3EBYA

Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
153
Chain Sequence
b'EVAQVAQSAIDDFNAAYGLCLDDDRLEQWPTLFVDDCLYQVIARENVDNGLPAAVMYCDSKGMLADRVVALRKANHFNRHLIGRAVITGVEGDQVSAEASYVVFQTRNDGETRIYNAGKYVDRFDLSGGTVRLKSRTCIYDTLRIATLLATPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
rcsb
molecule keywords beta subunit of a putative Aromatic-ring-hydroxylating dioxy
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Structural genomics, unknown function
total genus 47
structure length 153
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebyA00
1ASKA 1ZO2A 4RZMA 4XDVA 3MYTA 5IG4A 2GXFA 1QJGA 2GBWB 1DMNA 1O7MB 2HMKB 2INXA 3FF2A 5FW5A 2XSOB 3UJMA 5CK6A 5BVBA 3NUVA 3MKIA 5IERA 3E99A 1CQSA 3K7CA 3JUOA 3T8NA 4HZBB 5TGNA 2BMQB 3WMDA 2RGQA 5CF1A 3BLZA 2IMJA 3F8HA 3K0ZA 1JKGA 2W2CA 3JUMA 2PZVA 1OGZA 5IG5A 1STDA 3DMCA 3EN8A 3JUPA 3MHEA 1NWWA 2HMLB 5IF6A 3SOYA 3HX8A 3F7SA 4HM8B 3LZAA 4HM5B 1OPYA 4L8PA 1BUQA 1K41A 1W00A 1JN5B 4HM1B 3GWRA 3NV0A 3GZYB 5AIFA 1W02A 3CNXA 3FZWA 4XB5A 5IG0A 2XRXB 1EA2A 4U13A 1W01A 3UNLA 1GY7A 1HKXA 2Z77A 3EN1B 4R9LA 4H3UA 3EC9A 4LMIA 1C7HA 3ER7A 3F7XA 4WYKB 4R1KA 3RGRA 2YFIB 3EX9A 3EQQB 3BB9A 4KVHA 7STDA 1TP6A 4XBYA 4HM2B 5DRVA 3NBRA 3DXOA 1Q42A 3NV0B 3FLJA 5CLKA 2F98A 1DMMA 3G8ZA 3GZRA 4HM4B 1W6YA 3I0YA 2GEYA 2UX0A 3DM8A 1O7NB 1O7HB 4MJDA 2XSHB 6STDA 2BNGA 1JN5A 4K1UA 1DMQA 2HMJB 3NHXA 2JQ5A 4IIAA 3CPOA 2B1XB 4L7KA 1A2KA 3B4OA 3FSDA 1JB4A 4HJLB 5JPUA 1OUNA 3DZLA 2YFJB 3OWSA 4HKVB 1OHSA 3S5CA 3FKAA 3NM2A 3VGNA 2YFLB 3JUQA 4FCJA 1OGXA 4ORLA 4PEJA 4WP5A 4HM6B 4WYKA 3EHCA 4J8TA 3G16A 2HMOB 5JPPA 2Z7AA 2QIYA 2Z76A 3OWYA 4X2HA 3VSYA 3KE7A 1O7PB 1IDPA 3NXJA 2CHCA 1OHPA 4XM4A 3JUNA 2K54A 3ECFA 1UUWB 2BMRB 3GZXB 1NDOB 4HZ9B 5AI1A 3H51A 4Q53A 3GRDA 3M8CA 3H3HA 2CKFB 4WWUC 3B8LA 3DUKA 3STDA 3OV4A 1OCVA 4STDA 1AR0A 3F8XA 1NU3A 1O7GB 1GY5A 3MG1A 1JB2A 1OF5B 3KZTA 5G2GA 2RCDA 3MG3A 1U5OA 3MG2A 4K1VA 3CNMA 4XDWA 8CHOA 5AIIA 3ROBA 2R4IA 4CDLA 3IPTA 4LGQA 3KKGA 1ULIB 4XBTA 5D82A 5IEOA 5IG3A 2B24B 2QGUA 2BMOB 1EG9B 3T8UA 1SJWA 4HVNA 1ISKA 5HGRA 1E97A 3HK4A 4LEHA 3SOAA 3FF0A 1GS3A 4OVMA 3EBTA 3HZPA 1Q40B 3OX9A 2OWPA 2RFRA 1UUVB 2STDA 1ZX2A 3MSOA 5BXQA 4HM0B 3B4PA 1E3VA 5D81A 1TUHA 2F99A 4J9AA 5DREA 3CU3A 1OF5A 1E3RA 3OXAA 3F40A 2GEXA 4OUQA 5STDA 5AEWB 3SEDA 1OHOA 1GY6A 1WQLB 2GBXB 1Z1SA 5KP3A 5EVHA 2F86B 4L8OA 4N3VA 1VZZA 3EBYA 3G0KA 5CF2A 5AEUB 3FH1A 2HMNB 5AIHA 5IEPA 3D9RA 4XBXA 3OWUA 3GZBA 1GYBA 3LYGA 1JKGB 1O7WB 4HM3B 1ULJB 3RGAA 1Q40A 3B7CA 2I9WA 4R9KA 5CXOA 2XR8B 3F14A 3F9SA 3A76A 4I4KA 3Q90A 3FGYA 3EF8A 4HM7B 4X2OA 3KSPA 3EJVA 5D83A 2HMMB 5AIGA 1JB5A 5KP4A 4FCMA 5KP1A 4GB5A 1S5AA 1QMAA 5IENA 1OH0A 2A15A
chains in the Genus database with same CATH superfamily
2WGQA 3U97A 1ASKA 4CJNA 1LNHA 1G96A 4K90B 1ZO2A 1U8CB 2BHMA 2JDIH 3CCS3 4RZMA 1LQMB 4XDVA 1MGWA 1NB3I 2UGIA 3MYTA 5IG4A 1BNFA 2GXFA 1QJGA 2GBWB 4GSPA 3V99A 1D6ZA 1DMNA 1O7MB 2CFGA 4TX4A 3X3XA 2K0MA 3CC43 2HMKB 2INXA 3N54B 1NB5I 1J2BA 3FF2A 5FW5A 2CFKA 4EC6A 2OTL3 3CCM3 4EW5A 2XSOB 3OW22 1G02A 4MMXB 3UJMA 1V74A 3PYJA 5CK6A 2C10A 3WHOA 5BVBA 4K61A 1M9GA 1RGCA 5ELJA 2CG1A 3NUVA 5IW9A 3MKIA 5IERA 3E99A 1CQSA 3K7CA 3JUOA 3T8NA 1FUWA 1RRHA 4HZBB 4AEQA 3T0UA 5TGNA 2BMQB 3LH4A 2CX1A 3WMDA 2RGQA 5CF1A 1MGRA 3BLZA 1B20A 2IMJA 3F8HA 1I3IA 3U1WA 4O3VA 1RNTA 3K0ZA 1MWUA 1HU9A 1SARA 2UUGC 1JKGA 1EKMA 3WR2A 2W2CA 1N5HA 3JUMA 3LTAA 3K5TA 1TRPA 2GU1A 3PS8A 3URPA 1BNRA 4JRFA 1W2ZA 2RNTA 2PZVA 4LZIA 1OGZA 5IG5A 5EEOA 1STDA 3DMCA 3AGOA 2E2UA 3CCR3 4IPBA 3EN8A 3MWZA 1LOVA 3JUPA 1N8R4 3X3ZA 1W4NA 4N6UA 1RLSA 3HIGA 1KD14 1TTOA 3MHEA 1NWWA 1RGFA 3PCSA 2HMLB 3PXMA 4EV2A 8RNTA 1UCIA 5AYSC 1NJI4 1I8VA 2XH9A 5IF6A 3CC23 1C54A 3BNEA 4RBNA 3SOYA 2J8XB 3FCSB 3HX8A 1CH0A 2W9PA 3RNTA 2P38A 3F7SA 4AKZA 4HM8B 1R4YA 1CYUA 1VQ73 2OQEC 3WA2X 2SARA 1VQ63 2O3OA 3LZAA 4EV5A 3DGLA 1OPYA 4HM5B 1A67A 2OOVC 1GOUA 4L8PA 3KN4A 1BUQA 1K41A 1W00A 3CXC2 1BNIA 1JN5B 4HM1B 1L5GB 3GWRA 3NV0A 2IA7A 3GZYB 2XF3A 1UCKA 5AIFA 1T2IA 1W02A 1FGQA 1QALA 1RMSA 3CNXA 3FZWA 1I2GA 2LQVA 2GU3A 2OCTA 3FG4A 4XB5A 2CC3A 5AYRB 5IG0A 1DVCA 3DH2A 1FZUA 2XRXB 1EA2A 1RCKA 4U13A 1W01A 4EYCA 1YVSA 3PGBA 1BRKA 2FXTA 3UNLA 3SX1A 2MC8A 1GY7A 2XEPA 1B2MA 5M1AA 3S67A 1JBRA 2W9QA 1HKXA 1Q9EA 2Z77A 3EN1B 4H3UA 4R9LA 1IK3A 1DE3A 1EUIC 1VQL3 4GHOA 3EC9A 1RN7A 3G713 1RHLA 4LMIA 1C7HA 4O2HA 2L4VA 3ER7A 2KF4A 3F7XA 1SIIA 2LYXA 4R1KA 4QWTA 4WYKB 3RGRA 1BUJA 2L1SA 2YFIB 3EE1A 2K3DA 1TU5A 3EX9A 1YGEA 2CH9A 3D5GA 3EQQB 3ZG0A 2YX9A 1YHQ3 3BB9A 4KVHA 3X41A 7STDA 1JZOA 2P0XA 1QAKA 1TFKA 1TP6A 2XGLA 2ZA4A 1RGHA 1D6UA 3K63A 4XBYA 3V98A 3CCU3 4HM2B 5DRVA 3QRDA 2KAAA 3DGOA 1BRIA 1BSAA 3CMA3 3CME3 1FA3A 3SYUA 3IMAB 2QEX3 3AMOA 3NBRA 4R80A 1I0VA 2RBIA 3EB8A 3DXOA 1Q42A 5LC6A 1YJ93 3NV0B 2KRTA 1TRQA 2H0HA 3FLJA 5CLKA 2ML6A 4HBRA 4BTXA 3G6E3 2F98A 1DMMA 3G8ZA 2W03A 3AHWA 2CIUA 1VQP3 3GZRA 4HM4B 1NNVA 1W6YA 3NX0A 4FMCA 4LSOA 1BRHA 2BIRA 3I0YA 2GEYA 1SPUA 1LOWA 1R4CA 3D5IA 4RNZA 4ZM8A 2UX0A 1DYUA 3Q1CA 1JRQA 1BNEA 3DM8A 3DY5A 4AKYA 1O7NB 3LXUX 4LYLB 1O7HB 1RGLA 1SQWA 3K9MC 3UL5A 3LMLA 4MJDA 2FNQA 2XSHB 3QK9A 6STDA 2F56A 3LTBA 1IT7A 3CCV3 2BNGA 3D4AA 1JN5A 5M18A 4MMZB 4K1UA 1DMQA 7RNTA 4MEIA 1BSEA 2HMJB 2ML5A 1RGAA 4O8SA 6GSPA 1AQZA 3NHXA 1IQ8A 2JQ5A 4IIAA 3CPOA 4R4KA 1LOXA 4OK0A 1ZS7A 3BIRA 3CCL3 2B1XB 4L7KA 1DVDA 1FW7A 1A2VA 1A2KA 3B4OA 2ZL8A 5FGOA 1EQKA 1I0XA 3FSDA 1B2UA 3I563 2V1LA 1JB4A 2W0QA 4HJLB 3CCJ3 4HAAA 3O8YA 5JPUA 1FGRA 1OUNA 3DZLA 3SXXA 1VQK3 2YFJB 2MF7A 5I97A 3OWSA 4HKVB 1OHSA 3S5CA 1NO3A 1LOYA 1I2EA 3AMOB 1IQYA 1BNSA 1PFPA 1AV4A 2M7OA 3FKAA 3NM2A 2YFLB 3VGNA 3WOEB 3JUQA 3KSED 4FCJA 1OGXA 1BRSA 4ORLA 4PEJA 4HM6B 4WP5A 1IV9A 4WYKA 1IV7A 3EHCA 1Q7HA 2CWVA 1LVNA 4J8TA 3G16A 4FR9A 3CPW2 1K8A4 1JZDA 2HMOB 5M19A 2QA43 5JPPA 5ELUA 4GL6A 1MWSA 3KFQC 3WOFB 1BGSA 2RSXA 1IVVA 1UGHI 2Z7AA 1GMRA 2QIYA 2W56B 1BVIA 2Z76A 3OWYA 4CCVA 2GSPA 4X2HA 3VSYA 3KE7A 4RNYA 5HOHA 1IVUA 1VQ83 2Q07A 4HOHA 1O7PB 1IDPA 2F5MA 2CFLA 3NXJA 9RNTA 2CHCA 2D42A 1K9M4 1OHPA 1QAFA 1LNIA 3N9HA 4XM4A 1VQM3 1JNQA 3JUNA 2K54A 2P09A 1RN4A 1RGEA 3GSPA 3ECFA 4FMAA 3NBBA 3CCE3 1UUWB 1Q7Y4 2BMRB 1SIHA 1RTUA 3FG1A 3GAXA 1IVWA 4G1MB 3LOYA 3GZXB 2Y73A 1B27A 1NDOB 4HZ9B 2CWTA 4NREA 1FYSA 5AI1A 5G1LA 3G4S3 3H51A 1M904 4Q53A 3Q2PA 4KZ1A 4BTWA 3GRDA 3M8CA 2W6JH 3J7Yd 1JBSA 2E2TA 2H0GA 3H3HA 2CKFB 4MMYB 4WWUC 2CG0A 2IUJA 3LTCA 3B8LA 3DUKA 3STDA 3OV4A 1OCVA 2CFWA 4STDA 1BIRA 2IYJA 1AR0A 1WMNA 1WTHA 2H0IA 3FG3A 3F8XA 3ZFZA 4BL3A 1WMPA 1NU3A 1O7GB 3MPHA 4CPKA 1HYFA 1GY5A 3PCRA 3KIIA 3X42A 2CW9A 3MG1A 1X1YA 1JB2A 3DGNA 1FUSA 1FUTA 1RKYA 1OF5B 1MWRA 3KZTA 1BNGA 1UUGB 3TDGA 4FMDA 5G2GA 1EEJA 1I2FA 1UW1A 2IUKA 7GSPA 5BIRA 3LTDA 1KQS2 1BSBA 4H61A 1F8NA 6RNTA 4N6NB 2RCDA 2SBLA 1DETA 1N5PA 3MG3A 1JJ22 1U5OA 3Q3FA 1UGIA 3MG2A 1UCLA 4K1VA 3CNMA 1KWIA 4XDWA 2CFDA 4J5GA 8CHOA 3DGMA 5AIIA 1X1WA 3ROBA 2R4IA 4CDLA 1PY3A 1QVG2 1IQXA 1GD3A 3IPTA 5RNTA 1I3FA 4LGQA 3KKGA 1VQO3 3N8BA 3CCQ3 1ULIB 4XBTA 5D82A 5IEOA 3ZG5A 1GD4A 1UDII 2Y74A 1CEWI 1RDSA 1BANA 1PYLA 2B24B 5IG3A 2QGUA 1B21A 3RDEA 1A2PA 3BNBA 1UI7A 2FGTA 2WOFA 2BMOB 4N6LA 2AADA 4FCZA 2CX0A 2OQEA 3V92A 1KC84 1B2SA 1EG9B 3T8UA 1SJWA 2W04A 2W56A 4HVNA 1ISKA 2OOVA 1YJW3 1VQN3 3D79A 4N6V0 1B2XA 1JBTA 5HGRA 1E97A 2D1WA 2WO0A 3KCHA 1BSCA 3HK4A 2AAEA 4J5KA 1M1XB 4WHAA 4LEHA 1RGGA 2HOHA 4KFFA 3SOAA 3FF0A 2OTJ3 1G0TA 1GS3A 1JV2B 1US1A 1W6GA 1LRAA 1BOXA 4OVMA 4BTYA 3EBTA 2F4YA 3HZPA 3X3YA 1LQGC 1K734 1Q40B 3OX9A 4KFDA 4N6TA 2OWPA 2RFRA 4IT7A 1UUVB 1YNVX 3HOHA 2STDA 2BU4A 3S28A 4BIRA 1ZX2A 1W5ZA 3VF1A 3MSOA 2WOHA 1ROVA 5BXQA 1YIJ3 4HM0B 3B4PA 4DKIA 1LXEA 2KCDA 1E3VA 4O02B 3I553 5D81A 1TUHA 2F99A 4J9AA 1S723 1X1UA 3BNDA 5EQLA 5DREA 1RCLA 3CU3A 4EBGA 3DGYA 1OF5A 1E3RA 3L0RA 1IU7A 2BO9B 1BRNL 1RNBA 3BNCA 2Z6BA 3OXAA 1RJOA 3PZWA 3UB1A 3S27A 4BU4A 3F40A 3LT9A 1BSDA 2GEXA 4KFEA 3CC73 1N9EA 4OUQA 3AHSA 1FGTA 1RSNA 3JVCA 1WMOA 3NBJA 5STDA 4KT3B 2ZHXB 5AEWB 3WA3A 3SEDA 1T3BA 1OHOA 1BNJA 2KXGA 1GY6A 3D3LA 3LT8A 2E2VA 3ALAA 4HYZA 1IT8A 1STFI 1WQLB 4NPBA 1BU4A 5GSPA 2GBXB 1BRJA 2XFTA 1Z1SA 1VQ53 5KP3A 5A0OB 3IJEB 5EVHA 1UI8A 2ZDJA 2KF5A 1K28A 4N6MA 1TFOA 2F86B 1YJN3 2P05A 5G1KA 1W7CA 1N8QA 1HZ1A 1MWTA 4L8OA 1GSPA 2C4BA 1T2HA 4NHFA 4N3VA 1VZZA 1QVF2 2XFSA 3EBYA 1M1K4 5LC7A 3HI7A 3G0KA 2R41A 3NQZA 1ROAA 1Y4KA 1YVBI 2PNCA 1OACA 2BT3A 2IY2A 1PU4A 3BU4A 5CF2A 5AEUB 1CYVA 1FGMA 3FH1A 1KSIA 2KF3A 3NQYA 2HMNB 3UL6A 1N9JA 3SLUA 1WNHA 1V58A 1RRLA 5AIHA 4JF8A 2P0MA 5IEPA 3D9RA 4RNTA 1MOLA 4XBXA 2O9UX 3AGNA 2CK3H 3WDGB 3OWUA 3GZBA 1GYBA 3LYGA 1JKGB 1GMPA 1BAOA 4BL2A 1A90A 1ZGXA 1YI23 1O7WB 1T5YA 4HM3B 1B2ZA 1ULJB 3RGAA 1Q40A 2C11A 3B7CA 1Q824 5JBSA 1Q864 3NM7A 2I9WA 3WODG 1VQ93 1TIJA 3A5EA 1IYYA 4R9KA 5CXOA 1W6CA 1AVLA 2CWUA 2XR8B 1BRGA 3F14A 3F9SA 1YIT3 1RN1A 5BU4A 2F5WA 3A76A 1AY7A 4FMBA 4I4KA 1VQQA 3Q90A 1RGKA 4N6OB 1V57A 1D6YA 1UCJA 3FGYA 3EF8A 4HM7B 3CD63 1I70A 1VQ43 1B3SA 1GMQA 4X2OA 3KSPA 1GOVA 3EJVA 3S29A 1AVKA 3HIIA 4I5QA 5D83A 3SVAA 1W2B2 1YGWA 2HMMB 4EXRA 1GOYA 5AIGA 1JB5A 5KP4A 3X40A 4FCMA 5KP1A 4GB5A 1X1XA 1IVXA 2KF6A 2XGNA 1S5AA 1TJDA 1FGOA 1QMAA 2WGOA 4WFOA 4ILFA 5IENA 1MNLA 1OH0A 1Q814 2A15A
chains in the Genus database with same CATH topology
2WGQA 3U97A 1ASKA 1LNHA 1G96A 4K90B 1ZO2A 1U8CB 2BHMA 2JDIH 3CCS3 4RZMA 4XDVA 1NB3I 3MYTA 5IG4A 2GXFA 1QJGA 2GBWB 3V99A 1D6ZA 1DMNA 1O7MB 2CFGA 4TX4A 3X3XA 2K0MA 3CC43 2HMKB 2INXA 3N54B 1NB5I 1J2BA 3FF2A 5FW5A 2CFKA 4EC6A 2OTL3 3CCM3 2XSOB 3OW22 4MMXB 3UJMA 1V74A 3PYJA 5CK6A 2C10A 5BVBA 4K61A 1M9GA 5ELJA 2CG1A 3NUVA 5IW9A 3MKIA 5IERA 3E99A 1CQSA 3K7CA 3JUOA 3T8NA 1FUWA 1RRHA 4HZBB 4AEQA 3T0UA 5TGNA 2BMQB 3LH4A 3WMDA 2RGQA 5CF1A 3BLZA 2IMJA 3F8HA 3U1WA 4O3VA 3K0ZA 1HU9A 1JKGA 1EKMA 2W2CA 1N5HA 3JUMA 3LTAA 3K5TA 2GU1A 3PS8A 4JRFA 1W2ZA 4LZIA 2PZVA 1OGZA 5IG5A 5EEOA 1STDA 3DMCA 2E2UA 3CCR3 4IPBA 3EN8A 3MWZA 3JUPA 1N8R4 3X3ZA 1W4NA 4N6UA 3HIGA 1KD14 3PCSA 3MHEA 1NWWA 2HMLB 3PXMA 4EV2A 5AYSC 1NJI4 2XH9A 5IF6A 3CC23 3BNEA 4RBNA 3SOYA 3FCSB 3HX8A 2W9PA 2P38A 3F7SA 4AKZA 4HM8B 1CYUA 1VQ73 2OQEC 3WA2X 1MNLA 2O3OA 3LZAA 1VQ63 4EV5A 3DGLA 1OPYA 4HM5B 1A67A 2OOVC 4L8PA 3KN4A 1BUQA 1K41A 1W00A 3CXC2 1JN5B 4HM1B 1L5GB 3GWRA 3NV0A 2IA7A 3GZYB 2XF3A 5AIFA 1W02A 1FGQA 1QALA 3CNXA 3FZWA 2LQVA 2GU3A 2OCTA 3FG4A 4XB5A 2CC3A 5AYRB 5IG0A 1DVCA 2XRXB 1EA2A 4U13A 4EYCA 1W01A 3PGBA 2FXTA 3UNLA 3SX1A 2MC8A 1GY7A 2XEPA 3S67A 2W9QA 1HKXA 2Z77A 3EN1B 4R9LA 4H3UA 1IK3A 1VQL3 3EC9A 1RN7A 3G713 4LMIA 4O2HA 1C7HA 2L4VA 3ER7A 3F7XA 1SIIA 4WYKB 4R1KA 4QWTA 3RGRA 2YFIB 3EE1A 1TU5A 3EX9A 1YGEA 2CH9A 3EQQB 2YX9A 1YHQ3 3BB9A 4KVHA 3X41A 7STDA 2P0XA 1QAKA 1TFKA 1TP6A 2XGLA 3K63A 1D6UA 4XBYA 3V98A 3CCU3 4HM2B 5DRVA 3QRDA 3DGOA 3CMA3 3CME3 1FA3A 3IMAB 2QEX3 3AMOA 3NBRA 4R80A 3EB8A 3DXOA 1Q42A 5LC6A 1YJ93 3NV0B 2KRTA 3FLJA 4BTXA 5CLKA 2ML6A 4HBRA 3G6E3 2F98A 1DMMA 3G8ZA 2W03A 2CIUA 1VQP3 3GZRA 4HM4B 1W6YA 3NX0A 4FMCA 4LSOA 3I0YA 2GEYA 1SPUA 4RNZA 1R4CA 4ZM8A 2UX0A 1DYUA 3Q1CA 1JRQA 3DY5A 3DM8A 4AKYA 1O7NB 3LXUX 1O7HB 3K9MC 1SQWA 3UL5A 3LMLA 4MJDA 2FNQA 2XSHB 3QK9A 6STDA 3LTBA 1IT7A 3CCV3 2BNGA 1JN5A 4MMZB 4K1UA 1DMQA 4MEIA 2HMJB 2ML5A 4O8SA 3NHXA 1IQ8A 2JQ5A 4IIAA 3CPOA 4R4KA 1LOXA 4OK0A 3CCL3 2B1XB 4L7KA 1DVDA 1A2VA 1A2KA 3B4OA 2ZL8A 5FGOA 1EQKA 3FSDA 3I563 3CCJ3 2V1LA 1JB4A 2W0QA 4HJLB 3O8YA 5JPUA 1FGRA 1OUNA 3DZLA 3SXXA 1VQK3 2YFJB 2MF7A 5I97A 3OWSA 4HKVB 1OHSA 3S5CA 1NO3A 3AMOB 1IQYA 1PFPA 3FKAA 1AV4A 2M7OA 3NM2A 3VGNA 2YFLB 3WOEB 3JUQA 3KSED 4FCJA 1OGXA 4ORLA 4PEJA 4WP5A 4HM6B 4WYKA 1IV9A 1IV7A 3EHCA 2CWVA 1LVNA 4J8TA 3G16A 4FR9A 3CPW2 1K8A4 2HMOB 2QA43 5JPPA 5ELUA 4GL6A 3KFQC 3WOFB 2RSXA 1IVVA 2Z7AA 2W56B 2QIYA 2Z76A 3OWYA 4CCVA 4X2HA 3VSYA 3KE7A 4RNYA 1VQ83 1IVUA 2Q07A 1O7PB 1IDPA 2CFLA 3NXJA 2CHCA 2D42A 1OHPA 1QAFA 3N9HA 4XM4A 1VQM3 1JNQA 3JUNA 2K54A 2P09A 4FMAA 3ECFA 3NBBA 3CCE3 1UUWB 1Q7Y4 2BMRB 1SIHA 3FG1A 3GAXA 1IVWA 4G1MB 3LOYA 3GZXB 2Y73A 1NDOB 4HZ9B 4NREA 2CWTA 1M904 5AI1A 3G4S3 3H51A 4Q53A 3Q2PA 4KZ1A 4BTWA 3GRDA 3M8CA 2W6JH 3J7Yd 2E2TA 3H3HA 2CKFB 4MMYB 4WWUC 2CG0A 2IUJA 3LTCA 3B8LA 3DUKA 3STDA 3OV4A 1OCVA 2CFWA 4STDA 1AR0A 1WMNA 1WTHA 3FG3A 3F8XA 1WMPA 1NU3A 1O7GB 3MPHA 1GY5A 3PCRA 3KIIA 3X42A 2CW9A 3MG1A 1JB2A 3DGNA 1RKYA 1OF5B 3KZTA 3TDGA 4FMDA 5G2GA 1UW1A 2IUKA 1KQS2 3LTDA 4H61A 1F8NA 4N6NB 2RCDA 2SBLA 3MG3A 1N5PA 1JJ22 1U5OA 3MG2A 4K1VA 3CNMA 1KWIA 4XDWA 2CFDA 8CHOA 3DGMA 5AIIA 3ROBA 2R4IA 4CDLA 1QVG2 1IQXA 1GD3A 3IPTA 1VQO3 4LGQA 3KKGA 3N8BA 3CCQ3 1ULIB 4XBTA 5D82A 5IEOA 1GD4A 2Y74A 1CEWI 5IG3A 2B24B 2QGUA 3RDEA 3BNBA 1UI7A 2FGTA 2WOFA 2BMOB 4N6LA 4FCZA 1KC84 2OQEA 3V92A 1EG9B 3T8UA 1SJWA 2W04A 2W56A 4HVNA 1ISKA 2OOVA 1YJW3 1VQN3 4N6V0 5HGRA 1E97A 2D1WA 2WO0A 3HK4A 1M1XB 4WHAA 4LEHA 4KFFA 3SOAA 3FF0A 2OTJ3 1GS3A 1US1A 1JV2B 1W6GA 4OVMA 4BTYA 3EBTA 3HZPA 3X3YA 1K734 1Q40B 3OX9A 4KFDA 4N6TA 2OWPA 2RFRA 4IT7A 1UUVB 2STDA 3S28A 1ZX2A 1W5ZA 3VF1A 3MSOA 2WOHA 1ROVA 5BXQA 1YIJ3 4HM0B 3B4PA 1LXEA 2KCDA 1E3VA 4O02B 3I553 5D81A 1TUHA 2F99A 4J9AA 1S723 3BNDA 5EQLA 5DREA 3CU3A 4EBGA 3L0RA 1OF5A 1E3RA 1IU7A 2BO9B 3BNCA 2Z6BA 3OXAA 1RJOA 3PZWA 3UB1A 3S27A 3F40A 3LT9A 2GEXA 4KFEA 3CC73 1N9EA 4OUQA 1FGTA 5STDA 3JVCA 1WMOA 3NBJA 3WA3A 5AEWB 3SEDA 1OHOA 3D3LA 2KXGA 1GY6A 3LT8A 2E2VA 3ALAA 4HYZA 1IT8A 1STFI 1WQLB 2GBXB 2XFTA 1VQ53 1Z1SA 5KP3A 5A0OB 3IJEB 5EVHA 1UI8A 2ZDJA 4N6MA 1K28A 1TFOA 2F86B 1YJN3 2P05A 1W7CA 1N8QA 4L8OA 4NHFA 4N3VA 1VZZA 1QVF2 2XFSA 3EBYA 1M1K4 5LC7A 3HI7A 3G0KA 3NQZA 1ROAA 1Y4KA 1YVBI 2PNCA 1OACA 2BT3A 1PU4A 5CF2A 5AEUB 1CYVA 1FGMA 3FH1A 1KSIA 3NQYA 2HMNB 3UL6A 1N9JA 3SLUA 1WNHA 1RRLA 5AIHA 4JF8A 2P0MA 5IEPA 3D9RA 1MOLA 4XBXA 2O9UX 2CK3H 3WDGB 3OWUA 3GZBA 1GYBA 3LYGA 1JKGB 1A90A 1YI23 1O7WB 1T5YA 4HM3B 1ULJB 3RGAA 1Q40A 2C11A 3B7CA 1Q824 5JBSA 1Q864 3NM7A 2I9WA 3WODG 1VQ93 1TIJA 4R9KA 5CXOA 1W6CA 1AVLA 2CWUA 2XR8B 3F14A 3F9SA 1YIT3 3A76A 4FMBA 4I4KA 3Q90A 4N6OB 1D6YA 3FGYA 3EF8A 4HM7B 3CD63 1VQ43 4X2OA 3KSPA 3EJVA 3S29A 1AVKA 3HIIA 5D83A 3SVAA 1W2B2 2HMMB 4EXRA 5AIGA 1JB5A 5KP4A 3X40A 4FCMA 5KP1A 4GB5A 2XGNA 1IVXA 4WFOA 1S5AA 2WGOA 1FGOA 1QMAA 5IENA 1Q814 2LYXA 1OH0A 1K9M4 2A15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASK A;  1ZO2 A;  4RZM A;  4XDV A;  3MYT A;  5IG4 A;  2GXF A;  1QJG A;  2GBW B;  1DMN A;  1O7M B;  2HMK B;  2INX A;  3FF2 A;  5FW5 A;  2XSO B;  3UJM A;  5CK6 A;  5BVB A;  3NUV A;  3MKI A;  5IER A;  3E99 A;  1CQS A;  3K7C A;  3JUO A;  3T8N A;  4HZB B;  5TGN A;  2BMQ B;  3WMD A;  2RGQ A;  5CF1 A;  3BLZ A;  2IMJ A;  3F8H A;  3K0Z A;  1JKG A;  2W2C A;  3JUM A;  2PZV A;  1OGZ A;  5IG5 A;  1STD A;  3DMC A;  3EN8 A;  3JUP A;  3MHE A;  1NWW A;  2HML B;  5IF6 A;  3SOY A;  3HX8 A;  3F7S A;  4HM8 B;  3LZA A;  4HM5 B;  1OPY A;  4L8P A;  1BUQ A;  1K41 A;  1W00 A;  1JN5 B;  4HM1 B;  3GWR A;  3NV0 A;  3GZY B;  5AIF A;  1W02 A;  3CNX A;  3FZW A;  4XB5 A;  5IG0 A;  2XRX B;  1EA2 A;  4U13 A;  1W01 A;  3UNL A;  1GY7 A;  1HKX A;  2Z77 A;  3EN1 B;  4R9L A;  4H3U A;  3EC9 A;  4LMI A;  1C7H A;  3ER7 A;  3F7X A;  4WYK B;  4R1K A;  3RGR A;  2YFI B;  3EX9 A;  3EQQ B;  3BB9 A;  4KVH A;  7STD A;  1TP6 A;  4XBY A;  4HM2 B;  5DRV A;  3NBR A;  3DXO A;  1Q42 A;  3NV0 B;  3FLJ A;  5CLK A;  2F98 A;  1DMM A;  3G8Z A;  3GZR A;  4HM4 B;  1W6Y A;  3I0Y A;  2GEY A;  2UX0 A;  3DM8 A;  1O7N B;  1O7H B;  4MJD A;  2XSH B;  6STD A;  2BNG A;  1JN5 A;  4K1U A;  1DMQ A;  2HMJ B;  3NHX A;  2JQ5 A;  4IIA A;  3CPO A;  2B1X B;  4L7K A;  1A2K A;  3B4O A;  3FSD A;  1JB4 A;  4HJL B;  5JPU A;  1OUN A;  3DZL A;  2YFJ B;  3OWS A;  4HKV B;  1OHS A;  3S5C A;  3FKA A;  3NM2 A;  3VGN A;  2YFL B;  3JUQ A;  4FCJ A;  1OGX A;  4ORL A;  4PEJ A;  4WP5 A;  4HM6 B;  4WYK A;  3EHC A;  4J8T A;  3G16 A;  2HMO B;  5JPP A;  2Z7A A;  2QIY A;  2Z76 A;  3OWY A;  4X2H A;  3VSY A;  3KE7 A;  1O7P B;  1IDP A;  3NXJ A;  2CHC A;  1OHP A;  4XM4 A;  3JUN A;  2K54 A;  3ECF A;  1UUW B;  2BMR B;  3GZX B;  1NDO B;  4HZ9 B;  5AI1 A;  3H51 A;  4Q53 A;  3GRD A;  3M8C A;  3H3H A;  2CKF B;  4WWU C;  3B8L A;  3DUK A;  3STD A;  3OV4 A;  1OCV A;  4STD A;  1AR0 A;  3F8X A;  1NU3 A;  1O7G B;  1GY5 A;  3MG1 A;  1JB2 A;  1OF5 B;  3KZT A;  5G2G A;  2RCD A;  3MG3 A;  1U5O A;  3MG2 A;  4K1V A;  3CNM A;  4XDW A;  8CHO A;  5AII A;  3ROB A;  2R4I A;  4CDL A;  3IPT A;  4LGQ A;  3KKG A;  1ULI B;  4XBT A;  5D82 A;  5IEO A;  5IG3 A;  2B24 B;  2QGU A;  2BMO B;  1EG9 B;  3T8U A;  1SJW A;  4HVN A;  1ISK A;  5HGR A;  1E97 A;  3HK4 A;  4LEH A;  3SOA A;  3FF0 A;  1GS3 A;  4OVM A;  3EBT A;  3HZP A;  1Q40 B;  3OX9 A;  2OWP A;  2RFR A;  1UUV B;  2STD A;  1ZX2 A;  3MSO A;  5BXQ A;  4HM0 B;  3B4P A;  1E3V A;  5D81 A;  1TUH A;  2F99 A;  4J9A A;  5DRE A;  3CU3 A;  1OF5 A;  1E3R A;  3OXA A;  3F40 A;  2GEX A;  4OUQ A;  5STD A;  5AEW B;  3SED A;  1OHO A;  1GY6 A;  1WQL B;  2GBX B;  1Z1S A;  5KP3 A;  5EVH A;  2F86 B;  4L8O A;  4N3V A;  1VZZ A;  3EBY A;  3G0K A;  5CF2 A;  5AEU B;  3FH1 A;  2HMN B;  5AIH A;  5IEP A;  3D9R A;  4XBX A;  3OWU A;  3GZB A;  1GYB A;  3LYG A;  1JKG B;  1O7W B;  4HM3 B;  1ULJ B;  3RGA A;  1Q40 A;  3B7C A;  2I9W A;  4R9K A;  5CXO A;  2XR8 B;  3F14 A;  3F9S A;  3A76 A;  4I4K A;  3Q90 A;  3FGY A;  3EF8 A;  4HM7 B;  4X2O A;  3KSP A;  3EJV A;  5D83 A;  2HMM B;  5AIG A;  1JB5 A;  5KP4 A;  4FCM A;  5KP1 A;  4GB5 A;  1S5A A;  1QMA A;  5IEN A;  1OH0 A;  2A15 A; 
#chains in the Genus database with same CATH topology
 2WGQ A;  3U97 A;  1ASK A;  4CJN A;  1LNH A;  1G96 A;  4K90 B;  1ZO2 A;  1U8C B;  2BHM A;  2JDI H;  3CCS 3;  4RZM A;  1LQM B;  4XDV A;  1MGW A;  1NB3 I;  2UGI A;  3MYT A;  5IG4 A;  1BNF A;  2GXF A;  1QJG A;  2GBW B;  4GSP A;  3V99 A;  1D6Z A;  1DMN A;  1O7M B;  2CFG A;  4TX4 A;  3X3X A;  2K0M A;  3CC4 3;  2HMK B;  2INX A;  3N54 B;  1NB5 I;  1J2B A;  3FF2 A;  5FW5 A;  2CFK A;  4EC6 A;  2OTL 3;  3CCM 3;  4EW5 A;  2XSO B;  3OW2 2;  1G02 A;  4MMX B;  3UJM A;  1V74 A;  3PYJ A;  5CK6 A;  2C10 A;  3WHO A;  5BVB A;  4K61 A;  1M9G A;  1RGC A;  5ELJ A;  2CG1 A;  3NUV A;  5IW9 A;  3MKI A;  5IER A;  3E99 A;  1CQS A;  3K7C A;  3JUO A;  3T8N A;  1FUW A;  1RRH A;  4HZB B;  4AEQ A;  3T0U A;  5TGN A;  2BMQ B;  3LH4 A;  2CX1 A;  3WMD A;  2RGQ A;  5CF1 A;  1MGR A;  3BLZ A;  1B20 A;  2IMJ A;  3F8H A;  1I3I A;  3U1W A;  4O3V A;  1RNT A;  3K0Z A;  1MWU A;  1HU9 A;  1SAR A;  2UUG C;  1JKG A;  1EKM A;  3WR2 A;  2W2C A;  1N5H A;  3JUM A;  3LTA A;  3K5T A;  1TRP A;  2GU1 A;  3PS8 A;  3URP A;  1BNR A;  4JRF A;  1W2Z A;  2RNT A;  2PZV A;  4LZI A;  1OGZ A;  5IG5 A;  5EEO A;  1STD A;  3DMC A;  3AGO A;  2E2U A;  3CCR 3;  4IPB A;  3EN8 A;  3MWZ A;  1LOV A;  3JUP A;  1N8R 4;  3X3Z A;  1W4N A;  4N6U A;  1RLS A;  3HIG A;  1KD1 4;  1TTO A;  3MHE A;  1NWW A;  1RGF A;  3PCS A;  2HML B;  3PXM A;  4EV2 A;  8RNT A;  1UCI A;  5AYS C;  1NJI 4;  1I8V A;  2XH9 A;  5IF6 A;  3CC2 3;  1C54 A;  3BNE A;  4RBN A;  3SOY A;  2J8X B;  3FCS B;  3HX8 A;  1CH0 A;  2W9P A;  3RNT A;  2P38 A;  3F7S A;  4AKZ A;  4HM8 B;  1R4Y A;  1CYU A;  1VQ7 3;  2OQE C;  3WA2 X;  2SAR A;  1VQ6 3;  2O3O A;  3LZA A;  4EV5 A;  3DGL A;  1OPY A;  4HM5 B;  1A67 A;  2OOV C;  1GOU A;  4L8P A;  3KN4 A;  1BUQ A;  1K41 A;  1W00 A;  3CXC 2;  1BNI A;  1JN5 B;  4HM1 B;  1L5G B;  3GWR A;  3NV0 A;  2IA7 A;  3GZY B;  2XF3 A;  1UCK A;  5AIF A;  1T2I A;  1W02 A;  1FGQ A;  1QAL A;  1RMS A;  3CNX A;  3FZW A;  1I2G A;  2LQV A;  2GU3 A;  2OCT A;  3FG4 A;  4XB5 A;  2CC3 A;  5AYR B;  5IG0 A;  1DVC A;  3DH2 A;  1FZU A;  2XRX B;  1EA2 A;  1RCK A;  4U13 A;  1W01 A;  4EYC A;  1YVS A;  3PGB A;  1BRK A;  2FXT A;  3UNL A;  3SX1 A;  2MC8 A;  1GY7 A;  2XEP A;  1B2M A;  5M1A A;  3S67 A;  1JBR A;  2W9Q A;  1HKX A;  1Q9E A;  2Z77 A;  3EN1 B;  4H3U A;  4R9L A;  1IK3 A;  1DE3 A;  1EUI C;  1VQL 3;  4GHO A;  3EC9 A;  1RN7 A;  3G71 3;  1RHL A;  4LMI A;  1C7H A;  4O2H A;  2L4V A;  3ER7 A;  2KF4 A;  3F7X A;  1SII A;  2LYX A;  4R1K A;  4QWT A;  4WYK B;  3RGR A;  1BUJ A;  2L1S A;  2YFI B;  3EE1 A;  2K3D A;  1TU5 A;  3EX9 A;  1YGE A;  2CH9 A;  3D5G A;  3EQQ B;  3ZG0 A;  2YX9 A;  1YHQ 3;  3BB9 A;  4KVH A;  3X41 A;  7STD A;  1JZO A;  2P0X A;  1QAK A;  1TFK A;  1TP6 A;  2XGL A;  2ZA4 A;  1RGH A;  1D6U A;  3K63 A;  4XBY A;  3V98 A;  3CCU 3;  4HM2 B;  5DRV A;  3QRD A;  2KAA A;  3DGO A;  1BRI A;  1BSA A;  3CMA 3;  3CME 3;  1FA3 A;  3SYU A;  3IMA B;  2QEX 3;  3AMO A;  3NBR A;  4R80 A;  1I0V A;  2RBI A;  3EB8 A;  3DXO A;  1Q42 A;  5LC6 A;  1YJ9 3;  3NV0 B;  2KRT A;  1TRQ A;  2H0H A;  3FLJ A;  5CLK A;  2ML6 A;  4HBR A;  4BTX A;  3G6E 3;  2F98 A;  1DMM A;  3G8Z A;  2W03 A;  3AHW A;  2CIU A;  1VQP 3;  3GZR A;  4HM4 B;  1NNV A;  1W6Y A;  3NX0 A;  4FMC A;  4LSO A;  1BRH A;  2BIR A;  3I0Y A;  2GEY A;  1SPU A;  1LOW A;  1R4C A;  3D5I A;  4RNZ A;  4ZM8 A;  2UX0 A;  1DYU A;  3Q1C A;  1JRQ A;  1BNE A;  3DM8 A;  3DY5 A;  4AKY A;  1O7N B;  3LXU X;  4LYL B;  1O7H B;  1RGL A;  1SQW A;  3K9M C;  3UL5 A;  3LML A;  4MJD A;  2FNQ A;  2XSH B;  3QK9 A;  6STD A;  2F56 A;  3LTB A;  1IT7 A;  3CCV 3;  2BNG A;  3D4A A;  1JN5 A;  5M18 A;  4MMZ B;  4K1U A;  1DMQ A;  7RNT A;  4MEI A;  1BSE A;  2HMJ B;  2ML5 A;  1RGA A;  4O8S A;  6GSP A;  1AQZ A;  3NHX A;  1IQ8 A;  2JQ5 A;  4IIA A;  3CPO A;  4R4K A;  1LOX A;  4OK0 A;  1ZS7 A;  3BIR A;  3CCL 3;  2B1X B;  4L7K A;  1DVD A;  1FW7 A;  1A2V A;  1A2K A;  3B4O A;  2ZL8 A;  5FGO A;  1EQK A;  1I0X A;  3FSD A;  1B2U A;  3I56 3;  2V1L A;  1JB4 A;  2W0Q A;  4HJL B;  3CCJ 3;  4HAA A;  3O8Y A;  5JPU A;  1FGR A;  1OUN A;  3DZL A;  3SXX A;  1VQK 3;  2YFJ B;  2MF7 A;  5I97 A;  3OWS A;  4HKV B;  1OHS A;  3S5C A;  1NO3 A;  1LOY A;  1I2E A;  3AMO B;  1IQY A;  1BNS A;  1PFP A;  1AV4 A;  2M7O A;  3FKA A;  3NM2 A;  2YFL B;  3VGN A;  3WOE B;  3JUQ A;  3KSE D;  4FCJ A;  1OGX A;  1BRS A;  4ORL A;  4PEJ A;  4HM6 B;  4WP5 A;  1IV9 A;  4WYK A;  1IV7 A;  3EHC A;  1Q7H A;  2CWV A;  1LVN A;  4J8T A;  3G16 A;  4FR9 A;  3CPW 2;  1K8A 4;  1JZD A;  2HMO B;  5M19 A;  2QA4 3;  5JPP A;  5ELU A;  4GL6 A;  1MWS A;  3KFQ C;  3WOF B;  1BGS A;  2RSX A;  1IVV A;  1UGH I;  2Z7A A;  1GMR A;  2QIY A;  2W56 B;  1BVI A;  2Z76 A;  3OWY A;  4CCV A;  2GSP A;  4X2H A;  3VSY A;  3KE7 A;  4RNY A;  5HOH A;  1IVU A;  1VQ8 3;  2Q07 A;  4HOH A;  1O7P B;  1IDP A;  2F5M A;  2CFL A;  3NXJ A;  9RNT A;  2CHC A;  2D42 A;  1K9M 4;  1OHP A;  1QAF A;  1LNI A;  3N9H A;  4XM4 A;  1VQM 3;  1JNQ A;  3JUN A;  2K54 A;  2P09 A;  1RN4 A;  1RGE A;  3GSP A;  3ECF A;  4FMA A;  3NBB A;  3CCE 3;  1UUW B;  1Q7Y 4;  2BMR B;  1SIH A;  1RTU A;  3FG1 A;  3GAX A;  1IVW A;  4G1M B;  3LOY A;  3GZX B;  2Y73 A;  1B27 A;  1NDO B;  4HZ9 B;  2CWT A;  4NRE A;  1FYS A;  5AI1 A;  5G1L A;  3G4S 3;  3H51 A;  1M90 4;  4Q53 A;  3Q2P A;  4KZ1 A;  4BTW A;  3GRD A;  3M8C A;  2W6J H;  3J7Y d;  1JBS A;  2E2T A;  2H0G A;  3H3H A;  2CKF B;  4MMY B;  4WWU C;  2CG0 A;  2IUJ A;  3LTC A;  3B8L A;  3DUK A;  3STD A;  3OV4 A;  1OCV A;  2CFW A;  4STD A;  1BIR A;  2IYJ A;  1AR0 A;  1WMN A;  1WTH A;  2H0I A;  3FG3 A;  3F8X A;  3ZFZ A;  4BL3 A;  1WMP A;  1NU3 A;  1O7G B;  3MPH A;  4CPK A;  1HYF A;  1GY5 A;  3PCR A;  3KII A;  3X42 A;  2CW9 A;  3MG1 A;  1X1Y A;  1JB2 A;  3DGN A;  1FUS A;  1FUT A;  1RKY A;  1OF5 B;  1MWR A;  3KZT A;  1BNG A;  1UUG B;  3TDG A;  4FMD A;  5G2G A;  1EEJ A;  1I2F A;  1UW1 A;  2IUK A;  7GSP A;  5BIR A;  3LTD A;  1KQS 2;  1BSB A;  4H61 A;  1F8N A;  6RNT A;  4N6N B;  2RCD A;  2SBL A;  1DET A;  1N5P A;  3MG3 A;  1JJ2 2;  1U5O A;  3Q3F A;  1UGI A;  3MG2 A;  1UCL A;  4K1V A;  3CNM A;  1KWI A;  4XDW A;  2CFD A;  4J5G A;  8CHO A;  3DGM A;  5AII A;  1X1W A;  3ROB A;  2R4I A;  4CDL A;  1PY3 A;  1QVG 2;  1IQX A;  1GD3 A;  3IPT A;  5RNT A;  1I3F A;  4LGQ A;  3KKG A;  1VQO 3;  3N8B A;  3CCQ 3;  1ULI B;  4XBT A;  5D82 A;  5IEO A;  3ZG5 A;  1GD4 A;  1UDI I;  2Y74 A;  1CEW I;  1RDS A;  1BAN A;  1PYL A;  2B24 B;  5IG3 A;  2QGU A;  1B21 A;  3RDE A;  1A2P A;  3BNB A;  1UI7 A;  2FGT A;  2WOF A;  2BMO B;  4N6L A;  2AAD A;  4FCZ A;  2CX0 A;  2OQE A;  3V92 A;  1KC8 4;  1B2S A;  1EG9 B;  3T8U A;  1SJW A;  2W04 A;  2W56 A;  4HVN A;  1ISK A;  2OOV A;  1YJW 3;  1VQN 3;  3D79 A;  4N6V 0;  1B2X A;  1JBT A;  5HGR A;  1E97 A;  2D1W A;  2WO0 A;  3KCH A;  1BSC A;  3HK4 A;  2AAE A;  4J5K A;  1M1X B;  4WHA A;  4LEH A;  1RGG A;  2HOH A;  4KFF A;  3SOA A;  3FF0 A;  2OTJ 3;  1G0T A;  1GS3 A;  1JV2 B;  1US1 A;  1W6G A;  1LRA A;  1BOX A;  4OVM A;  4BTY A;  3EBT A;  2F4Y A;  3HZP A;  3X3Y A;  1LQG C;  1K73 4;  1Q40 B;  3OX9 A;  4KFD A;  4N6T A;  2OWP A;  2RFR A;  4IT7 A;  1UUV B;  1YNV X;  3HOH A;  2STD A;  2BU4 A;  3S28 A;  4BIR A;  1ZX2 A;  1W5Z A;  3VF1 A;  3MSO A;  2WOH A;  1ROV A;  5BXQ A;  1YIJ 3;  4HM0 B;  3B4P A;  4DKI A;  1LXE A;  2KCD A;  1E3V A;  4O02 B;  3I55 3;  5D81 A;  1TUH A;  2F99 A;  4J9A A;  1S72 3;  1X1U A;  3BND A;  5EQL A;  5DRE A;  1RCL A;  3CU3 A;  4EBG A;  3DGY A;  1OF5 A;  1E3R A;  3L0R A;  1IU7 A;  2BO9 B;  1BRN L;  1RNB A;  3BNC A;  2Z6B A;  3OXA A;  1RJO A;  3PZW A;  3UB1 A;  3S27 A;  4BU4 A;  3F40 A;  3LT9 A;  1BSD A;  2GEX A;  4KFE A;  3CC7 3;  1N9E A;  4OUQ A;  3AHS A;  1FGT A;  1RSN A;  3JVC A;  1WMO A;  3NBJ A;  5STD A;  4KT3 B;  2ZHX B;  5AEW B;  3WA3 A;  3SED A;  1T3B A;  1OHO A;  1BNJ A;  2KXG A;  1GY6 A;  3D3L A;  3LT8 A;  2E2V A;  3ALA A;  4HYZ A;  1IT8 A;  1STF I;  1WQL B;  4NPB A;  1BU4 A;  5GSP A;  2GBX B;  1BRJ A;  2XFT A;  1Z1S A;  1VQ5 3;  5KP3 A;  5A0O B;  3IJE B;  5EVH A;  1UI8 A;  2ZDJ A;  2KF5 A;  1K28 A;  4N6M A;  1TFO A;  2F86 B;  1YJN 3;  2P05 A;  5G1K A;  1W7C A;  1N8Q A;  1HZ1 A;  1MWT A;  4L8O A;  1GSP A;  2C4B A;  1T2H A;  4NHF A;  4N3V A;  1VZZ A;  1QVF 2;  2XFS A;  3EBY A;  1M1K 4;  5LC7 A;  3HI7 A;  3G0K A;  2R41 A;  3NQZ A;  1ROA A;  1Y4K A;  1YVB I;  2PNC A;  1OAC A;  2BT3 A;  2IY2 A;  1PU4 A;  3BU4 A;  5CF2 A;  5AEU B;  1CYV A;  1FGM A;  3FH1 A;  1KSI A;  2KF3 A;  3NQY A;  2HMN B;  3UL6 A;  1N9J A;  3SLU A;  1WNH A;  1V58 A;  1RRL A;  5AIH A;  4JF8 A;  2P0M A;  5IEP A;  3D9R A;  4RNT A;  1MOL A;  4XBX A;  2O9U X;  3AGN A;  2CK3 H;  3WDG B;  3OWU A;  3GZB A;  1GYB A;  3LYG A;  1JKG B;  1GMP A;  1BAO A;  4BL2 A;  1A90 A;  1ZGX A;  1YI2 3;  1O7W B;  1T5Y A;  4HM3 B;  1B2Z A;  1ULJ B;  3RGA A;  1Q40 A;  2C11 A;  3B7C A;  1Q82 4;  5JBS A;  1Q86 4;  3NM7 A;  2I9W A;  3WOD G;  1VQ9 3;  1TIJ A;  3A5E A;  1IYY A;  4R9K A;  5CXO A;  1W6C A;  1AVL A;  2CWU A;  2XR8 B;  1BRG A;  3F14 A;  3F9S A;  1YIT 3;  1RN1 A;  5BU4 A;  2F5W A;  3A76 A;  1AY7 A;  4FMB A;  4I4K A;  1VQQ A;  3Q90 A;  1RGK A;  4N6O B;  1V57 A;  1D6Y A;  1UCJ A;  3FGY A;  3EF8 A;  4HM7 B;  3CD6 3;  1I70 A;  1VQ4 3;  1B3S A;  1GMQ A;  4X2O A;  3KSP A;  1GOV A;  3EJV A;  3S29 A;  1AVK A;  3HII A;  4I5Q A;  5D83 A;  3SVA A;  1W2B 2;  1YGW A;  2HMM B;  4EXR A;  1GOY A;  5AIG A;  1JB5 A;  5KP4 A;  3X40 A;  4FCM A;  5KP1 A;  4GB5 A;  1X1X A;  1IVX A;  2KF6 A;  2XGN A;  1S5A A;  1TJD A;  1FGO A;  1QMA A;  2WGO A;  4WFO A;  4ILF A;  5IEN A;  1MNL A;  1OH0 A;  1Q81 4;  2A15 A; 
#chains in the Genus database with same CATH homology
 2WGQ A;  3U97 A;  1ASK A;  1LNH A;  1G96 A;  4K90 B;  1ZO2 A;  1U8C B;  2BHM A;  2JDI H;  3CCS 3;  4RZM A;  4XDV A;  1NB3 I;  3MYT A;  5IG4 A;  2GXF A;  1QJG A;  2GBW B;  3V99 A;  1D6Z A;  1DMN A;  1O7M B;  2CFG A;  4TX4 A;  3X3X A;  2K0M A;  3CC4 3;  2HMK B;  2INX A;  3N54 B;  1NB5 I;  1J2B A;  3FF2 A;  5FW5 A;  2CFK A;  4EC6 A;  2OTL 3;  3CCM 3;  2XSO B;  3OW2 2;  4MMX B;  3UJM A;  1V74 A;  3PYJ A;  5CK6 A;  2C10 A;  5BVB A;  4K61 A;  1M9G A;  5ELJ A;  2CG1 A;  3NUV A;  5IW9 A;  3MKI A;  5IER A;  3E99 A;  1CQS A;  3K7C A;  3JUO A;  3T8N A;  1FUW A;  1RRH A;  4HZB B;  4AEQ A;  3T0U A;  5TGN A;  2BMQ B;  3LH4 A;  3WMD A;  2RGQ A;  5CF1 A;  3BLZ A;  2IMJ A;  3F8H A;  3U1W A;  4O3V A;  3K0Z A;  1HU9 A;  1JKG A;  1EKM A;  2W2C A;  1N5H A;  3JUM A;  3LTA A;  3K5T A;  2GU1 A;  3PS8 A;  4JRF A;  1W2Z A;  4LZI A;  2PZV A;  1OGZ A;  5IG5 A;  5EEO A;  1STD A;  3DMC A;  2E2U A;  3CCR 3;  4IPB A;  3EN8 A;  3MWZ A;  3JUP A;  1N8R 4;  3X3Z A;  1W4N A;  4N6U A;  3HIG A;  1KD1 4;  3PCS A;  3MHE A;  1NWW A;  2HML B;  3PXM A;  4EV2 A;  5AYS C;  1NJI 4;  2XH9 A;  5IF6 A;  3CC2 3;  3BNE A;  4RBN A;  3SOY A;  3FCS B;  3HX8 A;  2W9P A;  2P38 A;  3F7S A;  4AKZ A;  4HM8 B;  1CYU A;  1VQ7 3;  2OQE C;  3WA2 X;  1MNL A;  2O3O A;  3LZA A;  1VQ6 3;  4EV5 A;  3DGL A;  1OPY A;  4HM5 B;  1A67 A;  2OOV C;  4L8P A;  3KN4 A;  1BUQ A;  1K41 A;  1W00 A;  3CXC 2;  1JN5 B;  4HM1 B;  1L5G B;  3GWR A;  3NV0 A;  2IA7 A;  3GZY B;  2XF3 A;  5AIF A;  1W02 A;  1FGQ A;  1QAL A;  3CNX A;  3FZW A;  2LQV A;  2GU3 A;  2OCT A;  3FG4 A;  4XB5 A;  2CC3 A;  5AYR B;  5IG0 A;  1DVC A;  2XRX B;  1EA2 A;  4U13 A;  4EYC A;  1W01 A;  3PGB A;  2FXT A;  3UNL A;  3SX1 A;  2MC8 A;  1GY7 A;  2XEP A;  3S67 A;  2W9Q A;  1HKX A;  2Z77 A;  3EN1 B;  4R9L A;  4H3U A;  1IK3 A;  1VQL 3;  3EC9 A;  1RN7 A;  3G71 3;  4LMI A;  4O2H A;  1C7H A;  2L4V A;  3ER7 A;  3F7X A;  1SII A;  4WYK B;  4R1K A;  4QWT A;  3RGR A;  2YFI B;  3EE1 A;  1TU5 A;  3EX9 A;  1YGE A;  2CH9 A;  3EQQ B;  2YX9 A;  1YHQ 3;  3BB9 A;  4KVH A;  3X41 A;  7STD A;  2P0X A;  1QAK A;  1TFK A;  1TP6 A;  2XGL A;  3K63 A;  1D6U A;  4XBY A;  3V98 A;  3CCU 3;  4HM2 B;  5DRV A;  3QRD A;  3DGO A;  3CMA 3;  3CME 3;  1FA3 A;  3IMA B;  2QEX 3;  3AMO A;  3NBR A;  4R80 A;  3EB8 A;  3DXO A;  1Q42 A;  5LC6 A;  1YJ9 3;  3NV0 B;  2KRT A;  3FLJ A;  4BTX A;  5CLK A;  2ML6 A;  4HBR A;  3G6E 3;  2F98 A;  1DMM A;  3G8Z A;  2W03 A;  2CIU A;  1VQP 3;  3GZR A;  4HM4 B;  1W6Y A;  3NX0 A;  4FMC A;  4LSO A;  3I0Y A;  2GEY A;  1SPU A;  4RNZ A;  1R4C A;  4ZM8 A;  2UX0 A;  1DYU A;  3Q1C A;  1JRQ A;  3DY5 A;  3DM8 A;  4AKY A;  1O7N B;  3LXU X;  1O7H B;  3K9M C;  1SQW A;  3UL5 A;  3LML A;  4MJD A;  2FNQ A;  2XSH B;  3QK9 A;  6STD A;  3LTB A;  1IT7 A;  3CCV 3;  2BNG A;  1JN5 A;  4MMZ B;  4K1U A;  1DMQ A;  4MEI A;  2HMJ B;  2ML5 A;  4O8S A;  3NHX A;  1IQ8 A;  2JQ5 A;  4IIA A;  3CPO A;  4R4K A;  1LOX A;  4OK0 A;  3CCL 3;  2B1X B;  4L7K A;  1DVD A;  1A2V A;  1A2K A;  3B4O A;  2ZL8 A;  5FGO A;  1EQK A;  3FSD A;  3I56 3;  3CCJ 3;  2V1L A;  1JB4 A;  2W0Q A;  4HJL B;  3O8Y A;  5JPU A;  1FGR A;  1OUN A;  3DZL A;  3SXX A;  1VQK 3;  2YFJ B;  2MF7 A;  5I97 A;  3OWS A;  4HKV B;  1OHS A;  3S5C A;  1NO3 A;  3AMO B;  1IQY A;  1PFP A;  3FKA A;  1AV4 A;  2M7O A;  3NM2 A;  3VGN A;  2YFL B;  3WOE B;  3JUQ A;  3KSE D;  4FCJ A;  1OGX A;  4ORL A;  4PEJ A;  4WP5 A;  4HM6 B;  4WYK A;  1IV9 A;  1IV7 A;  3EHC A;  2CWV A;  1LVN A;  4J8T A;  3G16 A;  4FR9 A;  3CPW 2;  1K8A 4;  2HMO B;  2QA4 3;  5JPP A;  5ELU A;  4GL6 A;  3KFQ C;  3WOF B;  2RSX A;  1IVV A;  2Z7A A;  2W56 B;  2QIY A;  2Z76 A;  3OWY A;  4CCV A;  4X2H A;  3VSY A;  3KE7 A;  4RNY A;  1VQ8 3;  1IVU A;  2Q07 A;  1O7P B;  1IDP A;  2CFL A;  3NXJ A;  2CHC A;  2D42 A;  1OHP A;  1QAF A;  3N9H A;  4XM4 A;  1VQM 3;  1JNQ A;  3JUN A;  2K54 A;  2P09 A;  4FMA A;  3ECF A;  3NBB A;  3CCE 3;  1UUW B;  1Q7Y 4;  2BMR B;  1SIH A;  3FG1 A;  3GAX A;  1IVW A;  4G1M B;  3LOY A;  3GZX B;  2Y73 A;  1NDO B;  4HZ9 B;  4NRE A;  2CWT A;  1M90 4;  5AI1 A;  3G4S 3;  3H51 A;  4Q53 A;  3Q2P A;  4KZ1 A;  4BTW A;  3GRD A;  3M8C A;  2W6J H;  3J7Y d;  2E2T A;  3H3H A;  2CKF B;  4MMY B;  4WWU C;  2CG0 A;  2IUJ A;  3LTC A;  3B8L A;  3DUK A;  3STD A;  3OV4 A;  1OCV A;  2CFW A;  4STD A;  1AR0 A;  1WMN A;  1WTH A;  3FG3 A;  3F8X A;  1WMP A;  1NU3 A;  1O7G B;  3MPH A;  1GY5 A;  3PCR A;  3KII A;  3X42 A;  2CW9 A;  3MG1 A;  1JB2 A;  3DGN A;  1RKY A;  1OF5 B;  3KZT A;  3TDG A;  4FMD A;  5G2G A;  1UW1 A;  2IUK A;  1KQS 2;  3LTD A;  4H61 A;  1F8N A;  4N6N B;  2RCD A;  2SBL A;  3MG3 A;  1N5P A;  1JJ2 2;  1U5O A;  3MG2 A;  4K1V A;  3CNM A;  1KWI A;  4XDW A;  2CFD A;  8CHO A;  3DGM A;  5AII A;  3ROB A;  2R4I A;  4CDL A;  1QVG 2;  1IQX A;  1GD3 A;  3IPT A;  1VQO 3;  4LGQ A;  3KKG A;  3N8B A;  3CCQ 3;  1ULI B;  4XBT A;  5D82 A;  5IEO A;  1GD4 A;  2Y74 A;  1CEW I;  5IG3 A;  2B24 B;  2QGU A;  3RDE A;  3BNB A;  1UI7 A;  2FGT A;  2WOF A;  2BMO B;  4N6L A;  4FCZ A;  1KC8 4;  2OQE A;  3V92 A;  1EG9 B;  3T8U A;  1SJW A;  2W04 A;  2W56 A;  4HVN A;  1ISK A;  2OOV A;  1YJW 3;  1VQN 3;  4N6V 0;  5HGR A;  1E97 A;  2D1W A;  2WO0 A;  3HK4 A;  1M1X B;  4WHA A;  4LEH A;  4KFF A;  3SOA A;  3FF0 A;  2OTJ 3;  1GS3 A;  1US1 A;  1JV2 B;  1W6G A;  4OVM A;  4BTY A;  3EBT A;  3HZP A;  3X3Y A;  1K73 4;  1Q40 B;  3OX9 A;  4KFD A;  4N6T A;  2OWP A;  2RFR A;  4IT7 A;  1UUV B;  2STD A;  3S28 A;  1ZX2 A;  1W5Z A;  3VF1 A;  3MSO A;  2WOH A;  1ROV A;  5BXQ A;  1YIJ 3;  4HM0 B;  3B4P A;  1LXE A;  2KCD A;  1E3V A;  4O02 B;  3I55 3;  5D81 A;  1TUH A;  2F99 A;  4J9A A;  1S72 3;  3BND A;  5EQL A;  5DRE A;  3CU3 A;  4EBG A;  3L0R A;  1OF5 A;  1E3R A;  1IU7 A;  2BO9 B;  3BNC A;  2Z6B A;  3OXA A;  1RJO A;  3PZW A;  3UB1 A;  3S27 A;  3F40 A;  3LT9 A;  2GEX A;  4KFE A;  3CC7 3;  1N9E A;  4OUQ A;  1FGT A;  5STD A;  3JVC A;  1WMO A;  3NBJ A;  3WA3 A;  5AEW B;  3SED A;  1OHO A;  3D3L A;  2KXG A;  1GY6 A;  3LT8 A;  2E2V A;  3ALA A;  4HYZ A;  1IT8 A;  1STF I;  1WQL B;  2GBX B;  2XFT A;  1VQ5 3;  1Z1S A;  5KP3 A;  5A0O B;  3IJE B;  5EVH A;  1UI8 A;  2ZDJ A;  4N6M A;  1K28 A;  1TFO A;  2F86 B;  1YJN 3;  2P05 A;  1W7C A;  1N8Q A;  4L8O A;  4NHF A;  4N3V A;  1VZZ A;  1QVF 2;  2XFS A;  3EBY A;  1M1K 4;  5LC7 A;  3HI7 A;  3G0K A;  3NQZ A;  1ROA A;  1Y4K A;  1YVB I;  2PNC A;  1OAC A;  2BT3 A;  1PU4 A;  5CF2 A;  5AEU B;  1CYV A;  1FGM A;  3FH1 A;  1KSI A;  3NQY A;  2HMN B;  3UL6 A;  1N9J A;  3SLU A;  1WNH A;  1RRL A;  5AIH A;  4JF8 A;  2P0M A;  5IEP A;  3D9R A;  1MOL A;  4XBX A;  2O9U X;  2CK3 H;  3WDG B;  3OWU A;  3GZB A;  1GYB A;  3LYG A;  1JKG B;  1A90 A;  1YI2 3;  1O7W B;  1T5Y A;  4HM3 B;  1ULJ B;  3RGA A;  1Q40 A;  2C11 A;  3B7C A;  1Q82 4;  5JBS A;  1Q86 4;  3NM7 A;  2I9W A;  3WOD G;  1VQ9 3;  1TIJ A;  4R9K A;  5CXO A;  1W6C A;  1AVL A;  2CWU A;  2XR8 B;  3F14 A;  3F9S A;  1YIT 3;  3A76 A;  4FMB A;  4I4K A;  3Q90 A;  4N6O B;  1D6Y A;  3FGY A;  3EF8 A;  4HM7 B;  3CD6 3;  1VQ4 3;  4X2O A;  3KSP A;  3EJV A;  3S29 A;  1AVK A;  3HII A;  5D83 A;  3SVA A;  1W2B 2;  2HMM B;  4EXR A;  5AIG A;  1JB5 A;  5KP4 A;  3X40 A;  4FCM A;  5KP1 A;  4GB5 A;  2XGN A;  1IVX A;  4WFO A;  1S5A A;  2WGO A;  1FGO A;  1QMA A;  5IEN A;  1Q81 4;  2LYX A;  1OH0 A;  1K9M 4;  2A15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...