3EBYA

Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
153
Chain Sequence
EVAQVAQSAIDDFNAAYGLCLDDDRLEQWPTLFVDDCLYQVIARENVDNGLPAAVMYCDSKGMLADRVVALRKANHFNRHLIGRAVITGVEGDQVSAEASYVVFQTRNDGETRIYNAGKYVDRFDLSGGTVRLKSRTCIYDTLRIATLLATPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
rcsb
molecule keywords beta subunit of a putative Aromatic-ring-hydroxylating dioxy
molecule tags Structural genomics, unknown function
source organism Novosphingobium aromaticivorans dsm 12444
total genus 47
structure length 153
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebyA00
3GRDA 2F98A 3FLJA 1W02A 2F99A 2BMOB 3NV0B 1JB4A 4HZ9B 3NV0A 1S5AA 1W01A 4KVHA 3EHCA 3GZBA 3GZRA 4HM2B 3HZPA 1JN5B 5IG5A 1O7WB 4HZBB 5CF2A 1JN5A 3NXJA 2GEXA 2UX0A 3ECFA 4L7KA 3G16A 2A15A 1VZZA 3RGRA 3NM2A 2GXFA 4RZMA 1OGZA 1DMQA 3F9SA 5KP1A 4L8PA 4N3VA 4XBTA 3SOAA 2BMRB 1OUNA 1OGXA 2STDA 1ULIB 3EQQB 4HM5B 3OXAA 4LMIA 2BNGA 1O7NB 3A76A 3MYTA 1JB5A 2F86B 3G0KA 2K54A 4XBYA 5JPUA 2GBWB 2HMNB 1K41A 3VSYA 4HJLB 3E99A 3M8CA 1CQSA 3DXOA 3EBYA 1Q40B 2RFRA 3DUKA 3HX8A 3H51A 2XSHB 1ZO2A 4XDVA 3IPTA 2YFIB 1A2KA 4J9AA 3GZYB 3JUQA 5CF1A 3F7XA 5BXQA 2GBXB 4HKVB 1W00A 5IG4A 3MHEA 3STDA 5JPPA 3UJMA 1OF5A 3UNLA 1QMAA 3BB9A 3FF2A 4R9KA 3F8HA 2JQ5A 2YFJB 4OUQA 3SEDA 3DMCA 4MJDA 2RGQA 3K7CA 1WQLB 5AIFA 4FCJA 2R4IA 5DRVA 8CHOA 5FW5A 1IDPA 3B7CA 4ORLA 3EC9A 1NDOB 3CNMA 1GS3A 3G8ZA 1DMMA 5HGRA 4HM0B 4FCMA 4GB5A 5AIHA 5D82A 3DZLA 2QGUA 4LEHA 3FF0A 3ER7A 1ULJB 1TUHA 4R1KA 5D83A 4K1UA 2HMLB 3NHXA 5CXOA 4R9LA 4U13A 1QJGA 1ISKA 4X2OA 5IERA 4WP5A 2W2CA 2CKFB 1SJWA 5IENA 4HM7B 1E3VA 4HVNA 3MSOA 3EX9A 1NWWA 3S5CA 2XSOB 4XDWA 1DMNA 1OPYA 5IF6A 3H3HA 3EF8A 2OWPA 4J8TA 4Q53A 2HMMB 3DM8A 3FSDA 3T8UA 5IG3A 3FZWA 4I4KA 3F40A 3MG1A 4CDLA 3MG2A 2CHCA 2HMKB 2HMJB 4H3UA 1OHPA 1Q42A 3CU3A 1AR0A 1JKGB 5EVHA 1JKGA 5AI1A 3JUNA 3F14A 1HKXA 5AIIA 5KP3A 4WWUC 2GEYA 3Q90A 3WMDA 5AIGA 1C7HA 1OF5B 3T8NA 1NU3A 1STDA 1GY6A 5AEUB 5IEOA 3F8XA 3KKGA 1O7PB 2XRXB 1TP6A 5IG0A 5AEWB 3RGAA 5G2GA 5CLKA 5IEPA 6STDA 4HM3B 5BVBA 1O7GB 3EN8A 3OWSA 3GZXB 3F7SA 1W6YA 3OV4A 3VGNA 3OX9A 2HMOB 4K1VA 4STDA 3KE7A 1UUWB 3EJVA 2INXA 3FKAA 1GY7A 4HM8B 7STDA 2B24B 3SOYA 1Z1SA 2YFLB 3D9RA 2Z7AA 3LYGA 3KZTA 4WYKB 1EA2A 3KSPA 4WYKA 4XB5A 1GY5A 3B4OA 1OHOA 4X2HA 3EN1B 3BLZA 4OVMA 5D81A 3B4PA 3JUOA 4L8OA 1OH0A 1O7MB 2Z77A 1GYBA 3NUVA 1OCVA 4HM1B 1ASKA 2XR8B 2B1XB 3MG3A 3LZAA 4HM6B 5STDA 1E3RA 3MKIA 1OHSA 3OWUA 3EBTA 4IIAA 3K0ZA 5KP4A 5DREA 3HK4A 3JUMA 1O7HB 1JB2A 3JUPA 1Q40A 3FGYA 4XM4A 2Z76A 2PZVA 4PEJA 4XBXA 5CK6A 2IMJA 3B8LA 1BUQA 4LGQA 4HM4B 2BMQB 3I0YA 2RCDA 3CPOA 2I9WA 3ROBA 1U5OA 1E97A 1UUVB 1EG9B 3NBRA 3OWYA 3FH1A 1ZX2A 3GWRA 2QIYA 5TGNA 3CNXA
chains in the Genus database with same CATH superfamily
1KSIA 2C10A 2ZL8A 3GRDA 2F98A 3FLJA 1W02A 1BNRA 2F99A 2CH9A 1J2BA 2BMOB 3NV0B 1JB4A 3DGMA 1GSPA 9RNTA 4HZ9B 3TDGA 1FUSA 3NV0A 1S5AA 4EBGA 1W01A 1W2B2 3MWZA 3EHCA 4KVHA 1WMOA 3GZBA 3WDGB 3GZRA 1VQM3 2CFGA 4HM2B 5AYSC 1LXEA 1ZGXA 1TIJA 1UW1A 4J5GA 2C4BA 3HZPA 1JN5B 1QAFA 1D6UA 2CFWA 2WOHA 1C54A 1RN1A 5IG5A 1BNEA 1O7WB 4HZBB 5CF2A 1JN5A 3NXJA 2GEXA 2UX0A 3T0UA 3N9HA 2Z6BA 1I2EA 3ECFA 2F56A 4L7KA 3G16A 2A15A 2P05A 1KC84 1VQ83 1VZZA 4CCVA 2CG1A 1A2VA 3RGRA 1SIHA 2BO9B 3NM2A 3LH4A 4KFFA 1B21A 3WA2X 2GXFA 3ALAA 4N6OB 2KCDA 1OACA 4RZMA 1CH0A 2LQVA 1OGZA 1ROVA 1DMQA 3IMAB 2ML6A 3AGNA 3F9SA 1IQYA 5KP1A 4L8PA 3JVCA 4N3VA 4XBTA 1LVNA 2H0HA 3SOAA 3WHOA 1MOLA 2F5MA 3UL6A 1BSEA 1GMQA 1QALA 1S723 5M19A 4G1MB 2BMRB 1OUNA 1OGXA 2STDA 1ULIB 2WGQA 4LZIA 1RHLA 3EQQB 4HM5B 2ZDJA 5BU4A 1JZDA 2CWVA 3OXAA 4J5KA 3DH2A 1BAOA 4LMIA 2BNGA 1MWSA 1K28A 1O7NB 2ZA4A 3A76A 1M1XB 3MYTA 1YVBI 1BRNL 1JB5A 2CFKA 1TRPA 4N6UA 1TFOA 2F86B 2OQEA 3G0KA 1BSAA 4AEQA 2K54A 4XBYA 1DYUA 1UUGB 1X1UA 4QWTA 5JPUA 1Q814 2IA7A 1FUTA 5ELUA 1I2FA 1BOXA 1VQQA 2GBWB 1TRQA 2HMNB 4R80A 4HOHA 2P09A 2WO0A 1RCLA 1K41A 1RRHA 2H0GA 3LTAA 3X3ZA 3S29A 3BNEA 1CYVA 5LC7A 5LC6A 3VSYA 4BTWA 1MWRA 1BVIA 2L1SA 3GSPA 4HJLB 1A67A 4HAAA 1JV2B 5A0OB 3NX0A 3E99A 2P38A 3A5EA 1NNVA 3SVAA 1YJW3 5G1KA 3IJEB 2OTL3 3M8CA 1CQSA 1WNHA 1LOWA 4LSOA 2KF3A 1BANA 3DXOA 3EBYA 2ML5A 1PFPA 4EXRA 4ZM8A 1HYFA 3D3LA 1SIIA 2W9QA 1VQ63 3K5TA 1Q40B 2RFRA 3DUKA 3BNBA 3HX8A 1TFKA 1NJI4 3H51A 4IPBA 1UI7A 2XSHB 1ZO2A 1EEJA 4XDVA 2KXGA 3IPTA 2YFIB 2E2UA 4H61A 1BNFA 1RGCA 4ILFA 1A2KA 4RNTA 4KT3B 4J9AA 3CCS3 3GZYB 2OOVC 3JUQA 5FGOA 1VQ73 3KIIA 1RGAA 5CF1A 3F7XA 3SLUA 5BXQA 2GBXB 4HKVB 1N5PA 1GOVA 1W00A 4NPBA 5IG4A 3MHEA 3STDA 5JPPA 1YGEA 4MMYB 1UCIA 3D5IA 3UJMA 3Q3FA 1EQKA 1U8CB 1M9GA 1OF5A 3UNLA 1QMAA 1DE3A 3BB9A 1FW7A 3FF2A 3NBBA 4R9KA 2P0MA 5IW9A 3F8HA 2XH9A 3I553 1B3SA 2JQ5A 1IVXA 2YFJB 3LTCA 1CEWI 4OUQA 3SEDA 3SXXA 1AQZA 3DMCA 4NHFA 4MJDA 1K8A4 3Q1CA 3I563 3BU4A 1ROAA 1YIT3 2RGQA 3D5GA 3K7CA 2RBIA 3RNTA 1WQLB 5AIFA 4GSPA 1VQK3 1B2SA 2R4IA 4FCJA 1B2UA 4FMCA 1RSNA 5DRVA 4N6LA 1MNLA 4N6TA 1A2PA 8CHOA 1VQL3 2O9UX 4IT7A 5FW5A 2KF5A 1RNTA 1IDPA 4AKYA 1RTUA 3N8BA 2LYXA 4RNYA 4K61A 2C11A 3B7CA 3CPW2 1BNSA 4ORLA 2H0IA 3EC9A 1NDOB 3CNMA 1I0XA 3KN4A 1GS3A 2Y73A 3G8ZA 1N9EA 3EE1A 1DMMA 4O3VA 5HGRA 1FUWA 2W56A 4MMXB 2BU4A 2D42A 3G713 4HM0B 4FCMA 2J8XB 3PCRA 1DVCA 1RKYA 3Q2PA 1UI8A 4WHAA 2CX0A 4GB5A 5AIHA 5D82A 2V1LA 2XFTA 3DZLA 1KD14 2QGUA 3DGOA 4LEHA 1IVWA 1LQGC 3ER7A 3FF0A 4R4KA 3OW22 3U97A 1AV4A 1GOYA 1MGWA 1ULJB 3FCSB 1TUHA 3UL5A 1WMPA 3CCM3 4R1KA 2W03A 5D83A 1US1A 1W4NA 4K1UA 1YJ93 2HMLB 3NHXA 5CXOA 3ZG0A 1A90A 1M904 1FGOA 1T2IA 4R9LA 1YVSA 2YX9A 2Q07A 3AMOA 4U13A 2KF6A 2UGIA 1QJGA 1YJN3 2W6JH 1PU4A 4I5QA 1ISKA 3EB8A 3K9MC 3WR2A 4X2OA 2XF3A 4CJNA 1RGKA 5IERA 4WP5A 5RNTA 7GSPA 3CCJ3 2W2CA 1QVF2 2CKFB 1SJWA 4FMAA 1JRQA 3QK9A 5IENA 1TU5A 4HM7B 1E3VA 2CG0A 2IUJA 1CYUA 4HVNA 1SPUA 2OCTA 2P0XA 3MSOA 4CPKA 1TTOA 3EX9A 1NWWA 1B20A 1MWUA 2E2TA 1BRGA 1BSBA 1IVVA 1FGMA 2XSOB 1PYLA 2F5WA 4XDWA 1IK3A 1KQS2 1DMNA 1SARA 1OPYA 6GSPA 2FXTA 3DGNA 5IF6A 1G96A 3H3HA 2MC8A 4RNZA 1IQ8A 3CCQ3 3S27A 3EF8A 3S67A 2OOVA 5BIRA 2OWPA 4J8TA 4N6V0 4Q53A 1IYYA 2HMMB 1BSCA 3KSED 4BIRA 3G4S3 3K63A 3DM8A 2JDIH 3FSDA 1K9M4 1RRLA 1HU9A 3T8UA 5IG3A 2XGNA 3FZWA 1NB3I 2E2VA 1W6CA 4I4KA 1AVLA 3F40A 3MG1A 4CDLA 2BHMA 1W6GA 3FG1A 3MG2A 3PZWA 1GD3A 2CHCA 1IV7A 2HMJB 2HMKB 3L0RA 2R41A 4H3UA 1V74A 3CC23 2D1WA 1WTHA 1OHPA 1Q42A 2CWUA 2CX1A 3CC73 3NQYA 3CU3A 1MGRA 1YGWA 1AR0A 1JKGB 1QAKA 4BL2A 4BTYA 1T3BA 2K0MA 1Q7Y4 5EVHA 1G02A 1JKGA 5AI1A 4KFDA 3JUNA 3F14A 1RLSA 3MPHA 1HKXA 5AIIA 1V57A 2L4VA 1JBRA 1LNHA 5KP3A 1JJ22 4WWUC 3LT8A 3HIGA 1T2HA 4MMZB 1BRHA 2GEYA 3VF1A 4BTXA 1JBTA 1BRKA 2Y74A 3Q90A 5AYRB 3HI7A 4EV5A 3DGYA 3WMDA 5AIGA 4JRFA 1HZ1A 4RBNA 3CXC2 1C7HA 1YHQ3 3AGOA 4TX4A 1NB5I 2SBLA 1PY3A 1OF5B 3T8NA 1G0TA 3X41A 4GHOA 1NU3A 2IYJA 3LT9A 1STDA 1I70A 1BNJA 1M1K4 2W9PA 1GY6A 4BL3A 4O02B 1N9JA 1RGLA 2CW9A 3CME3 5AEUB 4GL6A 3CMA3 3QRDA 3ZG5A 1AY7A 1FGTA 4JF8A 5IEOA 3F8XA 1BGSA 3KKGA 1VQ53 1O7PB 1DVDA 3V92A 2XRXB 4FMDA 1TP6A 4EV2A 5IG0A 5AEWB 3N54B 3LTDA 3RGAA 1W7CA 5G2GA 4KZ1A 1RGFA 1RMSA 2IUKA 5I97A 1YI23 1RN7A 5CLKA 4MEIA 3KCHA 5IEPA 6STDA 1FA3A 3NQZA 3X42A 3HIIA 3LOYA 4HM3B 5BVBA 3DY5A 4NREA 1O7GB 1RNBA 1RGGA 4FR9A 3S5CA 3EN8A 3OWSA 4LYLB 1Q9EA 2W56B 3WA3A 3GZXB 3F7SA 4N6NB 1W6YA 3BIRA 3OV4A 3CCU3 2O3OA 1BSDA 4DKIA 3CCL3 3VGNA 5M18A 1B2MA 4WFOA 3PYJA 3URPA 3V99A 3OX9A 1LRAA 1X1YA 4BU4A 2CK3H 4O8SA 2BT3A 1R4YA 3CCE3 1UGIA 2HMOB 5HOHA 4K1VA 4STDA 3CCV3 3AHSA 5JBSA 1GMRA 1BU4A 3KE7A 1UUWB 3GAXA 1I3IA 3EJVA 7RNTA 3FG4A 4KFEA 4FMBA 2INXA 2FGTA 1AVKA 4AKZA 3FKAA 1GY7A 3UB1A 3CD63 3AMOB 8RNTA 3X40A 4HM8B 2RSXA 1R4CA 4HBRA 7STDA 1W5ZA 2B24B 1WMNA 1X1XA 3SX1A 2CWTA 3SOYA 1Z1SA 3S28A 3PGBA 2YFLB 1X1WA 1YIJ3 3PS8A 1TJDA 1W2ZA 2PNCA 3WOEB 3D4AA 1Q7HA 3D9RA 3LXUX 3WODG 3V98A 2Z7AA 1IT8A 1I3FA 3FG3A 1JBSA 3LYGA 1JNQA 3BNDA 3DGLA 4HYZA 2AAEA 3KZTA 4WYKB 1EA2A 1F8NA 2SARA 2GU1A 2F4YA 2WOFA 1UDII 3KSPA 4WYKA 4XB5A 1BRIA 1L5GB 1GY5A 1RGHA 1IQXA 2KRTA 3B4OA 3U1WA 2M7OA 1OHOA 4X2HA 1Q864 1T5YA 3EN1B 3BLZA 4OVMA 5D81A 1LOYA 3B4PA 3X3YA 3JUOA 4L8OA 1I0VA 1OH0A 1N8R4 1GD4A 1DETA 2GSPA 1RGEA 1IT7A 1O7MB 1VQN3 1BNGA 1B2XA 2Z77A 1GYBA 3NUVA 1OCVA 2QEX3 1VQO3 2ZHXB 1V58A 2HOHA 4HM1B 4K90B 3RDEA 1ASKA 1BRSA 3G6E3 2XR8B 3CCR3 5EQLA 2B1XB 5EEOA 1NO3A 2IY2A 1FGRA 1IVUA 1Q824 3MG3A 3LZAA 1Y4KA 3D79A 4HM6B 4O2HA 3NBJA 1VQP3 1I2GA 3O8YA 1SQWA 3ZFZA 4EW5A 5STDA 1E3RA 3J7Yd 1GMPA 4OK0A 3HOHA 3MKIA 1B2ZA 1N8QA 1OHSA 1GOUA 3OWUA 3EBTA 1BRJA 4IIAA 1VQ43 1D6YA 3K0ZA 5KP4A 2KF4A 1BNIA 3HK4A 5DREA 3JUMA 1O7HB 1JB2A 4EC6A 2CIUA 2CFDA 2CFLA 3KFQC 3JUPA 1N5HA 3NM7A 1JZOA 1Q40A 3FGYA 3LTBA 3AHWA 3BNCA 4XM4A 2OQEC 2KAAA 1VQ93 2Z76A 2PZVA 2W0QA 2W04A 4PEJA 4XBXA 5GSPA 1LOXA 2BIRA 1FGQA 1B27A 2RNTA 3PXMA 2AADA 2IMJA 5CK6A 1IV9A 1ZS7A 3B8LA 2CC3A 1EKMA 1BIRA 1STFI 2XEPA 4LGQA 1BUQA 2QA43 4HM4B 1I8VA 2BMQB 1FYSA 3I0YA 1LOVA 5ELJA 2RCDA 5M1AA 2XGLA 3CPOA 2I9WA 1IU7A 1U5OA 2FNQA 3ROBA 1E97A 1EUIC 1RJOA 3PCSA 1LQMB 1QVG2 5G1LA 3LMLA 2GU3A 3CC43 1D6ZA 1LNIA 1UUVB 1RN4A 4N6MA 1EG9B 3X3XA 4EYCA 2OTJ3 1K734 3SYUA 2MF7A 1UCJA 1UCLA 1RCKA 1UGHI 6RNTA 1RDSA 1UCKA 3NBRA 2WGOA 2XFSA 1FZUA 1BUJA 1YNVX 2K3DA 2UUGC 3OWYA 3FH1A 1ZX2A 3GWRA 4FCZA 3WOFB 2QIYA 1KWIA 1MWTA 5TGNA 3CNXA
chains in the Genus database with same CATH topology
1KSIA 2C10A 2ZL8A 3GRDA 2F98A 3FLJA 1W02A 2F99A 2CH9A 1J2BA 2BMOB 3NV0B 1JB4A 3DGMA 4HZ9B 3TDGA 3NV0A 4EBGA 1S5AA 1W01A 1W2B2 3MWZA 3EHCA 4KVHA 1WMOA 3GZBA 3WDGB 3GZRA 1VQM3 2CFGA 4HM2B 5AYSC 1LXEA 1TIJA 1UW1A 3HZPA 1JN5B 1QAFA 1D6UA 2CFWA 2WOHA 5IG5A 1O7WB 4HZBB 5CF2A 1JN5A 3NXJA 2GEXA 2UX0A 3T0UA 3N9HA 2Z6BA 3ECFA 4L7KA 1KC84 3G16A 2A15A 2P05A 1VQ83 1VZZA 4CCVA 2CG1A 1A2VA 3RGRA 1SIHA 2BO9B 3NM2A 3LH4A 4KFFA 3WA2X 2GXFA 3ALAA 4N6OB 2KCDA 1OACA 4RZMA 2LQVA 1OGZA 1ROVA 1DMQA 3IMAB 2ML6A 3F9SA 1IQYA 5KP1A 4L8PA 3JVCA 4N3VA 4XBTA 1LVNA 3SOAA 1MOLA 3UL6A 1QALA 1S723 4G1MB 2BMRB 1OUNA 1OGXA 2STDA 1ULIB 2WGQA 4LZIA 3EQQB 4HM5B 2ZDJA 2CWVA 3OXAA 4LMIA 2BNGA 1O7NB 1K28A 3A76A 3MYTA 1M1XB 1YVBI 1JB5A 2CFKA 4N6UA 1TFOA 2F86B 2OQEA 3G0KA 4AEQA 2K54A 4XBYA 1DYUA 4QWTA 5JPUA 1Q814 2IA7A 5ELUA 2GBWB 2HMNB 4R80A 2P09A 2WO0A 1K41A 1RRHA 3LTAA 3X3ZA 3S29A 3BNEA 1CYVA 5LC7A 5LC6A 3VSYA 4BTWA 4HJLB 1A67A 1JV2B 5A0OB 3NX0A 3E99A 2P38A 3SVAA 1YJW3 3IJEB 2OTL3 3M8CA 1CQSA 1WNHA 4LSOA 3DXOA 3EBYA 2ML5A 1PFPA 4EXRA 4ZM8A 3D3LA 1SIIA 2W9QA 1VQ63 3K5TA 1Q40B 2RFRA 3DUKA 3BNBA 3HX8A 1TFKA 1NJI4 3H51A 4IPBA 1UI7A 2XSHB 1ZO2A 4XDVA 2KXGA 3IPTA 2YFIB 2E2UA 4H61A 1A2KA 4J9AA 3CCS3 3GZYB 2OOVC 3JUQA 5FGOA 1VQ73 3KIIA 5CF1A 3F7XA 3SLUA 5BXQA 2GBXB 4HKVB 1N5PA 1W00A 5IG4A 3MHEA 3STDA 5JPPA 1YGEA 4MMYB 3UJMA 1EQKA 1U8CB 1M9GA 1OF5A 3UNLA 1QMAA 3BB9A 3FF2A 3NBBA 4R9KA 2P0MA 5IW9A 3F8HA 2XH9A 3I553 2JQ5A 1IVXA 2YFJB 3LTCA 1CEWI 4OUQA 3SEDA 3SXXA 3DMCA 4NHFA 4MJDA 1K8A4 3Q1CA 3I563 1ROAA 1YIT3 2RGQA 3K7CA 1WQLB 5AIFA 1VQK3 4FCJA 2R4IA 4FMCA 5DRVA 4N6LA 1MNLA 4N6TA 8CHOA 1VQL3 2O9UX 4IT7A 5FW5A 4AKYA 1IDPA 3N8BA 2LYXA 4RNYA 4K61A 2C11A 3B7CA 3CPW2 4ORLA 3EC9A 1NDOB 3CNMA 3KN4A 1GS3A 2Y73A 3G8ZA 1N9EA 3EE1A 1DMMA 4O3VA 5HGRA 1FUWA 2W56A 4MMXB 2D42A 3G713 4HM0B 4FCMA 3PCRA 1DVCA 1RKYA 3Q2PA 1UI8A 4WHAA 4GB5A 5AIHA 5D82A 2V1LA 2XFTA 3DZLA 1KD14 2QGUA 3DGOA 4LEHA 1IVWA 3FF0A 3ER7A 4R4KA 3OW22 3U97A 1AV4A 1ULJB 3FCSB 1TUHA 3UL5A 1WMPA 3CCM3 4R1KA 2W03A 5D83A 1US1A 1W4NA 4K1UA 1YJ93 2HMLB 3NHXA 5CXOA 1A90A 1M904 1FGOA 4R9LA 4U13A 2YX9A 2Q07A 3AMOA 1QJGA 1YJN3 2W6JH 1PU4A 1ISKA 3EB8A 3K9MC 4X2OA 2XF3A 5IERA 4WP5A 3CCJ3 2W2CA 1QVF2 2CKFB 1SJWA 4FMAA 1JRQA 3QK9A 5IENA 1TU5A 4HM7B 1E3VA 2CG0A 2IUJA 1CYUA 4HVNA 1SPUA 2OCTA 2P0XA 3MSOA 3EX9A 1NWWA 3S5CA 2E2TA 2XSOB 1IK3A 1IVVA 1FGMA 4XDWA 1KQS2 1DMNA 1OPYA 2FXTA 3DGNA 5IF6A 1G96A 3H3HA 2MC8A 4RNZA 1IQ8A 3CCQ3 3S27A 3EF8A 3S67A 2OOVA 2OWPA 4J8TA 4N6V0 4Q53A 2HMMB 3KSED 3G4S3 3K63A 3DM8A 2JDIH 3FSDA 1K9M4 1RRLA 1HU9A 3T8UA 5IG3A 2XGNA 3FZWA 1NB3I 2E2VA 1W6CA 4I4KA 1AVLA 3F40A 3MG1A 4CDLA 2BHMA 1W6GA 3FG1A 3MG2A 3PZWA 1GD3A 2CHCA 1IV7A 2HMJB 2HMKB 3L0RA 4H3UA 1V74A 3CC23 2D1WA 1WTHA 1OHPA 1Q42A 2CWUA 3CC73 3NQYA 3CU3A 4BTYA 1AR0A 1JKGB 1QAKA 2K0MA 1Q7Y4 5EVHA 1JKGA 5AI1A 4KFDA 3JUNA 3F14A 3MPHA 1HKXA 5AIIA 2L4VA 1LNHA 5KP3A 1JJ22 4WWUC 3LT8A 3HIGA 3VF1A 4MMZB 2GEYA 4BTXA 2Y74A 3Q90A 5AYRB 3HI7A 4EV5A 3WMDA 5AIGA 4JRFA 4RBNA 3CXC2 1C7HA 1YHQ3 4TX4A 1NB5I 2SBLA 1OF5B 3T8NA 3X41A 1NU3A 3LT9A 1STDA 1M1K4 2W9PA 1GY6A 4O02B 1N9JA 2CW9A 3CME3 5AEUB 4GL6A 3CMA3 3QRDA 1FGTA 4JF8A 5IEOA 3F8XA 3KKGA 1VQ53 1O7PB 1DVDA 3V92A 2XRXB 4FMDA 1TP6A 4EV2A 5IG0A 5AEWB 3N54B 3LTDA 3RGAA 1W7CA 5G2GA 4KZ1A 2IUKA 5I97A 1YI23 1RN7A 5CLKA 4MEIA 5IEPA 6STDA 1FA3A 3NQZA 3X42A 3HIIA 3LOYA 4HM3B 5BVBA 3DY5A 4NREA 1O7GB 4FR9A 3EN8A 3OWSA 2W56B 3WA3A 3GZXB 3F7SA 4N6NB 1W6YA 3OV4A 3CCU3 2O3OA 3CCL3 3VGNA 4WFOA 3PYJA 3V99A 3OX9A 2CK3H 4O8SA 2BT3A 3CCE3 2HMOB 4K1VA 4STDA 3CCV3 5JBSA 3KE7A 1UUWB 3GAXA 3EJVA 3FG4A 4KFEA 4FMBA 2INXA 2FGTA 1AVKA 4AKZA 3FKAA 1GY7A 3UB1A 3CD63 3AMOB 3X40A 4HM8B 2RSXA 1R4CA 4HBRA 7STDA 1W5ZA 2B24B 1WMNA 3SX1A 2CWTA 3SOYA 1Z1SA 3S28A 3PGBA 2YFLB 1YIJ3 3PS8A 2PNCA 1W2ZA 3WOEB 3D9RA 3LXUX 3WODG 3V98A 2Z7AA 1IT8A 3FG3A 3LYGA 1JNQA 3BNDA 3DGLA 4HYZA 3KZTA 4WYKB 1EA2A 1F8NA 2GU1A 2WOFA 3KSPA 4WYKA 4XB5A 1L5GB 1GY5A 3U1WA 1IQXA 2KRTA 3B4OA 1Q864 2M7OA 1OHOA 4X2HA 1T5YA 3EN1B 3BLZA 4OVMA 5D81A 3B4PA 3X3YA 3JUOA 4L8OA 1OH0A 1N8R4 1GD4A 1IT7A 1O7MB 1VQN3 2Z77A 1GYBA 3NUVA 1OCVA 2QEX3 1VQO3 4HM1B 4K90B 3RDEA 1ASKA 3G6E3 3CCR3 2XR8B 5EQLA 2B1XB 5EEOA 1NO3A 1FGRA 1IVUA 1Q824 3MG3A 3LZAA 1Y4KA 4HM6B 4O2HA 3NBJA 1VQP3 3O8YA 1SQWA 3J7Yd 5STDA 1E3RA 4OK0A 3MKIA 1N8QA 1OHSA 3OWUA 3EBTA 4IIAA 1VQ43 1D6YA 3K0ZA 5KP4A 5DREA 3HK4A 3JUMA 1O7HB 1JB2A 4EC6A 2CIUA 2CFDA 2CFLA 3KFQC 3JUPA 1N5HA 3NM7A 1Q40A 3FGYA 3LTBA 3BNCA 4XM4A 2OQEC 1VQ93 2Z76A 2PZVA 2W0QA 2W04A 4PEJA 4XBXA 1LOXA 1FGQA 3PXMA 5CK6A 2IMJA 1IV9A 3B8LA 2CC3A 1EKMA 1STFI 2XEPA 4LGQA 1BUQA 2QA43 4HM4B 2BMQB 3I0YA 5ELJA 2RCDA 2XGLA 3CPOA 2I9WA 1IU7A 1U5OA 2FNQA 3ROBA 1E97A 1RJOA 3PCSA 1QVG2 3LMLA 2GU3A 3CC43 1D6ZA 1UUVB 4N6MA 3X3XA 1EG9B 4EYCA 2OTJ3 1K734 2MF7A 3NBRA 2WGOA 2XFSA 3OWYA 3FH1A 1ZX2A 3GWRA 4FCZA 3WOFB 2QIYA 1KWIA 5TGNA 3CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRD A;  2F98 A;  3FLJ A;  1W02 A;  2F99 A;  2BMO B;  3NV0 B;  1JB4 A;  4HZ9 B;  3NV0 A;  1S5A A;  1W01 A;  4KVH A;  3EHC A;  3GZB A;  3GZR A;  4HM2 B;  3HZP A;  1JN5 B;  5IG5 A;  1O7W B;  4HZB B;  5CF2 A;  1JN5 A;  3NXJ A;  2GEX A;  2UX0 A;  3ECF A;  4L7K A;  3G16 A;  2A15 A;  1VZZ A;  3RGR A;  3NM2 A;  2GXF A;  4RZM A;  1OGZ A;  1DMQ A;  3F9S A;  5KP1 A;  4L8P A;  4N3V A;  4XBT A;  3SOA A;  2BMR B;  1OUN A;  1OGX A;  2STD A;  1ULI B;  3EQQ B;  4HM5 B;  3OXA A;  4LMI A;  2BNG A;  1O7N B;  3A76 A;  3MYT A;  1JB5 A;  2F86 B;  3G0K A;  2K54 A;  4XBY A;  5JPU A;  2GBW B;  2HMN B;  1K41 A;  3VSY A;  4HJL B;  3E99 A;  3M8C A;  1CQS A;  3DXO A;  3EBY A;  1Q40 B;  2RFR A;  3DUK A;  3HX8 A;  3H51 A;  2XSH B;  1ZO2 A;  4XDV A;  3IPT A;  2YFI B;  1A2K A;  4J9A A;  3GZY B;  3JUQ A;  5CF1 A;  3F7X A;  5BXQ A;  2GBX B;  4HKV B;  1W00 A;  5IG4 A;  3MHE A;  3STD A;  5JPP A;  3UJM A;  1OF5 A;  3UNL A;  1QMA A;  3BB9 A;  3FF2 A;  4R9K A;  3F8H A;  2JQ5 A;  2YFJ B;  4OUQ A;  3SED A;  3DMC A;  4MJD A;  2RGQ A;  3K7C A;  1WQL B;  5AIF A;  4FCJ A;  2R4I A;  5DRV A;  8CHO A;  5FW5 A;  1IDP A;  3B7C A;  4ORL A;  3EC9 A;  1NDO B;  3CNM A;  1GS3 A;  3G8Z A;  1DMM A;  5HGR A;  4HM0 B;  4FCM A;  4GB5 A;  5AIH A;  5D82 A;  3DZL A;  2QGU A;  4LEH A;  3FF0 A;  3ER7 A;  1ULJ B;  1TUH A;  4R1K A;  5D83 A;  4K1U A;  2HML B;  3NHX A;  5CXO A;  4R9L A;  4U13 A;  1QJG A;  1ISK A;  4X2O A;  5IER A;  4WP5 A;  2W2C A;  2CKF B;  1SJW A;  5IEN A;  4HM7 B;  1E3V A;  4HVN A;  3MSO A;  3EX9 A;  1NWW A;  3S5C A;  2XSO B;  4XDW A;  1DMN A;  1OPY A;  5IF6 A;  3H3H A;  3EF8 A;  2OWP A;  4J8T A;  4Q53 A;  2HMM B;  3DM8 A;  3FSD A;  3T8U A;  5IG3 A;  3FZW A;  4I4K A;  3F40 A;  3MG1 A;  4CDL A;  3MG2 A;  2CHC A;  2HMK B;  2HMJ B;  4H3U A;  1OHP A;  1Q42 A;  3CU3 A;  1AR0 A;  1JKG B;  5EVH A;  1JKG A;  5AI1 A;  3JUN A;  3F14 A;  1HKX A;  5AII A;  5KP3 A;  4WWU C;  2GEY A;  3Q90 A;  3WMD A;  5AIG A;  1C7H A;  1OF5 B;  3T8N A;  1NU3 A;  1STD A;  1GY6 A;  5AEU B;  5IEO A;  3F8X A;  3KKG A;  1O7P B;  2XRX B;  1TP6 A;  5IG0 A;  5AEW B;  3RGA A;  5G2G A;  5CLK A;  5IEP A;  6STD A;  4HM3 B;  5BVB A;  1O7G B;  3EN8 A;  3OWS A;  3GZX B;  3F7S A;  1W6Y A;  3OV4 A;  3VGN A;  3OX9 A;  2HMO B;  4K1V A;  4STD A;  3KE7 A;  1UUW B;  3EJV A;  2INX A;  3FKA A;  1GY7 A;  4HM8 B;  7STD A;  2B24 B;  3SOY A;  1Z1S A;  2YFL B;  3D9R A;  2Z7A A;  3LYG A;  3KZT A;  4WYK B;  1EA2 A;  3KSP A;  4WYK A;  4XB5 A;  1GY5 A;  3B4O A;  1OHO A;  4X2H A;  3EN1 B;  3BLZ A;  4OVM A;  5D81 A;  3B4P A;  3JUO A;  4L8O A;  1OH0 A;  1O7M B;  2Z77 A;  1GYB A;  3NUV A;  1OCV A;  4HM1 B;  1ASK A;  2XR8 B;  2B1X B;  3MG3 A;  3LZA A;  4HM6 B;  5STD A;  1E3R A;  3MKI A;  1OHS A;  3OWU A;  3EBT A;  4IIA A;  3K0Z A;  5KP4 A;  5DRE A;  3HK4 A;  3JUM A;  1O7H B;  1JB2 A;  3JUP A;  1Q40 A;  3FGY A;  4XM4 A;  2Z76 A;  2PZV A;  4PEJ A;  4XBX A;  5CK6 A;  2IMJ A;  3B8L A;  1BUQ A;  4LGQ A;  4HM4 B;  2BMQ B;  3I0Y A;  2RCD A;  3CPO A;  2I9W A;  3ROB A;  1U5O A;  1E97 A;  1UUV B;  1EG9 B;  3NBR A;  3OWY A;  3FH1 A;  1ZX2 A;  3GWR A;  2QIY A;  5TGN A;  3CNX A; 
#chains in the Genus database with same CATH topology
 1KSI A;  2C10 A;  2ZL8 A;  3GRD A;  2F98 A;  3FLJ A;  1W02 A;  1BNR A;  2F99 A;  2CH9 A;  1J2B A;  2BMO B;  3NV0 B;  1JB4 A;  3DGM A;  1GSP A;  9RNT A;  4HZ9 B;  3TDG A;  1FUS A;  3NV0 A;  1S5A A;  4EBG A;  1W01 A;  1W2B 2;  3MWZ A;  3EHC A;  4KVH A;  1WMO A;  3GZB A;  3WDG B;  3GZR A;  1VQM 3;  2CFG A;  4HM2 B;  5AYS C;  1LXE A;  1ZGX A;  1TIJ A;  1UW1 A;  4J5G A;  2C4B A;  3HZP A;  1JN5 B;  1QAF A;  1D6U A;  2CFW A;  2WOH A;  1C54 A;  1RN1 A;  5IG5 A;  1BNE A;  1O7W B;  4HZB B;  5CF2 A;  1JN5 A;  3NXJ A;  2GEX A;  2UX0 A;  3T0U A;  3N9H A;  2Z6B A;  1I2E A;  3ECF A;  2F56 A;  4L7K A;  3G16 A;  2A15 A;  2P05 A;  1KC8 4;  1VQ8 3;  1VZZ A;  4CCV A;  2CG1 A;  1A2V A;  3RGR A;  1SIH A;  2BO9 B;  3NM2 A;  3LH4 A;  4KFF A;  1B21 A;  3WA2 X;  2GXF A;  3ALA A;  4N6O B;  2KCD A;  1OAC A;  4RZM A;  1CH0 A;  2LQV A;  1OGZ A;  1ROV A;  1DMQ A;  3IMA B;  2ML6 A;  3AGN A;  3F9S A;  1IQY A;  5KP1 A;  4L8P A;  3JVC A;  4N3V A;  4XBT A;  1LVN A;  2H0H A;  3SOA A;  3WHO A;  1MOL A;  2F5M A;  3UL6 A;  1BSE A;  1GMQ A;  1QAL A;  1S72 3;  5M19 A;  4G1M B;  2BMR B;  1OUN A;  1OGX A;  2STD A;  1ULI B;  2WGQ A;  4LZI A;  1RHL A;  3EQQ B;  4HM5 B;  2ZDJ A;  5BU4 A;  1JZD A;  2CWV A;  3OXA A;  4J5K A;  3DH2 A;  1BAO A;  4LMI A;  2BNG A;  1MWS A;  1K28 A;  1O7N B;  2ZA4 A;  3A76 A;  1M1X B;  3MYT A;  1YVB I;  1BRN L;  1JB5 A;  2CFK A;  1TRP A;  4N6U A;  1TFO A;  2F86 B;  2OQE A;  3G0K A;  1BSA A;  4AEQ A;  2K54 A;  4XBY A;  1DYU A;  1UUG B;  1X1U A;  4QWT A;  5JPU A;  1Q81 4;  2IA7 A;  1FUT A;  5ELU A;  1I2F A;  1BOX A;  1VQQ A;  2GBW B;  1TRQ A;  2HMN B;  4R80 A;  4HOH A;  2P09 A;  2WO0 A;  1RCL A;  1K41 A;  1RRH A;  2H0G A;  3LTA A;  3X3Z A;  3S29 A;  3BNE A;  1CYV A;  5LC7 A;  5LC6 A;  3VSY A;  4BTW A;  1MWR A;  1BVI A;  2L1S A;  3GSP A;  4HJL B;  1A67 A;  4HAA A;  1JV2 B;  5A0O B;  3NX0 A;  3E99 A;  2P38 A;  3A5E A;  1NNV A;  3SVA A;  1YJW 3;  5G1K A;  3IJE B;  2OTL 3;  3M8C A;  1CQS A;  1WNH A;  1LOW A;  4LSO A;  2KF3 A;  1BAN A;  3DXO A;  3EBY A;  2ML5 A;  1PFP A;  4EXR A;  4ZM8 A;  1HYF A;  3D3L A;  1SII A;  2W9Q A;  1VQ6 3;  3K5T A;  1Q40 B;  2RFR A;  3DUK A;  3BNB A;  3HX8 A;  1TFK A;  1NJI 4;  3H51 A;  4IPB A;  1UI7 A;  2XSH B;  1ZO2 A;  1EEJ A;  4XDV A;  2KXG A;  3IPT A;  2YFI B;  2E2U A;  4H61 A;  1BNF A;  1RGC A;  4ILF A;  1A2K A;  4RNT A;  4KT3 B;  4J9A A;  3CCS 3;  3GZY B;  2OOV C;  3JUQ A;  5FGO A;  1VQ7 3;  3KII A;  1RGA A;  5CF1 A;  3F7X A;  3SLU A;  5BXQ A;  2GBX B;  4HKV B;  1N5P A;  1GOV A;  1W00 A;  4NPB A;  5IG4 A;  3MHE A;  3STD A;  5JPP A;  1YGE A;  4MMY B;  1UCI A;  3D5I A;  3UJM A;  3Q3F A;  1EQK A;  1U8C B;  1M9G A;  1OF5 A;  3UNL A;  1QMA A;  1DE3 A;  3BB9 A;  1FW7 A;  3FF2 A;  3NBB A;  4R9K A;  2P0M A;  5IW9 A;  3F8H A;  2XH9 A;  3I55 3;  1B3S A;  2JQ5 A;  1IVX A;  2YFJ B;  3LTC A;  1CEW I;  4OUQ A;  3SED A;  3SXX A;  1AQZ A;  3DMC A;  4NHF A;  4MJD A;  1K8A 4;  3Q1C A;  3I56 3;  3BU4 A;  1ROA A;  1YIT 3;  2RGQ A;  3D5G A;  3K7C A;  2RBI A;  3RNT A;  1WQL B;  5AIF A;  4GSP A;  1VQK 3;  1B2S A;  2R4I A;  4FCJ A;  1B2U A;  4FMC A;  1RSN A;  5DRV A;  4N6L A;  1MNL A;  4N6T A;  1A2P A;  8CHO A;  1VQL 3;  2O9U X;  4IT7 A;  5FW5 A;  2KF5 A;  1RNT A;  1IDP A;  4AKY A;  1RTU A;  3N8B A;  2LYX A;  4RNY A;  4K61 A;  2C11 A;  3B7C A;  3CPW 2;  1BNS A;  4ORL A;  2H0I A;  3EC9 A;  1NDO B;  3CNM A;  1I0X A;  3KN4 A;  1GS3 A;  2Y73 A;  3G8Z A;  1N9E A;  3EE1 A;  1DMM A;  4O3V A;  5HGR A;  1FUW A;  2W56 A;  4MMX B;  2BU4 A;  2D42 A;  3G71 3;  4HM0 B;  4FCM A;  2J8X B;  3PCR A;  1DVC A;  1RKY A;  3Q2P A;  1UI8 A;  4WHA A;  2CX0 A;  4GB5 A;  5AIH A;  5D82 A;  2V1L A;  2XFT A;  3DZL A;  1KD1 4;  2QGU A;  3DGO A;  4LEH A;  1IVW A;  1LQG C;  3ER7 A;  3FF0 A;  4R4K A;  3OW2 2;  3U97 A;  1AV4 A;  1GOY A;  1MGW A;  1ULJ B;  3FCS B;  1TUH A;  3UL5 A;  1WMP A;  3CCM 3;  4R1K A;  2W03 A;  5D83 A;  1US1 A;  1W4N A;  4K1U A;  1YJ9 3;  2HML B;  3NHX A;  5CXO A;  3ZG0 A;  1A90 A;  1M90 4;  1FGO A;  1T2I A;  4R9L A;  1YVS A;  2YX9 A;  2Q07 A;  3AMO A;  4U13 A;  2KF6 A;  2UGI A;  1QJG A;  1YJN 3;  2W6J H;  1PU4 A;  4I5Q A;  1ISK A;  3EB8 A;  3K9M C;  3WR2 A;  4X2O A;  2XF3 A;  4CJN A;  1RGK A;  5IER A;  4WP5 A;  5RNT A;  7GSP A;  3CCJ 3;  2W2C A;  1QVF 2;  2CKF B;  1SJW A;  4FMA A;  1JRQ A;  3QK9 A;  5IEN A;  1TU5 A;  4HM7 B;  1E3V A;  2CG0 A;  2IUJ A;  1CYU A;  4HVN A;  1SPU A;  2OCT A;  2P0X A;  3MSO A;  4CPK A;  1TTO A;  3EX9 A;  1NWW A;  1B20 A;  1MWU A;  2E2T A;  1BRG A;  1BSB A;  1IVV A;  1FGM A;  2XSO B;  1PYL A;  2F5W A;  4XDW A;  1IK3 A;  1KQS 2;  1DMN A;  1SAR A;  1OPY A;  6GSP A;  2FXT A;  3DGN A;  5IF6 A;  1G96 A;  3H3H A;  2MC8 A;  4RNZ A;  1IQ8 A;  3CCQ 3;  3S27 A;  3EF8 A;  3S67 A;  2OOV A;  5BIR A;  2OWP A;  4J8T A;  4N6V 0;  4Q53 A;  1IYY A;  2HMM B;  1BSC A;  3KSE D;  4BIR A;  3G4S 3;  3K63 A;  3DM8 A;  2JDI H;  3FSD A;  1K9M 4;  1RRL A;  1HU9 A;  3T8U A;  5IG3 A;  2XGN A;  3FZW A;  1NB3 I;  2E2V A;  1W6C A;  4I4K A;  1AVL A;  3F40 A;  3MG1 A;  4CDL A;  2BHM A;  1W6G A;  3FG1 A;  3MG2 A;  3PZW A;  1GD3 A;  2CHC A;  1IV7 A;  2HMJ B;  2HMK B;  3L0R A;  2R41 A;  4H3U A;  1V74 A;  3CC2 3;  2D1W A;  1WTH A;  1OHP A;  1Q42 A;  2CWU A;  2CX1 A;  3CC7 3;  3NQY A;  3CU3 A;  1MGR A;  1YGW A;  1AR0 A;  1JKG B;  1QAK A;  4BL2 A;  4BTY A;  1T3B A;  2K0M A;  1Q7Y 4;  5EVH A;  1G02 A;  1JKG A;  5AI1 A;  4KFD A;  3JUN A;  3F14 A;  1RLS A;  3MPH A;  1HKX A;  5AII A;  1V57 A;  2L4V A;  1JBR A;  1LNH A;  5KP3 A;  1JJ2 2;  4WWU C;  3LT8 A;  3HIG A;  1T2H A;  4MMZ B;  1BRH A;  2GEY A;  3VF1 A;  4BTX A;  1JBT A;  1BRK A;  2Y74 A;  3Q90 A;  5AYR B;  3HI7 A;  4EV5 A;  3DGY A;  3WMD A;  5AIG A;  4JRF A;  1HZ1 A;  4RBN A;  3CXC 2;  1C7H A;  1YHQ 3;  3AGO A;  4TX4 A;  1NB5 I;  2SBL A;  1PY3 A;  1OF5 B;  3T8N A;  1G0T A;  3X41 A;  4GHO A;  1NU3 A;  2IYJ A;  3LT9 A;  1STD A;  1I70 A;  1BNJ A;  1M1K 4;  2W9P A;  1GY6 A;  4BL3 A;  4O02 B;  1N9J A;  1RGL A;  2CW9 A;  3CME 3;  5AEU B;  4GL6 A;  3CMA 3;  3QRD A;  3ZG5 A;  1AY7 A;  1FGT A;  4JF8 A;  5IEO A;  3F8X A;  1BGS A;  3KKG A;  1VQ5 3;  1O7P B;  1DVD A;  3V92 A;  2XRX B;  4FMD A;  1TP6 A;  4EV2 A;  5IG0 A;  5AEW B;  3N54 B;  3LTD A;  3RGA A;  1W7C A;  5G2G A;  4KZ1 A;  1RGF A;  1RMS A;  2IUK A;  5I97 A;  1YI2 3;  1RN7 A;  5CLK A;  4MEI A;  3KCH A;  5IEP A;  6STD A;  1FA3 A;  3NQZ A;  3X42 A;  3HII A;  3LOY A;  4HM3 B;  5BVB A;  3DY5 A;  4NRE A;  1O7G B;  1RNB A;  1RGG A;  4FR9 A;  3S5C A;  3EN8 A;  3OWS A;  4LYL B;  1Q9E A;  2W56 B;  3WA3 A;  3GZX B;  3F7S A;  4N6N B;  1W6Y A;  3BIR A;  3OV4 A;  3CCU 3;  2O3O A;  1BSD A;  4DKI A;  3CCL 3;  3VGN A;  5M18 A;  1B2M A;  4WFO A;  3PYJ A;  3URP A;  3V99 A;  3OX9 A;  1LRA A;  1X1Y A;  4BU4 A;  2CK3 H;  4O8S A;  2BT3 A;  1R4Y A;  3CCE 3;  1UGI A;  2HMO B;  5HOH A;  4K1V A;  4STD A;  3CCV 3;  3AHS A;  5JBS A;  1GMR A;  1BU4 A;  3KE7 A;  1UUW B;  3GAX A;  1I3I A;  3EJV A;  7RNT A;  3FG4 A;  4KFE A;  4FMB A;  2INX A;  2FGT A;  1AVK A;  4AKZ A;  3FKA A;  1GY7 A;  3UB1 A;  3CD6 3;  3AMO B;  8RNT A;  3X40 A;  4HM8 B;  2RSX A;  1R4C A;  4HBR A;  7STD A;  1W5Z A;  2B24 B;  1WMN A;  1X1X A;  3SX1 A;  2CWT A;  3SOY A;  1Z1S A;  3S28 A;  3PGB A;  2YFL B;  1X1W A;  1YIJ 3;  3PS8 A;  1TJD A;  1W2Z A;  2PNC A;  3WOE B;  3D4A A;  1Q7H A;  3D9R A;  3LXU X;  3WOD G;  3V98 A;  2Z7A A;  1IT8 A;  1I3F A;  3FG3 A;  1JBS A;  3LYG A;  1JNQ A;  3BND A;  3DGL A;  4HYZ A;  2AAE A;  3KZT A;  4WYK B;  1EA2 A;  1F8N A;  2SAR A;  2GU1 A;  2F4Y A;  2WOF A;  1UDI I;  3KSP A;  4WYK A;  4XB5 A;  1BRI A;  1L5G B;  1GY5 A;  1RGH A;  1IQX A;  2KRT A;  3B4O A;  3U1W A;  2M7O A;  1OHO A;  4X2H A;  1Q86 4;  1T5Y A;  3EN1 B;  3BLZ A;  4OVM A;  5D81 A;  1LOY A;  3B4P A;  3X3Y A;  3JUO A;  4L8O A;  1I0V A;  1OH0 A;  1N8R 4;  1GD4 A;  1DET A;  2GSP A;  1RGE A;  1IT7 A;  1O7M B;  1VQN 3;  1BNG A;  1B2X A;  2Z77 A;  1GYB A;  3NUV A;  1OCV A;  2QEX 3;  1VQO 3;  2ZHX B;  1V58 A;  2HOH A;  4HM1 B;  4K90 B;  3RDE A;  1ASK A;  1BRS A;  3G6E 3;  2XR8 B;  3CCR 3;  5EQL A;  2B1X B;  5EEO A;  1NO3 A;  2IY2 A;  1FGR A;  1IVU A;  1Q82 4;  3MG3 A;  3LZA A;  1Y4K A;  3D79 A;  4HM6 B;  4O2H A;  3NBJ A;  1VQP 3;  1I2G A;  3O8Y A;  1SQW A;  3ZFZ A;  4EW5 A;  5STD A;  1E3R A;  3J7Y d;  1GMP A;  4OK0 A;  3HOH A;  3MKI A;  1B2Z A;  1N8Q A;  1OHS A;  1GOU A;  3OWU A;  3EBT A;  1BRJ A;  4IIA A;  1VQ4 3;  1D6Y A;  3K0Z A;  5KP4 A;  2KF4 A;  1BNI A;  3HK4 A;  5DRE A;  3JUM A;  1O7H B;  1JB2 A;  4EC6 A;  2CIU A;  2CFD A;  2CFL A;  3KFQ C;  3JUP A;  1N5H A;  3NM7 A;  1JZO A;  1Q40 A;  3FGY A;  3LTB A;  3AHW A;  3BNC A;  4XM4 A;  2OQE C;  2KAA A;  1VQ9 3;  2Z76 A;  2PZV A;  2W0Q A;  2W04 A;  4PEJ A;  4XBX A;  5GSP A;  1LOX A;  2BIR A;  1FGQ A;  1B27 A;  2RNT A;  3PXM A;  2AAD A;  2IMJ A;  5CK6 A;  1IV9 A;  1ZS7 A;  3B8L A;  2CC3 A;  1EKM A;  1BIR A;  1STF I;  2XEP A;  4LGQ A;  1BUQ A;  2QA4 3;  4HM4 B;  1I8V A;  2BMQ B;  1FYS A;  3I0Y A;  1LOV A;  5ELJ A;  2RCD A;  5M1A A;  2XGL A;  3CPO A;  2I9W A;  1IU7 A;  1U5O A;  2FNQ A;  3ROB A;  1E97 A;  1EUI C;  1RJO A;  3PCS A;  1LQM B;  1QVG 2;  5G1L A;  3LML A;  2GU3 A;  3CC4 3;  1D6Z A;  1LNI A;  1UUV B;  1RN4 A;  4N6M A;  1EG9 B;  3X3X A;  4EYC A;  2OTJ 3;  1K73 4;  3SYU A;  2MF7 A;  1UCJ A;  1UCL A;  1RCK A;  1UGH I;  6RNT A;  1RDS A;  1UCK A;  3NBR A;  2WGO A;  2XFS A;  1FZU A;  1BUJ A;  1YNV X;  2K3D A;  2UUG C;  3OWY A;  3FH1 A;  1ZX2 A;  3GWR A;  4FCZ A;  3WOF B;  2QIY A;  1KWI A;  1MWT A;  5TGN A;  3CNX A; 
#chains in the Genus database with same CATH homology
 1KSI A;  2C10 A;  2ZL8 A;  3GRD A;  2F98 A;  3FLJ A;  1W02 A;  2F99 A;  2CH9 A;  1J2B A;  2BMO B;  3NV0 B;  1JB4 A;  3DGM A;  4HZ9 B;  3TDG A;  3NV0 A;  4EBG A;  1S5A A;  1W01 A;  1W2B 2;  3MWZ A;  3EHC A;  4KVH A;  1WMO A;  3GZB A;  3WDG B;  3GZR A;  1VQM 3;  2CFG A;  4HM2 B;  5AYS C;  1LXE A;  1TIJ A;  1UW1 A;  3HZP A;  1JN5 B;  1QAF A;  1D6U A;  2CFW A;  2WOH A;  5IG5 A;  1O7W B;  4HZB B;  5CF2 A;  1JN5 A;  3NXJ A;  2GEX A;  2UX0 A;  3T0U A;  3N9H A;  2Z6B A;  3ECF A;  4L7K A;  1KC8 4;  3G16 A;  2A15 A;  2P05 A;  1VQ8 3;  1VZZ A;  4CCV A;  2CG1 A;  1A2V A;  3RGR A;  1SIH A;  2BO9 B;  3NM2 A;  3LH4 A;  4KFF A;  3WA2 X;  2GXF A;  3ALA A;  4N6O B;  2KCD A;  1OAC A;  4RZM A;  2LQV A;  1OGZ A;  1ROV A;  1DMQ A;  3IMA B;  2ML6 A;  3F9S A;  1IQY A;  5KP1 A;  4L8P A;  3JVC A;  4N3V A;  4XBT A;  1LVN A;  3SOA A;  1MOL A;  3UL6 A;  1QAL A;  1S72 3;  4G1M B;  2BMR B;  1OUN A;  1OGX A;  2STD A;  1ULI B;  2WGQ A;  4LZI A;  3EQQ B;  4HM5 B;  2ZDJ A;  2CWV A;  3OXA A;  4LMI A;  2BNG A;  1O7N B;  1K28 A;  3A76 A;  3MYT A;  1M1X B;  1YVB I;  1JB5 A;  2CFK A;  4N6U A;  1TFO A;  2F86 B;  2OQE A;  3G0K A;  4AEQ A;  2K54 A;  4XBY A;  1DYU A;  4QWT A;  5JPU A;  1Q81 4;  2IA7 A;  5ELU A;  2GBW B;  2HMN B;  4R80 A;  2P09 A;  2WO0 A;  1K41 A;  1RRH A;  3LTA A;  3X3Z A;  3S29 A;  3BNE A;  1CYV A;  5LC7 A;  5LC6 A;  3VSY A;  4BTW A;  4HJL B;  1A67 A;  1JV2 B;  5A0O B;  3NX0 A;  3E99 A;  2P38 A;  3SVA A;  1YJW 3;  3IJE B;  2OTL 3;  3M8C A;  1CQS A;  1WNH A;  4LSO A;  3DXO A;  3EBY A;  2ML5 A;  1PFP A;  4EXR A;  4ZM8 A;  3D3L A;  1SII A;  2W9Q A;  1VQ6 3;  3K5T A;  1Q40 B;  2RFR A;  3DUK A;  3BNB A;  3HX8 A;  1TFK A;  1NJI 4;  3H51 A;  4IPB A;  1UI7 A;  2XSH B;  1ZO2 A;  4XDV A;  2KXG A;  3IPT A;  2YFI B;  2E2U A;  4H61 A;  1A2K A;  4J9A A;  3CCS 3;  3GZY B;  2OOV C;  3JUQ A;  5FGO A;  1VQ7 3;  3KII A;  5CF1 A;  3F7X A;  3SLU A;  5BXQ A;  2GBX B;  4HKV B;  1N5P A;  1W00 A;  5IG4 A;  3MHE A;  3STD A;  5JPP A;  1YGE A;  4MMY B;  3UJM A;  1EQK A;  1U8C B;  1M9G A;  1OF5 A;  3UNL A;  1QMA A;  3BB9 A;  3FF2 A;  3NBB A;  4R9K A;  2P0M A;  5IW9 A;  3F8H A;  2XH9 A;  3I55 3;  2JQ5 A;  1IVX A;  2YFJ B;  3LTC A;  1CEW I;  4OUQ A;  3SED A;  3SXX A;  3DMC A;  4NHF A;  4MJD A;  1K8A 4;  3Q1C A;  3I56 3;  1ROA A;  1YIT 3;  2RGQ A;  3K7C A;  1WQL B;  5AIF A;  1VQK 3;  4FCJ A;  2R4I A;  4FMC A;  5DRV A;  4N6L A;  1MNL A;  4N6T A;  8CHO A;  1VQL 3;  2O9U X;  4IT7 A;  5FW5 A;  4AKY A;  1IDP A;  3N8B A;  2LYX A;  4RNY A;  4K61 A;  2C11 A;  3B7C A;  3CPW 2;  4ORL A;  3EC9 A;  1NDO B;  3CNM A;  3KN4 A;  1GS3 A;  2Y73 A;  3G8Z A;  1N9E A;  3EE1 A;  1DMM A;  4O3V A;  5HGR A;  1FUW A;  2W56 A;  4MMX B;  2D42 A;  3G71 3;  4HM0 B;  4FCM A;  3PCR A;  1DVC A;  1RKY A;  3Q2P A;  1UI8 A;  4WHA A;  4GB5 A;  5AIH A;  5D82 A;  2V1L A;  2XFT A;  3DZL A;  1KD1 4;  2QGU A;  3DGO A;  4LEH A;  1IVW A;  3FF0 A;  3ER7 A;  4R4K A;  3OW2 2;  3U97 A;  1AV4 A;  1ULJ B;  3FCS B;  1TUH A;  3UL5 A;  1WMP A;  3CCM 3;  4R1K A;  2W03 A;  5D83 A;  1US1 A;  1W4N A;  4K1U A;  1YJ9 3;  2HML B;  3NHX A;  5CXO A;  1A90 A;  1M90 4;  1FGO A;  4R9L A;  4U13 A;  2YX9 A;  2Q07 A;  3AMO A;  1QJG A;  1YJN 3;  2W6J H;  1PU4 A;  1ISK A;  3EB8 A;  3K9M C;  4X2O A;  2XF3 A;  5IER A;  4WP5 A;  3CCJ 3;  2W2C A;  1QVF 2;  2CKF B;  1SJW A;  4FMA A;  1JRQ A;  3QK9 A;  5IEN A;  1TU5 A;  4HM7 B;  1E3V A;  2CG0 A;  2IUJ A;  1CYU A;  4HVN A;  1SPU A;  2OCT A;  2P0X A;  3MSO A;  3EX9 A;  1NWW A;  3S5C A;  2E2T A;  2XSO B;  1IK3 A;  1IVV A;  1FGM A;  4XDW A;  1KQS 2;  1DMN A;  1OPY A;  2FXT A;  3DGN A;  5IF6 A;  1G96 A;  3H3H A;  2MC8 A;  4RNZ A;  1IQ8 A;  3CCQ 3;  3S27 A;  3EF8 A;  3S67 A;  2OOV A;  2OWP A;  4J8T A;  4N6V 0;  4Q53 A;  2HMM B;  3KSE D;  3G4S 3;  3K63 A;  3DM8 A;  2JDI H;  3FSD A;  1K9M 4;  1RRL A;  1HU9 A;  3T8U A;  5IG3 A;  2XGN A;  3FZW A;  1NB3 I;  2E2V A;  1W6C A;  4I4K A;  1AVL A;  3F40 A;  3MG1 A;  4CDL A;  2BHM A;  1W6G A;  3FG1 A;  3MG2 A;  3PZW A;  1GD3 A;  2CHC A;  1IV7 A;  2HMJ B;  2HMK B;  3L0R A;  4H3U A;  1V74 A;  3CC2 3;  2D1W A;  1WTH A;  1OHP A;  1Q42 A;  2CWU A;  3CC7 3;  3NQY A;  3CU3 A;  4BTY A;  1AR0 A;  1JKG B;  1QAK A;  2K0M A;  1Q7Y 4;  5EVH A;  1JKG A;  5AI1 A;  4KFD A;  3JUN A;  3F14 A;  3MPH A;  1HKX A;  5AII A;  2L4V A;  1LNH A;  5KP3 A;  1JJ2 2;  4WWU C;  3LT8 A;  3HIG A;  3VF1 A;  4MMZ B;  2GEY A;  4BTX A;  2Y74 A;  3Q90 A;  5AYR B;  3HI7 A;  4EV5 A;  3WMD A;  5AIG A;  4JRF A;  4RBN A;  3CXC 2;  1C7H A;  1YHQ 3;  4TX4 A;  1NB5 I;  2SBL A;  1OF5 B;  3T8N A;  3X41 A;  1NU3 A;  3LT9 A;  1STD A;  1M1K 4;  2W9P A;  1GY6 A;  4O02 B;  1N9J A;  2CW9 A;  3CME 3;  5AEU B;  4GL6 A;  3CMA 3;  3QRD A;  1FGT A;  4JF8 A;  5IEO A;  3F8X A;  3KKG A;  1VQ5 3;  1O7P B;  1DVD A;  3V92 A;  2XRX B;  4FMD A;  1TP6 A;  4EV2 A;  5IG0 A;  5AEW B;  3N54 B;  3LTD A;  3RGA A;  1W7C A;  5G2G A;  4KZ1 A;  2IUK A;  5I97 A;  1YI2 3;  1RN7 A;  5CLK A;  4MEI A;  5IEP A;  6STD A;  1FA3 A;  3NQZ A;  3X42 A;  3HII A;  3LOY A;  4HM3 B;  5BVB A;  3DY5 A;  4NRE A;  1O7G B;  4FR9 A;  3EN8 A;  3OWS A;  2W56 B;  3WA3 A;  3GZX B;  3F7S A;  4N6N B;  1W6Y A;  3OV4 A;  3CCU 3;  2O3O A;  3CCL 3;  3VGN A;  4WFO A;  3PYJ A;  3V99 A;  3OX9 A;  2CK3 H;  4O8S A;  2BT3 A;  3CCE 3;  2HMO B;  4K1V A;  4STD A;  3CCV 3;  5JBS A;  3KE7 A;  1UUW B;  3GAX A;  3EJV A;  3FG4 A;  4KFE A;  4FMB A;  2INX A;  2FGT A;  1AVK A;  4AKZ A;  3FKA A;  1GY7 A;  3UB1 A;  3CD6 3;  3AMO B;  3X40 A;  4HM8 B;  2RSX A;  1R4C A;  4HBR A;  7STD A;  1W5Z A;  2B24 B;  1WMN A;  3SX1 A;  2CWT A;  3SOY A;  1Z1S A;  3S28 A;  3PGB A;  2YFL B;  1YIJ 3;  3PS8 A;  2PNC A;  1W2Z A;  3WOE B;  3D9R A;  3LXU X;  3WOD G;  3V98 A;  2Z7A A;  1IT8 A;  3FG3 A;  3LYG A;  1JNQ A;  3BND A;  3DGL A;  4HYZ A;  3KZT A;  4WYK B;  1EA2 A;  1F8N A;  2GU1 A;  2WOF A;  3KSP A;  4WYK A;  4XB5 A;  1L5G B;  1GY5 A;  3U1W A;  1IQX A;  2KRT A;  3B4O A;  1Q86 4;  2M7O A;  1OHO A;  4X2H A;  1T5Y A;  3EN1 B;  3BLZ A;  4OVM A;  5D81 A;  3B4P A;  3X3Y A;  3JUO A;  4L8O A;  1OH0 A;  1N8R 4;  1GD4 A;  1IT7 A;  1O7M B;  1VQN 3;  2Z77 A;  1GYB A;  3NUV A;  1OCV A;  2QEX 3;  1VQO 3;  4HM1 B;  4K90 B;  3RDE A;  1ASK A;  3G6E 3;  3CCR 3;  2XR8 B;  5EQL A;  2B1X B;  5EEO A;  1NO3 A;  1FGR A;  1IVU A;  1Q82 4;  3MG3 A;  3LZA A;  1Y4K A;  4HM6 B;  4O2H A;  3NBJ A;  1VQP 3;  3O8Y A;  1SQW A;  3J7Y d;  5STD A;  1E3R A;  4OK0 A;  3MKI A;  1N8Q A;  1OHS A;  3OWU A;  3EBT A;  4IIA A;  1VQ4 3;  1D6Y A;  3K0Z A;  5KP4 A;  5DRE A;  3HK4 A;  3JUM A;  1O7H B;  1JB2 A;  4EC6 A;  2CIU A;  2CFD A;  2CFL A;  3KFQ C;  3JUP A;  1N5H A;  3NM7 A;  1Q40 A;  3FGY A;  3LTB A;  3BNC A;  4XM4 A;  2OQE C;  1VQ9 3;  2Z76 A;  2PZV A;  2W0Q A;  2W04 A;  4PEJ A;  4XBX A;  1LOX A;  1FGQ A;  3PXM A;  5CK6 A;  2IMJ A;  1IV9 A;  3B8L A;  2CC3 A;  1EKM A;  1STF I;  2XEP A;  4LGQ A;  1BUQ A;  2QA4 3;  4HM4 B;  2BMQ B;  3I0Y A;  5ELJ A;  2RCD A;  2XGL A;  3CPO A;  2I9W A;  1IU7 A;  1U5O A;  2FNQ A;  3ROB A;  1E97 A;  1RJO A;  3PCS A;  1QVG 2;  3LML A;  2GU3 A;  3CC4 3;  1D6Z A;  1UUV B;  4N6M A;  3X3X A;  1EG9 B;  4EYC A;  2OTJ 3;  1K73 4;  2MF7 A;  3NBR A;  2WGO A;  2XFS A;  3OWY A;  3FH1 A;  1ZX2 A;  3GWR A;  4FCZ A;  3WOF B;  2QIY A;  1KWI A;  5TGN A;  3CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...