3EBNA

A special dimerization of sars-cov main protease c-terminal domain due to domain-swapping
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
b'TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replicase polyprotein 1ab
publication title C-terminal domain of SARS-CoV main protease can form a 3D domain-swapped dimer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 24
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ebnA00
3TITA 5B6OA 4HI3A 3EA7A 4ZROA 5C5OA 4TWWA 3TLOA 2ZU2A 4YOGA 1UK3A 2Z3DA 2K7XA 2GZ9A 3SNEA 3M3VA 5C3NA 2Z3EA 2ZU5A 2LIZA 3V3MA 2BX4A 1UK2A 2AMDA 1UK4A 3VB6A 4ZUHA 4WMFA 3SNBA 1UJ1A 4YO9A 3TNSA 1Q2WA 2GZ8A 3F9EA 3SZNA 2C3SA 3IWMA 2PWXA 2Z9KA 4YLUA 5C5NA 2GT7A 2AMQA 2QIQA 3TIUA 2Z9JA 3EA9A 4TWYA 2VJ1A 3ATWA 3VB5A 3AW1A 4MDSA 3SNAA 2OP9A 2AMPA 3SNCA 3D23A 3F9FA 2ALVA 2DUCA 3AW0A 2V6NA 2ZU4A 4YOJA 2Z94A 1P9SA 2GZ7A 3VB7A 3FZDA 2QCYA 2Q6DA 2Z9LA 2YNBA 2YNAA 1LVOA 2A5IA 3E91A 2Z3CA 3VB4A 3SN8A 2GTBA 1WOFA 3AVZA 4WMEA 3M3TA 5EU8A 2QC2A 2HOBA 4YOIA 3VB3A 3F9HA 3M3SA 3F9GA 2Q6FA 4XFQA 2A5AA 2Q6GA 2GT8A 2GX4A 4F49A 4RSPA 2Z9GA 2D2DA 2H2ZA 3D62A 3EAJA 3TNTA 4WY3A 1P9UA 3EBNA 2BX3A 1Z1JA 1Z1IA 3SNDA 3EA8A 5HYOA 4WMDA 2A5KA 5GWZA
chains in the Genus database with same CATH superfamily
3TITA 5B6OA 4HI3A 3EA7A 4ZROA 5C5OA 4TWWA 3TLOA 2ZU2A 4YOGA 1UK3A 2Z3DA 2K7XA 2GZ9A 3SNEA 3M3VA 5C3NA 2Z3EA 2ZU5A 2LIZA 3V3MA 2BX4A 1UK2A 2AMDA 1UK4A 3VB6A 4ZUHA 4WMFA 3SNBA 1UJ1A 4YO9A 3TNSA 1Q2WA 2GZ8A 3F9EA 3SZNA 2C3SA 3IWMA 2PWXA 2Z9KA 4YLUA 5C5NA 2GT7A 2AMQA 2QIQA 3TIUA 2Z9JA 3EA9A 4TWYA 2VJ1A 3ATWA 3VB5A 3AW1A 4MDSA 3SNAA 2OP9A 2AMPA 3SNCA 3D23A 3F9FA 2ALVA 2DUCA 3AW0A 2V6NA 2ZU4A 4YOJA 2Z94A 1P9SA 2GZ7A 3VB7A 3FZDA 2QCYA 2Q6DA 2Z9LA 2YNBA 2YNAA 1LVOA 2A5IA 3E91A 2Z3CA 3VB4A 3SN8A 2GTBA 1WOFA 3AVZA 4WMEA 3M3TA 5EU8A 2QC2A 2HOBA 4YOIA 3VB3A 3F9HA 3M3SA 3F9GA 2Q6FA 4XFQA 2A5AA 2Q6GA 2GT8A 2GX4A 4F49A 4RSPA 2Z9GA 2D2DA 2H2ZA 3D62A 3EAJA 3TNTA 4WY3A 1P9UA 3EBNA 2BX3A 1Z1JA 1Z1IA 3SNDA 3EA8A 5HYOA 4WMDA 2A5KA 5GWZA
chains in the Genus database with same CATH topology
3TITA 5B6OA 4HI3A 3EA7A 4ZROA 5C5OA 4TWWA 3TLOA 2ZU2A 4YOGA 1UK3A 2Z3DA 2K7XA 2GZ9A 3SNEA 3M3VA 5C3NA 2Z3EA 2ZU5A 2LIZA 3V3MA 2BX4A 1UK2A 2AMDA 1UK4A 3VB6A 4ZUHA 4WMFA 3SNBA 1UJ1A 4YO9A 3TNSA 1Q2WA 2GZ8A 3F9EA 3SZNA 2C3SA 3IWMA 2PWXA 2Z9KA 4YLUA 5C5NA 2GT7A 2AMQA 2QIQA 3TIUA 2Z9JA 3EA9A 4TWYA 2VJ1A 3ATWA 3VB5A 3AW1A 4MDSA 3SNAA 2OP9A 2AMPA 3SNCA 3D23A 3F9FA 2ALVA 2DUCA 3AW0A 2V6NA 2ZU4A 4YOJA 2Z94A 1P9SA 2GZ7A 3VB7A 3FZDA 2QCYA 2Q6DA 2Z9LA 2YNBA 2YNAA 1LVOA 2A5IA 3E91A 2Z3CA 3VB4A 3SN8A 2GTBA 1WOFA 3AVZA 4WMEA 3M3TA 5EU8A 2QC2A 2HOBA 4YOIA 3VB3A 3F9HA 3M3SA 3F9GA 2Q6FA 4XFQA 2A5AA 2Q6GA 2GT8A 2GX4A 4F49A 4RSPA 2Z9GA 2D2DA 2H2ZA 3D62A 3EAJA 3TNTA 4WY3A 1P9UA 3EBNA 2BX3A 1Z1JA 1Z1IA 3SNDA 3EA8A 5HYOA 4WMDA 2A5KA 5GWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TIT A;  5B6O A;  4HI3 A;  3EA7 A;  4ZRO A;  5C5O A;  4TWW A;  3TLO A;  2ZU2 A;  4YOG A;  1UK3 A;  2Z3D A;  2K7X A;  2GZ9 A;  3SNE A;  3M3V A;  5C3N A;  2Z3E A;  2ZU5 A;  2LIZ A;  3V3M A;  2BX4 A;  1UK2 A;  2AMD A;  1UK4 A;  3VB6 A;  4ZUH A;  4WMF A;  3SNB A;  1UJ1 A;  4YO9 A;  3TNS A;  1Q2W A;  2GZ8 A;  3F9E A;  3SZN A;  2C3S A;  3IWM A;  2PWX A;  2Z9K A;  4YLU A;  5C5N A;  2GT7 A;  2AMQ A;  2QIQ A;  3TIU A;  2Z9J A;  3EA9 A;  4TWY A;  2VJ1 A;  3ATW A;  3VB5 A;  3AW1 A;  4MDS A;  3SNA A;  2OP9 A;  2AMP A;  3SNC A;  3D23 A;  3F9F A;  2ALV A;  2DUC A;  3AW0 A;  2V6N A;  2ZU4 A;  4YOJ A;  2Z94 A;  1P9S A;  2GZ7 A;  3VB7 A;  3FZD A;  2QCY A;  2Q6D A;  2Z9L A;  2YNB A;  2YNA A;  1LVO A;  2A5I A;  3E91 A;  2Z3C A;  3VB4 A;  3SN8 A;  2GTB A;  1WOF A;  3AVZ A;  4WME A;  3M3T A;  5EU8 A;  2QC2 A;  2HOB A;  4YOI A;  3VB3 A;  3F9H A;  3M3S A;  3F9G A;  2Q6F A;  4XFQ A;  2A5A A;  2Q6G A;  2GT8 A;  2GX4 A;  4F49 A;  4RSP A;  2Z9G A;  2D2D A;  2H2Z A;  3D62 A;  3EAJ A;  3TNT A;  4WY3 A;  1P9U A;  3EBN A;  2BX3 A;  1Z1J A;  1Z1I A;  3SND A;  3EA8 A;  5HYO A;  4WMD A;  2A5K A;  5GWZ A; 
#chains in the Genus database with same CATH topology
 3TIT A;  5B6O A;  4HI3 A;  3EA7 A;  4ZRO A;  5C5O A;  4TWW A;  3TLO A;  2ZU2 A;  4YOG A;  1UK3 A;  2Z3D A;  2K7X A;  2GZ9 A;  3SNE A;  3M3V A;  5C3N A;  2Z3E A;  2ZU5 A;  2LIZ A;  3V3M A;  2BX4 A;  1UK2 A;  2AMD A;  1UK4 A;  3VB6 A;  4ZUH A;  4WMF A;  3SNB A;  1UJ1 A;  4YO9 A;  3TNS A;  1Q2W A;  2GZ8 A;  3F9E A;  3SZN A;  2C3S A;  3IWM A;  2PWX A;  2Z9K A;  4YLU A;  5C5N A;  2GT7 A;  2AMQ A;  2QIQ A;  3TIU A;  2Z9J A;  3EA9 A;  4TWY A;  2VJ1 A;  3ATW A;  3VB5 A;  3AW1 A;  4MDS A;  3SNA A;  2OP9 A;  2AMP A;  3SNC A;  3D23 A;  3F9F A;  2ALV A;  2DUC A;  3AW0 A;  2V6N A;  2ZU4 A;  4YOJ A;  2Z94 A;  1P9S A;  2GZ7 A;  3VB7 A;  3FZD A;  2QCY A;  2Q6D A;  2Z9L A;  2YNB A;  2YNA A;  1LVO A;  2A5I A;  3E91 A;  2Z3C A;  3VB4 A;  3SN8 A;  2GTB A;  1WOF A;  3AVZ A;  4WME A;  3M3T A;  5EU8 A;  2QC2 A;  2HOB A;  4YOI A;  3VB3 A;  3F9H A;  3M3S A;  3F9G A;  2Q6F A;  4XFQ A;  2A5A A;  2Q6G A;  2GT8 A;  2GX4 A;  4F49 A;  4RSP A;  2Z9G A;  2D2D A;  2H2Z A;  3D62 A;  3EAJ A;  3TNT A;  4WY3 A;  1P9U A;  3EBN A;  2BX3 A;  1Z1J A;  1Z1I A;  3SND A;  3EA8 A;  5HYO A;  4WMD A;  2A5K A;  5GWZ A; 
#chains in the Genus database with same CATH homology
 3TIT A;  5B6O A;  4HI3 A;  3EA7 A;  4ZRO A;  5C5O A;  4TWW A;  3TLO A;  2ZU2 A;  4YOG A;  1UK3 A;  2Z3D A;  2K7X A;  2GZ9 A;  3SNE A;  3M3V A;  5C3N A;  2Z3E A;  2ZU5 A;  2LIZ A;  3V3M A;  2BX4 A;  1UK2 A;  2AMD A;  1UK4 A;  3VB6 A;  4ZUH A;  4WMF A;  3SNB A;  1UJ1 A;  4YO9 A;  3TNS A;  1Q2W A;  2GZ8 A;  3F9E A;  3SZN A;  2C3S A;  3IWM A;  2PWX A;  2Z9K A;  4YLU A;  5C5N A;  2GT7 A;  2AMQ A;  2QIQ A;  3TIU A;  2Z9J A;  3EA9 A;  4TWY A;  2VJ1 A;  3ATW A;  3VB5 A;  3AW1 A;  4MDS A;  3SNA A;  2OP9 A;  2AMP A;  3SNC A;  3D23 A;  3F9F A;  2ALV A;  2DUC A;  3AW0 A;  2V6N A;  2ZU4 A;  4YOJ A;  2Z94 A;  1P9S A;  2GZ7 A;  3VB7 A;  3FZD A;  2QCY A;  2Q6D A;  2Z9L A;  2YNB A;  2YNA A;  1LVO A;  2A5I A;  3E91 A;  2Z3C A;  3VB4 A;  3SN8 A;  2GTB A;  1WOF A;  3AVZ A;  4WME A;  3M3T A;  5EU8 A;  2QC2 A;  2HOB A;  4YOI A;  3VB3 A;  3F9H A;  3M3S A;  3F9G A;  2Q6F A;  4XFQ A;  2A5A A;  2Q6G A;  2GT8 A;  2GX4 A;  4F49 A;  4RSP A;  2Z9G A;  2D2D A;  2H2Z A;  3D62 A;  3EAJ A;  3TNT A;  4WY3 A;  1P9U A;  3EBN A;  2BX3 A;  1Z1J A;  1Z1I A;  3SND A;  3EA8 A;  5HYO A;  4WMD A;  2A5K A;  5GWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...