3EBNA

A special dimerization of sars-cov main protease c-terminal domain due to domain-swapping
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replicase polyprotein 1ab
publication title C-terminal domain of SARS-CoV main protease can form a 3D domain-swapped dimer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 24
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ebnA00
3V3MA 2Q6DA 2Z3EA 2Z9LA 1P9UA 5C5OA 4XFQA 4ZUHA 4YOJA 3AW0A 2QIQA 2LIZA 3AVZA 1UK3A 2GT7A 3FZDA 2Q6GA 3M3TA 2H2ZA 4RSPA 3ATWA 3M3VA 4TWWA 1P9SA 3EBNA 3SNCA 4MDSA 3SN8A 3SZNA 3F9EA 1UK2A 3EA8A 3F9HA 2A5IA 2QC2A 2C3SA 3M3SA 2Z9GA 4HI3A 3F9FA 4WMEA 2YNAA 2ZU2A 3TITA 4YLUA 3SNAA 2AMPA 3SNBA 2GZ9A 3IWMA 4YOGA 1Q2WA 4TWYA 2ZU5A 2K7XA 2AMDA 2A5KA 4ZROA 4YOIA 2ZU4A 1UJ1A 2GTBA 5C3NA 4YO9A 4F49A 2AMQA 3VB3A 3TIUA 3EA9A 3TLOA 3AW1A 2OP9A 3TNTA 5HYOA 2BX4A 5B6OA 3VB5A 2Z94A 2VJ1A 4WMFA 3VB6A 3VB4A 2Z3DA 3SNDA 2GZ7A 3E91A 2GZ8A 2QCYA 2D2DA 3SNEA 2BX3A 2DUCA 5C5NA 5GWZA 1UK4A 2Q6FA 1Z1JA 3EA7A 2Z9KA 1LVOA 2ALVA 3D62A 3VB7A 2HOBA 4WY3A 2YNBA 2GX4A 2PWXA 2Z3CA 3D23A 1WOFA 2A5AA 5EU8A 2Z9JA 4WMDA 2V6NA 1Z1IA 3EAJA 3TNSA 3F9GA 2GT8A
chains in the Genus database with same CATH superfamily
3V3MA 2Q6DA 2Z3EA 2Z9LA 1P9UA 5C5OA 4XFQA 4ZUHA 4YOJA 3AW0A 2QIQA 2LIZA 3AVZA 1UK3A 2GT7A 3FZDA 2Q6GA 3M3TA 2H2ZA 4RSPA 3ATWA 3M3VA 4TWWA 1P9SA 3EBNA 3SNCA 4MDSA 3SN8A 3SZNA 3F9EA 1UK2A 3EA8A 3F9HA 2A5IA 2QC2A 2C3SA 3M3SA 2Z9GA 4HI3A 3F9FA 4WMEA 2YNAA 2ZU2A 3TITA 4YLUA 3SNAA 2AMPA 3SNBA 2GZ9A 3IWMA 4YOGA 1Q2WA 4TWYA 2ZU5A 2K7XA 2AMDA 2A5KA 4ZROA 4YOIA 2ZU4A 1UJ1A 2GTBA 5C3NA 4YO9A 4F49A 2AMQA 3VB3A 3TIUA 3EA9A 3TLOA 3AW1A 2OP9A 3TNTA 5HYOA 2BX4A 5B6OA 3VB5A 2Z94A 2VJ1A 4WMFA 3VB6A 3VB4A 2Z3DA 3SNDA 2GZ7A 3E91A 2GZ8A 2QCYA 2D2DA 3SNEA 2BX3A 2DUCA 5C5NA 5GWZA 1UK4A 2Q6FA 1Z1JA 3EA7A 2Z9KA 1LVOA 2ALVA 3D62A 3VB7A 2HOBA 4WY3A 2YNBA 2GX4A 2PWXA 2Z3CA 3D23A 1WOFA 2A5AA 5EU8A 2Z9JA 4WMDA 2V6NA 1Z1IA 3EAJA 3TNSA 3F9GA 2GT8A
chains in the Genus database with same CATH topology
3V3MA 2Q6DA 2Z3EA 2Z9LA 1P9UA 5C5OA 4XFQA 4ZUHA 4YOJA 3AW0A 2QIQA 2LIZA 3AVZA 1UK3A 2GT7A 3FZDA 2Q6GA 3M3TA 2H2ZA 4RSPA 3ATWA 3M3VA 4TWWA 1P9SA 3EBNA 3SNCA 4MDSA 3SN8A 3SZNA 3F9EA 1UK2A 3EA8A 3F9HA 2A5IA 2QC2A 2C3SA 3M3SA 2Z9GA 4HI3A 3F9FA 4WMEA 2YNAA 2ZU2A 3TITA 4YLUA 3SNAA 2AMPA 3SNBA 2GZ9A 3IWMA 4YOGA 1Q2WA 4TWYA 2ZU5A 2K7XA 2AMDA 2A5KA 4ZROA 4YOIA 2ZU4A 1UJ1A 2GTBA 5C3NA 4YO9A 4F49A 2AMQA 3VB3A 3TIUA 3EA9A 3TLOA 3AW1A 2OP9A 3TNTA 5HYOA 2BX4A 5B6OA 3VB5A 2Z94A 2VJ1A 4WMFA 3VB6A 3VB4A 2Z3DA 3SNDA 2GZ7A 3E91A 2GZ8A 2QCYA 2D2DA 3SNEA 2BX3A 2DUCA 5C5NA 5GWZA 1UK4A 2Q6FA 1Z1JA 3EA7A 2Z9KA 1LVOA 2ALVA 3D62A 3VB7A 2HOBA 4WY3A 2YNBA 2GX4A 2PWXA 2Z3CA 3D23A 1WOFA 2A5AA 5EU8A 2Z9JA 4WMDA 2V6NA 1Z1IA 3EAJA 3TNSA 3F9GA 2GT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3M A;  2Q6D A;  2Z3E A;  2Z9L A;  1P9U A;  5C5O A;  4XFQ A;  4ZUH A;  4YOJ A;  3AW0 A;  2QIQ A;  2LIZ A;  3AVZ A;  1UK3 A;  2GT7 A;  3FZD A;  2Q6G A;  3M3T A;  2H2Z A;  4RSP A;  3ATW A;  3M3V A;  4TWW A;  1P9S A;  3EBN A;  3SNC A;  4MDS A;  3SN8 A;  3SZN A;  3F9E A;  1UK2 A;  3EA8 A;  3F9H A;  2A5I A;  2QC2 A;  2C3S A;  3M3S A;  2Z9G A;  4HI3 A;  3F9F A;  4WME A;  2YNA A;  2ZU2 A;  3TIT A;  4YLU A;  3SNA A;  2AMP A;  3SNB A;  2GZ9 A;  3IWM A;  4YOG A;  1Q2W A;  4TWY A;  2ZU5 A;  2K7X A;  2AMD A;  2A5K A;  4ZRO A;  4YOI A;  2ZU4 A;  1UJ1 A;  2GTB A;  5C3N A;  4YO9 A;  4F49 A;  2AMQ A;  3VB3 A;  3TIU A;  3EA9 A;  3TLO A;  3AW1 A;  2OP9 A;  3TNT A;  5HYO A;  2BX4 A;  5B6O A;  3VB5 A;  2Z94 A;  2VJ1 A;  4WMF A;  3VB6 A;  3VB4 A;  2Z3D A;  3SND A;  2GZ7 A;  3E91 A;  2GZ8 A;  2QCY A;  2D2D A;  3SNE A;  2BX3 A;  2DUC A;  5C5N A;  5GWZ A;  1UK4 A;  2Q6F A;  1Z1J A;  3EA7 A;  2Z9K A;  1LVO A;  2ALV A;  3D62 A;  3VB7 A;  2HOB A;  4WY3 A;  2YNB A;  2GX4 A;  2PWX A;  2Z3C A;  3D23 A;  1WOF A;  2A5A A;  5EU8 A;  2Z9J A;  4WMD A;  2V6N A;  1Z1I A;  3EAJ A;  3TNS A;  3F9G A;  2GT8 A; 
#chains in the Genus database with same CATH topology
 3V3M A;  2Q6D A;  2Z3E A;  2Z9L A;  1P9U A;  5C5O A;  4XFQ A;  4ZUH A;  4YOJ A;  3AW0 A;  2QIQ A;  2LIZ A;  3AVZ A;  1UK3 A;  2GT7 A;  3FZD A;  2Q6G A;  3M3T A;  2H2Z A;  4RSP A;  3ATW A;  3M3V A;  4TWW A;  1P9S A;  3EBN A;  3SNC A;  4MDS A;  3SN8 A;  3SZN A;  3F9E A;  1UK2 A;  3EA8 A;  3F9H A;  2A5I A;  2QC2 A;  2C3S A;  3M3S A;  2Z9G A;  4HI3 A;  3F9F A;  4WME A;  2YNA A;  2ZU2 A;  3TIT A;  4YLU A;  3SNA A;  2AMP A;  3SNB A;  2GZ9 A;  3IWM A;  4YOG A;  1Q2W A;  4TWY A;  2ZU5 A;  2K7X A;  2AMD A;  2A5K A;  4ZRO A;  4YOI A;  2ZU4 A;  1UJ1 A;  2GTB A;  5C3N A;  4YO9 A;  4F49 A;  2AMQ A;  3VB3 A;  3TIU A;  3EA9 A;  3TLO A;  3AW1 A;  2OP9 A;  3TNT A;  5HYO A;  2BX4 A;  5B6O A;  3VB5 A;  2Z94 A;  2VJ1 A;  4WMF A;  3VB6 A;  3VB4 A;  2Z3D A;  3SND A;  2GZ7 A;  3E91 A;  2GZ8 A;  2QCY A;  2D2D A;  3SNE A;  2BX3 A;  2DUC A;  5C5N A;  5GWZ A;  1UK4 A;  2Q6F A;  1Z1J A;  3EA7 A;  2Z9K A;  1LVO A;  2ALV A;  3D62 A;  3VB7 A;  2HOB A;  4WY3 A;  2YNB A;  2GX4 A;  2PWX A;  2Z3C A;  3D23 A;  1WOF A;  2A5A A;  5EU8 A;  2Z9J A;  4WMD A;  2V6N A;  1Z1I A;  3EAJ A;  3TNS A;  3F9G A;  2GT8 A; 
#chains in the Genus database with same CATH homology
 3V3M A;  2Q6D A;  2Z3E A;  2Z9L A;  1P9U A;  5C5O A;  4XFQ A;  4ZUH A;  4YOJ A;  3AW0 A;  2QIQ A;  2LIZ A;  3AVZ A;  1UK3 A;  2GT7 A;  3FZD A;  2Q6G A;  3M3T A;  2H2Z A;  4RSP A;  3ATW A;  3M3V A;  4TWW A;  1P9S A;  3EBN A;  3SNC A;  4MDS A;  3SN8 A;  3SZN A;  3F9E A;  1UK2 A;  3EA8 A;  3F9H A;  2A5I A;  2QC2 A;  2C3S A;  3M3S A;  2Z9G A;  4HI3 A;  3F9F A;  4WME A;  2YNA A;  2ZU2 A;  3TIT A;  4YLU A;  3SNA A;  2AMP A;  3SNB A;  2GZ9 A;  3IWM A;  4YOG A;  1Q2W A;  4TWY A;  2ZU5 A;  2K7X A;  2AMD A;  2A5K A;  4ZRO A;  4YOI A;  2ZU4 A;  1UJ1 A;  2GTB A;  5C3N A;  4YO9 A;  4F49 A;  2AMQ A;  3VB3 A;  3TIU A;  3EA9 A;  3TLO A;  3AW1 A;  2OP9 A;  3TNT A;  5HYO A;  2BX4 A;  5B6O A;  3VB5 A;  2Z94 A;  2VJ1 A;  4WMF A;  3VB6 A;  3VB4 A;  2Z3D A;  3SND A;  2GZ7 A;  3E91 A;  2GZ8 A;  2QCY A;  2D2D A;  3SNE A;  2BX3 A;  2DUC A;  5C5N A;  5GWZ A;  1UK4 A;  2Q6F A;  1Z1J A;  3EA7 A;  2Z9K A;  1LVO A;  2ALV A;  3D62 A;  3VB7 A;  2HOB A;  4WY3 A;  2YNB A;  2GX4 A;  2PWX A;  2Z3C A;  3D23 A;  1WOF A;  2A5A A;  5EU8 A;  2Z9J A;  4WMD A;  2V6N A;  1Z1I A;  3EAJ A;  3TNS A;  3F9G A;  2GT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...