3EBYA

Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
153
Chain Sequence
EVAQVAQSAIDDFNAAYGLCLDDDRLEQWPTLFVDDCLYQVIARENVDNGLPAAVMYCDSKGMLADRVVALRKANHFNRHLIGRAVITGVEGDQVSAEASYVVFQTRNDGETRIYNAGKYVDRFDLSGGTVRLKSRTCIYDTLRIATLLATPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Structural genomics, unknown function
molecule keywords beta subunit of a putative Aromatic-ring-hydroxylating dioxy
total genus 47
structure length 153
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebyA00
3EBTA 5KP3A 1TUHA 1O7GB 1OF5B 3CNXA 3GWRA 3B4PA 2K54A 4XBYA 1W02A 3DXOA 2R4IA 4ORLA 3UJMA 1EA2A 2Z7AA 1W01A 3EF8A 5CLKA 5FW5A 1Z1SA 3BB9A 5HGRA 1DMMA 3G0KA 3IPTA 1HKXA 1JKGA 3CPOA 2IMJA 3E99A 3EX9A 3GZRA 3CU3A 3HK4A 1JN5A 2OWPA 3GZYB 1OH0A 3MG1A 3EBYA 4GB5A 4HM5B 3EN1B 3STDA 3ECFA 1K41A 4XM4A 1NDOB 6STDA 4R1KA 3FZWA 3FKAA 1ULIB 1O7MB 2GEXA 3Q90A 3B7CA 2HMNB 3NXJA 3FF0A 1BUQA 2Z76A 1Q40A 3DUKA 4HM4B 2YFIB 3DM8A 2BNGA 3NHXA 3OWYA 5D82A 2RFRA 4LEHA 4WYKA 5AEUB 5IEPA 3DZLA 3SEDA 3F14A 3DMCA 2YFLB 3OWUA 5IERA 1E3RA 5KP4A 3EC9A 3MG2A 1OF5A 2A15A 1IDPA 1A2KA 3B8LA 1EG9B 1GY5A 1UUVB 1OGZA 2XRXB 3A76A 3GZBA 4IIAA 1ZX2A 2GEYA 1Q42A 3H51A 3T8UA 5IG3A 1O7NB 1OGXA 3FLJA 4X2OA 2HMLB 5AIIA 4HM2B 1AR0A 5BXQA 5IG5A 1ISKA 5IEOA 5KP1A 3K7CA 3F8XA 4L7KA 4RZMA 3NM2A 5IENA 3MHEA 3WMDA 2GXFA 1OHPA 1UUWB 4XBTA 3HZPA 5AIHA 3RGRA 3H3HA 4FCMA 2BMRB 2PZVA 4K1VA 2HMJB 4XDVA 4CDLA 4KVHA 3EHCA 4XDWA 5AEWB 1ULJB 2YFJB 4HM6B 2UX0A 1E3VA 1OHSA 2CKFB 3FH1A 3KKGA 3KZTA 4HM0B 4STDA 4N3VA 3LYGA 5AIFA 2GBXB 4X2HA 5EVHA 3FSDA 5STDA 2XSHB 4R9LA 2F98A 3CNMA 1VZZA 3OWSA 1JB5A 2BMOB 2CHCA 3NV0A 3MG3A 4OUQA 3RGAA 5JPUA 4I4KA 1O7WB 1ASKA 3ER7A 1OHOA 2STDA 3HX8A 3G8ZA 4LMIA 2INXA 3GZXB 4H3UA 4L8OA 2QIYA 2F99A 1JKGB 2GBWB 1NWWA 2W2CA 3JUQA 2F86B 4R9KA 2JQ5A 1JN5B 3KSPA 3EJVA 3FF2A 3T8NA 2I9WA 3JUPA 3G16A 1QMAA 3NBRA 4MJDA 3KE7A 4PEJA 5BVBA 1DMNA 5D81A 1CQSA 3F40A 4HZBB 4J8TA 5TGNA 3EN8A 3SOAA 4HVNA 5IF6A 3LZAA 1JB4A 2B1XB 1OUNA 1Q40B 4K1UA 4L8PA 1JB2A 1C7HA 4Q53A 2QGUA 8CHOA 1NU3A 2HMOB 3BLZA 3D9RA 3I0YA 1TP6A 4U13A 5JPPA 1DMQA 2B24B 3K0ZA 3B4OA 3F7XA 2RGQA 1WQLB 2BMQB 3MYTA 2RCDA 1GYBA 2XSOB 3ROBA 1GY6A 2Z77A 1E97A 3OXAA 4HM7B 3F7SA 3VSYA 2HMMB 1O7HB 3VGNA 3NV0B 4WP5A 2HMKB 1S5AA 1W00A 3JUMA 4HM1B 3OV4A 1STDA 4HM8B 5AIGA 7STDA 4WWUC 1OPYA 4XB5A 4J9AA 4HJLB 3JUOA 1QJGA 5DREA 3F8HA 3OX9A 3F9SA 5D83A 1W6YA 2XR8B 3M8CA 3JUNA 3MSOA 1GS3A 4OVMA 5IG0A 5CF2A 1OCVA 1U5OA 4HKVB 3MKIA 4HZ9B 3EQQB 5AI1A 4HM3B 3SOYA 4LGQA 5CK6A 1O7PB 3NUVA 5DRVA 5G2GA 4FCJA 4XBXA 1ZO2A 1SJWA 3GRDA 4WYKB 3S5CA 3UNLA 5CF1A 5IG4A 5CXOA 1GY7A 3FGYA
chains in the Genus database with same CATH superfamily
1O7GB 1IU7A 1IK3A 4NHFA 3AMOA 3UJMA 1EA2A 1SPUA 2RNTA 1JNQA 2Z7AA 3CME3 1VQ73 2MF7A 1MWTA 1RN7A 1AVKA 1LVNA 1N9EA 1N5PA 3HOHA 1N9JA 1HKXA 3MG2A 1B2ZA 4AKZA 4BTYA 2PNCA 4STDA 3MG1A 3WDGB 2L1SA 3EBYA 3CCE3 3EN1B 1F8NA 3CD63 2CX0A 1YI23 3IMAB 1VQO3 3KSED 3FZWA 1EKMA 1ULIB 3Q90A 1BUQA 4I5QA 1Q40A 3DM8A 3ALAA 1HZ1A 2BHMA 2W03A 3LMLA 2RFRA 4LEHA 5AEUB 2QEX3 2SARA 1W6GA 2BU4A 2OTL3 2OOVA 5M18A 2KRTA 1IDPA 1BSCA 1GY5A 3A76A 1N5HA 3JVCA 1A2VA 1VQ93 2IUKA 3T8UA 5IG3A 1O7NB 2H0IA 3FLJA 3O8YA 5M1AA 5AIIA 5BXQA 1AR0A 2XEPA 5IG5A 1NJI4 5IEOA 3NX0A 1QALA 1BSBA 4L7KA 4RZMA 1BVIA 3NM2A 1LQMB 2F4YA 2GXFA 1UUWB 1GMRA 3HZPA 5AIHA 4N6UA 1B2SA 1MWUA 4CDLA 2Y74A 4XDWA 1BNIA 2BIRA 1IT8A 1ULJB 2M7OA 2YFJB 1E3VA 3KZTA 2ZA4A 3KKGA 2GU3A 3SVAA 4LZIA 3DGOA 2GBXB 3LT8A 2WOHA 3FSDA 4LYLB 4BU4A 1HU9A 2XSHB 4BL2A 2CWUA 2F98A 1B20A 2Q07A 1BNGA 1JB5A 3CCV3 1UGHI 1L5GB 4I4KA 1RLSA 1US1A 4BTWA 3ER7A 1Q7Y4 3NQYA 1A67A 3HX8A 1KD14 1C54A 1VQQA 3MWZA 4N6MA 1T2IA 2WO0A 2QIYA 3AGOA 1RGEA 2W2CA 3JUQA 1A2PA 4N6NB 2F86B 3G6E3 2JQ5A 3KSPA 4AKYA 1LQGC 2AADA 2I9WA 1I2GA 3NBRA 1FZUA 1G96A 1IQ8A 1JRQA 1RCKA 3F40A 3LOYA 3EN8A 5D81A 1QAFA 2BT3A 5G1LA 4K1UA 1Q40B 3V99A 1UW1A 1STFI 1GOYA 3DGMA 1RN1A 2QGUA 8CHOA 1NU3A 1N8QA 3BLZA 3PXMA 4U13A 1UGIA 3CXC2 1T5YA 2B24B 4MMYB 2XSOB 1J2BA 3ROBA 1GY6A 3OXAA 4HM7B 2P0MA 4N6TA 1QVG2 1RSNA 1ZS7A 3S28A 1O7HB 1CH0A 4MMXB 1TJDA 2UUGC 2HMKB 4HM1B 3K5TA 5RNTA 1I70A 4XB5A 3K9MC 1NB3I 4HJLB 3WR2A 4K90B 5D83A 4BTXA 3JUNA 3LTDA 4OVMA 1K9M4 5CF2A 1OCVA 1Q824 2KXGA 3EQQB 4HM3B 3SOYA 4LGQA 3ZG0A 3DGYA 3NUVA 4AEQA 3I563 5DRVA 5G2GA 3CPW2 3GRDA 4QWTA 1BRSA 4MJDA 5KP3A 1YIJ3 1UI8A 3GWRA 2CG1A 1PU4A 1JZDA 2CX1A 1VQN3 2K54A 1LOXA 1R4CA 2R4IA 1AV4A 1TFOA 1MGRA 1ROVA 2W0QA 1W4NA 1M1XB 1W01A 1LOWA 4KFDA 1KC84 2F5WA 1DMMA 3G0KA 2XF3A 3CPOA 1WTHA 1BNJA 1RGCA 4H3UA 4JRFA 3CU3A 4R1KA 1JN5A 3X3ZA 1QAKA 5AYRB 1K41A 1MWSA 1NDOB 5FGOA 4N6V0 4KFFA 3FKAA 1FUTA 3B7CA 2JDIH 3DUKA 1I0XA 4HM4B 1VQP3 1YJW3 1NNVA 3NHXA 5D82A 5IEPA 3VF1A 5ELJA 1Q7HA 3F14A 3FCSB 2YFLB 3OWUA 5IERA 1OF5A 1A2KA 1D6ZA 1R4YA 1EG9B 1BRNL 3BNDA 1BUJA 1JJ22 1QVF2 1ZX2A 1YJ93 1Q42A 3H51A 2F56A 4MEIA 2HMLB 4HM2B 3PCSA 1AY7A 4EBGA 3DGLA 1FGTA 3MHEA 1MNLA 2E2VA 2XFSA 4XBTA 3LT9A 4EV2A 1T2HA 3CC23 1BNFA 3S29A 4H61A 2HMJB 4FCZA 5A0OB 3EHCA 1B27A 1TU5A 5IG4A 2C10A 2UX0A 3NQZA 2CKFB 1OHSA 4HM0B 1VQ83 1YVSA 1RGHA 2CH9A 2O3OA 2CW9A 5EVHA 1VQ63 3CCU3 3CCS3 2E2TA 2FGTA 3CNMA 3KFQC 3RDEA 1FGMA 1MOLA 3UL5A 3X41A 2KF6A 2LQVA 3SXXA 4KFEA 2CHCA 3AMOB 3MG3A 1LNIA 3RGAA 5HOHA 2STDA 1X1WA 4LMIA 1BAOA 3PGBA 2BO9B 1RDSA 3GZXB 3CCJ3 2F99A 2GBWB 4GSPA 3NBJA 1JN5B 3EJVA 1JBTA 3FF2A 1BRIA 4ZM8A 1AQZA 4PEJA 1RNBA 1IYYA 4J8TA 2FXTA 1D6YA 1PY3A 3KCHA 1JB4A 2XFTA 4G1MB 3U97A 3G713 1K28A 1B2UA 4Q53A 3I553 2HMOB 1BSAA 1BRJA 2Z6BA 1TP6A 3V92A 4EV5A 1DMQA 1YNVX 3D5GA 2RGQA 1B3SA 3MYTA 1UCIA 3VSYA 1AVLA 1E97A 1NO3A 3F7SA 2W6JH 3KN4A 3NV0B 1KWIA 3AHSA 1LRAA 3LTAA 3CC43 2C4BA 3X40A 3WA3A 1BRHA 1YGWA 4HM8B 1DE3A 1UUGB 4RBNA 3SYUA 3NM7A 1IV7A 1QJGA 3JUOA 2WOFA 3FG3A 1W6YA 2XR8B 3M8CA 5IG0A 2CFLA 1MGWA 3ZFZA 1YJN3 2OOVC 4HZ9B 4HKVB 2OTJ3 5ELUA 3PCRA 2IYJA 4FCJA 4IPBA 5CF1A 1EEJA 1MWRA 2W56A 4NPBA 3OW22 2CFDA 1TUHA 2P05A 1OF5B 3CNXA 3B4PA 1GD3A 2E2UA 2W9PA 4XBYA 1W02A 3DXOA 1IVWA 1RNTA 3D5IA 3LTBA 4HYZA 1FYSA 1DETA 3S27A 4RNYA 1NB5I 1IT7A 1Z1SA 2V1LA 2K0MA 3BB9A 3BIRA 1I2FA 2KCDA 1JKGA 3GZRA 3IPTA 3OWYA 4J9AA 3RNTA 4GB5A 4N6OB 3GZYB 4HM5B 1M9GA 1LXEA 1BU4A 4XM4A 4BL3A 1JZOA 2CWTA 3L0RA 1YHQ3 2O9UX 1IV9A 2CWVA 3FG4A 4ILFA 2GEXA 1W5ZA 3AGNA 2HMNB 2P0XA 3FF0A 3NXJA 1RKYA 1RCLA 1VQM3 2Z76A 2C11A 2XGNA 2YFIB 1ZGXA 2BNGA 4R4KA 3Q1CA 3WOFB 3SEDA 3FG1A 2H0GA 3DMCA 2ZL8A 2P38A 1E3RA 5KP4A 1DVCA 3EC9A 1CYUA 1FUWA 3EB8A 2UGIA 3B8LA 1X1XA 1OGZA 3GZBA 4IIAA 1W6CA 3TDGA 2GEYA 1BNSA 4CJNA 3HIIA 3K7CA 1N8R4 1RGFA 1TIJA 2OQEC 5IENA 3GSPA 1SIHA 3IJEB 1BNEA 1V58A 3KIIA 5GSPA 3RGRA 3CMA3 1T3BA 2BMRB 1LOYA 4XDVA 5AEWB 3PZWA 1BOXA 2CIUA 4RNZA 1LNHA 4N3VA 3LYGA 3N9HA 2KAAA 4FMDA 4O3VA 4X2HA 3UL6A 4EYCA 2RBIA 1BIRA 4R9LA 1IQYA 5IW9A 1RRLA 2CK3H 4EC6A 2SBLA 4IT7A 3X42A 1VZZA 1X1YA 1Q864 2BMOB 3NV0A 1JBSA 5JPUA 1W2B2 1EQKA 1ASKA 3CC73 1Y4KA 2W9QA 5BIRA 2INXA 5KP1A 4J5GA 4R9KA 4HOHA 4O8SA 1Q9EA 1NWWA 1ROAA 1VQK3 3HIGA 3T8NA 1RJOA 3G16A 2J8XB 4K61A 3KE7A 1CQSA 4HZBB 5TGNA 2WGQA 3SOAA 2CFGA 2K3DA 4HVNA 1GSPA 3SX1A 1WNHA 5IF6A 1G02A 1OUNA 1W7CA 2RSXA 2ZHXB 1JB2A 1C7HA 3LXUX 2IUJA 1V74A 1I3IA 3LTCA 1RTUA 3A5EA 2W56B 1B2MA 4CPKA 1I0VA 3J7Yd 3B4OA 3F7XA 1GMQA 2BMQB 2LYXA 4FMCA 2RCDA 1GYBA 1UI7A 2Z77A 3N8BA 1UCJA 3GAXA 3VGNA 2KF4A 3BNBA 2F5MA 2OCTA 4WP5A 1I8VA 1RRHA 1S5AA 5LC6A 1IVXA 1CYVA 1STDA 2W04A 7STDA 4WWUC 1X1UA 3DGNA 4EW5A 3OX9A 3DH2A 2CC3A 1B21A 1GOVA 3N54B 3EE1A 3PS8A 4HAAA 1GS3A 3CCR3 3PYJA 1RGLA 5AYSC 3SLUA 5EQLA 2YX9A 7RNTA 1UCLA 1RHLA 2MC8A 1O7PB 1VQ43 1ZO2A 4WYKB 1D6UA 3BNCA 3D3LA 1TRQA 3URPA 5JBSA 2WGOA 1VQ53 1BSDA 1M1K4 3Q2PA 3EBTA 3LH4A 3G4S3 3X3YA 1S723 3CCL3 1FGRA 2FNQA 1BSEA 4ORLA 3U1WA 3EF8A 5CLKA 1GD4A 1UCKA 5M19A 5FW5A 5HGRA 1IVUA 4NREA 3E99A 3K63A 1M904 2IMJA 3EX9A 3HK4A 4R80A 1RGKA 2OWPA 1OH0A 3MPHA 2OQEA 3STDA 1VQL3 3ECFA 3D4AA 5G1KA 1FGQA 1O7MB 2IA7A 1WMPA 3WODG 2GSPA 2KF5A 4WYKA 1TTOA 1TRPA 3DZLA 1SIIA 4TX4A 1V57A 2A15A 4GHOA 4O2HA 1I3FA 1Q814 1IQXA 1UUVB 4WFOA 2XRXB 4CCVA 1A90A 1KQS2 3T0UA 2H0HA 3CCQ3 1OGXA 3QK9A 2ML6A 1BANA 2XGLA 4X2OA 4OK0A 1ISKA 2ML5A 3F8XA 1BRKA 3Q3FA 1PYLA 1HYFA 1I2EA 1OHPA 3DY5A 3HI7A 3WMDA 1CEWI 3WA2X 3H3HA 4FCMA 2PZVA 4K1VA 2P09A 4KVHA 4RNTA 1IVVA 5EEOA 6STDA 4HM6B 3FH1A 1B2XA 1U8CB 4FMBA 5LC7A 1FW7A 5AIFA 1TFKA 7GSPA 2HOHA 1LOVA 5STDA 3V98A 2CG0A 1BNRA 3NBBA 1KSIA 3WOEB 2L4VA 4N6LA 1DYUA 3OWSA 1SARA 4OUQA 1RGGA 1G0TA 1O7WB 4GL6A 1OHOA 1YVBI 3G8ZA 2ZDJA 2GU1A 6GSPA 3AHWA 2R41A 4L8OA 3X3XA 1JKGB 5BU4A 3CCM3 3S67A 2QA43 2D42A 2CFWA 4KT3B 3JUPA 2KF3A 1JV2B 1QMAA 1K8A4 5BVBA 1DMNA 1WMOA 2D1WA 4DKIA 4FR9A 3LZAA 2B1XB 4L8PA 2XH9A 1EUIC 4WHAA 1K734 1WMNA 3D9RA 3I0YA 5JPPA 3K0ZA 1PFPA 1WQLB 1FUSA 1GOUA 2HMMB 1BGSA 1FA3A 9RNTA 1OACA 2IY2A 1W2ZA 1W00A 3JUMA 1FGOA 3OV4A 5AIGA 3BU4A 3UB1A 1SQWA 4BIRA 8RNTA 1OPYA 4LSOA 4FMAA 2Y73A 1RMSA 4MMZB 3D79A 5DREA 1BRGA 2AAEA 3F8HA 3F9SA 3BNEA 1UDII 4J5KA 3QRDA 1RN4A 3MSOA 3ZG5A 1DVDA 1U5OA 1YGEA 3MKIA 4KZ1A 5AI1A 2CFKA 5CK6A 1RGAA 4EXRA 3UNLA 4XBXA 4O02B 1SJWA 4JF8A 3S5CA 5I97A 1YIT3 3WHOA 5CXOA 1GMPA 1GY7A 6RNTA 4HBRA 3FGYA 1JBRA
chains in the Genus database with same CATH topology
1O7GB 1IU7A 1IK3A 4NHFA 3AMOA 3UJMA 1EA2A 1SPUA 2Z7AA 1JNQA 3CME3 1VQ73 2MF7A 1RN7A 1AVKA 1N9EA 1LVNA 1N5PA 1N9JA 1HKXA 3MG2A 4AKZA 4BTYA 2PNCA 4STDA 3MG1A 3WDGB 3EBYA 3CCE3 3EN1B 1F8NA 3CD63 1YI23 3IMAB 1VQO3 3KSED 3FZWA 1EKMA 1ULIB 3Q90A 1BUQA 1Q40A 3DM8A 3ALAA 2W03A 2BHMA 3LMLA 2QEX3 2RFRA 4LEHA 5AEUB 1W6GA 2OTL3 2OOVA 2KRTA 1IDPA 1GY5A 3A76A 1N5HA 3JVCA 1A2VA 1VQ93 2IUKA 3T8UA 5IG3A 1O7NB 3FLJA 3O8YA 5AIIA 5BXQA 1AR0A 2XEPA 5IG5A 1NJI4 5IEOA 3NX0A 1QALA 4L7KA 4RZMA 3NM2A 2GXFA 1UUWB 3HZPA 5AIHA 4N6UA 4CDLA 2Y74A 4XDWA 2YFJB 1IT8A 1ULJB 2M7OA 1E3VA 3KZTA 3KKGA 2GU3A 3SVAA 4LZIA 3DGOA 2GBXB 3LT8A 2WOHA 3FSDA 1HU9A 2XSHB 2CWUA 2F98A 2Q07A 1JB5A 3CCV3 1L5GB 4I4KA 1US1A 4BTWA 3ER7A 1Q7Y4 3NQYA 1A67A 3HX8A 1KD14 3MWZA 4N6MA 2WO0A 2QIYA 3JUQA 2W2CA 3G6E3 4N6NB 2F86B 2JQ5A 3KSPA 4AKYA 2I9WA 3NBRA 1G96A 1JRQA 1IQ8A 3F40A 5D81A 3LOYA 3EN8A 1QAFA 2BT3A 4K1UA 1Q40B 3V99A 1UW1A 1STFI 3DGMA 2QGUA 8CHOA 1NU3A 1N8QA 3BLZA 3PXMA 4U13A 3CXC2 1T5YA 2B24B 4MMYB 2XSOB 1J2BA 3ROBA 1GY6A 3OXAA 4HM7B 2P0MA 4N6TA 1QVG2 3S28A 1O7HB 4MMXB 2HMKB 4HM1B 3K5TA 4XB5A 3K9MC 1NB3I 4HJLB 4K90B 5D83A 4BTXA 3JUNA 3LTDA 4OVMA 1K9M4 5CF2A 1OCVA 1Q824 2KXGA 3EQQB 4HM3B 3SOYA 4LGQA 3NUVA 4AEQA 3I563 5DRVA 5G2GA 3CPW2 3GRDA 4QWTA 4MJDA 5KP3A 1YIJ3 1UI8A 3GWRA 2CG1A 1PU4A 1VQN3 2K54A 1LOXA 1R4CA 2R4IA 1AV4A 1TFOA 1ROVA 2W0QA 1W4NA 1M1XB 1W01A 4KFDA 1KC84 1DMMA 3G0KA 2XF3A 3CPOA 1WTHA 3X3ZA 4H3UA 4JRFA 3CU3A 4R1KA 1JN5A 1QAKA 5AYRB 1K41A 5FGOA 1NDOB 4N6V0 4KFFA 3FKAA 3B7CA 2JDIH 3DUKA 4HM4B 1VQP3 1YJW3 3NHXA 5D82A 5IEPA 3VF1A 5ELJA 3F14A 3FCSB 2YFLB 3OWUA 5IERA 1OF5A 1A2KA 1D6ZA 1EG9B 3BNDA 1JJ22 1QVF2 1ZX2A 1YJ93 1Q42A 3H51A 4MEIA 2HMLB 4HM2B 3PCSA 4EBGA 3DGLA 1FGTA 3MHEA 1MNLA 2E2VA 2XFSA 4XBTA 3LT9A 4EV2A 3CC23 3S29A 4H61A 2HMJB 4FCZA 5A0OB 3EHCA 1TU5A 5IG4A 2C10A 2UX0A 3NQZA 1OHSA 2CKFB 4HM0B 1VQ83 2CH9A 2O3OA 2CW9A 5EVHA 1VQ63 3CCU3 3CCS3 2E2TA 2FGTA 3CNMA 3KFQC 3RDEA 1FGMA 1MOLA 3UL5A 3X41A 3SXXA 2LQVA 4KFEA 2CHCA 3AMOB 3MG3A 3RGAA 2STDA 4LMIA 3PGBA 2BO9B 3GZXB 3CCJ3 2F99A 2GBWB 3NBJA 1JN5B 3EJVA 3FF2A 4ZM8A 4PEJA 4J8TA 2FXTA 1D6YA 3G713 1JB4A 2XFTA 4G1MB 3U97A 1K28A 4Q53A 3I553 2HMOB 2Z6BA 4EV5A 1TP6A 3V92A 1DMQA 2RGQA 3MYTA 3VSYA 1AVLA 1E97A 1NO3A 3F7SA 2W6JH 3KN4A 3NV0B 1KWIA 3LTAA 3CC43 3X40A 3WA3A 4HM8B 4RBNA 3NM7A 1IV7A 1QJGA 3JUOA 2WOFA 3FG3A 1W6YA 2XR8B 3M8CA 5IG0A 2CFLA 1YJN3 2OOVC 4HZ9B 4HKVB 2OTJ3 5ELUA 3PCRA 4FCJA 4IPBA 5CF1A 2W56A 3OW22 2CFDA 1TUHA 2P05A 1OF5B 3CNXA 3B4PA 1GD3A 2E2UA 2W9PA 4XBYA 1W02A 3DXOA 1IVWA 3LTBA 4HYZA 3S27A 4RNYA 1NB5I 1IT7A 1Z1SA 2V1LA 2K0MA 3BB9A 3IPTA 2KCDA 1JKGA 3GZRA 3OWYA 4J9AA 4GB5A 4N6OB 3GZYB 4HM5B 1M9GA 1LXEA 4XM4A 3L0RA 2CWTA 1YHQ3 2O9UX 1IV9A 2CWVA 3FG4A 2GEXA 1W5ZA 1RKYA 2HMNB 2P0XA 3FF0A 3NXJA 1VQM3 2Z76A 2C11A 2XGNA 2YFIB 2BNGA 4R4KA 3Q1CA 3WOFB 3SEDA 3FG1A 3DMCA 2ZL8A 2P38A 1E3RA 5KP4A 1DVCA 3EC9A 1CYUA 1FUWA 3EB8A 3B8LA 1OGZA 3GZBA 4IIAA 1W6CA 3TDGA 2GEYA 3HIIA 3K7CA 1N8R4 1TIJA 2OQEC 5IENA 1SIHA 3IJEB 3RGRA 3KIIA 3CMA3 2BMRB 4XDVA 5AEWB 3PZWA 2CIUA 4RNZA 1LNHA 4N3VA 3LYGA 3N9HA 4O3VA 4FMDA 3UL6A 4X2HA 4EYCA 4R9LA 1IQYA 5IW9A 1RRLA 2CK3H 4EC6A 2SBLA 4IT7A 3X42A 1VZZA 1Q864 2BMOB 3NV0A 5JPUA 1W2B2 1EQKA 1ASKA 3CC73 1Y4KA 2W9QA 2INXA 5KP1A 4R9KA 4O8SA 1NWWA 1ROAA 1VQK3 3HIGA 3T8NA 1RJOA 3G16A 4K61A 3KE7A 1CQSA 4HZBB 5TGNA 2WGQA 3SOAA 2CFGA 4HVNA 3SX1A 1WNHA 5IF6A 1OUNA 1W7CA 2RSXA 1JB2A 1C7HA 3LXUX 2IUJA 1V74A 3LTCA 2W56B 3J7Yd 3B4OA 3F7XA 2BMQB 2LYXA 4FMCA 2RCDA 1GYBA 1UI7A 2Z77A 3N8BA 3GAXA 3VGNA 3BNBA 4WP5A 2OCTA 5LC6A 1RRHA 1S5AA 1IVXA 1CYVA 1STDA 2W04A 7STDA 4WWUC 3DGNA 3OX9A 2CC3A 3CCR3 3N54B 3EE1A 3PS8A 1GS3A 3PYJA 5AYSC 3SLUA 5EQLA 2YX9A 2MC8A 1O7PB 1VQ43 1ZO2A 4WYKB 1D6UA 3BNCA 3D3LA 5JBSA 2WGOA 1VQ53 1M1K4 3Q2PA 3EBTA 3LH4A 3G4S3 3X3YA 1S723 3CCL3 1FGRA 2FNQA 4ORLA 3U1WA 3EF8A 5CLKA 1GD4A 5FW5A 5HGRA 1IVUA 4NREA 3E99A 3K63A 1M904 2IMJA 3EX9A 3HK4A 4R80A 2OWPA 3MPHA 1OH0A 2OQEA 3STDA 1VQL3 3ECFA 1FGQA 1O7MB 2IA7A 1WMPA 3WODG 4WYKA 3DZLA 1SIIA 4TX4A 2A15A 4O2HA 1Q814 1IQXA 1UUVB 4WFOA 2XRXB 4CCVA 1A90A 1KQS2 3T0UA 3CCQ3 1OGXA 3QK9A 2ML6A 2XGLA 4X2OA 4OK0A 1ISKA 2ML5A 3F8XA 3WMDA 1OHPA 3DY5A 3HI7A 1CEWI 3WA2X 3H3HA 4FCMA 2PZVA 4K1VA 2P09A 4KVHA 1IVVA 5EEOA 6STDA 4HM6B 3FH1A 1U8CB 4FMBA 5LC7A 5AIFA 1TFKA 5STDA 3V98A 2CG0A 3NBBA 1KSIA 3WOEB 2L4VA 4N6LA 1DYUA 3OWSA 4OUQA 1O7WB 4GL6A 1OHOA 1YVBI 3G8ZA 2ZDJA 2GU1A 4L8OA 3X3XA 3CCM3 1JKGB 3S67A 2QA43 2D42A 2CFWA 3JUPA 1JV2B 1QMAA 1K8A4 5BVBA 1DMNA 1WMOA 2D1WA 4FR9A 3LZAA 2B1XB 4L8PA 2XH9A 1K734 4WHAA 1WMNA 3D9RA 3I0YA 5JPPA 3K0ZA 1PFPA 1WQLB 2HMMB 1FA3A 1OACA 3UB1A 1W2ZA 1W00A 3JUMA 1FGOA 3OV4A 5AIGA 1SQWA 1OPYA 4LSOA 4FMAA 2Y73A 4MMZB 5DREA 3F8HA 3F9SA 3BNEA 3QRDA 3MSOA 1DVDA 1U5OA 1YGEA 3MKIA 4KZ1A 5AI1A 2CFKA 5CK6A 4EXRA 3UNLA 4XBXA 4O02B 1SJWA 4JF8A 3S5CA 5I97A 1YIT3 5CXOA 1GY7A 4HBRA 3FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBT A;  5KP3 A;  1TUH A;  1O7G B;  1OF5 B;  3CNX A;  3GWR A;  3B4P A;  2K54 A;  4XBY A;  1W02 A;  3DXO A;  2R4I A;  4ORL A;  3UJM A;  1EA2 A;  2Z7A A;  1W01 A;  3EF8 A;  5CLK A;  5FW5 A;  1Z1S A;  3BB9 A;  5HGR A;  1DMM A;  3G0K A;  3IPT A;  1HKX A;  1JKG A;  3CPO A;  2IMJ A;  3E99 A;  3EX9 A;  3GZR A;  3CU3 A;  3HK4 A;  1JN5 A;  2OWP A;  3GZY B;  1OH0 A;  3MG1 A;  3EBY A;  4GB5 A;  4HM5 B;  3EN1 B;  3STD A;  3ECF A;  1K41 A;  4XM4 A;  1NDO B;  6STD A;  4R1K A;  3FZW A;  3FKA A;  1ULI B;  1O7M B;  2GEX A;  3Q90 A;  3B7C A;  2HMN B;  3NXJ A;  3FF0 A;  1BUQ A;  2Z76 A;  1Q40 A;  3DUK A;  4HM4 B;  2YFI B;  3DM8 A;  2BNG A;  3NHX A;  3OWY A;  5D82 A;  2RFR A;  4LEH A;  4WYK A;  5AEU B;  5IEP A;  3DZL A;  3SED A;  3F14 A;  3DMC A;  2YFL B;  3OWU A;  5IER A;  1E3R A;  5KP4 A;  3EC9 A;  3MG2 A;  1OF5 A;  2A15 A;  1IDP A;  1A2K A;  3B8L A;  1EG9 B;  1GY5 A;  1UUV B;  1OGZ A;  2XRX B;  3A76 A;  3GZB A;  4IIA A;  1ZX2 A;  2GEY A;  1Q42 A;  3H51 A;  3T8U A;  5IG3 A;  1O7N B;  1OGX A;  3FLJ A;  4X2O A;  2HML B;  5AII A;  4HM2 B;  1AR0 A;  5BXQ A;  5IG5 A;  1ISK A;  5IEO A;  5KP1 A;  3K7C A;  3F8X A;  4L7K A;  4RZM A;  3NM2 A;  5IEN A;  3MHE A;  3WMD A;  2GXF A;  1OHP A;  1UUW B;  4XBT A;  3HZP A;  5AIH A;  3RGR A;  3H3H A;  4FCM A;  2BMR B;  2PZV A;  4K1V A;  2HMJ B;  4XDV A;  4CDL A;  4KVH A;  3EHC A;  4XDW A;  5AEW B;  1ULJ B;  2YFJ B;  4HM6 B;  2UX0 A;  1E3V A;  1OHS A;  2CKF B;  3FH1 A;  3KKG A;  3KZT A;  4HM0 B;  4STD A;  4N3V A;  3LYG A;  5AIF A;  2GBX B;  4X2H A;  5EVH A;  3FSD A;  5STD A;  2XSH B;  4R9L A;  2F98 A;  3CNM A;  1VZZ A;  3OWS A;  1JB5 A;  2BMO B;  2CHC A;  3NV0 A;  3MG3 A;  4OUQ A;  3RGA A;  5JPU A;  4I4K A;  1O7W B;  1ASK A;  3ER7 A;  1OHO A;  2STD A;  3HX8 A;  3G8Z A;  4LMI A;  2INX A;  3GZX B;  4H3U A;  4L8O A;  2QIY A;  2F99 A;  1JKG B;  2GBW B;  1NWW A;  2W2C A;  3JUQ A;  2F86 B;  4R9K A;  2JQ5 A;  1JN5 B;  3KSP A;  3EJV A;  3FF2 A;  3T8N A;  2I9W A;  3JUP A;  3G16 A;  1QMA A;  3NBR A;  4MJD A;  3KE7 A;  4PEJ A;  5BVB A;  1DMN A;  5D81 A;  1CQS A;  3F40 A;  4HZB B;  4J8T A;  5TGN A;  3EN8 A;  3SOA A;  4HVN A;  5IF6 A;  3LZA A;  1JB4 A;  2B1X B;  1OUN A;  1Q40 B;  4K1U A;  4L8P A;  1JB2 A;  1C7H A;  4Q53 A;  2QGU A;  8CHO A;  1NU3 A;  2HMO B;  3BLZ A;  3D9R A;  3I0Y A;  1TP6 A;  4U13 A;  5JPP A;  1DMQ A;  2B24 B;  3K0Z A;  3B4O A;  3F7X A;  2RGQ A;  1WQL B;  2BMQ B;  3MYT A;  2RCD A;  1GYB A;  2XSO B;  3ROB A;  1GY6 A;  2Z77 A;  1E97 A;  3OXA A;  4HM7 B;  3F7S A;  3VSY A;  2HMM B;  1O7H B;  3VGN A;  3NV0 B;  4WP5 A;  2HMK B;  1S5A A;  1W00 A;  3JUM A;  4HM1 B;  3OV4 A;  1STD A;  4HM8 B;  5AIG A;  7STD A;  4WWU C;  1OPY A;  4XB5 A;  4J9A A;  4HJL B;  3JUO A;  1QJG A;  5DRE A;  3F8H A;  3OX9 A;  3F9S A;  5D83 A;  1W6Y A;  2XR8 B;  3M8C A;  3JUN A;  3MSO A;  1GS3 A;  4OVM A;  5IG0 A;  5CF2 A;  1OCV A;  1U5O A;  4HKV B;  3MKI A;  4HZ9 B;  3EQQ B;  5AI1 A;  4HM3 B;  3SOY A;  4LGQ A;  5CK6 A;  1O7P B;  3NUV A;  5DRV A;  5G2G A;  4FCJ A;  4XBX A;  1ZO2 A;  1SJW A;  3GRD A;  4WYK B;  3S5C A;  3UNL A;  5CF1 A;  5IG4 A;  5CXO A;  1GY7 A;  3FGY A; 
#chains in the Genus database with same CATH topology
 1O7G B;  1IU7 A;  1IK3 A;  4NHF A;  3AMO A;  3UJM A;  1EA2 A;  1SPU A;  2RNT A;  1JNQ A;  2Z7A A;  3CME 3;  1VQ7 3;  2MF7 A;  1MWT A;  1RN7 A;  1AVK A;  1LVN A;  1N9E A;  1N5P A;  3HOH A;  1N9J A;  1HKX A;  3MG2 A;  1B2Z A;  4AKZ A;  4BTY A;  2PNC A;  4STD A;  3MG1 A;  3WDG B;  2L1S A;  3EBY A;  3CCE 3;  3EN1 B;  1F8N A;  3CD6 3;  2CX0 A;  1YI2 3;  3IMA B;  1VQO 3;  3KSE D;  3FZW A;  1EKM A;  1ULI B;  3Q90 A;  1BUQ A;  4I5Q A;  1Q40 A;  3DM8 A;  3ALA A;  1HZ1 A;  2BHM A;  2W03 A;  3LML A;  2RFR A;  4LEH A;  5AEU B;  2QEX 3;  2SAR A;  1W6G A;  2BU4 A;  2OTL 3;  2OOV A;  5M18 A;  2KRT A;  1IDP A;  1BSC A;  1GY5 A;  3A76 A;  1N5H A;  3JVC A;  1A2V A;  1VQ9 3;  2IUK A;  3T8U A;  5IG3 A;  1O7N B;  2H0I A;  3FLJ A;  3O8Y A;  5M1A A;  5AII A;  5BXQ A;  1AR0 A;  2XEP A;  5IG5 A;  1NJI 4;  5IEO A;  3NX0 A;  1QAL A;  1BSB A;  4L7K A;  4RZM A;  1BVI A;  3NM2 A;  1LQM B;  2F4Y A;  2GXF A;  1UUW B;  1GMR A;  3HZP A;  5AIH A;  4N6U A;  1B2S A;  1MWU A;  4CDL A;  2Y74 A;  4XDW A;  1BNI A;  2BIR A;  1IT8 A;  1ULJ B;  2M7O A;  2YFJ B;  1E3V A;  3KZT A;  2ZA4 A;  3KKG A;  2GU3 A;  3SVA A;  4LZI A;  3DGO A;  2GBX B;  3LT8 A;  2WOH A;  3FSD A;  4LYL B;  4BU4 A;  1HU9 A;  2XSH B;  4BL2 A;  2CWU A;  2F98 A;  1B20 A;  2Q07 A;  1BNG A;  1JB5 A;  3CCV 3;  1UGH I;  1L5G B;  4I4K A;  1RLS A;  1US1 A;  4BTW A;  3ER7 A;  1Q7Y 4;  3NQY A;  1A67 A;  3HX8 A;  1KD1 4;  1C54 A;  1VQQ A;  3MWZ A;  4N6M A;  1T2I A;  2WO0 A;  2QIY A;  3AGO A;  1RGE A;  2W2C A;  3JUQ A;  1A2P A;  4N6N B;  2F86 B;  3G6E 3;  2JQ5 A;  3KSP A;  4AKY A;  1LQG C;  2AAD A;  2I9W A;  1I2G A;  3NBR A;  1FZU A;  1G96 A;  1IQ8 A;  1JRQ A;  1RCK A;  3F40 A;  3LOY A;  3EN8 A;  5D81 A;  1QAF A;  2BT3 A;  5G1L A;  4K1U A;  1Q40 B;  3V99 A;  1UW1 A;  1STF I;  1GOY A;  3DGM A;  1RN1 A;  2QGU A;  8CHO A;  1NU3 A;  1N8Q A;  3BLZ A;  3PXM A;  4U13 A;  1UGI A;  3CXC 2;  1T5Y A;  2B24 B;  4MMY B;  2XSO B;  1J2B A;  3ROB A;  1GY6 A;  3OXA A;  4HM7 B;  2P0M A;  4N6T A;  1QVG 2;  1RSN A;  1ZS7 A;  3S28 A;  1O7H B;  1CH0 A;  4MMX B;  1TJD A;  2UUG C;  2HMK B;  4HM1 B;  3K5T A;  5RNT A;  1I70 A;  4XB5 A;  3K9M C;  1NB3 I;  4HJL B;  3WR2 A;  4K90 B;  5D83 A;  4BTX A;  3JUN A;  3LTD A;  4OVM A;  1K9M 4;  5CF2 A;  1OCV A;  1Q82 4;  2KXG A;  3EQQ B;  4HM3 B;  3SOY A;  4LGQ A;  3ZG0 A;  3DGY A;  3NUV A;  4AEQ A;  3I56 3;  5DRV A;  5G2G A;  3CPW 2;  3GRD A;  4QWT A;  1BRS A;  4MJD A;  5KP3 A;  1YIJ 3;  1UI8 A;  3GWR A;  2CG1 A;  1PU4 A;  1JZD A;  2CX1 A;  1VQN 3;  2K54 A;  1LOX A;  1R4C A;  2R4I A;  1AV4 A;  1TFO A;  1MGR A;  1ROV A;  2W0Q A;  1W4N A;  1M1X B;  1W01 A;  1LOW A;  4KFD A;  1KC8 4;  2F5W A;  1DMM A;  3G0K A;  2XF3 A;  3CPO A;  1WTH A;  1BNJ A;  1RGC A;  4H3U A;  4JRF A;  3CU3 A;  4R1K A;  1JN5 A;  3X3Z A;  1QAK A;  5AYR B;  1K41 A;  1MWS A;  1NDO B;  5FGO A;  4N6V 0;  4KFF A;  3FKA A;  1FUT A;  3B7C A;  2JDI H;  3DUK A;  1I0X A;  4HM4 B;  1VQP 3;  1YJW 3;  1NNV A;  3NHX A;  5D82 A;  5IEP A;  3VF1 A;  5ELJ A;  1Q7H A;  3F14 A;  3FCS B;  2YFL B;  3OWU A;  5IER A;  1OF5 A;  1A2K A;  1D6Z A;  1R4Y A;  1EG9 B;  1BRN L;  3BND A;  1BUJ A;  1JJ2 2;  1QVF 2;  1ZX2 A;  1YJ9 3;  1Q42 A;  3H51 A;  2F56 A;  4MEI A;  2HML B;  4HM2 B;  3PCS A;  1AY7 A;  4EBG A;  3DGL A;  1FGT A;  3MHE A;  1MNL A;  2E2V A;  2XFS A;  4XBT A;  3LT9 A;  4EV2 A;  1T2H A;  3CC2 3;  1BNF A;  3S29 A;  4H61 A;  2HMJ B;  4FCZ A;  5A0O B;  3EHC A;  1B27 A;  1TU5 A;  5IG4 A;  2C10 A;  2UX0 A;  3NQZ A;  2CKF B;  1OHS A;  4HM0 B;  1VQ8 3;  1YVS A;  1RGH A;  2CH9 A;  2O3O A;  2CW9 A;  5EVH A;  1VQ6 3;  3CCU 3;  3CCS 3;  2E2T A;  2FGT A;  3CNM A;  3KFQ C;  3RDE A;  1FGM A;  1MOL A;  3UL5 A;  3X41 A;  2KF6 A;  2LQV A;  3SXX A;  4KFE A;  2CHC A;  3AMO B;  3MG3 A;  1LNI A;  3RGA A;  5HOH A;  2STD A;  1X1W A;  4LMI A;  1BAO A;  3PGB A;  2BO9 B;  1RDS A;  3GZX B;  3CCJ 3;  2F99 A;  2GBW B;  4GSP A;  3NBJ A;  1JN5 B;  3EJV A;  1JBT A;  3FF2 A;  1BRI A;  4ZM8 A;  1AQZ A;  4PEJ A;  1RNB A;  1IYY A;  4J8T A;  2FXT A;  1D6Y A;  1PY3 A;  3KCH A;  1JB4 A;  2XFT A;  4G1M B;  3U97 A;  3G71 3;  1K28 A;  1B2U A;  4Q53 A;  3I55 3;  2HMO B;  1BSA A;  1BRJ A;  2Z6B A;  1TP6 A;  3V92 A;  4EV5 A;  1DMQ A;  1YNV X;  3D5G A;  2RGQ A;  1B3S A;  3MYT A;  1UCI A;  3VSY A;  1AVL A;  1E97 A;  1NO3 A;  3F7S A;  2W6J H;  3KN4 A;  3NV0 B;  1KWI A;  3AHS A;  1LRA A;  3LTA A;  3CC4 3;  2C4B A;  3X40 A;  3WA3 A;  1BRH A;  1YGW A;  4HM8 B;  1DE3 A;  1UUG B;  4RBN A;  3SYU A;  3NM7 A;  1IV7 A;  1QJG A;  3JUO A;  2WOF A;  3FG3 A;  1W6Y A;  2XR8 B;  3M8C A;  5IG0 A;  2CFL A;  1MGW A;  3ZFZ A;  1YJN 3;  2OOV C;  4HZ9 B;  4HKV B;  2OTJ 3;  5ELU A;  3PCR A;  2IYJ A;  4FCJ A;  4IPB A;  5CF1 A;  1EEJ A;  1MWR A;  2W56 A;  4NPB A;  3OW2 2;  2CFD A;  1TUH A;  2P05 A;  1OF5 B;  3CNX A;  3B4P A;  1GD3 A;  2E2U A;  2W9P A;  4XBY A;  1W02 A;  3DXO A;  1IVW A;  1RNT A;  3D5I A;  3LTB A;  4HYZ A;  1FYS A;  1DET A;  3S27 A;  4RNY A;  1NB5 I;  1IT7 A;  1Z1S A;  2V1L A;  2K0M A;  3BB9 A;  3BIR A;  1I2F A;  2KCD A;  1JKG A;  3GZR A;  3IPT A;  3OWY A;  4J9A A;  3RNT A;  4GB5 A;  4N6O B;  3GZY B;  4HM5 B;  1M9G A;  1LXE A;  1BU4 A;  4XM4 A;  4BL3 A;  1JZO A;  2CWT A;  3L0R A;  1YHQ 3;  2O9U X;  1IV9 A;  2CWV A;  3FG4 A;  4ILF A;  2GEX A;  1W5Z A;  3AGN A;  2HMN B;  2P0X A;  3FF0 A;  3NXJ A;  1RKY A;  1RCL A;  1VQM 3;  2Z76 A;  2C11 A;  2XGN A;  2YFI B;  1ZGX A;  2BNG A;  4R4K A;  3Q1C A;  3WOF B;  3SED A;  3FG1 A;  2H0G A;  3DMC A;  2ZL8 A;  2P38 A;  1E3R A;  5KP4 A;  1DVC A;  3EC9 A;  1CYU A;  1FUW A;  3EB8 A;  2UGI A;  3B8L A;  1X1X A;  1OGZ A;  3GZB A;  4IIA A;  1W6C A;  3TDG A;  2GEY A;  1BNS A;  4CJN A;  3HII A;  3K7C A;  1N8R 4;  1RGF A;  1TIJ A;  2OQE C;  5IEN A;  3GSP A;  1SIH A;  3IJE B;  1BNE A;  1V58 A;  3KII A;  5GSP A;  3RGR A;  3CMA 3;  1T3B A;  2BMR B;  1LOY A;  4XDV A;  5AEW B;  3PZW A;  1BOX A;  2CIU A;  4RNZ A;  1LNH A;  4N3V A;  3LYG A;  3N9H A;  2KAA A;  4FMD A;  4O3V A;  4X2H A;  3UL6 A;  4EYC A;  2RBI A;  1BIR A;  4R9L A;  1IQY A;  5IW9 A;  1RRL A;  2CK3 H;  4EC6 A;  2SBL A;  4IT7 A;  3X42 A;  1VZZ A;  1X1Y A;  1Q86 4;  2BMO B;  3NV0 A;  1JBS A;  5JPU A;  1W2B 2;  1EQK A;  1ASK A;  3CC7 3;  1Y4K A;  2W9Q A;  5BIR A;  2INX A;  5KP1 A;  4J5G A;  4R9K A;  4HOH A;  4O8S A;  1Q9E A;  1NWW A;  1ROA A;  1VQK 3;  3HIG A;  3T8N A;  1RJO A;  3G16 A;  2J8X B;  4K61 A;  3KE7 A;  1CQS A;  4HZB B;  5TGN A;  2WGQ A;  3SOA A;  2CFG A;  2K3D A;  4HVN A;  1GSP A;  3SX1 A;  1WNH A;  5IF6 A;  1G02 A;  1OUN A;  1W7C A;  2RSX A;  2ZHX B;  1JB2 A;  1C7H A;  3LXU X;  2IUJ A;  1V74 A;  1I3I A;  3LTC A;  1RTU A;  3A5E A;  2W56 B;  1B2M A;  4CPK A;  1I0V A;  3J7Y d;  3B4O A;  3F7X A;  1GMQ A;  2BMQ B;  2LYX A;  4FMC A;  2RCD A;  1GYB A;  1UI7 A;  2Z77 A;  3N8B A;  1UCJ A;  3GAX A;  3VGN A;  2KF4 A;  3BNB A;  2F5M A;  2OCT A;  4WP5 A;  1I8V A;  1RRH A;  1S5A A;  5LC6 A;  1IVX A;  1CYV A;  1STD A;  2W04 A;  7STD A;  4WWU C;  1X1U A;  3DGN A;  4EW5 A;  3OX9 A;  3DH2 A;  2CC3 A;  1B21 A;  1GOV A;  3N54 B;  3EE1 A;  3PS8 A;  4HAA A;  1GS3 A;  3CCR 3;  3PYJ A;  1RGL A;  5AYS C;  3SLU A;  5EQL A;  2YX9 A;  7RNT A;  1UCL A;  1RHL A;  2MC8 A;  1O7P B;  1VQ4 3;  1ZO2 A;  4WYK B;  1D6U A;  3BNC A;  3D3L A;  1TRQ A;  3URP A;  5JBS A;  2WGO A;  1VQ5 3;  1BSD A;  1M1K 4;  3Q2P A;  3EBT A;  3LH4 A;  3G4S 3;  3X3Y A;  1S72 3;  3CCL 3;  1FGR A;  2FNQ A;  1BSE A;  4ORL A;  3U1W A;  3EF8 A;  5CLK A;  1GD4 A;  1UCK A;  5M19 A;  5FW5 A;  5HGR A;  1IVU A;  4NRE A;  3E99 A;  3K63 A;  1M90 4;  2IMJ A;  3EX9 A;  3HK4 A;  4R80 A;  1RGK A;  2OWP A;  1OH0 A;  3MPH A;  2OQE A;  3STD A;  1VQL 3;  3ECF A;  3D4A A;  5G1K A;  1FGQ A;  1O7M B;  2IA7 A;  1WMP A;  3WOD G;  2GSP A;  2KF5 A;  4WYK A;  1TTO A;  1TRP A;  3DZL A;  1SII A;  4TX4 A;  1V57 A;  2A15 A;  4GHO A;  4O2H A;  1I3F A;  1Q81 4;  1IQX A;  1UUV B;  4WFO A;  2XRX B;  4CCV A;  1A90 A;  1KQS 2;  3T0U A;  2H0H A;  3CCQ 3;  1OGX A;  3QK9 A;  2ML6 A;  1BAN A;  2XGL A;  4X2O A;  4OK0 A;  1ISK A;  2ML5 A;  3F8X A;  1BRK A;  3Q3F A;  1PYL A;  1HYF A;  1I2E A;  1OHP A;  3DY5 A;  3HI7 A;  3WMD A;  1CEW I;  3WA2 X;  3H3H A;  4FCM A;  2PZV A;  4K1V A;  2P09 A;  4KVH A;  4RNT A;  1IVV A;  5EEO A;  6STD A;  4HM6 B;  3FH1 A;  1B2X A;  1U8C B;  4FMB A;  5LC7 A;  1FW7 A;  5AIF A;  1TFK A;  7GSP A;  2HOH A;  1LOV A;  5STD A;  3V98 A;  2CG0 A;  1BNR A;  3NBB A;  1KSI A;  3WOE B;  2L4V A;  4N6L A;  1DYU A;  3OWS A;  1SAR A;  4OUQ A;  1RGG A;  1G0T A;  1O7W B;  4GL6 A;  1OHO A;  1YVB I;  3G8Z A;  2ZDJ A;  2GU1 A;  6GSP A;  3AHW A;  2R41 A;  4L8O A;  3X3X A;  1JKG B;  5BU4 A;  3CCM 3;  3S67 A;  2QA4 3;  2D42 A;  2CFW A;  4KT3 B;  3JUP A;  2KF3 A;  1JV2 B;  1QMA A;  1K8A 4;  5BVB A;  1DMN A;  1WMO A;  2D1W A;  4DKI A;  4FR9 A;  3LZA A;  2B1X B;  4L8P A;  2XH9 A;  1EUI C;  4WHA A;  1K73 4;  1WMN A;  3D9R A;  3I0Y A;  5JPP A;  3K0Z A;  1PFP A;  1WQL B;  1FUS A;  1GOU A;  2HMM B;  1BGS A;  1FA3 A;  9RNT A;  1OAC A;  2IY2 A;  1W2Z A;  1W00 A;  3JUM A;  1FGO A;  3OV4 A;  5AIG A;  3BU4 A;  3UB1 A;  1SQW A;  4BIR A;  8RNT A;  1OPY A;  4LSO A;  4FMA A;  2Y73 A;  1RMS A;  4MMZ B;  3D79 A;  5DRE A;  1BRG A;  2AAE A;  3F8H A;  3F9S A;  3BNE A;  1UDI I;  4J5K A;  3QRD A;  1RN4 A;  3MSO A;  3ZG5 A;  1DVD A;  1U5O A;  1YGE A;  3MKI A;  4KZ1 A;  5AI1 A;  2CFK A;  5CK6 A;  1RGA A;  4EXR A;  3UNL A;  4XBX A;  4O02 B;  1SJW A;  4JF8 A;  3S5C A;  5I97 A;  1YIT 3;  3WHO A;  5CXO A;  1GMP A;  1GY7 A;  6RNT A;  4HBR A;  3FGY A;  1JBR A; 
#chains in the Genus database with same CATH homology
 1O7G B;  1IU7 A;  1IK3 A;  4NHF A;  3AMO A;  3UJM A;  1EA2 A;  1SPU A;  2Z7A A;  1JNQ A;  3CME 3;  1VQ7 3;  2MF7 A;  1RN7 A;  1AVK A;  1N9E A;  1LVN A;  1N5P A;  1N9J A;  1HKX A;  3MG2 A;  4AKZ A;  4BTY A;  2PNC A;  4STD A;  3MG1 A;  3WDG B;  3EBY A;  3CCE 3;  3EN1 B;  1F8N A;  3CD6 3;  1YI2 3;  3IMA B;  1VQO 3;  3KSE D;  3FZW A;  1EKM A;  1ULI B;  3Q90 A;  1BUQ A;  1Q40 A;  3DM8 A;  3ALA A;  2W03 A;  2BHM A;  3LML A;  2QEX 3;  2RFR A;  4LEH A;  5AEU B;  1W6G A;  2OTL 3;  2OOV A;  2KRT A;  1IDP A;  1GY5 A;  3A76 A;  1N5H A;  3JVC A;  1A2V A;  1VQ9 3;  2IUK A;  3T8U A;  5IG3 A;  1O7N B;  3FLJ A;  3O8Y A;  5AII A;  5BXQ A;  1AR0 A;  2XEP A;  5IG5 A;  1NJI 4;  5IEO A;  3NX0 A;  1QAL A;  4L7K A;  4RZM A;  3NM2 A;  2GXF A;  1UUW B;  3HZP A;  5AIH A;  4N6U A;  4CDL A;  2Y74 A;  4XDW A;  2YFJ B;  1IT8 A;  1ULJ B;  2M7O A;  1E3V A;  3KZT A;  3KKG A;  2GU3 A;  3SVA A;  4LZI A;  3DGO A;  2GBX B;  3LT8 A;  2WOH A;  3FSD A;  1HU9 A;  2XSH B;  2CWU A;  2F98 A;  2Q07 A;  1JB5 A;  3CCV 3;  1L5G B;  4I4K A;  1US1 A;  4BTW A;  3ER7 A;  1Q7Y 4;  3NQY A;  1A67 A;  3HX8 A;  1KD1 4;  3MWZ A;  4N6M A;  2WO0 A;  2QIY A;  3JUQ A;  2W2C A;  3G6E 3;  4N6N B;  2F86 B;  2JQ5 A;  3KSP A;  4AKY A;  2I9W A;  3NBR A;  1G96 A;  1JRQ A;  1IQ8 A;  3F40 A;  5D81 A;  3LOY A;  3EN8 A;  1QAF A;  2BT3 A;  4K1U A;  1Q40 B;  3V99 A;  1UW1 A;  1STF I;  3DGM A;  2QGU A;  8CHO A;  1NU3 A;  1N8Q A;  3BLZ A;  3PXM A;  4U13 A;  3CXC 2;  1T5Y A;  2B24 B;  4MMY B;  2XSO B;  1J2B A;  3ROB A;  1GY6 A;  3OXA A;  4HM7 B;  2P0M A;  4N6T A;  1QVG 2;  3S28 A;  1O7H B;  4MMX B;  2HMK B;  4HM1 B;  3K5T A;  4XB5 A;  3K9M C;  1NB3 I;  4HJL B;  4K90 B;  5D83 A;  4BTX A;  3JUN A;  3LTD A;  4OVM A;  1K9M 4;  5CF2 A;  1OCV A;  1Q82 4;  2KXG A;  3EQQ B;  4HM3 B;  3SOY A;  4LGQ A;  3NUV A;  4AEQ A;  3I56 3;  5DRV A;  5G2G A;  3CPW 2;  3GRD A;  4QWT A;  4MJD A;  5KP3 A;  1YIJ 3;  1UI8 A;  3GWR A;  2CG1 A;  1PU4 A;  1VQN 3;  2K54 A;  1LOX A;  1R4C A;  2R4I A;  1AV4 A;  1TFO A;  1ROV A;  2W0Q A;  1W4N A;  1M1X B;  1W01 A;  4KFD A;  1KC8 4;  1DMM A;  3G0K A;  2XF3 A;  3CPO A;  1WTH A;  3X3Z A;  4H3U A;  4JRF A;  3CU3 A;  4R1K A;  1JN5 A;  1QAK A;  5AYR B;  1K41 A;  5FGO A;  1NDO B;  4N6V 0;  4KFF A;  3FKA A;  3B7C A;  2JDI H;  3DUK A;  4HM4 B;  1VQP 3;  1YJW 3;  3NHX A;  5D82 A;  5IEP A;  3VF1 A;  5ELJ A;  3F14 A;  3FCS B;  2YFL B;  3OWU A;  5IER A;  1OF5 A;  1A2K A;  1D6Z A;  1EG9 B;  3BND A;  1JJ2 2;  1QVF 2;  1ZX2 A;  1YJ9 3;  1Q42 A;  3H51 A;  4MEI A;  2HML B;  4HM2 B;  3PCS A;  4EBG A;  3DGL A;  1FGT A;  3MHE A;  1MNL A;  2E2V A;  2XFS A;  4XBT A;  3LT9 A;  4EV2 A;  3CC2 3;  3S29 A;  4H61 A;  2HMJ B;  4FCZ A;  5A0O B;  3EHC A;  1TU5 A;  5IG4 A;  2C10 A;  2UX0 A;  3NQZ A;  1OHS A;  2CKF B;  4HM0 B;  1VQ8 3;  2CH9 A;  2O3O A;  2CW9 A;  5EVH A;  1VQ6 3;  3CCU 3;  3CCS 3;  2E2T A;  2FGT A;  3CNM A;  3KFQ C;  3RDE A;  1FGM A;  1MOL A;  3UL5 A;  3X41 A;  3SXX A;  2LQV A;  4KFE A;  2CHC A;  3AMO B;  3MG3 A;  3RGA A;  2STD A;  4LMI A;  3PGB A;  2BO9 B;  3GZX B;  3CCJ 3;  2F99 A;  2GBW B;  3NBJ A;  1JN5 B;  3EJV A;  3FF2 A;  4ZM8 A;  4PEJ A;  4J8T A;  2FXT A;  1D6Y A;  3G71 3;  1JB4 A;  2XFT A;  4G1M B;  3U97 A;  1K28 A;  4Q53 A;  3I55 3;  2HMO B;  2Z6B A;  4EV5 A;  1TP6 A;  3V92 A;  1DMQ A;  2RGQ A;  3MYT A;  3VSY A;  1AVL A;  1E97 A;  1NO3 A;  3F7S A;  2W6J H;  3KN4 A;  3NV0 B;  1KWI A;  3LTA A;  3CC4 3;  3X40 A;  3WA3 A;  4HM8 B;  4RBN A;  3NM7 A;  1IV7 A;  1QJG A;  3JUO A;  2WOF A;  3FG3 A;  1W6Y A;  2XR8 B;  3M8C A;  5IG0 A;  2CFL A;  1YJN 3;  2OOV C;  4HZ9 B;  4HKV B;  2OTJ 3;  5ELU A;  3PCR A;  4FCJ A;  4IPB A;  5CF1 A;  2W56 A;  3OW2 2;  2CFD A;  1TUH A;  2P05 A;  1OF5 B;  3CNX A;  3B4P A;  1GD3 A;  2E2U A;  2W9P A;  4XBY A;  1W02 A;  3DXO A;  1IVW A;  3LTB A;  4HYZ A;  3S27 A;  4RNY A;  1NB5 I;  1IT7 A;  1Z1S A;  2V1L A;  2K0M A;  3BB9 A;  3IPT A;  2KCD A;  1JKG A;  3GZR A;  3OWY A;  4J9A A;  4GB5 A;  4N6O B;  3GZY B;  4HM5 B;  1M9G A;  1LXE A;  4XM4 A;  3L0R A;  2CWT A;  1YHQ 3;  2O9U X;  1IV9 A;  2CWV A;  3FG4 A;  2GEX A;  1W5Z A;  1RKY A;  2HMN B;  2P0X A;  3FF0 A;  3NXJ A;  1VQM 3;  2Z76 A;  2C11 A;  2XGN A;  2YFI B;  2BNG A;  4R4K A;  3Q1C A;  3WOF B;  3SED A;  3FG1 A;  3DMC A;  2ZL8 A;  2P38 A;  1E3R A;  5KP4 A;  1DVC A;  3EC9 A;  1CYU A;  1FUW A;  3EB8 A;  3B8L A;  1OGZ A;  3GZB A;  4IIA A;  1W6C A;  3TDG A;  2GEY A;  3HII A;  3K7C A;  1N8R 4;  1TIJ A;  2OQE C;  5IEN A;  1SIH A;  3IJE B;  3RGR A;  3KII A;  3CMA 3;  2BMR B;  4XDV A;  5AEW B;  3PZW A;  2CIU A;  4RNZ A;  1LNH A;  4N3V A;  3LYG A;  3N9H A;  4O3V A;  4FMD A;  3UL6 A;  4X2H A;  4EYC A;  4R9L A;  1IQY A;  5IW9 A;  1RRL A;  2CK3 H;  4EC6 A;  2SBL A;  4IT7 A;  3X42 A;  1VZZ A;  1Q86 4;  2BMO B;  3NV0 A;  5JPU A;  1W2B 2;  1EQK A;  1ASK A;  3CC7 3;  1Y4K A;  2W9Q A;  2INX A;  5KP1 A;  4R9K A;  4O8S A;  1NWW A;  1ROA A;  1VQK 3;  3HIG A;  3T8N A;  1RJO A;  3G16 A;  4K61 A;  3KE7 A;  1CQS A;  4HZB B;  5TGN A;  2WGQ A;  3SOA A;  2CFG A;  4HVN A;  3SX1 A;  1WNH A;  5IF6 A;  1OUN A;  1W7C A;  2RSX A;  1JB2 A;  1C7H A;  3LXU X;  2IUJ A;  1V74 A;  3LTC A;  2W56 B;  3J7Y d;  3B4O A;  3F7X A;  2BMQ B;  2LYX A;  4FMC A;  2RCD A;  1GYB A;  1UI7 A;  2Z77 A;  3N8B A;  3GAX A;  3VGN A;  3BNB A;  4WP5 A;  2OCT A;  5LC6 A;  1RRH A;  1S5A A;  1IVX A;  1CYV A;  1STD A;  2W04 A;  7STD A;  4WWU C;  3DGN A;  3OX9 A;  2CC3 A;  3CCR 3;  3N54 B;  3EE1 A;  3PS8 A;  1GS3 A;  3PYJ A;  5AYS C;  3SLU A;  5EQL A;  2YX9 A;  2MC8 A;  1O7P B;  1VQ4 3;  1ZO2 A;  4WYK B;  1D6U A;  3BNC A;  3D3L A;  5JBS A;  2WGO A;  1VQ5 3;  1M1K 4;  3Q2P A;  3EBT A;  3LH4 A;  3G4S 3;  3X3Y A;  1S72 3;  3CCL 3;  1FGR A;  2FNQ A;  4ORL A;  3U1W A;  3EF8 A;  5CLK A;  1GD4 A;  5FW5 A;  5HGR A;  1IVU A;  4NRE A;  3E99 A;  3K63 A;  1M90 4;  2IMJ A;  3EX9 A;  3HK4 A;  4R80 A;  2OWP A;  3MPH A;  1OH0 A;  2OQE A;  3STD A;  1VQL 3;  3ECF A;  1FGQ A;  1O7M B;  2IA7 A;  1WMP A;  3WOD G;  4WYK A;  3DZL A;  1SII A;  4TX4 A;  2A15 A;  4O2H A;  1Q81 4;  1IQX A;  1UUV B;  4WFO A;  2XRX B;  4CCV A;  1A90 A;  1KQS 2;  3T0U A;  3CCQ 3;  1OGX A;  3QK9 A;  2ML6 A;  2XGL A;  4X2O A;  4OK0 A;  1ISK A;  2ML5 A;  3F8X A;  3WMD A;  1OHP A;  3DY5 A;  3HI7 A;  1CEW I;  3WA2 X;  3H3H A;  4FCM A;  2PZV A;  4K1V A;  2P09 A;  4KVH A;  1IVV A;  5EEO A;  6STD A;  4HM6 B;  3FH1 A;  1U8C B;  4FMB A;  5LC7 A;  5AIF A;  1TFK A;  5STD A;  3V98 A;  2CG0 A;  3NBB A;  1KSI A;  3WOE B;  2L4V A;  4N6L A;  1DYU A;  3OWS A;  4OUQ A;  1O7W B;  4GL6 A;  1OHO A;  1YVB I;  3G8Z A;  2ZDJ A;  2GU1 A;  4L8O A;  3X3X A;  3CCM 3;  1JKG B;  3S67 A;  2QA4 3;  2D42 A;  2CFW A;  3JUP A;  1JV2 B;  1QMA A;  1K8A 4;  5BVB A;  1DMN A;  1WMO A;  2D1W A;  4FR9 A;  3LZA A;  2B1X B;  4L8P A;  2XH9 A;  1K73 4;  4WHA A;  1WMN A;  3D9R A;  3I0Y A;  5JPP A;  3K0Z A;  1PFP A;  1WQL B;  2HMM B;  1FA3 A;  1OAC A;  3UB1 A;  1W2Z A;  1W00 A;  3JUM A;  1FGO A;  3OV4 A;  5AIG A;  1SQW A;  1OPY A;  4LSO A;  4FMA A;  2Y73 A;  4MMZ B;  5DRE A;  3F8H A;  3F9S A;  3BNE A;  3QRD A;  3MSO A;  1DVD A;  1U5O A;  1YGE A;  3MKI A;  4KZ1 A;  5AI1 A;  2CFK A;  5CK6 A;  4EXR A;  3UNL A;  4XBX A;  4O02 B;  1SJW A;  4JF8 A;  3S5C A;  5I97 A;  1YIT 3;  5CXO A;  1GY7 A;  4HBR A;  3FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...