3EBYA

Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
153
Chain Sequence
b'EVAQVAQSAIDDFNAAYGLCLDDDRLEQWPTLFVDDCLYQVIARENVDNGLPAAVMYCDSKGMLADRVVALRKANHFNRHLIGRAVITGVEGDQVSAEASYVVFQTRNDGETRIYNAGKYVDRFDLSGGTVRLKSRTCIYDTLRIATLLATPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta subunit of a putative Aromatic-ring-hydroxylating dioxy
publication title Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Structural genomics, unknown function
total genus 47
structure length 153
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebyA00
1QJGA 1SJWA 3STDA 1JN5B 4RZMA 1Q40A 3RGAA 5KP3A 3BB9A 3ECFA 6STDA 1GS3A 3GRDA 2RGQA 2CHCA 3IPTA 4HVNA 4Q53A 4WYKB 2RCDA 3D9RA 4LMIA 1STDA 3A76A 3EBTA 3EQQB 3JUPA 1DMNA 1OHOA 5IF6A 3DUKA 1OF5B 2UX0A 3FH1A 5KP1A 2GEXA 2IMJA 3SOAA 3G0KA 2XR8B 3LZAA 3HK4A 3GZBA 3FF0A 4K1VA 2W2CA 1S5AA 3FKAA 2BNGA 4PEJA 4U13A 1NWWA 3FSDA 3NV0A 2JQ5A 4HM4B 5D81A 1JB4A 5BVBA 2F98A 4R9KA 5DRVA 2BMRB 3ROBA 1O7WB 4HM3B 1JKGB 5TGNA 4WP5A 4HM5B 5CK6A 2Z76A 5AIIA 5EVHA 3MYTA 2YFLB 5KP4A 3B4OA 1EA2A 3F9SA 4CDLA 1OPYA 1UUVB 3HZPA 1E3VA 3K0ZA 2HMLB 3HX8A 2GEYA 5AEUB 2QGUA 4I4KA 3DMCA 1JN5A 5IENA 4X2OA 3GZYB 8CHOA 2BMOB 1QMAA 5BXQA 3B4PA 5G2GA 2Z77A 4XBXA 4N3VA 5CF2A 3I0YA 3MG1A 1GY7A 4WWUC 4HM2B 3Q90A 5IG0A 5FW5A 3EN1B 1OF5A 5JPPA 1Z1SA 3F40A 3KSPA 5AEWB 1VZZA 1OGXA 2STDA 2QIYA 3DM8A 4HM1B 3KKGA 4HKVB 1DMMA 3EBYA 1OCVA 3MG2A 3EN8A 1ASKA 4XM4A 1W00A 2CKFB 4R9LA 1NDOB 3NBRA 4L8PA 1DMQA 3KZTA 3M8CA 4HZ9B 4XB5A 2YFIB 3EC9A 3OWUA 1O7MB 2F86B 3OWSA 4R1KA 2PZVA 3CNMA 2K54A 2YFJB 3MG3A 4X2HA 3F7XA 2I9WA 1K41A 5IEOA 3GZXB 4LGQA 2B1XB 4XDWA 1WQLB 2INXA 3ER7A 1O7NB 3BLZA 3DZLA 2OWPA 4K1UA 1C7HA 3RGRA 3JUNA 3OXAA 3EHCA 2RFRA 4WYKA 3NXJA 4FCMA 5D82A 1E97A 2HMKB 4HZBB 1GYBA 2XSHB 1CQSA 3FF2A 2HMJB 3K7CA 1JB5A 5STDA 2A15A 3T8NA 3G8ZA 4HM8B 4XBYA 1W6YA 1U5OA 3DXOA 2F99A 1ZO2A 3CNXA 4KVHA 2BMQB 3F14A 3E99A 3SEDA 5IEPA 2XSOB 1ISKA 2HMMB 3B8LA 5JPUA 5AIFA 2GBWB 3OV4A 2XRXB 3JUOA 3KE7A 5D83A 3H3HA 4IIAA 4L8OA 5HGRA 1JKGA 1OUNA 4HM0B 1BUQA 1HKXA 5AIGA 1TP6A 2GXFA 1Q42A 3GWRA 3NM2A 1E3RA 1Q40B 5CF1A 4XBTA 3NHXA 3MSOA 1TUHA 4OUQA 3UJMA 1UUWB 3FZWA 3F8XA 4L7KA 5IG4A 3EF8A 3G16A 3EJVA 3WMDA 3MHEA 4J9AA 4FCJA 2GBXB 4OVMA 1ULIB 3F7SA 5IERA 3H51A 4MJDA 1O7GB 4STDA 2HMNB 1O7HB 1A2KA 1OHSA 4LEHA 5IG5A 3OWYA 4HM7B 4J8TA 3CPOA 1GY6A 5CLKA 3JUMA 3NV0B 1JB2A 3EX9A 1ZX2A 3LYGA 2R4IA 3SOYA 5IG3A 3FLJA 2B24B 1O7PB 1NU3A 5AIHA 4HJLB 1ULJB 3CU3A 2Z7AA 3VSYA 4GB5A 1OH0A 3FGYA 3T8UA 7STDA 2HMOB 3MKIA 3UNLA 3F8HA 1IDPA 4ORLA 4HM6B 1EG9B 5CXOA 4H3UA 5DREA 3OX9A 4XDVA 1OGZA 3NUVA 3B7CA 1GY5A 5AI1A 1AR0A 3S5CA 3VGNA 3GZRA 3JUQA 1W02A 1W01A 1OHPA
chains in the Genus database with same CATH superfamily
4I5QA 1QJGA 1SJWA 4WHAA 1JN5B 3STDA 1MNLA 4RZMA 1Q40A 3RGAA 2CWVA 5KP3A 3BB9A 3GAXA 5G1KA 4KZ1A 4AEQA 3X42A 2P09A 2KRTA 3ECFA 6STDA 1GS3A 3T0UA 1TJDA 1VQ93 2W03A 4KT3B 1K28A 1V74A 3GRDA 1BIRA 4EC6A 3K5TA 2RGQA 1FGQA 1YJW3 1EKMA 1I8VA 1MWTA 2CHCA 3IPTA 4HVNA 4Q53A 4EV5A 4WYKB 4LYLB 1I3FA 1LRAA 2Y74A 2RCDA 4N6UA 3D9RA 4AKYA 1LQGC 2CK3H 2GSPA 4O8SA 1WMOA 4LMIA 1STDA 3A76A 3EBTA 2OQEA 3EQQB 3PCRA 2Y73A 3JUPA 4AKZA 1GMQA 2O3OA 1DMNA 1IT8A 1OHOA 1WNHA 5IF6A 3DUKA 3HI7A 3WR2A 3BIRA 2W9PA 1OF5B 1RGEA 1X1XA 2IUJA 2UX0A 3FH1A 1LNIA 1N8QA 1Q7HA 1TFKA 3SYUA 3RNTA 2UUGC 5KP1A 2FGTA 3CCE3 3CC73 2GEXA 2IMJA 3SOAA 3G0KA 3CME3 3CCJ3 2XR8B 3SXXA 1EEJA 1BNJA 3WOFB 2W56B 3LZAA 1HU9A 3GZBA 1X1YA 3HK4A 3G6E3 1X1UA 1FUSA 5JBSA 3FF0A 1L5GB 4K61A 3CMA3 4K1VA 3K9MC 1RRLA 4FMDA 2W2CA 3DGMA 4ZM8A 1S5AA 3FKAA 1VQ73 1KQS2 4NHFA 2BNGA 1UCIA 4PEJA 4U13A 1W4NA 1NWWA 4N6LA 3FSDA 3NV0A 2QA43 2CFLA 3WODG 2JQ5A 4HM4B 1A2VA 2XEPA 5D81A 1T3BA 1Q824 1PYLA 3PYJA 4KFDA 1KSIA 1JB4A 2K3DA 3NX0A 1YIJ3 1G0TA 2L4VA 1BSEA 2F98A 4R9KA 5DRVA 3SVAA 5BVBA 2BMRB 4LZIA 1OACA 3ROBA 1ZS7A 1BVIA 1B2UA 1CYVA 1O7WB 4HM3B 1MWUA 1PY3A 1JKGB 2P05A 3X41A 1G02A 1B21A 1BU4A 1LOWA 2AAEA 3DGYA 5ELJA 3FG1A 3WA2X 5TGNA 1QVF2 4WP5A 3AHWA 7GSPA 3NBBA 1BUJA 1DVDA 3WA3A 3CCS3 4HM5B 2Q07A 4R4KA 5CK6A 1S723 3BU4A 2V1LA 2Z76A 2H0IA 4MEIA 5AIIA 4J5GA 1RGLA 5EVHA 1W2ZA 4K90B 1GOVA 1I2GA 3RDEA 3MYTA 4RNYA 2M7OA 2YFLB 1NJI4 1RCLA 3PCSA 3LTCA 5KP4A 2CW9A 3B4OA 3SX1A 1UI8A 1RN7A 1EA2A 4TX4A 7RNTA 1UCJA 2ZL8A 4BTYA 4QWTA 3F9SA 1CH0A 1RRHA 4CDLA 1JZDA 1A2PA 1OPYA 5BIRA 1UUVB 3HZPA 3D4AA 1E3VA 2CWTA 3K0ZA 2HMLB 3HX8A 2GEYA 1RGKA 4MMXB 5AEUB 2QGUA 1YHQ3 2P0XA 1WMNA 1SIHA 4LSOA 2CX1A 4I4KA 3CCR3 1FW7A 4CJNA 3DMCA 3LTDA 4KFFA 1IVXA 1QAKA 1KD14 3N8BA 1DVCA 1JN5A 3J7Yd 3ALAA 3U1WA 5IENA 5ELUA 3V98A 1AVLA 4X2OA 2IA7A 3PS8A 1R4CA 1Q9EA 3GZYB 8CHOA 4HAAA 2PNCA 4FCZA 4IPBA 3N9HA 4BL3A 2L1SA 3V92A 2BMOB 1QMAA 1G96A 3CCU3 4JRFA 2F5MA 5BXQA 3B4PA 5G2GA 3CCV3 1QALA 2Z77A 3NQZA 2W0QA 4FMCA 4N3VA 4XBXA 1I2EA 5CF2A 3I0YA 3MG1A 1GY7A 1RGHA 4GSPA 4BTWA 3DGLA 3Q2PA 4WWUC 1RJOA 4HM2B 1D6UA 3Q90A 4CCVA 3MWZA 5IG0A 2KCDA 5FW5A 3G4S3 5EQLA 3EN1B 3AGNA 3PXMA 1OF5A 1B2SA 5JPPA 4J5KA 1Z1SA 2C4BA 1DE3A 4N6TA 2C11A 3F40A 3SLUA 2H0HA 2J8XB 1BRJA 1SIIA 3LTAA 3KSPA 1RKYA 5AEWB 2WOFA 4FR9A 4WFOA 1TRQA 2LYXA 3AGOA 3NQYA 3ZG0A 1YJN3 1IVWA 1M1XB 2KF5A 1VZZA 3IJEB 1AV4A 2XGLA 2WO0A 3WDGB 6GSPA 1OGXA 1RN4A 4HOHA 3QRDA 2STDA 2QIYA 3DM8A 3VF1A 5M19A 4HM1B 5AYRB 3KKGA 4HKVB 4DKIA 9RNTA 4GL6A 1M9GA 3KIIA 1D6ZA 1M904 1DMMA 2ZDJA 1VQ63 2CFWA 1FUTA 1RLSA 3EBYA 1FGMA 2P0MA 1OCVA 1B2XA 3MG2A 3UL5A 3HIIA 1ROVA 3A5EA 1US1A 2CX0A 3EN8A 4O3VA 1ASKA 3WHOA 4XM4A 4RNTA 3OW22 3BNDA 1VQL3 1B2ZA 1W00A 3KN4A 2RBIA 2ZA4A 1N9EA 1W6GA 3WOEB 3LTBA 2CKFB 1K9M4 2CC3A 2FNQA 2W9QA 1B20A 2YX9A 3JVCA 1RGFA 1BAOA 3PZWA 4KFEA 4OK0A 4R9LA 5HOHA 2D1WA 1IV7A 1NDOB 1YVBI 4FMBA 1GSPA 4MMYB 1B27A 1FZUA 1HYFA 1BSAA 3NBRA 3D5IA 3ZFZA 2OCTA 4L8PA 3BNEA 1DMQA 2XH9A 2SARA 3IMAB 1UCLA 3KZTA 3DGNA 2OOVC 1UGHI 1YNVX 2CG0A 3M8CA 3DY5A 1T2IA 4HZ9B 2YFIB 4XB5A 1VQ53 3EC9A 3OWUA 2BT3A 1YIT3 2JDIH 4O02B 1O7MB 2E2UA 1JBSA 1C54A 1K734 2F86B 3LT9A 1LOXA 3OWSA 1FYSA 4R1KA 5G1LA 1BRIA 4O2HA 1RGAA 2PZVA 2H0GA 2GU1A 3CNMA 3X3ZA 3S28A 1K8A4 1RMSA 1VQ83 2K54A 2F4YA 1JNQA 1IQYA 2YFJB 3MG3A 4X2HA 1AY7A 1T5YA 3K63A 3LMLA 3F7XA 1UCKA 2I9WA 1K41A 3Q1CA 1UI7A 5IEOA 3GZXB 2ZHXB 2OTJ3 4LGQA 1RTUA 2Z6BA 1WMPA 2IY2A 3CCQ3 5GSPA 1TIJA 2IUKA 1U8CB 2B1XB 3L0RA 2FXTA 1M1K4 1B3SA 4XDWA 1MWRA 1YGWA 5RNTA 1NNVA 1WQLB 2INXA 3ER7A 1FGRA 1O7NB 3BLZA 1BOXA 1LXEA 2KF3A 2XFTA 3GSPA 4EXRA 3DZLA 2OWPA 3G713 4K1UA 1C7HA 3RGRA 3JUNA 2IYJA 2HOHA 1IYYA 3OXAA 2MF7A 1JRQA 3EHCA 1I70A 2CFKA 2RFRA 2WOHA 4WYKA 1FGTA 3DH2A 2XGNA 3NXJA 1FA3A 3CCL3 1BSCA 4N6OB 4FCMA 5D82A 1E97A 2HMKB 4HZBB 1SARA 1VQN3 1GYBA 2CG1A 2W04A 2CIUA 2XSHB 2KF6A 1D6YA 1CQSA 1Y4KA 3FF2A 4HYZA 2D42A 1BNIA 2W6JH 2HMJB 3K7CA 1JB5A 5STDA 2A15A 3T8NA 3CPW2 3G8ZA 4HM8B 4XBYA 1WTHA 1W6YA 2RNTA 1U5OA 3DXOA 4EW5A 2F99A 1ZO2A 3CNXA 4KVHA 1VQQA 1YI23 2BMQB 1VQM3 3F14A 1SPUA 1RSNA 1X1WA 3E99A 2XSOB 3SEDA 5IEPA 2W56A 3BNCA 2CH9A 2HMMB 3B8LA 4H61A 5JPUA 1ISKA 5AIFA 2GBWB 1LQMB 3OV4A 1N5PA 2XF3A 1I3IA 1GD4A 2XRXB 4N6MA 5LC7A 3Q3FA 1BNGA 3AMOB 3PGBA 1T2HA 3D79A 4BU4A 1MGWA 1W7CA 3JUOA 3I553 1YGEA 3KE7A 4N6NB 1BRGA 5D83A 1GOYA 1TRPA 1I0VA 1BANA 3H3HA 2WGOA 4IIAA 1RCKA 2CWUA 2MC8A 4L8OA 1IQXA 4GHOA 3QK9A 1BGSA 2OQEC 5HGRA 1BNSA 1GOUA 2ML5A 1NO3A 5LC6A 1R4YA 1FUWA 1JKGA 1TFOA 1ZGXA 1OUNA 3CC43 4HM0B 4NPBA 1BUQA 4BIRA 1HKXA 3D5GA 4MMZB 2XFSA 3DGOA 3O8YA 1FGOA 5EEOA 5M18A 5AIGA 3FG3A 1TP6A 3AHSA 1N9JA 2GU3A 2GXFA 1JJ22 1CEWI 1Q42A 4ILFA 5I97A 3GWRA 1E3RA 2KXGA 3NM2A 2BO9B 2ML6A 1Q40B 1IVVA 4EV2A 5CF1A 4XBTA 3NHXA 1IVUA 5IW9A 3MSOA 1TUHA 4OUQA 3UJMA 3URPA 1LNHA 1UUWB 3FZWA 6RNTA 3F8XA 2QEX3 4NREA 1UDII 4L7KA 5IG4A 2O9UX 2K0MA 4R80A 1PU4A 3V99A 2KAAA 1N8R4 1ROAA 2BU4A 3EF8A 3G16A 3EJVA 1PFPA 3MHEA 4J9AA 1V57A 3WMDA 1RHLA 4FCJA 1A67A 1BNRA 1V58A 1BSBA 2GBXB 4OVMA 1IV9A 1ULIB 3F7SA 5IERA 3H51A 4MJDA 1EQKA 1O7GB 2OTL3 1IK3A 4STDA 2F56A 1Q814 1MWSA 2UGIA 1BRHA 3EE1A 5FGOA 3BNBA 2OOVA 2BIRA 1RGCA 1VQK3 2HMNB 1O7HB 4BTXA 4N6V0 1A2KA 1DETA 1OHSA 1BRKA 4EYCA 4LEHA 1Q864 1QAFA 2C10A 3HOHA 1BNEA 5IG5A 1F8NA 3OWYA 2LQVA 4HM7B 3N54B 1N5HA 3FCSB 3U97A 1GMRA 1A90A 2KF4A 1BRNL 1LVNA 4J8TA 1JV2B 1RDSA 2CFGA 3X3XA 3CPOA 1GY6A 5CLKA 3LOYA 2R41A 1YVSA 3JUMA 5A0OB 3KFQC 1GMPA 3NV0B 1NB5I 1VQ43 1JZOA 3S67A 3UL6A 1JB2A 1DYUA 3EX9A 1TU5A 1ZX2A 3LYGA 1W2B2 1IT7A 1MGRA 2R4IA 3SOYA 5IG3A 3FLJA 1HZ1A 3MPHA 1CYUA 1IQ8A 1AQZA 1TTOA 2B24B 2E2TA 1O7PB 3KSED 3LT8A 3X40A 3HIGA 4G1MB 1AVKA 1NU3A 5AIHA 4HJLB 3EB8A 1ULJB 3CU3A 2F5WA 1VQO3 3NM7A 5AYSC 1W5ZA 1YJ93 4JF8A 1SQWA 2Z7AA 3VSYA 1UUGB 4GB5A 4HBRA 1OH0A 3FGYA 2BHMA 1UGIA 2P38A 3T8UA 1BRSA 2E2VA 7STDA 1KC84 1EUIC 3CCM3 5BU4A 2HMOB 1QVG2 3CD63 1MOLA 4RNZA 1NB3I 2WGQA 3MKIA 2SBLA 1RN1A 3F8HA 3AMOA 1IDPA 1RNTA 4HM6B 4ORLA 3UNLA 3I563 1UW1A 1LOVA 3KCHA 4EBGA 1KWIA 3NBJA 4CPKA 1VQP3 1J2BA 1EG9B 5M1AA 5CXOA 4H3UA 5DREA 1JBRA 1IU7A 3FG4A 1BSDA 2RSXA 3LXUX 1GD3A 4BL2A 3CC23 1I2FA 1Q7Y4 3OX9A 1BNFA 4XDVA 3D3LA 4RBNA 1OGZA 3X3YA 2AADA 4FMAA 1W6CA 3NUVA 3B7CA 1GY5A 5AI1A 1AR0A 3S5CA 1STFI 3LH4A 8RNTA 1I0XA 3VGNA 3GZRA 3JUQA 3S29A 3CXC2 4IT7A 3S27A 1W02A 2CFDA 1RGGA 3ZG5A 1RNBA 1LOYA 3TDGA 3UB1A 1JBTA 1B2MA 1W01A 1OHPA
chains in the Genus database with same CATH topology
1QJGA 1SJWA 4WHAA 1JN5B 3STDA 1MNLA 4RZMA 1Q40A 3RGAA 2CWVA 5KP3A 3BB9A 3GAXA 4AEQA 4KZ1A 3X42A 2P09A 2KRTA 3ECFA 6STDA 1GS3A 3T0UA 1VQ93 2W03A 1K28A 1V74A 3GRDA 4EC6A 3K5TA 2RGQA 1FGQA 1YJW3 1EKMA 2CHCA 4EV5A 3IPTA 4HVNA 4Q53A 4WYKB 2Y74A 2RCDA 4N6UA 3D9RA 4AKYA 2CK3H 4O8SA 1WMOA 4LMIA 1STDA 3A76A 3EBTA 2OQEA 3EQQB 3PCRA 2Y73A 3JUPA 4AKZA 2O3OA 1DMNA 1IT8A 1OHOA 1WNHA 5IF6A 3DUKA 3HI7A 2W9PA 1OF5B 2IUJA 2UX0A 3FH1A 1N8QA 1TFKA 5KP1A 2FGTA 3CCE3 2GEXA 2IMJA 3SOAA 3G0KA 3CME3 3CCJ3 2XR8B 3SXXA 3WOFB 2W56B 3LZAA 1HU9A 3GZBA 3HK4A 3G6E3 5JBSA 3FF0A 1L5GB 4K61A 3CMA3 4K1VA 3K9MC 1RRLA 4FMDA 2W2CA 3DGMA 4ZM8A 1S5AA 3FKAA 1VQ73 1KQS2 4NHFA 2BNGA 4PEJA 4U13A 1W4NA 1NWWA 4N6LA 3FSDA 3NV0A 2QA43 2CFLA 2JQ5A 4HM4B 1A2VA 2XEPA 5D81A 3PYJA 4KFDA 1KSIA 1JB4A 3NX0A 1YIJ3 5BVBA 2L4VA 2F98A 4R9KA 5DRVA 3SVAA 1Q824 2BMRB 4LZIA 1OACA 3ROBA 1CYVA 1O7WB 4HM3B 3X41A 1JKGB 2P05A 5ELJA 3FG1A 3WA2X 5TGNA 1QVF2 4WP5A 3NBBA 1DVDA 3WA3A 3CCS3 4HM5B 2Q07A 4R4KA 5CK6A 1S723 2V1LA 2Z76A 4MEIA 5AIIA 5EVHA 1W2ZA 4K90B 3RDEA 3MYTA 4RNYA 2M7OA 2YFLB 1NJI4 3PCSA 3LTCA 5KP4A 2CW9A 3B4OA 3SX1A 1UI8A 1RN7A 1EA2A 4TX4A 2ZL8A 4BTYA 4QWTA 3F9SA 1RRHA 4CDLA 1OPYA 1UUVB 3HZPA 1E3VA 2CWTA 3K0ZA 2HMLB 3HX8A 2GEYA 4MMXB 5AEUB 2QGUA 1YHQ3 2P0XA 1WMNA 1SIHA 4LSOA 4I4KA 3CCR3 3DMCA 3LTDA 4KFFA 1IVXA 1QAKA 1KD14 3N8BA 1DVCA 1JN5A 3J7Yd 3ALAA 3U1WA 5IENA 5ELUA 3V98A 1AVLA 4X2OA 2IA7A 3PS8A 1R4CA 3GZYB 8CHOA 2PNCA 4FCZA 4IPBA 3N9HA 3V92A 2BMOB 1QMAA 1G96A 3CCU3 4JRFA 5BXQA 3B4PA 5G2GA 3CCV3 1QALA 2Z77A 3NQZA 2W0QA 4FMCA 4N3VA 4XBXA 5CF2A 3CC73 3I0YA 3MG1A 1GY7A 4BTWA 3DGLA 3Q2PA 4WWUC 1RJOA 4HM2B 1D6UA 3Q90A 4CCVA 3MWZA 5IG0A 2KCDA 5FW5A 3G4S3 5EQLA 3EN1B 3PXMA 1OF5A 5JPPA 1Z1SA 4N6TA 2C11A 3F40A 3SLUA 1SIIA 3LTAA 3KSPA 1RKYA 5AEWB 2WOFA 4FR9A 4WFOA 2LYXA 3NQYA 1YJN3 1IVWA 1M1XB 1VZZA 3IJEB 1AV4A 2XGLA 2WO0A 3WDGB 1OGXA 3QRDA 2STDA 2QIYA 3DM8A 3VF1A 4HM1B 5AYRB 3KKGA 4HKVB 4GL6A 1M9GA 3KIIA 1D6ZA 1M904 1DMMA 2ZDJA 1VQ63 2CFWA 3EBYA 1FGMA 2P0MA 1OCVA 3MG2A 3UL5A 3HIIA 1ROVA 1US1A 3EN8A 4O3VA 1ASKA 4XM4A 3OW22 1VQL3 3BNDA 1W00A 3KN4A 1N9EA 1W6GA 3WOEB 3LTBA 2CKFB 1K9M4 2CC3A 2FNQA 2W9QA 2YX9A 3JVCA 3PZWA 4KFEA 4OK0A 4R9LA 2D1WA 1IV7A 1NDOB 1YVBI 4FMBA 4MMYB 3NBRA 2OCTA 4L8PA 3BNEA 1DMQA 2XH9A 3IMAB 3KZTA 3DGNA 2OOVC 2CG0A 3M8CA 3DY5A 4HZ9B 4XB5A 2YFIB 1VQ53 3EC9A 3OWUA 2BT3A 1YIT3 2JDIH 4O02B 1O7MB 2E2UA 1K734 2F86B 3LT9A 1LOXA 3OWSA 4R1KA 4O2HA 2PZVA 2GU1A 3CNMA 3X3ZA 3S28A 1K8A4 1VQ83 2K54A 1JNQA 1IQYA 2YFJB 3MG3A 4X2HA 1T5YA 3K63A 3LMLA 3F7XA 2I9WA 3WODG 1K41A 3Q1CA 1UI7A 5IEOA 3GZXB 2OTJ3 4LGQA 2Z6BA 1WMPA 3CCQ3 1TIJA 2IUKA 1U8CB 2B1XB 3L0RA 2FXTA 1M1K4 4XDWA 1WQLB 2INXA 3ER7A 1FGRA 1O7NB 3BLZA 1LXEA 4EXRA 2XFTA 3DZLA 2OWPA 3G713 4K1UA 1C7HA 3RGRA 3JUNA 3OXAA 2MF7A 1JRQA 3EHCA 2CFKA 2RFRA 2WOHA 4WYKA 1FGTA 2XGNA 3NXJA 1FA3A 3CCL3 4N6OB 4FCMA 5D82A 1E97A 2HMKB 4HZBB 1VQN3 1GYBA 2CG1A 2W04A 2CIUA 2XSHB 1D6YA 1CQSA 1Y4KA 3FF2A 4HYZA 2D42A 2W6JH 2HMJB 3K7CA 1JB5A 5STDA 2A15A 3T8NA 3CPW2 3G8ZA 4HM8B 4XBYA 1WTHA 1W6YA 1U5OA 3DXOA 2F99A 1ZO2A 3CNXA 4KVHA 1YI23 2BMQB 1VQM3 3F14A 1SPUA 3E99A 3SEDA 5IEPA 2XSOB 2W56A 3BNCA 2CH9A 2HMMB 3B8LA 4H61A 5JPUA 1ISKA 5AIFA 2GBWB 3OV4A 1N5PA 2XF3A 2XRXB 1GD4A 4N6MA 5LC7A 3PGBA 3AMOB 1W7CA 3JUOA 3I553 1YGEA 3KE7A 4N6NB 5D83A 3H3HA 2WGOA 4IIAA 2CWUA 2MC8A 4L8OA 1IQXA 3QK9A 2OQEC 5HGRA 2ML5A 1NO3A 5LC6A 1FUWA 1JKGA 1TFOA 3CC43 1OUNA 4HM0B 1BUQA 1HKXA 4MMZB 2XFSA 3DGOA 3O8YA 1FGOA 5EEOA 5AIGA 3FG3A 1TP6A 1N9JA 2GU3A 2GXFA 1JJ22 1CEWI 1Q42A 5I97A 3GWRA 1E3RA 2KXGA 3NM2A 2BO9B 2ML6A 1Q40B 1IVVA 4EV2A 5CF1A 4XBTA 3NHXA 1IVUA 5IW9A 3MSOA 1TUHA 4OUQA 3UJMA 1LNHA 1UUWB 3FZWA 3F8XA 2QEX3 4NREA 4L7KA 5IG4A 2O9UX 2K0MA 4R80A 1PU4A 3V99A 1N8R4 1ROAA 3EF8A 3G16A 3EJVA 1PFPA 3MHEA 4J9AA 3WMDA 4FCJA 1A67A 2GBXB 4OVMA 1IV9A 1ULIB 3F7SA 5IERA 3H51A 4MJDA 1EQKA 1O7GB 2OTL3 1IK3A 4STDA 1Q814 3EE1A 5FGOA 3BNBA 2OOVA 1VQK3 2HMNB 1O7HB 4BTXA 4N6V0 1A2KA 1OHSA 4EYCA 4LEHA 1Q864 1QAFA 2C10A 5IG5A 1F8NA 3OWYA 2LQVA 4HM7B 3N54B 1N5HA 3FCSB 3U97A 1A90A 1LVNA 4J8TA 1JV2B 2CFGA 3X3XA 3CPOA 1GY6A 5CLKA 3LOYA 3JUMA 5A0OB 3KFQC 3NV0B 1NB5I 1VQ43 3S67A 3UL6A 1JB2A 1DYUA 3EX9A 1TU5A 1ZX2A 3LYGA 1W2B2 1IT7A 2R4IA 3SOYA 5IG3A 3FLJA 1CYUA 3MPHA 1IQ8A 2E2TA 2B24B 3KSED 3LT8A 1O7PB 3X40A 3HIGA 4G1MB 1AVKA 1NU3A 5AIHA 4HJLB 3EB8A 1ULJB 3CU3A 1VQO3 3NM7A 5AYSC 1W5ZA 1YJ93 4JF8A 1SQWA 2Z7AA 3VSYA 4GB5A 4HBRA 1OH0A 3FGYA 2BHMA 3T8UA 2P38A 7STDA 2E2VA 1KC84 3CCM3 2HMOB 1QVG2 3CD63 1MOLA 4RNZA 1NB3I 2WGQA 3MKIA 2SBLA 3UNLA 3F8HA 3AMOA 1IDPA 4ORLA 4HM6B 3I563 1UW1A 4EBGA 1KWIA 3NBJA 1VQP3 1J2BA 1EG9B 5CXOA 4H3UA 5DREA 1IU7A 3FG4A 3CC23 2RSXA 3LXUX 1GD3A 1Q7Y4 3OX9A 4XDVA 3D3LA 4RBNA 1OGZA 3X3YA 4FMAA 1W6CA 3NUVA 3B7CA 1GY5A 5AI1A 1AR0A 3S5CA 1STFI 3LH4A 3VGNA 3GZRA 3JUQA 3S29A 3CXC2 4IT7A 3S27A 1W02A 2CFDA 3TDGA 3UB1A 1W01A 1OHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJG A;  1SJW A;  3STD A;  1JN5 B;  4RZM A;  1Q40 A;  3RGA A;  5KP3 A;  3BB9 A;  3ECF A;  6STD A;  1GS3 A;  3GRD A;  2RGQ A;  2CHC A;  3IPT A;  4HVN A;  4Q53 A;  4WYK B;  2RCD A;  3D9R A;  4LMI A;  1STD A;  3A76 A;  3EBT A;  3EQQ B;  3JUP A;  1DMN A;  1OHO A;  5IF6 A;  3DUK A;  1OF5 B;  2UX0 A;  3FH1 A;  5KP1 A;  2GEX A;  2IMJ A;  3SOA A;  3G0K A;  2XR8 B;  3LZA A;  3HK4 A;  3GZB A;  3FF0 A;  4K1V A;  2W2C A;  1S5A A;  3FKA A;  2BNG A;  4PEJ A;  4U13 A;  1NWW A;  3FSD A;  3NV0 A;  2JQ5 A;  4HM4 B;  5D81 A;  1JB4 A;  5BVB A;  2F98 A;  4R9K A;  5DRV A;  2BMR B;  3ROB A;  1O7W B;  4HM3 B;  1JKG B;  5TGN A;  4WP5 A;  4HM5 B;  5CK6 A;  2Z76 A;  5AII A;  5EVH A;  3MYT A;  2YFL B;  5KP4 A;  3B4O A;  1EA2 A;  3F9S A;  4CDL A;  1OPY A;  1UUV B;  3HZP A;  1E3V A;  3K0Z A;  2HML B;  3HX8 A;  2GEY A;  5AEU B;  2QGU A;  4I4K A;  3DMC A;  1JN5 A;  5IEN A;  4X2O A;  3GZY B;  8CHO A;  2BMO B;  1QMA A;  5BXQ A;  3B4P A;  5G2G A;  2Z77 A;  4XBX A;  4N3V A;  5CF2 A;  3I0Y A;  3MG1 A;  1GY7 A;  4WWU C;  4HM2 B;  3Q90 A;  5IG0 A;  5FW5 A;  3EN1 B;  1OF5 A;  5JPP A;  1Z1S A;  3F40 A;  3KSP A;  5AEW B;  1VZZ A;  1OGX A;  2STD A;  2QIY A;  3DM8 A;  4HM1 B;  3KKG A;  4HKV B;  1DMM A;  3EBY A;  1OCV A;  3MG2 A;  3EN8 A;  1ASK A;  4XM4 A;  1W00 A;  2CKF B;  4R9L A;  1NDO B;  3NBR A;  4L8P A;  1DMQ A;  3KZT A;  3M8C A;  4HZ9 B;  4XB5 A;  2YFI B;  3EC9 A;  3OWU A;  1O7M B;  2F86 B;  3OWS A;  4R1K A;  2PZV A;  3CNM A;  2K54 A;  2YFJ B;  3MG3 A;  4X2H A;  3F7X A;  2I9W A;  1K41 A;  5IEO A;  3GZX B;  4LGQ A;  2B1X B;  4XDW A;  1WQL B;  2INX A;  3ER7 A;  1O7N B;  3BLZ A;  3DZL A;  2OWP A;  4K1U A;  1C7H A;  3RGR A;  3JUN A;  3OXA A;  3EHC A;  2RFR A;  4WYK A;  3NXJ A;  4FCM A;  5D82 A;  1E97 A;  2HMK B;  4HZB B;  1GYB A;  2XSH B;  1CQS A;  3FF2 A;  2HMJ B;  3K7C A;  1JB5 A;  5STD A;  2A15 A;  3T8N A;  3G8Z A;  4HM8 B;  4XBY A;  1W6Y A;  1U5O A;  3DXO A;  2F99 A;  1ZO2 A;  3CNX A;  4KVH A;  2BMQ B;  3F14 A;  3E99 A;  3SED A;  5IEP A;  2XSO B;  1ISK A;  2HMM B;  3B8L A;  5JPU A;  5AIF A;  2GBW B;  3OV4 A;  2XRX B;  3JUO A;  3KE7 A;  5D83 A;  3H3H A;  4IIA A;  4L8O A;  5HGR A;  1JKG A;  1OUN A;  4HM0 B;  1BUQ A;  1HKX A;  5AIG A;  1TP6 A;  2GXF A;  1Q42 A;  3GWR A;  3NM2 A;  1E3R A;  1Q40 B;  5CF1 A;  4XBT A;  3NHX A;  3MSO A;  1TUH A;  4OUQ A;  3UJM A;  1UUW B;  3FZW A;  3F8X A;  4L7K A;  5IG4 A;  3EF8 A;  3G16 A;  3EJV A;  3WMD A;  3MHE A;  4J9A A;  4FCJ A;  2GBX B;  4OVM A;  1ULI B;  3F7S A;  5IER A;  3H51 A;  4MJD A;  1O7G B;  4STD A;  2HMN B;  1O7H B;  1A2K A;  1OHS A;  4LEH A;  5IG5 A;  3OWY A;  4HM7 B;  4J8T A;  3CPO A;  1GY6 A;  5CLK A;  3JUM A;  3NV0 B;  1JB2 A;  3EX9 A;  1ZX2 A;  3LYG A;  2R4I A;  3SOY A;  5IG3 A;  3FLJ A;  2B24 B;  1O7P B;  1NU3 A;  5AIH A;  4HJL B;  1ULJ B;  3CU3 A;  2Z7A A;  3VSY A;  4GB5 A;  1OH0 A;  3FGY A;  3T8U A;  7STD A;  2HMO B;  3MKI A;  3UNL A;  3F8H A;  1IDP A;  4ORL A;  4HM6 B;  1EG9 B;  5CXO A;  4H3U A;  5DRE A;  3OX9 A;  4XDV A;  1OGZ A;  3NUV A;  3B7C A;  1GY5 A;  5AI1 A;  1AR0 A;  3S5C A;  3VGN A;  3GZR A;  3JUQ A;  1W02 A;  1W01 A;  1OHP A; 
#chains in the Genus database with same CATH topology
 4I5Q A;  1QJG A;  1SJW A;  4WHA A;  1JN5 B;  3STD A;  1MNL A;  4RZM A;  1Q40 A;  3RGA A;  2CWV A;  5KP3 A;  3BB9 A;  3GAX A;  5G1K A;  4KZ1 A;  4AEQ A;  3X42 A;  2P09 A;  2KRT A;  3ECF A;  6STD A;  1GS3 A;  3T0U A;  1TJD A;  1VQ9 3;  2W03 A;  4KT3 B;  1K28 A;  1V74 A;  3GRD A;  1BIR A;  4EC6 A;  3K5T A;  2RGQ A;  1FGQ A;  1YJW 3;  1EKM A;  1I8V A;  1MWT A;  2CHC A;  3IPT A;  4HVN A;  4Q53 A;  4EV5 A;  4WYK B;  4LYL B;  1I3F A;  1LRA A;  2Y74 A;  2RCD A;  4N6U A;  3D9R A;  4AKY A;  1LQG C;  2CK3 H;  2GSP A;  4O8S A;  1WMO A;  4LMI A;  1STD A;  3A76 A;  3EBT A;  2OQE A;  3EQQ B;  3PCR A;  2Y73 A;  3JUP A;  4AKZ A;  1GMQ A;  2O3O A;  1DMN A;  1IT8 A;  1OHO A;  1WNH A;  5IF6 A;  3DUK A;  3HI7 A;  3WR2 A;  3BIR A;  2W9P A;  1OF5 B;  1RGE A;  1X1X A;  2IUJ A;  2UX0 A;  3FH1 A;  1LNI A;  1N8Q A;  1Q7H A;  1TFK A;  3SYU A;  3RNT A;  2UUG C;  5KP1 A;  2FGT A;  3CCE 3;  3CC7 3;  2GEX A;  2IMJ A;  3SOA A;  3G0K A;  3CME 3;  3CCJ 3;  2XR8 B;  3SXX A;  1EEJ A;  1BNJ A;  3WOF B;  2W56 B;  3LZA A;  1HU9 A;  3GZB A;  1X1Y A;  3HK4 A;  3G6E 3;  1X1U A;  1FUS A;  5JBS A;  3FF0 A;  1L5G B;  4K61 A;  3CMA 3;  4K1V A;  3K9M C;  1RRL A;  4FMD A;  2W2C A;  3DGM A;  4ZM8 A;  1S5A A;  3FKA A;  1VQ7 3;  1KQS 2;  4NHF A;  2BNG A;  1UCI A;  4PEJ A;  4U13 A;  1W4N A;  1NWW A;  4N6L A;  3FSD A;  3NV0 A;  2QA4 3;  2CFL A;  3WOD G;  2JQ5 A;  4HM4 B;  1A2V A;  2XEP A;  5D81 A;  1T3B A;  1Q82 4;  1PYL A;  3PYJ A;  4KFD A;  1KSI A;  1JB4 A;  2K3D A;  3NX0 A;  1YIJ 3;  1G0T A;  2L4V A;  1BSE A;  2F98 A;  4R9K A;  5DRV A;  3SVA A;  5BVB A;  2BMR B;  4LZI A;  1OAC A;  3ROB A;  1ZS7 A;  1BVI A;  1B2U A;  1CYV A;  1O7W B;  4HM3 B;  1MWU A;  1PY3 A;  1JKG B;  2P05 A;  3X41 A;  1G02 A;  1B21 A;  1BU4 A;  1LOW A;  2AAE A;  3DGY A;  5ELJ A;  3FG1 A;  3WA2 X;  5TGN A;  1QVF 2;  4WP5 A;  3AHW A;  7GSP A;  3NBB A;  1BUJ A;  1DVD A;  3WA3 A;  3CCS 3;  4HM5 B;  2Q07 A;  4R4K A;  5CK6 A;  1S72 3;  3BU4 A;  2V1L A;  2Z76 A;  2H0I A;  4MEI A;  5AII A;  4J5G A;  1RGL A;  5EVH A;  1W2Z A;  4K90 B;  1GOV A;  1I2G A;  3RDE A;  3MYT A;  4RNY A;  2M7O A;  2YFL B;  1NJI 4;  1RCL A;  3PCS A;  3LTC A;  5KP4 A;  2CW9 A;  3B4O A;  3SX1 A;  1UI8 A;  1RN7 A;  1EA2 A;  4TX4 A;  7RNT A;  1UCJ A;  2ZL8 A;  4BTY A;  4QWT A;  3F9S A;  1CH0 A;  1RRH A;  4CDL A;  1JZD A;  1A2P A;  1OPY A;  5BIR A;  1UUV B;  3HZP A;  3D4A A;  1E3V A;  2CWT A;  3K0Z A;  2HML B;  3HX8 A;  2GEY A;  1RGK A;  4MMX B;  5AEU B;  2QGU A;  1YHQ 3;  2P0X A;  1WMN A;  1SIH A;  4LSO A;  2CX1 A;  4I4K A;  3CCR 3;  1FW7 A;  4CJN A;  3DMC A;  3LTD A;  4KFF A;  1IVX A;  1QAK A;  1KD1 4;  3N8B A;  1DVC A;  1JN5 A;  3J7Y d;  3ALA A;  3U1W A;  5IEN A;  5ELU A;  3V98 A;  1AVL A;  4X2O A;  2IA7 A;  3PS8 A;  1R4C A;  1Q9E A;  3GZY B;  8CHO A;  4HAA A;  2PNC A;  4FCZ A;  4IPB A;  3N9H A;  4BL3 A;  2L1S A;  3V92 A;  2BMO B;  1QMA A;  1G96 A;  3CCU 3;  4JRF A;  2F5M A;  5BXQ A;  3B4P A;  5G2G A;  3CCV 3;  1QAL A;  2Z77 A;  3NQZ A;  2W0Q A;  4FMC A;  4N3V A;  4XBX A;  1I2E A;  5CF2 A;  3I0Y A;  3MG1 A;  1GY7 A;  1RGH A;  4GSP A;  4BTW A;  3DGL A;  3Q2P A;  4WWU C;  1RJO A;  4HM2 B;  1D6U A;  3Q90 A;  4CCV A;  3MWZ A;  5IG0 A;  2KCD A;  5FW5 A;  3G4S 3;  5EQL A;  3EN1 B;  3AGN A;  3PXM A;  1OF5 A;  1B2S A;  5JPP A;  4J5K A;  1Z1S A;  2C4B A;  1DE3 A;  4N6T A;  2C11 A;  3F40 A;  3SLU A;  2H0H A;  2J8X B;  1BRJ A;  1SII A;  3LTA A;  3KSP A;  1RKY A;  5AEW B;  2WOF A;  4FR9 A;  4WFO A;  1TRQ A;  2LYX A;  3AGO A;  3NQY A;  3ZG0 A;  1YJN 3;  1IVW A;  1M1X B;  2KF5 A;  1VZZ A;  3IJE B;  1AV4 A;  2XGL A;  2WO0 A;  3WDG B;  6GSP A;  1OGX A;  1RN4 A;  4HOH A;  3QRD A;  2STD A;  2QIY A;  3DM8 A;  3VF1 A;  5M19 A;  4HM1 B;  5AYR B;  3KKG A;  4HKV B;  4DKI A;  9RNT A;  4GL6 A;  1M9G A;  3KII A;  1D6Z A;  1M90 4;  1DMM A;  2ZDJ A;  1VQ6 3;  2CFW A;  1FUT A;  1RLS A;  3EBY A;  1FGM A;  2P0M A;  1OCV A;  1B2X A;  3MG2 A;  3UL5 A;  3HII A;  1ROV A;  3A5E A;  1US1 A;  2CX0 A;  3EN8 A;  4O3V A;  1ASK A;  3WHO A;  4XM4 A;  4RNT A;  3OW2 2;  3BND A;  1VQL 3;  1B2Z A;  1W00 A;  3KN4 A;  2RBI A;  2ZA4 A;  1N9E A;  1W6G A;  3WOE B;  3LTB A;  2CKF B;  1K9M 4;  2CC3 A;  2FNQ A;  2W9Q A;  1B20 A;  2YX9 A;  3JVC A;  1RGF A;  1BAO A;  3PZW A;  4KFE A;  4OK0 A;  4R9L A;  5HOH A;  2D1W A;  1IV7 A;  1NDO B;  1YVB I;  4FMB A;  1GSP A;  4MMY B;  1B27 A;  1FZU A;  1HYF A;  1BSA A;  3NBR A;  3D5I A;  3ZFZ A;  2OCT A;  4L8P A;  3BNE A;  1DMQ A;  2XH9 A;  2SAR A;  3IMA B;  1UCL A;  3KZT A;  3DGN A;  2OOV C;  1UGH I;  1YNV X;  2CG0 A;  3M8C A;  3DY5 A;  1T2I A;  4HZ9 B;  2YFI B;  4XB5 A;  1VQ5 3;  3EC9 A;  3OWU A;  2BT3 A;  1YIT 3;  2JDI H;  4O02 B;  1O7M B;  2E2U A;  1JBS A;  1C54 A;  1K73 4;  2F86 B;  3LT9 A;  1LOX A;  3OWS A;  1FYS A;  4R1K A;  5G1L A;  1BRI A;  4O2H A;  1RGA A;  2PZV A;  2H0G A;  2GU1 A;  3CNM A;  3X3Z A;  3S28 A;  1K8A 4;  1RMS A;  1VQ8 3;  2K54 A;  2F4Y A;  1JNQ A;  1IQY A;  2YFJ B;  3MG3 A;  4X2H A;  1AY7 A;  1T5Y A;  3K63 A;  3LML A;  3F7X A;  1UCK A;  2I9W A;  1K41 A;  3Q1C A;  1UI7 A;  5IEO A;  3GZX B;  2ZHX B;  2OTJ 3;  4LGQ A;  1RTU A;  2Z6B A;  1WMP A;  2IY2 A;  3CCQ 3;  5GSP A;  1TIJ A;  2IUK A;  1U8C B;  2B1X B;  3L0R A;  2FXT A;  1M1K 4;  1B3S A;  4XDW A;  1MWR A;  1YGW A;  5RNT A;  1NNV A;  1WQL B;  2INX A;  3ER7 A;  1FGR A;  1O7N B;  3BLZ A;  1BOX A;  1LXE A;  2KF3 A;  2XFT A;  3GSP A;  4EXR A;  3DZL A;  2OWP A;  3G71 3;  4K1U A;  1C7H A;  3RGR A;  3JUN A;  2IYJ A;  2HOH A;  1IYY A;  3OXA A;  2MF7 A;  1JRQ A;  3EHC A;  1I70 A;  2CFK A;  2RFR A;  2WOH A;  4WYK A;  1FGT A;  3DH2 A;  2XGN A;  3NXJ A;  1FA3 A;  3CCL 3;  1BSC A;  4N6O B;  4FCM A;  5D82 A;  1E97 A;  2HMK B;  4HZB B;  1SAR A;  1VQN 3;  1GYB A;  2CG1 A;  2W04 A;  2CIU A;  2XSH B;  2KF6 A;  1D6Y A;  1CQS A;  1Y4K A;  3FF2 A;  4HYZ A;  2D42 A;  1BNI A;  2W6J H;  2HMJ B;  3K7C A;  1JB5 A;  5STD A;  2A15 A;  3T8N A;  3CPW 2;  3G8Z A;  4HM8 B;  4XBY A;  1WTH A;  1W6Y A;  2RNT A;  1U5O A;  3DXO A;  4EW5 A;  2F99 A;  1ZO2 A;  3CNX A;  4KVH A;  1VQQ A;  1YI2 3;  2BMQ B;  1VQM 3;  3F14 A;  1SPU A;  1RSN A;  1X1W A;  3E99 A;  2XSO B;  3SED A;  5IEP A;  2W56 A;  3BNC A;  2CH9 A;  2HMM B;  3B8L A;  4H61 A;  5JPU A;  1ISK A;  5AIF A;  2GBW B;  1LQM B;  3OV4 A;  1N5P A;  2XF3 A;  1I3I A;  1GD4 A;  2XRX B;  4N6M A;  5LC7 A;  3Q3F A;  1BNG A;  3AMO B;  3PGB A;  1T2H A;  3D79 A;  4BU4 A;  1MGW A;  1W7C A;  3JUO A;  3I55 3;  1YGE A;  3KE7 A;  4N6N B;  1BRG A;  5D83 A;  1GOY A;  1TRP A;  1I0V A;  1BAN A;  3H3H A;  2WGO A;  4IIA A;  1RCK A;  2CWU A;  2MC8 A;  4L8O A;  1IQX A;  4GHO A;  3QK9 A;  1BGS A;  2OQE C;  5HGR A;  1BNS A;  1GOU A;  2ML5 A;  1NO3 A;  5LC6 A;  1R4Y A;  1FUW A;  1JKG A;  1TFO A;  1ZGX A;  1OUN A;  3CC4 3;  4HM0 B;  4NPB A;  1BUQ A;  4BIR A;  1HKX A;  3D5G A;  4MMZ B;  2XFS A;  3DGO A;  3O8Y A;  1FGO A;  5EEO A;  5M18 A;  5AIG A;  3FG3 A;  1TP6 A;  3AHS A;  1N9J A;  2GU3 A;  2GXF A;  1JJ2 2;  1CEW I;  1Q42 A;  4ILF A;  5I97 A;  3GWR A;  1E3R A;  2KXG A;  3NM2 A;  2BO9 B;  2ML6 A;  1Q40 B;  1IVV A;  4EV2 A;  5CF1 A;  4XBT A;  3NHX A;  1IVU A;  5IW9 A;  3MSO A;  1TUH A;  4OUQ A;  3UJM A;  3URP A;  1LNH A;  1UUW B;  3FZW A;  6RNT A;  3F8X A;  2QEX 3;  4NRE A;  1UDI I;  4L7K A;  5IG4 A;  2O9U X;  2K0M A;  4R80 A;  1PU4 A;  3V99 A;  2KAA A;  1N8R 4;  1ROA A;  2BU4 A;  3EF8 A;  3G16 A;  3EJV A;  1PFP A;  3MHE A;  4J9A A;  1V57 A;  3WMD A;  1RHL A;  4FCJ A;  1A67 A;  1BNR A;  1V58 A;  1BSB A;  2GBX B;  4OVM A;  1IV9 A;  1ULI B;  3F7S A;  5IER A;  3H51 A;  4MJD A;  1EQK A;  1O7G B;  2OTL 3;  1IK3 A;  4STD A;  2F56 A;  1Q81 4;  1MWS A;  2UGI A;  1BRH A;  3EE1 A;  5FGO A;  3BNB A;  2OOV A;  2BIR A;  1RGC A;  1VQK 3;  2HMN B;  1O7H B;  4BTX A;  4N6V 0;  1A2K A;  1DET A;  1OHS A;  1BRK A;  4EYC A;  4LEH A;  1Q86 4;  1QAF A;  2C10 A;  3HOH A;  1BNE A;  5IG5 A;  1F8N A;  3OWY A;  2LQV A;  4HM7 B;  3N54 B;  1N5H A;  3FCS B;  3U97 A;  1GMR A;  1A90 A;  2KF4 A;  1BRN L;  1LVN A;  4J8T A;  1JV2 B;  1RDS A;  2CFG A;  3X3X A;  3CPO A;  1GY6 A;  5CLK A;  3LOY A;  2R41 A;  1YVS A;  3JUM A;  5A0O B;  3KFQ C;  1GMP A;  3NV0 B;  1NB5 I;  1VQ4 3;  1JZO A;  3S67 A;  3UL6 A;  1JB2 A;  1DYU A;  3EX9 A;  1TU5 A;  1ZX2 A;  3LYG A;  1W2B 2;  1IT7 A;  1MGR A;  2R4I A;  3SOY A;  5IG3 A;  3FLJ A;  1HZ1 A;  3MPH A;  1CYU A;  1IQ8 A;  1AQZ A;  1TTO A;  2B24 B;  2E2T A;  1O7P B;  3KSE D;  3LT8 A;  3X40 A;  3HIG A;  4G1M B;  1AVK A;  1NU3 A;  5AIH A;  4HJL B;  3EB8 A;  1ULJ B;  3CU3 A;  2F5W A;  1VQO 3;  3NM7 A;  5AYS C;  1W5Z A;  1YJ9 3;  4JF8 A;  1SQW A;  2Z7A A;  3VSY A;  1UUG B;  4GB5 A;  4HBR A;  1OH0 A;  3FGY A;  2BHM A;  1UGI A;  2P38 A;  3T8U A;  1BRS A;  2E2V A;  7STD A;  1KC8 4;  1EUI C;  3CCM 3;  5BU4 A;  2HMO B;  1QVG 2;  3CD6 3;  1MOL A;  4RNZ A;  1NB3 I;  2WGQ A;  3MKI A;  2SBL A;  1RN1 A;  3F8H A;  3AMO A;  1IDP A;  1RNT A;  4HM6 B;  4ORL A;  3UNL A;  3I56 3;  1UW1 A;  1LOV A;  3KCH A;  4EBG A;  1KWI A;  3NBJ A;  4CPK A;  1VQP 3;  1J2B A;  1EG9 B;  5M1A A;  5CXO A;  4H3U A;  5DRE A;  1JBR A;  1IU7 A;  3FG4 A;  1BSD A;  2RSX A;  3LXU X;  1GD3 A;  4BL2 A;  3CC2 3;  1I2F A;  1Q7Y 4;  3OX9 A;  1BNF A;  4XDV A;  3D3L A;  4RBN A;  1OGZ A;  3X3Y A;  2AAD A;  4FMA A;  1W6C A;  3NUV A;  3B7C A;  1GY5 A;  5AI1 A;  1AR0 A;  3S5C A;  1STF I;  3LH4 A;  8RNT A;  1I0X A;  3VGN A;  3GZR A;  3JUQ A;  3S29 A;  3CXC 2;  4IT7 A;  3S27 A;  1W02 A;  2CFD A;  1RGG A;  3ZG5 A;  1RNB A;  1LOY A;  3TDG A;  3UB1 A;  1JBT A;  1B2M A;  1W01 A;  1OHP A; 
#chains in the Genus database with same CATH homology
 1QJG A;  1SJW A;  4WHA A;  1JN5 B;  3STD A;  1MNL A;  4RZM A;  1Q40 A;  3RGA A;  2CWV A;  5KP3 A;  3BB9 A;  3GAX A;  4AEQ A;  4KZ1 A;  3X42 A;  2P09 A;  2KRT A;  3ECF A;  6STD A;  1GS3 A;  3T0U A;  1VQ9 3;  2W03 A;  1K28 A;  1V74 A;  3GRD A;  4EC6 A;  3K5T A;  2RGQ A;  1FGQ A;  1YJW 3;  1EKM A;  2CHC A;  4EV5 A;  3IPT A;  4HVN A;  4Q53 A;  4WYK B;  2Y74 A;  2RCD A;  4N6U A;  3D9R A;  4AKY A;  2CK3 H;  4O8S A;  1WMO A;  4LMI A;  1STD A;  3A76 A;  3EBT A;  2OQE A;  3EQQ B;  3PCR A;  2Y73 A;  3JUP A;  4AKZ A;  2O3O A;  1DMN A;  1IT8 A;  1OHO A;  1WNH A;  5IF6 A;  3DUK A;  3HI7 A;  2W9P A;  1OF5 B;  2IUJ A;  2UX0 A;  3FH1 A;  1N8Q A;  1TFK A;  5KP1 A;  2FGT A;  3CCE 3;  2GEX A;  2IMJ A;  3SOA A;  3G0K A;  3CME 3;  3CCJ 3;  2XR8 B;  3SXX A;  3WOF B;  2W56 B;  3LZA A;  1HU9 A;  3GZB A;  3HK4 A;  3G6E 3;  5JBS A;  3FF0 A;  1L5G B;  4K61 A;  3CMA 3;  4K1V A;  3K9M C;  1RRL A;  4FMD A;  2W2C A;  3DGM A;  4ZM8 A;  1S5A A;  3FKA A;  1VQ7 3;  1KQS 2;  4NHF A;  2BNG A;  4PEJ A;  4U13 A;  1W4N A;  1NWW A;  4N6L A;  3FSD A;  3NV0 A;  2QA4 3;  2CFL A;  2JQ5 A;  4HM4 B;  1A2V A;  2XEP A;  5D81 A;  3PYJ A;  4KFD A;  1KSI A;  1JB4 A;  3NX0 A;  1YIJ 3;  5BVB A;  2L4V A;  2F98 A;  4R9K A;  5DRV A;  3SVA A;  1Q82 4;  2BMR B;  4LZI A;  1OAC A;  3ROB A;  1CYV A;  1O7W B;  4HM3 B;  3X41 A;  1JKG B;  2P05 A;  5ELJ A;  3FG1 A;  3WA2 X;  5TGN A;  1QVF 2;  4WP5 A;  3NBB A;  1DVD A;  3WA3 A;  3CCS 3;  4HM5 B;  2Q07 A;  4R4K A;  5CK6 A;  1S72 3;  2V1L A;  2Z76 A;  4MEI A;  5AII A;  5EVH A;  1W2Z A;  4K90 B;  3RDE A;  3MYT A;  4RNY A;  2M7O A;  2YFL B;  1NJI 4;  3PCS A;  3LTC A;  5KP4 A;  2CW9 A;  3B4O A;  3SX1 A;  1UI8 A;  1RN7 A;  1EA2 A;  4TX4 A;  2ZL8 A;  4BTY A;  4QWT A;  3F9S A;  1RRH A;  4CDL A;  1OPY A;  1UUV B;  3HZP A;  1E3V A;  2CWT A;  3K0Z A;  2HML B;  3HX8 A;  2GEY A;  4MMX B;  5AEU B;  2QGU A;  1YHQ 3;  2P0X A;  1WMN A;  1SIH A;  4LSO A;  4I4K A;  3CCR 3;  3DMC A;  3LTD A;  4KFF A;  1IVX A;  1QAK A;  1KD1 4;  3N8B A;  1DVC A;  1JN5 A;  3J7Y d;  3ALA A;  3U1W A;  5IEN A;  5ELU A;  3V98 A;  1AVL A;  4X2O A;  2IA7 A;  3PS8 A;  1R4C A;  3GZY B;  8CHO A;  2PNC A;  4FCZ A;  4IPB A;  3N9H A;  3V92 A;  2BMO B;  1QMA A;  1G96 A;  3CCU 3;  4JRF A;  5BXQ A;  3B4P A;  5G2G A;  3CCV 3;  1QAL A;  2Z77 A;  3NQZ A;  2W0Q A;  4FMC A;  4N3V A;  4XBX A;  5CF2 A;  3CC7 3;  3I0Y A;  3MG1 A;  1GY7 A;  4BTW A;  3DGL A;  3Q2P A;  4WWU C;  1RJO A;  4HM2 B;  1D6U A;  3Q90 A;  4CCV A;  3MWZ A;  5IG0 A;  2KCD A;  5FW5 A;  3G4S 3;  5EQL A;  3EN1 B;  3PXM A;  1OF5 A;  5JPP A;  1Z1S A;  4N6T A;  2C11 A;  3F40 A;  3SLU A;  1SII A;  3LTA A;  3KSP A;  1RKY A;  5AEW B;  2WOF A;  4FR9 A;  4WFO A;  2LYX A;  3NQY A;  1YJN 3;  1IVW A;  1M1X B;  1VZZ A;  3IJE B;  1AV4 A;  2XGL A;  2WO0 A;  3WDG B;  1OGX A;  3QRD A;  2STD A;  2QIY A;  3DM8 A;  3VF1 A;  4HM1 B;  5AYR B;  3KKG A;  4HKV B;  4GL6 A;  1M9G A;  3KII A;  1D6Z A;  1M90 4;  1DMM A;  2ZDJ A;  1VQ6 3;  2CFW A;  3EBY A;  1FGM A;  2P0M A;  1OCV A;  3MG2 A;  3UL5 A;  3HII A;  1ROV A;  1US1 A;  3EN8 A;  4O3V A;  1ASK A;  4XM4 A;  3OW2 2;  1VQL 3;  3BND A;  1W00 A;  3KN4 A;  1N9E A;  1W6G A;  3WOE B;  3LTB A;  2CKF B;  1K9M 4;  2CC3 A;  2FNQ A;  2W9Q A;  2YX9 A;  3JVC A;  3PZW A;  4KFE A;  4OK0 A;  4R9L A;  2D1W A;  1IV7 A;  1NDO B;  1YVB I;  4FMB A;  4MMY B;  3NBR A;  2OCT A;  4L8P A;  3BNE A;  1DMQ A;  2XH9 A;  3IMA B;  3KZT A;  3DGN A;  2OOV C;  2CG0 A;  3M8C A;  3DY5 A;  4HZ9 B;  4XB5 A;  2YFI B;  1VQ5 3;  3EC9 A;  3OWU A;  2BT3 A;  1YIT 3;  2JDI H;  4O02 B;  1O7M B;  2E2U A;  1K73 4;  2F86 B;  3LT9 A;  1LOX A;  3OWS A;  4R1K A;  4O2H A;  2PZV A;  2GU1 A;  3CNM A;  3X3Z A;  3S28 A;  1K8A 4;  1VQ8 3;  2K54 A;  1JNQ A;  1IQY A;  2YFJ B;  3MG3 A;  4X2H A;  1T5Y A;  3K63 A;  3LML A;  3F7X A;  2I9W A;  3WOD G;  1K41 A;  3Q1C A;  1UI7 A;  5IEO A;  3GZX B;  2OTJ 3;  4LGQ A;  2Z6B A;  1WMP A;  3CCQ 3;  1TIJ A;  2IUK A;  1U8C B;  2B1X B;  3L0R A;  2FXT A;  1M1K 4;  4XDW A;  1WQL B;  2INX A;  3ER7 A;  1FGR A;  1O7N B;  3BLZ A;  1LXE A;  4EXR A;  2XFT A;  3DZL A;  2OWP A;  3G71 3;  4K1U A;  1C7H A;  3RGR A;  3JUN A;  3OXA A;  2MF7 A;  1JRQ A;  3EHC A;  2CFK A;  2RFR A;  2WOH A;  4WYK A;  1FGT A;  2XGN A;  3NXJ A;  1FA3 A;  3CCL 3;  4N6O B;  4FCM A;  5D82 A;  1E97 A;  2HMK B;  4HZB B;  1VQN 3;  1GYB A;  2CG1 A;  2W04 A;  2CIU A;  2XSH B;  1D6Y A;  1CQS A;  1Y4K A;  3FF2 A;  4HYZ A;  2D42 A;  2W6J H;  2HMJ B;  3K7C A;  1JB5 A;  5STD A;  2A15 A;  3T8N A;  3CPW 2;  3G8Z A;  4HM8 B;  4XBY A;  1WTH A;  1W6Y A;  1U5O A;  3DXO A;  2F99 A;  1ZO2 A;  3CNX A;  4KVH A;  1YI2 3;  2BMQ B;  1VQM 3;  3F14 A;  1SPU A;  3E99 A;  3SED A;  5IEP A;  2XSO B;  2W56 A;  3BNC A;  2CH9 A;  2HMM B;  3B8L A;  4H61 A;  5JPU A;  1ISK A;  5AIF A;  2GBW B;  3OV4 A;  1N5P A;  2XF3 A;  2XRX B;  1GD4 A;  4N6M A;  5LC7 A;  3PGB A;  3AMO B;  1W7C A;  3JUO A;  3I55 3;  1YGE A;  3KE7 A;  4N6N B;  5D83 A;  3H3H A;  2WGO A;  4IIA A;  2CWU A;  2MC8 A;  4L8O A;  1IQX A;  3QK9 A;  2OQE C;  5HGR A;  2ML5 A;  1NO3 A;  5LC6 A;  1FUW A;  1JKG A;  1TFO A;  3CC4 3;  1OUN A;  4HM0 B;  1BUQ A;  1HKX A;  4MMZ B;  2XFS A;  3DGO A;  3O8Y A;  1FGO A;  5EEO A;  5AIG A;  3FG3 A;  1TP6 A;  1N9J A;  2GU3 A;  2GXF A;  1JJ2 2;  1CEW I;  1Q42 A;  5I97 A;  3GWR A;  1E3R A;  2KXG A;  3NM2 A;  2BO9 B;  2ML6 A;  1Q40 B;  1IVV A;  4EV2 A;  5CF1 A;  4XBT A;  3NHX A;  1IVU A;  5IW9 A;  3MSO A;  1TUH A;  4OUQ A;  3UJM A;  1LNH A;  1UUW B;  3FZW A;  3F8X A;  2QEX 3;  4NRE A;  4L7K A;  5IG4 A;  2O9U X;  2K0M A;  4R80 A;  1PU4 A;  3V99 A;  1N8R 4;  1ROA A;  3EF8 A;  3G16 A;  3EJV A;  1PFP A;  3MHE A;  4J9A A;  3WMD A;  4FCJ A;  1A67 A;  2GBX B;  4OVM A;  1IV9 A;  1ULI B;  3F7S A;  5IER A;  3H51 A;  4MJD A;  1EQK A;  1O7G B;  2OTL 3;  1IK3 A;  4STD A;  1Q81 4;  3EE1 A;  5FGO A;  3BNB A;  2OOV A;  1VQK 3;  2HMN B;  1O7H B;  4BTX A;  4N6V 0;  1A2K A;  1OHS A;  4EYC A;  4LEH A;  1Q86 4;  1QAF A;  2C10 A;  5IG5 A;  1F8N A;  3OWY A;  2LQV A;  4HM7 B;  3N54 B;  1N5H A;  3FCS B;  3U97 A;  1A90 A;  1LVN A;  4J8T A;  1JV2 B;  2CFG A;  3X3X A;  3CPO A;  1GY6 A;  5CLK A;  3LOY A;  3JUM A;  5A0O B;  3KFQ C;  3NV0 B;  1NB5 I;  1VQ4 3;  3S67 A;  3UL6 A;  1JB2 A;  1DYU A;  3EX9 A;  1TU5 A;  1ZX2 A;  3LYG A;  1W2B 2;  1IT7 A;  2R4I A;  3SOY A;  5IG3 A;  3FLJ A;  1CYU A;  3MPH A;  1IQ8 A;  2E2T A;  2B24 B;  3KSE D;  3LT8 A;  1O7P B;  3X40 A;  3HIG A;  4G1M B;  1AVK A;  1NU3 A;  5AIH A;  4HJL B;  3EB8 A;  1ULJ B;  3CU3 A;  1VQO 3;  3NM7 A;  5AYS C;  1W5Z A;  1YJ9 3;  4JF8 A;  1SQW A;  2Z7A A;  3VSY A;  4GB5 A;  4HBR A;  1OH0 A;  3FGY A;  2BHM A;  3T8U A;  2P38 A;  7STD A;  2E2V A;  1KC8 4;  3CCM 3;  2HMO B;  1QVG 2;  3CD6 3;  1MOL A;  4RNZ A;  1NB3 I;  2WGQ A;  3MKI A;  2SBL A;  3UNL A;  3F8H A;  3AMO A;  1IDP A;  4ORL A;  4HM6 B;  3I56 3;  1UW1 A;  4EBG A;  1KWI A;  3NBJ A;  1VQP 3;  1J2B A;  1EG9 B;  5CXO A;  4H3U A;  5DRE A;  1IU7 A;  3FG4 A;  3CC2 3;  2RSX A;  3LXU X;  1GD3 A;  1Q7Y 4;  3OX9 A;  4XDV A;  3D3L A;  4RBN A;  1OGZ A;  3X3Y A;  4FMA A;  1W6C A;  3NUV A;  3B7C A;  1GY5 A;  5AI1 A;  1AR0 A;  3S5C A;  1STF I;  3LH4 A;  3VGN A;  3GZR A;  3JUQ A;  3S29 A;  3CXC 2;  4IT7 A;  3S27 A;  1W02 A;  2CFD A;  3TDG A;  3UB1 A;  1W01 A;  1OHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...