA 2J17A 4PVGA 1NO6A 1Q1MA 2CJZA 2I4GA 4WU2A 3QCCA 1JF7A 3F99A 3MOWA 1G7GA 2BGDA 2IMGA 4GFVA 4NX8A 2I4EA 2VEXA 1WCHA 2QBQA 1LYVA 3U96A 3EU0A 2WGPA 2B07A 1G4US 3EAXA 4R30A 3BLUA 3AWFA 3S3EA 1C84A 1G4WR 4ZN5A 2P4DA 2ZMMA 4ZRTA 1EEOA 5IBSA 1L8KA 5GTJA 4OHHA 3RZ2A 1OEUA 1C86A 3CM3A 3D1HA 3GXHA 4ICZA 5I6VA 3QCKA 1YTSA 4JNBA 1FQ1A 2FJMA 4OHIA 4RH9A 2AHSA 2E0TA 2QCJA 2I6PA 1X24A 4WU3A 2ESBA 1PXHA 1WAXA 4QAHA 2H4KA 4RKKA 4D3QA 2P6XA 2OUDA 3H2XA 5KA2A 4GWFA 1OEOX 4D3RA 2HC2A 3I36A 2C46A 2CNEA 2CM8A 1U25A 5K23A 2F70A 2CNFA 3QCJA 2I6OA 2OOQA 2HCMA 1C83A 2FJNA 2F6YA 5K9VA 1XXVA 5LXQB 2I3UA 1BZHA 4NYHA 4GRYA 2CNGA 2B3OA 4BPCA 1FPRA 3BLTA 3S3HA 3SR9A 2CMCA 3ZV2A 2BZLA 1SUGA 2J16B 5K25A 1P15A 1QZ0A 1PA9A 3D9CA 2B49A 4RI5A 2AZRA 1YN9A 3EB1A 3D42A 2BV5A 4YAAA 4OHDA 4H34A 2BIJA 3GXGA 3D1OA 1C85A 2I6IA 1PTYA 1U24A 1FPZA 1YZ4A 3QKQA 4TVVA 1KAKA 2CMAA 2QBRA 1C88A 1AAXA 3QCEA 4S0GA 1PTUA 3N0AA 3QCLA 3A5JA 5KA0A 2HY3A 2CNHA 4DGXA 2QBSA 3ZMPA 1A5YA 2B4PA 4Y14A 3V0FA 2PBNA 4KI9A 5HDEA 1J4XA 5BZXA 4H1OA 1LARA 1C87A 2NT2A 2CM7A 4R0TA 2VEWA 3AWGA 3B7OA 3O3LA 1NWEA 1BZJA 5BUGA 5KABA 1Q6SA 5K24A 1YFOA 2NTAA 1PA1A 4OHEA 3ZMQA 3EMUA 2JJDA 1I9TA 2NLKA 2I1YA 3F81A 2H02A 2QDMA 3I7ZA 1ONZA 3V0HA 4NWGA 1Q6TA 4YR8B 2H03A 2I4HA 3ZM0A 4WOHA 4QUNA 1NZ7A 2YDUA 5EHPA 3RGOA 2F6FA 2CMBA 3F41A 4QBEA 4DGPA 1Q6PA 3O4UA 1OHDA 2ZN7A 1RXDA 4Z6BA 5KA1A 2MBCA 3V0JA 1G1FA 1ZZWA 2I6MA 3AWEA 5M43A 1VHRA 3QCNA 3V0DA 2F6ZA 2SHPA 2NZ6A 4GE5A 5MMZB 3LJ8A 1OESA 2R0BA 2F71A 2VEYA 3A5KA 2F6WA 2Q47A 3ZM3A 2CM3A 4RHGA 2DXPA 2M3VA 4WTYA 2QCTA 1PTTA 3ZM2A 2HC1A 2HB1A 4PYHA 3RGQA 4GFUA 3QCFA 1XBOA 2I3RA 1NWLA 3QCBA 5J8RA 1JLNA 3QCDA 2F46A 2QBPA 4JBCA 4KYQA 2Y96A 3D44A 1XXPA 3QCGA 4AZ1A 1T48A 3F9BA 3RO1A 2HXPA 1PYNA 2OC3A 1PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U26 A;  4ZI4 A;  5KAD A;  2I6J A;  2I75 A;  4B04 A;  3D1Q A;  3O4T A;  1OEV A;  3BRH A;  1QXK A;  3I80 A;  3ZM1 A;  1OEM X;  4GE2 A;  2CNI A;  2H04 A;  2NV5 A;  1KAV A;  1G1G A;  1Q6M A;  1I57 A;  2FH7 A;  2VEV A;  4HJQ A;  2H4V A;  4JMK A;  1R6H A;  3MMJ A;  5KA8 A;  4IKC A;  4I8N A;  5KA4 A;  4R0S A;  1NNY A;  4GRZ A;  1G1H A;  1PTV A;  2I42 A;  1GWZ A;  2F6V A;  4QAP A;  4QBW A;  1L8G A;  4JMJ A;  4ERC A;  2Y2F A;  1MKP A;  1RPM A;  2CM2 A;  2A8B A;  2PSZ A;  2QDP A;  2BGE A;  5KA9 A;  3OLR A;  1YTW A;  5KA3 A;  1M3G A;  1NL9 A;  1OHE A;  3CWE A;  3V0G A;  2H4G A;  2GWO A;  2QEP A;  3V0I A;  1Q6J A;  3S4O A;  4QUM A;  2CFV A;  1Q6N A;  4NWF A;  2C7S A;  1EEN A;  1YGU A;  2GP0 A;  1OET A;  2RF6 A;  4J51 A;  2I5X A;  1I9S A;  4Y2E A;  3MOZ A;  2HNQ A;  1GFY A;  1T49 A;  2PT0 A;  1YPT A;  1LQF A;  1YWF A;  2HVL A;  3S4E A;  3QCI A;  3BM8 A;  3S3F A;  4NND A;  1XM2 A;  1OHC A;  3OMH A;  3PS5 A;  5KA7 A;  3O5X A;  2F6T A;  3EZZ A;  4HRF A;  3M4U A;  4RI4 A;  5IBM A;  3F9A A;  5BZZ A;  4D3P A;  5BX1 A;  2VEU A;  4GE6 A;  2G6Z A;  5KAC A;  4KYR A;  4BJO A;  2GJT A;  1ZC0 A;  1ONY A;  3QKP A;  5KAA A;  1V3A A;  3NME A;  1D5R A;  2PA5 A;  2B4S A;  1G7F A;  1WRM A;  3SME A;  3QCM A;  5AWX A;  2J16 A;  2Q05 A;  2A3K A;  4RDD A;  1YGR A;  2HNP A;  2PQ5 A;  2B4O A;  1BZC A;  1ZCL A;  5EHR A;  3S3K A;  1ZCK A;  2G59 A;  2NT7 A;  2B4U A;  3V0E A;  2QDC A;  5K22 A;  3QCH A;  1YTN A;  2OZ5 A;  1ECV A;  5K9W A;  4HJP A;  2PI7 A;  3O4S A;  4OHL A;  4MBB A;  4RH5 A;  1XRI A;  4GS0 A;  1T4J A;  2J17 A;  4PVG A;  1NO6 A;  1Q1M A;  2CJZ A;  2I4G A;  4WU2 A;  3QCC A;  1JF7 A;  3F99 A;  3MOW A;  1G7G A;  2BGD A;  2IMG A;  4GFV A;  4NX8 A;  2I4E A;  2VEX A;  1WCH A;  2QBQ A;  1LYV A;  3U96 A;  3EU0 A;  2WGP A;  2B07 A;  1G4U S;  3EAX A;  4R30 A;  3BLU A;  3AWF A;  3S3E A;  1C84 A;  1G4W R;  4ZN5 A;  2P4D A;  2ZMM A;  4ZRT A;  1EEO A;  5IBS A;  1L8K A;  5GTJ A;  4OHH A;  3RZ2 A;  1OEU A;  1C86 A;  3CM3 A;  3D1H A;  3GXH A;  4ICZ A;  5I6V A;  3QCK A;  1YTS A;  4JNB A;  1FQ1 A;  2FJM A;  4OHI A;  4RH9 A;  2AHS A;  2E0T A;  2QCJ A;  2I6P A;  1X24 A;  4WU3 A;  2ESB A;  1PXH A;  1WAX A;  4QAH A;  2H4K A;  4RKK A;  4D3Q A;  2P6X A;  2OUD A;  3H2X A;  5KA2 A;  4GWF A;  1OEO X;  4D3R A;  2HC2 A;  3I36 A;  2C46 A;  2CNE A;  2CM8 A;  1U25 A;  5K23 A;  2F70 A;  2CNF A;  3QCJ A;  2I6O A;  2OOQ A;  2HCM A;  1C83 A;  2FJN A;  2F6Y A;  5K9V A;  1XXV A;  5LXQ B;  2I3U A;  1BZH A;  4NYH A;  4GRY A;  2CNG A;  2B3O A;  4BPC A;  1FPR A;  3BLT A;  3S3H A;  3SR9 A;  2CMC A;  3ZV2 A;  2BZL A;  1SUG A;  2J16 B;  5K25 A;  1P15 A;  1QZ0 A;  1PA9 A;  3D9C A;  2B49 A;  4RI5 A;  2AZR A;  1YN9 A;  3EB1 A;  3D42 A;  2BV5 A;  4YAA A;  4OHD A;  4H34 A;  2BIJ A;  3GXG A;  3D1O A;  1C85 A;  2I6I A;  1PTY A;  1U24 A;  1FPZ A;  1YZ4 A;  3QKQ A;  4TVV A;  1KAK A;  2CMA A;  2QBR A;  1C88 A;  1AAX A;  3QCE A;  4S0G A;  1PTU A;  3N0A A;  3QCL A;  3A5J A;  5KA0 A;  2HY3 A;  2CNH A;  4DGX A;  2QBS A;  3ZMP A;  1A5Y A;  2B4P A;  4Y14 A;  3V0F A;  2PBN A;  4KI9 A;  5HDE A;  1J4X A;  5BZX A;  4H1O A;  1LAR A;  1C87 A;  2NT2 A;  2CM7 A;  4R0T A;  2VEW A;  3AWG A;  3B7O A;  3O3L A;  1NWE A;  1BZJ A;  5BUG A;  5KAB A;  1Q6S A;  5K24 A;  1YFO A;  2NTA A;  1PA1 A;  4OHE A;  3ZMQ A;  3EMU A;  2JJD A;  1I9T A;  2NLK A;  2I1Y A;  3F81 A;  2H02 A;  2QDM A;  3I7Z A;  1ONZ A;  3V0H A;  4NWG A;  1Q6T A;  4YR8 B;  2H03 A;  2I4H A;  3ZM0 A;  4WOH A;  4QUN A;  1NZ7 A;  2YDU A;  5EHP A;  3RGO A;  2F6F A;  2CMB A;  3F41 A;  4QBE A;  4DGP A;  1Q6P A;  3O4U A;  1OHD A;  2ZN7 A;  1RXD A;  4Z6B A;  5KA1 A;  2MBC A;  3V0J A;  1G1F A;  1ZZW A;  2I6M A;  3AWE A;  5M43 A;  1VHR A;  3QCN A;  3V0D A;  2F6Z A;  2SHP A;  2NZ6 A;  4GE5 A;  5MMZ B;  3LJ8 A;  1OES A;  2R0B A;  2F71 A;  2VEY A;  3A5K A;  2F6W A;  2Q47 A;  3ZM3 A;  2CM3 A;  4RHG A;  2DXP A;  2M3V A;  4WTY A;  2QCT A;  1PTT A;  3ZM2 A;  2HC1 A;  2HB1 A;  4PYH A;  3RGQ A;  4GFU A;  3QCF A;  1XBO A;  2I3R A;  1NWL A;  3QCB A;  5J8R A;  1JLN A;  3QCD A;  2F46 A;  2QBP A;  4JBC A;  4KYQ A;  2Y96 A;  3D44 A;  1XXP A;  3QCG A;  4AZ1 A;  1T48 A;  3F9B A;  3RO1 A;  2HXP A;  1PYN A;  2OC3 A;  1PH0 A; 
#chains in the Genus database with same CATH topology
 1U26 A;  4ZI4 A;  5KAD A;  2I6J A;  2I75 A;  4B04 A;  3D1Q A;  3O4T A;  1OEV A;  3BRH A;  1QXK A;  3I80 A;  2GC5 A;  3ZM1 A;  1OEM X;  4GE2 A;  2CNI A;  3HN7 A;  1O5Z A;  2AM1 A;  2H04 A;  2NV5 A;  1KAV A;  1G1G A;  1Q6M A;  1I57 A;  2FH7 A;  2VEV A;  4HJQ A;  2H4V A;  4JMK A;  1R6H A;  3MMJ A;  5KA8 A;  4IKC A;  2VOR A;  4I8N A;  5KA4 A;  4R0S A;  1NNY A;  2Y66 A;  4GRZ A;  1G1H A;  1PTV A;  4QDI A;  2I42 A;  1GWZ A;  4C13 A;  2F6V A;  4QAP A;  4QBW A;  1L8G A;  4JMJ A;  4ERC A;  2WTZ A;  2Y2F A;  1MKP A;  1RPM A;  2CM2 A;  2A8B A;  2PSZ A;  2QDP A;  2BGE A;  5KA9 A;  3OLR A;  1YTW A;  5KA3 A;  1M3G A;  1NL9 A;  1OHE A;  3CWE A;  3V0G A;  4CVM A;  2H4G A;  2GWO A;  2QEP A;  2XJA A;  3V0I A;  1Q6J A;  3S4O A;  4QUM A;  2CFV A;  1Q6N A;  4NWF A;  2C7S A;  1EEN A;  1YGU A;  2GP0 A;  1OET A;  2RF6 A;  4J51 A;  2I5X A;  1I9S A;  2X5O A;  4Y2E A;  3MOZ A;  2HNQ A;  1GFY A;  1T49 A;  2PT0 A;  1YPT A;  1LQF A;  1YWF A;  2HVL A;  3S4E A;  3QCI A;  3BM8 A;  3S3F A;  2JFG A;  4NND A;  1XM2 A;  1OHC A;  3OMH A;  3PS5 A;  5KA7 A;  3O5X A;  2F6T A;  3EZZ A;  1GQQ A;  3M4U A;  1J6U A;  2AM2 A;  4HRF A;  4RI4 A;  5IBM A;  3F9A A;  5BZZ A;  3QCZ A;  4D3P A;  5BX1 A;  2VEU A;  2UUP A;  4GE6 A;  2G6Z A;  5KAC A;  4KYR A;  4BJO A;  2GJT A;  1ZC0 A;  1ONY A;  3QKP A;  5KAA A;  1V3A A;  3NME A;  1D5R A;  2PA5 A;  2B4S A;  1G7F A;  1WRM A;  3SME A;  3MVN A;  3QCM A;  5AWX A;  2J16 A;  2Q05 A;  2A3K A;  4RDD A;  1YGR A;  2HNP A;  5A5F A;  2PQ5 A;  2B4O A;  1BZC A;  1ZCL A;  5EHR A;  2F00 A;  3S3K A;  1ZCK A;  2G59 A;  2NT7 A;  1W78 A;  2B4U A;  3V0E A;  2QDC A;  5K22 A;  3QCH A;  3PYZ A;  1YTN A;  2OZ5 A;  1ECV A;  5K9W A;  4HJP A;  2PI7 A;  3O4S A;  4OHL A;  4MBB A;  4RH5 A;  1XRI A;  4GS0 A;  1T4J A;  2JFF A;  1GQY A;  2J17 A;  4PVG A;  1NO6 A;  2UUO A;  1Q1M A;  2CJZ A;  2I4G A;  4WU2 A;  3QCC A;  2GC6 A;  2UAG A;  1EEH A;  4BUB A;  1JF7 A;  3F99 A;  3MOW A;  1G7G A;  2BGD A;  2IMG A;  4GFV A;  4NX8 A;  2I4E A;  2VEX A;  1WCH A;  2VOS A;  2QBQ A;  1LYV A;  3U96 A;  3EU0 A;  3UAG A;  2Y67 A;  2WGP A;  2B07 A;  1G4U S;  3EAX A;  4R30 A;  3BLU A;  3AWF A;  3S3E A;  1C84 A;  1G4W R;  4ZN5 A;  2P4D A;  2ZMM A;  4ZRT A;  1EEO A;  5IBS A;  1L8K A;  5GTJ A;  4OHH A;  3RZ2 A;  2Y68 A;  1OEU A;  2XPC A;  1C86 A;  3CM3 A;  3D1H A;  3GXH A;  4ICZ A;  2VTD A;  5I6V A;  3QCK A;  1YTS A;  4JNB A;  1FQ1 A;  2FJM A;  4OHI A;  4RH9 A;  2AHS A;  2E0T A;  2QCJ A;  2I6P A;  4C12 A;  1X24 A;  3N2A A;  4WU3 A;  1GG4 A;  1PXH A;  1WAX A;  2ESB A;  2H4K A;  4QAH A;  4RKK A;  4D3Q A;  2Y1O A;  2P6X A;  2OUD A;  3H2X A;  5KA2 A;  4GWF A;  1OEO X;  4D3R A;  2HC2 A;  3I36 A;  2C46 A;  3ZM6 A;  2CNE A;  4UAG A;  2CM8 A;  1U25 A;  5K23 A;  2F70 A;  1UAG A;  2CNF A;  3QCJ A;  2I6O A;  2OOQ A;  2HCM A;  1C83 A;  2FJN A;  2F6Y A;  5K9V A;  1XXV A;  5LXQ B;  2I3U A;  4BUC A;  1BZH A;  1E8C A;  4NYH A;  4GRY A;  2CNG A;  2B3O A;  4BPC A;  1FPR A;  3BLT A;  3S3H A;  3SR9 A;  2CMC A;  3ZV2 A;  2BZL A;  1SUG A;  2J16 B;  5K25 A;  1P15 A;  1QZ0 A;  2GCB A;  1PA9 A;  3D9C A;  2B49 A;  4RI5 A;  4CVL A;  4CVK A;  2AZR A;  1YN9 A;  3EB1 A;  2JFH A;  2BV5 A;  3D42 A;  4OHD A;  4YAA A;  4H34 A;  2BIJ A;  3GXG A;  1FGS A;  3D1O A;  1C85 A;  2I6I A;  1P31 A;  1PTY A;  1U24 A;  1FPZ A;  1YZ4 A;  3QKQ A;  4TVV A;  1KAK A;  1JBW A;  2CMA A;  2QBR A;  1C88 A;  1AAX A;  3QCE A;  4S0G A;  4HV4 A;  1PTU A;  3N0A A;  3QCL A;  3A5J A;  5KA0 A;  1P3D A;  2HY3 A;  2CNH A;  4DGX A;  4QF5 A;  2QBS A;  3ZMP A;  1A5Y A;  2B4P A;  4Y14 A;  3V0F A;  2PBN A;  3NRS A;  3ZL8 A;  4KI9 A;  5HDE A;  1J4X A;  5BZX A;  4H1O A;  1LAR A;  1C87 A;  2NT2 A;  2CM7 A;  4R0T A;  2VEW A;  3AWG A;  3B7O A;  1JBV A;  3O3L A;  1NWE A;  1BZJ A;  5BUG A;  5KAB A;  1Q6S A;  5K24 A;  1YFO A;  2NTA A;  1PA1 A;  1W7K A;  4OHE A;  3ZMQ A;  3EMU A;  2JJD A;  1E0D A;  1I9T A;  2NLK A;  2I1Y A;  3F81 A;  2H02 A;  2QDM A;  3I7Z A;  1ONZ A;  3V0H A;  4NWG A;  1Q6T A;  4YR8 B;  2H03 A;  2I4H A;  3ZM0 A;  4WOH A;  4QUN A;  1NZ7 A;  2YDU A;  5EHP A;  3RGO A;  2F6F A;  4ZIY A;  2CMB A;  3F41 A;  4QBE A;  4DGP A;  1Q6P A;  3O4U A;  1OHD A;  2ZN7 A;  1RXD A;  4Z6B A;  5KA1 A;  3LK7 A;  2MBC A;  3V0J A;  1G1F A;  1ZZW A;  2I6M A;  3AWE A;  5M43 A;  1VHR A;  3QCN A;  3V0D A;  2F6Z A;  2SHP A;  2NZ6 A;  4GE5 A;  5MMZ B;  3LJ8 A;  1OES A;  2R0B A;  2F71 A;  2VEY A;  3A5K A;  2F6W A;  2Q47 A;  2VTE A;  3ZM3 A;  2CM3 A;  4RHG A;  2DXP A;  2M3V A;  4WTY A;  2QCT A;  1PTT A;  3ZM2 A;  2HC1 A;  2HB1 A;  4PYH A;  3RGQ A;  3QCF A;  4GFU A;  1XBO A;  2I3R A;  1NWL A;  2WJP A;  3QCB A;  5J8R A;  1JLN A;  3QCD A;  2F46 A;  2QBP A;  2GCA A;  5A5E A;  4JBC A;  4KYQ A;  2Y96 A;  3ZM5 A;  3D44 A;  1XXP A;  3QCG A;  4AZ1 A;  1T48 A;  3F9B A;  3RO1 A;  2HXP A;  1PYN A;  2OC3 A;  1PH0 A; 
#chains in the Genus database with same CATH homology
 1U26 A;  4ZI4 A;  5KAD A;  2I6J A;  2I75 A;  4B04 A;  3D1Q A;  3O4T A;  1OEV A;  3BRH A;  1QXK A;  3I80 A;  3ZM1 A;  1OEM X;  4GE2 A;  2CNI A;  2H04 A;  2NV5 A;  1KAV A;  1G1G A;  1Q6M A;  1I57 A;  2FH7 A;  2VEV A;  4HJQ A;  2H4V A;  4JMK A;  1R6H A;  3MMJ A;  5KA8 A;  4IKC A;  4I8N A;  5KA4 A;  4R0S A;  1NNY A;  4GRZ A;  1G1H A;  1PTV A;  2I42 A;  1GWZ A;  2F6V A;  4QAP A;  4QBW A;  1L8G A;  4JMJ A;  4ERC A;  2Y2F A;  1MKP A;  1RPM A;  2CM2 A;  2A8B A;  2PSZ A;  2QDP A;  2BGE A;  5KA9 A;  3OLR A;  1YTW A;  5KA3 A;  1M3G A;  1NL9 A;  1OHE A;  3CWE A;  3V0G A;  2H4G A;  2GWO A;  2QEP A;  3V0I A;  1Q6J A;  3S4O A;  4QUM A;  2CFV A;  1Q6N A;  4NWF A;  2C7S A;  1EEN A;  1YGU A;  2GP0 A;  1OET A;  2RF6 A;  4J51 A;  2I5X A;  1I9S A;  4Y2E A;  3MOZ A;  2HNQ A;  1GFY A;  1T49 A;  2PT0 A;  1YPT A;  1LQF A;  1YWF A;  2HVL A;  3S4E A;  3QCI A;  3BM8 A;  3S3F A;  4NND A;  1XM2 A;  1OHC A;  3OMH A;  3PS5 A;  5KA7 A;  3O5X A;  2F6T A;  3EZZ A;  4HRF A;  3M4U A;  4RI4 A;  5IBM A;  3F9A A;  5BZZ A;  4D3P A;  5BX1 A;  2VEU A;  4GE6 A;  2G6Z A;  5KAC A;  4KYR A;  4BJO A;  2GJT A;  1ZC0 A;  1ONY A;  3QKP A;  5KAA A;  1V3A A;  3NME A;  1D5R A;  2PA5 A;  2B4S A;  1G7F A;  1WRM A;  3SME A;  3QCM A;  5AWX A;  2J16 A;  2Q05 A;  2A3K A;  4RDD A;  1YGR A;  2HNP A;  2PQ5 A;  2B4O A;  1BZC A;  1ZCL A;  5EHR A;  3S3K A;  1ZCK A;  2G59 A;  2NT7 A;  2B4U A;  3V0E A;  2QDC A;  5K22 A;  3QCH A;  1YTN A;  2OZ5 A;  1ECV A;  5K9W A;  4HJP A;  2PI7 A;  3O4S A;  4OHL A;  4MBB A;  4RH5 A;  1XRI A;  4GS0 A;  1T4J A;  2J17 A;  4PVG A;  1NO6 A;  1Q1M A;  2CJZ A;  2I4G A;  4WU2 A;  3QCC A;  1JF7 A;  3F99 A;  3MOW A;  1G7G A;  2BGD A;  2IMG A;  4GFV A;  4NX8 A;  2I4E A;  2VEX A;  1WCH A;  2QBQ A;  1LYV A;  3U96 A;  3EU0 A;  2WGP A;  2B07 A;  1G4U S;  3EAX A;  4R30 A;  3BLU A;  3AWF A;  3S3E A;  1C84 A;  1G4W R;  4ZN5 A;  2P4D A;  2ZMM A;  4ZRT A;  1EEO A;  5IBS A;  1L8K A;  5GTJ A;  4OHH A;  3RZ2 A;  1OEU A;  1C86 A;  3CM3 A;  3D1H A;  3GXH A;  4ICZ A;  5I6V A;  3QCK A;  1YTS A;  4JNB A;  1FQ1 A;  2FJM A;  4OHI A;  4RH9 A;  2AHS A;  2E0T A;  2QCJ A;  2I6P A;  1X24 A;  4WU3 A;  2ESB A;  1PXH A;  1WAX A;  4QAH A;  2H4K A;  4RKK A;  4D3Q A;  2P6X A;  2OUD A;  3H2X A;  5KA2 A;  4GWF A;  1OEO X;  4D3R A;  2HC2 A;  3I36 A;  2C46 A;  2CNE A;  2CM8 A;  1U25 A;  5K23 A;  2F70 A;  2CNF A;  3QCJ A;  2I6O A;  2OOQ A;  2HCM A;  1C83 A;  2FJN A;  2F6Y A;  5K9V A;  1XXV A;  5LXQ B;  2I3U A;  1BZH A;  4NYH A;  4GRY A;  2CNG A;  2B3O A;  4BPC A;  1FPR A;  3BLT A;  3S3H A;  3SR9 A;  2CMC A;  3ZV2 A;  2BZL A;  1SUG A;  2J16 B;  5K25 A;  1P15 A;  1QZ0 A;  1PA9 A;  3D9C A;  2B49 A;  4RI5 A;  2AZR A;  1YN9 A;  3EB1 A;  3D42 A;  2BV5 A;  4YAA A;  4OHD A;  4H34 A;  2BIJ A;  3GXG A;  3D1O A;  1C85 A;  2I6I A;  1PTY A;  1U24 A;  1FPZ A;  1YZ4 A;  3QKQ A;  4TVV A;  1KAK A;  2CMA A;  2QBR A;  1C88 A;  1AAX A;  3QCE A;  4S0G A;  1PTU A;  3N0A A;  3QCL A;  3A5J A;  5KA0 A;  2HY3 A;  2CNH A;  4DGX A;  2QBS A;  3ZMP A;  1A5Y A;  2B4P A;  4Y14 A;  3V0F A;  2PBN A;  4KI9 A;  5HDE A;  1J4X A;  5BZX A;  4H1O A;  1LAR A;  1C87 A;  2NT2 A;  2CM7 A;  4R0T A;  2VEW A;  3AWG A;  3B7O A;  3O3L A;  1NWE A;  1BZJ A;  5BUG A;  5KAB A;  1Q6S A;  5K24 A;  1YFO A;  2NTA A;  1PA1 A;  4OHE A;  3ZMQ A;  3EMU A;  2JJD A;  1I9T A;  2NLK A;  2I1Y A;  3F81 A;  2H02 A;  2QDM A;  3I7Z A;  1ONZ A;  3V0H A;  4NWG A;  1Q6T A;  4YR8 B;  2H03 A;  2I4H A;  3ZM0 A;  4WOH A;  4QUN A;  1NZ7 A;  2YDU A;  5EHP A;  3RGO A;  2F6F A;  2CMB A;  3F41 A;  4QBE A;  4DGP A;  1Q6P A;  3O4U A;  1OHD A;  2ZN7 A;  1RXD A;  4Z6B A;  5KA1 A;  2MBC A;  3V0J A;  1G1F A;  1ZZW A;  2I6M A;  3AWE A;  5M43 A;  1VHR A;  3QCN A;  3V0D A;  2F6Z A;  2SHP A;  2NZ6 A;  4GE5 A;  5MMZ B;  3LJ8 A;  1OES A;  2R0B A;  2F71 A;  2VEY A;  3A5K A;  2F6W A;  2Q47 A;  3ZM3 A;  2CM3 A;  4RHG A;  2DXP A;  2M3V A;  4WTY A;  2QCT A;  1PTT A;  3ZM2 A;  2HC1 A;  2HB1 A;  4PYH A;  3RGQ A;  4GFU A;  3QCF A;  1XBO A;  2I3R A;  1NWL A;  3QCB A;  5J8R A;  1JLN A;  3QCD A;  2F46 A;  2QBP A;  4JBC A;  4KYQ A;  2Y96 A;  3D44 A;  1XXP A;  3QCG A;  4AZ1 A;  1T48 A;  3F9B A;  3RO1 A;  2HXP A;  1PYN A;  2OC3 A;  1PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...