3EBYA

Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
153
Chain Sequence
b'EVAQVAQSAIDDFNAAYGLCLDDDRLEQWPTLFVDDCLYQVIARENVDNGLPAAVMYCDSKGMLADRVVALRKANHFNRHLIGRAVITGVEGDQVSAEASYVVFQTRNDGETRIYNAGKYVDRFDLSGGTVRLKSRTCIYDTLRIATLLATPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta subunit of a putative Aromatic-ring-hydroxylating dioxy
publication title Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Structural genomics, unknown function
total genus 47
structure length 153
sequence length 157
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ebyA00
2XSOB 4J9AA 1OGZA 4HM8B 3K7CA 1A2KA 3WMDA 2W2CA 2F86B 5D81A 6STDA 3JUOA 4OVMA 5FW5A 4CDLA 5CF2A 5IEPA 4HM6B 5JPUA 3OWYA 4PEJA 4XBYA 5IENA 1IDPA 1AR0A 3F14A 3MYTA 4Q53A 4X2HA 2CHCA 1QMAA 2JQ5A 4OUQA 4X2OA 1JB4A 2HMNB 3EN1B 1BUQA 1Z1SA 1U5OA 1Q42A 1ZX2A 3STDA 2HMOB 8CHOA 2B24B 1OHPA 3RGRA 3NUVA 5IG3A 3CU3A 2STDA 2Z77A 3MSOA 4L8OA 3M8CA 5CLKA 2K54A 3VSYA 3OX9A 3EF8A 3NXJA 3FF2A 4R9LA 3F8HA 3UJMA 1TP6A 3K0ZA 3NBRA 4HM4B 4HM3B 3T8UA 2QGUA 5IF6A 4HM2B 1ULJB 3MKIA 4HZBB 5CK6A 1W02A 4L7KA 4HM5B 2GBWB 4K1UA 4ORLA 5IERA 3JUQA 5G2GA 4RZMA 1GY5A 2IMJA 2YFIB 5IG0A 2R4IA 3B7CA 1E3RA 2RCDA 1OF5A 1O7MB 2HMKB 1OCVA 1ISKA 3JUNA 3FSDA 3EBYA 2INXA 3ECFA 2BNGA 1EG9B 2XR8B 3F9SA 2Z76A 3DZLA 3H51A 2XRXB 5CXOA 1UUVB 3T8NA 1E97A 1JN5B 1C7HA 3G8ZA 1OF5B 1ULIB 3DXOA 2HMMB 5STDA 3SEDA 5D82A 4I4KA 1S5AA 4HKVB 3EX9A 1OHOA 3H3HA 3JUMA 2B1XB 3EHCA 3G0KA 1O7PB 4HM7B 1O7NB 3NV0A 3I0YA 1JB2A 2GEYA 3MG2A 2BMQB 3LYGA 1O7GB 4XDVA 4WWUC 4MJDA 3E99A 2XSHB 4H3UA 5IG4A 1GYBA 3S5CA 3A76A 5BXQA 1SJWA 3Q90A 5KP4A 3KZTA 2RGQA 3GRDA 3CNXA 3VGNA 4J8TA 4HJLB 4WYKA 1Q40A 4R9KA 4XM4A 4R1KA 3CNMA 1TUHA 3GWRA 1O7HB 4LEHA 5AEWB 2YFJB 2UX0A 3EN8A 5DRVA 1WQLB 3OWSA 4N3VA 1EA2A 3D9RA 3KSPA 3GZBA 4K1VA 1OH0A 2RFRA 4WP5A 1OPYA 1HKXA 1QJGA 4XBXA 5AIIA 3HZPA 3FKAA 3IPTA 2F99A 3F8XA 2F98A 3HX8A 2GBXB 2QIYA 3SOYA 5TGNA 1OGXA 1OUNA 3ER7A 3EBTA 4HVNA 2GEXA 3FH1A 3MG3A 1CQSA 4GB5A 3EQQB 3UNLA 4HM0B 3MG1A 5AIGA 5JPPA 4HZ9B 1JKGA 3OV4A 1GS3A 5IG5A 7STDA 5HGRA 4XB5A 5BVBA 3GZRA 1W01A 1STDA 1DMQA 4HM1B 4FCJA 1ASKA 5EVHA 3KKGA 3B4PA 1JKGB 3MHEA 2A15A 3DUKA 4KVHA 2HMLB 1NWWA 1UUWB 3HK4A 5CF1A 1E3VA 3NV0B 4U13A 1ZO2A 1VZZA 5AIFA 1DMMA 3G16A 4XBTA 4XDWA 4IIAA 4LGQA 3F7SA 1W6YA 3BB9A 3DMCA 3B8LA 2PZVA 3EC9A 2YFLB 3GZYB 1NDOB 3NM2A 3BLZA 3NHXA 5IEOA 2OWPA 3OXAA 1O7WB 5KP1A 2I9WA 3F40A 5AEUB 2BMRB 5AIHA 4WYKB 3FZWA 1Q40B 2GXFA 3FLJA 4L8PA 1NU3A 2CKFB 3EJVA 5D83A 4FCMA 3FGYA 1GY7A 3JUPA 4STDA 1GY6A 3F7XA 3ROBA 2BMOB 1W00A 1JB5A 3LZAA 3SOAA 5AI1A 3B4OA 5DREA 3RGAA 1K41A 5KP3A 2Z7AA 1OHSA 3OWUA 1JN5A 3GZXB 3FF0A 2HMJB 3CPOA 1DMNA 4LMIA 3DM8A 3KE7A
chains in the Genus database with same CATH superfamily
1I0VA 3CCL3 2XSOB 3X41A 2SBLA 3FCSB 3NBBA 3G713 4HAAA 1W5ZA 4J9AA 1OGZA 1JJ22 1UCKA 1B2SA 4HM8B 3IMAB 3GSPA 3LXUX 3K7CA 3PS8A 1BRIA 4LYLB 3NX0A 1A2KA 3WMDA 1IT7A 2W2CA 2XFSA 2F86B 2CG1A 1ROVA 3QK9A 1KSIA 5D81A 2QA43 1K734 1IQ8A 6STDA 2GU1A 3JUOA 1N9JA 4OVMA 1Q824 3S28A 4FMCA 3HIGA 2CX0A 5FW5A 2O9UX 3ZG5A 4CDLA 5CF2A 3LTAA 5LC6A 4HM6B 5IEPA 5JPUA 3D5GA 2XEPA 3ZG0A 3OWYA 4PEJA 5LC7A 3G4S3 2CH9A 4XBYA 1FW7A 5IENA 1IDPA 4CJNA 1AR0A 1LOYA 3F14A 1FGMA 4AEQA 3MYTA 4Q53A 1BANA 4X2HA 3D4AA 1SQWA 2CHCA 2LQVA 1RN1A 2F5WA 2L1SA 3Q2PA 1UCIA 1KC84 1BOXA 1LVNA 1QMAA 2QEX3 3CXC2 2JQ5A 2CG0A 1I2EA 1PYLA 3KIIA 4OUQA 4X2OA 1GOYA 1JB4A 2HMNB 3EN1B 1BUQA 5RNTA 1I2GA 1U8CB 1Z1SA 1JBTA 2CK3H 2R41A 3CCJ3 1K8A4 1CYVA 1U5OA 1Q42A 3LTDA 4I5QA 1X1XA 3S27A 1RTUA 4H61A 1ZX2A 3WA3A 1B2ZA 2WOHA 3STDA 3NM7A 2HMOB 1TFKA 8CHOA 2B24B 4NREA 1YJN3 2IY2A 1L5GB 2W6JH 1N8QA 1BNSA 1OHPA 1IK3A 3RGRA 1RDSA 3NUVA 1IQYA 5IG3A 3CU3A 2STDA 2Z77A 3MSOA 4L8OA 3SYUA 3CCE3 1ZS7A 3K63A 5ELJA 4O2HA 1NB5I 2BIRA 4WFOA 3M8CA 2KF6A 5CLKA 2K54A 2W9PA 2MC8A 1PFPA 1GOUA 2JDIH 3OX9A 3VSYA 1D6ZA 1S723 1RGLA 3EF8A 5FGOA 1N8R4 3NXJA 3FF2A 3UL6A 3MWZA 2KCDA 1BSCA 1DYUA 3F8HA 4GSPA 4O8SA 4R9LA 5EQLA 3UJMA 1MWSA 1TP6A 3T0UA 3K0ZA 1M9GA 3ALAA 3NBRA 4QWTA 4HM4B 4HM3B 3T8UA 1V74A 3MPHA 2QGUA 3SXXA 1YJ93 1G02A 1GD3A 1STFI 1IVUA 3NBJA 5IF6A 4HM2B 1ULJB 3PZWA 3MKIA 1IU7A 1IYYA 4HZBB 5CK6A 3LOYA 1LNIA 4RNTA 1W02A 4L7KA 4HM5B 1JBSA 3WHOA 1Q7HA 1IVXA 2KF3A 3Q1CA 2Y74A 4NHFA 5M18A 2GBWB 4K1UA 1RRHA 4ORLA 1JZDA 4MMYB 5IW9A 5IERA 1LNHA 1WMNA 3AGOA 3AMOA 1B3SA 3JUQA 4HOHA 5G2GA 1RNBA 1LQGC 4BTYA 3WOEB 1IV7A 4RZMA 3U1WA 1RGCA 5HOHA 1AV4A 1GY5A 2IMJA 2BHMA 5EEOA 2YFIB 5IG0A 2R4IA 3B7CA 1VQ63 3AHWA 3CD63 1E3RA 2W56A 1AVLA 3KCHA 4BL2A 1M1K4 1UDII 3CCM3 2RCDA 1OF5A 2P05A 1FGQA 1GMRA 3V99A 1FGTA 3A5EA 1O7MB 1SPUA 1OCVA 2HMKB 3D5IA 3S29A 3JUNA 1ISKA 3FSDA 4FMAA 3EBYA 4ZM8A 2INXA 3UL5A 3ECFA 3AMOB 1FUWA 2BNGA 1EG9B 2CFLA 3PCSA 2AAEA 3V98A 2ML5A 2XR8B 2KF5A 3F9SA 2Z76A 3DZLA 3H51A 2XRXB 5CXOA 1UUVB 1YIJ3 1A2VA 1EUIC 3T8NA 1E97A 2H0GA 2W56B 1D6YA 3EE1A 4J5GA 5I97A 4BIRA 1YHQ3 3K5TA 3BIRA 3S67A 5M19A 1JN5B 1C7HA 3G8ZA 1RLSA 4EW5A 3CC43 1OF5B 3SVAA 1ULIB 1IQXA 1KD14 3DXOA 1GMQA 1UCJA 2HMMB 1TTOA 3PXMA 5M1AA 5STDA 2RSXA 4ILFA 3N8BA 3SEDA 1T5YA 5D82A 4I4KA 1BNEA 1S5AA 3ZFZA 4HKVB 3EX9A 1OHOA 3CCU3 3H3HA 3JUMA 1RCKA 3PCRA 1PY3A 2B1XB 3EHCA 3AGNA 3G0KA 3CME3 4G1MB 1O7PB 4N6V0 4HM7B 1QALA 2BT3A 1O7NB 3NV0A 1HYFA 3I0YA 1JB2A 1F8NA 4WHAA 1VQL3 2GEYA 3N9HA 4AKZA 3MG2A 2BMQB 3LYGA 1O7GB 1YGWA 4HYZA 4XDVA 3U97A 2W0QA 1BRKA 1RGAA 1GD4A 1V57A 4WWUC 2C4BA 4MJDA 2UUGC 2V1LA 3E99A 2XSHB 1VQ73 2F56A 4N6TA 1CYUA 3X3YA 4H3UA 1RGKA 1VQQA 2PNCA 4FR9A 3RDEA 3URPA 1JRQA 5IG4A 4MEIA 3I563 2WO0A 4FMDA 1GYBA 1NO3A 4N6OB 1FGOA 1BNJA 1ZGXA 4LZIA 3A76A 3S5CA 4EC6A 1T2IA 5BXQA 1SJWA 2W9QA 1Q9EA 3GAXA 4GHOA 1DVDA 2F4YA 3Q90A 3CC73 7GSPA 1KWIA 5KP4A 1UGIA 4IPBA 2Z6BA 3DGLA 3KZTA 2H0IA 1AQZA 1V58A 4O02B 2CWUA 1IV9A 2O3OA 2OQEA 3DH2A 2RGQA 1DE3A 2WGQA 3GRDA 1MWTA 3CCR3 1A2PA 1BRJA 1W4NA 5AYRB 3CNXA 2HOHA 3VGNA 4FMBA 4N6MA 1T2HA 2M7OA 1BRGA 2FNQA 4J8TA 6RNTA 1MGWA 4HJLB 4WYKA 1Q40A 3BU4A 5JBSA 3L0RA 4R9KA 1M1XB 2H0HA 3JVCA 4XM4A 1LOWA 2J8XB 1C54A 4R1KA 1BUJA 3OW22 4K61A 2E2UA 3CNMA 1YVSA 2CFGA 1Q864 4KFEA 1BNGA 1TUHA 2WGOA 3GWRA 3PGBA 4K90B 1O7HB 4NPBA 1TIJA 2OOVA 3DY5A 4LEHA 5AEWB 1LOXA 2YFJB 1VQ93 2UX0A 4TX4A 1W6GA 3EN8A 5DRVA 3V92A 1X1WA 1BNIA 1WQLB 2P0MA 3OWSA 4N3VA 3CCS3 1DETA 4MMXB 1I8VA 3CCQ3 1W2ZA 1EA2A 1JV2B 2IA7A 1TU5A 3Q3FA 3D9RA 3KSPA 3GZBA 4K1VA 1JZOA 3LT8A 1OH0A 1N5HA 4FCZA 4BTWA 1BRSA 2RFRA 1B27A 4WP5A 2BO9B 1I70A 1OPYA 2FGTA 1AVKA 2RNTA 1YVBI 3KSED 3HI7A 3AHSA 1HKXA 1WNHA 2D42A 1BSBA 1QJGA 1BVIA 3N54B 4XBXA 3J7Yd 1VQ53 1J2BA 5AIIA 1SARA 1UW1A 2IUKA 3HZPA 1AY7A 1RSNA 3FKAA 1B2MA 3IPTA 1YJW3 2E2VA 3WODG 1FYSA 1LRAA 4N6NB 2F99A 3F8XA 2AADA 1SIIA 2YX9A 1I2FA 1QAFA 2F98A 3DGOA 3HX8A 1RN4A 1M904 2GBXB 2LYXA 2QIYA 3SOYA 2KF4A 1RCLA 5G1LA 5TGNA 3LTBA 1HZ1A 1BIRA 1OGXA 1OUNA 6GSPA 4BTXA 2KAAA 1LOVA 1BRNL 1B2UA 5BU4A 3I553 3ER7A 1FGRA 2SARA 3EBTA 3KN4A 4KFDA 4OK0A 4HVNA 1TFOA 1DVCA 2GEXA 3FH1A 1US1A 1N5PA 2Y73A 2XGLA 1OACA 1UI7A 1B2XA 1CQSA 1MOLA 1I0XA 2GSPA 3LMLA 3MG3A 3EQQB 4GB5A 2KXGA 4J5KA 2F5MA 1I3IA 3FG3A 3UNLA 4HM0B 1RGEA 1A67A 1YNVX 3MG1A 1BRHA 1K9M4 3X40A 5AIGA 5JPPA 4HZ9B 1JKGA 2RBIA 1GS3A 3BNBA 3BNCA 3OV4A 2ZL8A 7STDA 5IG5A 1RNTA 3LH4A 5HGRA 1G96A 3NQYA 2WOFA 4XB5A 5BVBA 3GZRA 4DKIA 1W01A 1STDA 1MWUA 1DMQA 2K3DA 3EB8A 1FUSA 1UGHI 4HM1B 7RNTA 2CC3A 1RRLA 4FCJA 1WTHA 1ASKA 4AKYA 2GU3A 2CFWA 3PYJA 4HBRA 1Q7Y4 5EVHA 1NNVA 2CFDA 4LSOA 5ELUA 5GSPA 1EKMA 3KKGA 1GSPA 3HIIA 3WR2A 1MNLA 3B4PA 3CC23 3NQZA 4R4KA 2FXTA 2CW9A 1JKGB 1RN7A 1UCLA 3MHEA 2ZDJA 2A15A 2CWTA 3FG4A 1KQS2 3DUKA 4R80A 4RNYA 1BU4A 2CIUA 4KVHA 2HMLB 1NWWA 1R4CA 1UUWB 3HK4A 5AYSC 1VQ43 1BSEA 3BNEA 1BSAA 2IYJA 3IJEB 2XH9A 5CF1A 1E3VA 1W7CA 3WA2X 2C11A 2OTL3 1TRQA 1YGEA 1RJOA 2MF7A 3NV0B 4U13A 3D79A 1ZO2A 1QVG2 1VZZA 4KZ1A 1X1YA 3X3ZA 1Y4KA 5AIFA 1DMMA 3DGYA 3G16A 4XBTA 4XDWA 4IIAA 4EXRA 3BNDA 4LGQA 2KRTA 3F7SA 2OTJ3 1A90A 1T3BA 1EQKA 3O8YA 1BNRA 1RKYA 1W6YA 4EV5A 3BB9A 3DGNA 3DMCA 1HU9A 3DGMA 1W2B2 3LT9A 2XGNA 1TRPA 3B8LA 1UUGB 2ML6A 1X1UA 3X3XA 2PZVA 3EC9A 2YFLB 3TDGA 2IUJA 4MMZB 4KT3B 3GZYB 1FZUA 5G1KA 1NB3I 2E2TA 1RGGA 4JF8A 4N6UA 1NDOB 3NM2A 1IVWA 3CPW2 1NJI4 3BLZA 3NHXA 1MWRA 1QVF2 5IEOA 2OWPA 4EBGA 3OXAA 1O7WB 1TJDA 1FA3A 2CWVA 4BL3A 4GL6A 1R4YA 1SIHA 2L4VA 2XFTA 1FUTA 4JRFA 1VQO3 4IT7A 5KP1A 1JBRA 4CPKA 1LQMB 2I9WA 1BGSA 3K9MC 3F40A 5AEUB 2BMRB 5AIHA 4WYKB 3FZWA 1Q40B 2C10A 1CEWI 2GXFA 8RNTA 4RBNA 1LXEA 3FLJA 4BU4A 2OQEC 4O3VA 4L8PA 3RNTA 1NU3A 1BAOA 2CKFB 3EJVA 5D83A 1GMPA 3D3LA 3FGYA 1WMOA 1GY7A 1N9EA 1ROAA 4FCMA 3SX1A 5A0OB 1PU4A 3G6E3 1VQ83 3CMA3 1QAKA 3SLUA 1RGFA 1UI8A 2ZHXB 1EEJA 2XF3A 3JUPA 9RNTA 2K0MA 3KFQC 2W04A 4KFFA 1G0TA 4RNZA 1GOVA 1IVVA 3VF1A 4STDA 1GY6A 3F7XA 1MGRA 3UB1A 3ROBA 2BMOB 1BNFA 1W00A 3QRDA 1VQP3 2CFKA 2OOVC 1WMPA 4EYCA 1I3FA 1BSDA 1JB5A 3LZAA 4N6LA 2BU4A 3SOAA 2P38A 2Q07A 2W03A 5AI1A 3FG1A 3B4OA 3WDGB 2CX1A 1YIT3 5DREA 1RHLA 3X42A 1VQN3 3LTCA 3RGAA 5BIRA 2ZA4A 2D1WA 1D6UA 1K41A 4EV2A 1B20A 5KP3A 1RMSA 1W6CA 3CCV3 1YI23 1K28A 2OCTA 2Z7AA 3HOHA 1OHSA 3OWUA 1JN5A 1Q814 3GZXB 1JNQA 2UGIA 1B21A 3WOFB 1VQM3 3FF0A 2HMJB 4CCVA 3CPOA 1DMNA 4LMIA 1CH0A 3DM8A 3KE7A 1IT8A 1RGHA 2P0XA 1VQK3 2P09A
chains in the Genus database with same CATH topology
3CCL3 2XSOB 3X41A 2SBLA 3FCSB 3NBBA 3G713 4J9AA 1W5ZA 1OGZA 1JJ22 4HM8B 3IMAB 3LXUX 3K7CA 3PS8A 3NX0A 1A2KA 3WMDA 1IT7A 2W2CA 2XFSA 2F86B 2CG1A 1ROVA 3QK9A 1KSIA 5D81A 2QA43 1K734 1IQ8A 6STDA 2GU1A 3JUOA 1N9JA 4OVMA 1Q824 3S28A 4FMCA 3HIGA 5FW5A 2O9UX 4CDLA 5CF2A 5IEPA 3LTAA 5LC6A 4HM6B 5JPUA 2XEPA 3OWYA 4PEJA 5LC7A 3G4S3 2CH9A 4XBYA 5IENA 1IDPA 1AR0A 3F14A 1FGMA 4AEQA 3MYTA 4Q53A 4X2HA 1SQWA 2CHCA 2LQVA 3Q2PA 1KC84 1LVNA 1QMAA 2QEX3 3CXC2 2JQ5A 2CG0A 3KIIA 4OUQA 4X2OA 1JB4A 2HMNB 3EN1B 1BUQA 1Z1SA 1U8CB 2CK3H 3CCJ3 1K8A4 1CYVA 1U5OA 1Q42A 3LTDA 3S27A 4H61A 1ZX2A 3WA3A 2WOHA 3STDA 3NM7A 2HMOB 1TFKA 8CHOA 2B24B 4NREA 1YJN3 1L5GB 2W6JH 1N8QA 1OHPA 1IK3A 3RGRA 3NUVA 1IQYA 5IG3A 3CU3A 2STDA 2Z77A 3MSOA 4L8OA 3CCE3 3K63A 5ELJA 4O2HA 1NB5I 4WFOA 3M8CA 5CLKA 2K54A 2W9PA 2MC8A 1PFPA 2JDIH 3VSYA 3OX9A 1S723 1D6ZA 3EF8A 5FGOA 1N8R4 3NXJA 3FF2A 3UL6A 3MWZA 2KCDA 4R9LA 1DYUA 3F8HA 4O8SA 5EQLA 3UJMA 1TP6A 3T0UA 3K0ZA 1M9GA 3ALAA 3NBRA 4QWTA 4HM4B 4HM3B 3T8UA 1V74A 3MPHA 2QGUA 3SXXA 1YJ93 1GD3A 1STFI 1IVUA 3NBJA 5IF6A 4HM2B 1ULJB 3PZWA 3MKIA 1IU7A 4HZBB 5CK6A 3LOYA 1W02A 4L7KA 4HM5B 1IVXA 3J7Yd 3Q1CA 2Y74A 4NHFA 2GBWB 4K1UA 1RRHA 4ORLA 4MMYB 5IW9A 5IERA 1LNHA 1WMNA 3AMOA 3JUQA 5G2GA 4BTYA 3WOEB 1IV7A 4RZMA 3U1WA 1AV4A 1GY5A 2IMJA 2BHMA 5EEOA 2YFIB 5IG0A 2R4IA 3B7CA 1VQ63 3CD63 1E3RA 2W56A 1AVLA 1M1K4 3CCM3 2RCDA 1OF5A 2P05A 1FGQA 3V99A 1FGTA 1O7MB 1SPUA 1OCVA 2HMKB 3S29A 1ISKA 3JUNA 3FSDA 4FMAA 3EBYA 4ZM8A 2INXA 3UL5A 3ECFA 3AMOB 1FUWA 2BNGA 1EG9B 2CFLA 3PCSA 3V98A 2ML5A 2XR8B 3F9SA 2Z76A 3DZLA 3H51A 2XRXB 5CXOA 1UUVB 1YIJ3 1A2VA 3T8NA 1E97A 3EE1A 2W56B 1D6YA 5I97A 1YHQ3 3K5TA 3S67A 1JN5B 1C7HA 3G8ZA 3CC43 1OF5B 3SVAA 1ULIB 1IQXA 1KD14 3DXOA 2HMMB 3PXMA 5STDA 2RSXA 3N8BA 3SEDA 1T5YA 5D82A 4I4KA 1S5AA 4HKVB 3EX9A 1OHOA 3CCU3 3H3HA 3JUMA 3PCRA 2B1XB 3EHCA 3G0KA 3CME3 4G1MB 1O7PB 4N6V0 4HM7B 1QALA 2BT3A 1O7NB 3NV0A 3I0YA 1JB2A 1F8NA 4WHAA 1VQL3 2GEYA 3N9HA 4AKZA 3MG2A 2BMQB 3LYGA 1O7GB 4HYZA 4XDVA 3U97A 2W0QA 1GD4A 4WWUC 4MJDA 2V1LA 3E99A 2XSHB 1VQ73 4N6TA 1CYUA 3X3YA 4H3UA 2PNCA 3RDEA 4FR9A 3I563 1JRQA 5IG4A 4MEIA 2WO0A 4FMDA 1GYBA 1NO3A 4N6OB 1FGOA 4LZIA 3S5CA 4EC6A 3A76A 5BXQA 1SJWA 2W9QA 1DVDA 3GAXA 3Q90A 3CC73 1KWIA 5KP4A 4IPBA 2Z6BA 3DGLA 3KZTA 4O02B 2CWUA 1IV9A 2O3OA 2OQEA 2RGQA 2WGQA 3GRDA 3CCR3 1W4NA 5AYRB 3CNXA 3VGNA 4FMBA 4N6MA 2M7OA 2FNQA 4J8TA 4HJLB 4WYKA 1Q40A 5JBSA 3L0RA 4R9KA 1M1XB 3JVCA 4XM4A 4R1KA 3OW22 4K61A 2E2UA 3CNMA 2CFGA 1Q864 4KFEA 1TUHA 2WGOA 3GWRA 3PGBA 4K90B 1O7HB 1TIJA 2OOVA 3DY5A 4LEHA 5AEWB 1LOXA 2YFJB 1VQ93 2UX0A 4TX4A 1W6GA 3EN8A 5DRVA 3V92A 1WQLB 2P0MA 3OWSA 4N3VA 3CCS3 4MMXB 3CCQ3 1W2ZA 1EA2A 1JV2B 2IA7A 1TU5A 3D9RA 3KSPA 3GZBA 4K1VA 3LT8A 1OH0A 1N5HA 4FCZA 4BTWA 2RFRA 4WP5A 2BO9B 2FGTA 1OPYA 1AVKA 1YVBI 3KSED 3HI7A 1HKXA 1WNHA 2D42A 1QJGA 3N54B 4XBXA 1VQ53 1J2BA 5AIIA 1UW1A 2IUKA 3HZPA 3FKAA 3IPTA 1YJW3 2E2VA 3WODG 4N6NB 2F99A 3F8XA 1SIIA 2YX9A 1QAFA 2F98A 3DGOA 3HX8A 1M904 2GBXB 2LYXA 2QIYA 3SOYA 5TGNA 3LTBA 1OGXA 1OUNA 4BTXA 3I553 3ER7A 1FGRA 3KN4A 3EBTA 4KFDA 4OK0A 4HVNA 1TFOA 1DVCA 2GEXA 3FH1A 1US1A 1N5PA 2Y73A 2XGLA 1OACA 1UI7A 1MOLA 1CQSA 3MG3A 3LMLA 4GB5A 3EQQB 2KXGA 3FG3A 3UNLA 4HM0B 1A67A 3MG1A 1K9M4 3X40A 5AIGA 5JPPA 4HZ9B 1JKGA 3BNBA 1GS3A 3BNCA 3OV4A 7STDA 2ZL8A 5IG5A 3LH4A 5HGRA 1G96A 3NQYA 2WOFA 4XB5A 5BVBA 3GZRA 1W01A 1STDA 1DMQA 3EB8A 4HM1B 2CC3A 1RRLA 4FCJA 1WTHA 1ASKA 4AKYA 2GU3A 2CFWA 3PYJA 4HBRA 1Q7Y4 5EVHA 2CFDA 4LSOA 5ELUA 1EKMA 3KKGA 3HIIA 3CC23 3B4PA 1MNLA 3NQZA 4R4KA 2FXTA 2CW9A 1JKGB 1RN7A 3MHEA 2ZDJA 2A15A 2CWTA 3FG4A 1KQS2 3DUKA 4R80A 4RNYA 2CIUA 4KVHA 2HMLB 1NWWA 1R4CA 1UUWB 3HK4A 5AYSC 1VQ43 3BNEA 3IJEB 2XH9A 5CF1A 1E3VA 1W7CA 3WA2X 2C11A 2OTL3 1YGEA 1RJOA 2MF7A 3NV0B 4U13A 1ZO2A 1QVG2 1VZZA 4KZ1A 3X3ZA 1Y4KA 5AIFA 1DMMA 3G16A 4XBTA 4XDWA 4IIAA 4EXRA 3BNDA 4LGQA 2KRTA 3F7SA 2OTJ3 1A90A 1EQKA 3O8YA 1RKYA 1W6YA 4EV5A 3BB9A 3DGNA 3DMCA 1HU9A 3DGMA 1W2B2 3LT9A 2XGNA 3B8LA 2ML6A 3X3XA 2PZVA 3EC9A 2YFLB 3TDGA 2IUJA 4MMZB 3GZYB 1NB3I 2E2TA 4JF8A 4N6UA 3CPW2 1NDOB 3NM2A 1IVWA 1NJI4 3BLZA 3NHXA 1QVF2 5IEOA 2OWPA 4EBGA 3OXAA 1O7WB 1FA3A 2CWVA 4GL6A 2L4VA 1SIHA 2XFTA 4JRFA 1VQO3 4IT7A 5KP1A 2I9WA 3K9MC 3F40A 5AEUB 2BMRB 5AIHA 4WYKB 3FZWA 1Q40B 2C10A 1CEWI 2GXFA 4RBNA 1LXEA 3FLJA 2OQEC 4O3VA 4L8PA 1NU3A 2CKFB 3EJVA 5D83A 3D3LA 3FGYA 1WMOA 1GY7A 1N9EA 1ROAA 4FCMA 3SX1A 5A0OB 1PU4A 3G6E3 1VQ83 3CMA3 1QAKA 3SLUA 1UI8A 2XF3A 3JUPA 2K0MA 3KFQC 2W04A 4KFFA 4RNZA 1IVVA 3VF1A 4STDA 1GY6A 3F7XA 3UB1A 3ROBA 2BMOB 1W00A 3QRDA 1VQP3 2CFKA 2OOVC 1WMPA 4EYCA 1JB5A 3LZAA 4N6LA 3SOAA 2P38A 2Q07A 2W03A 5AI1A 3FG1A 3B4OA 3WDGB 1YIT3 5DREA 1VQN3 3X42A 3LTCA 3RGAA 2D1WA 1D6UA 1K41A 4EV2A 5KP3A 1W6CA 3CCV3 1YI23 1K28A 2OCTA 2Z7AA 1OHSA 3OWUA 1JN5A 1Q814 3GZXB 1JNQA 3WOFB 1VQM3 3FF0A 2HMJB 4CCVA 3CPOA 1DMNA 4LMIA 3DM8A 3KE7A 1IT8A 2P0XA 1VQK3 2P09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSO B;  4J9A A;  1OGZ A;  4HM8 B;  3K7C A;  1A2K A;  3WMD A;  2W2C A;  2F86 B;  5D81 A;  6STD A;  3JUO A;  4OVM A;  5FW5 A;  4CDL A;  5CF2 A;  5IEP A;  4HM6 B;  5JPU A;  3OWY A;  4PEJ A;  4XBY A;  5IEN A;  1IDP A;  1AR0 A;  3F14 A;  3MYT A;  4Q53 A;  4X2H A;  2CHC A;  1QMA A;  2JQ5 A;  4OUQ A;  4X2O A;  1JB4 A;  2HMN B;  3EN1 B;  1BUQ A;  1Z1S A;  1U5O A;  1Q42 A;  1ZX2 A;  3STD A;  2HMO B;  8CHO A;  2B24 B;  1OHP A;  3RGR A;  3NUV A;  5IG3 A;  3CU3 A;  2STD A;  2Z77 A;  3MSO A;  4L8O A;  3M8C A;  5CLK A;  2K54 A;  3VSY A;  3OX9 A;  3EF8 A;  3NXJ A;  3FF2 A;  4R9L A;  3F8H A;  3UJM A;  1TP6 A;  3K0Z A;  3NBR A;  4HM4 B;  4HM3 B;  3T8U A;  2QGU A;  5IF6 A;  4HM2 B;  1ULJ B;  3MKI A;  4HZB B;  5CK6 A;  1W02 A;  4L7K A;  4HM5 B;  2GBW B;  4K1U A;  4ORL A;  5IER A;  3JUQ A;  5G2G A;  4RZM A;  1GY5 A;  2IMJ A;  2YFI B;  5IG0 A;  2R4I A;  3B7C A;  1E3R A;  2RCD A;  1OF5 A;  1O7M B;  2HMK B;  1OCV A;  1ISK A;  3JUN A;  3FSD A;  3EBY A;  2INX A;  3ECF A;  2BNG A;  1EG9 B;  2XR8 B;  3F9S A;  2Z76 A;  3DZL A;  3H51 A;  2XRX B;  5CXO A;  1UUV B;  3T8N A;  1E97 A;  1JN5 B;  1C7H A;  3G8Z A;  1OF5 B;  1ULI B;  3DXO A;  2HMM B;  5STD A;  3SED A;  5D82 A;  4I4K A;  1S5A A;  4HKV B;  3EX9 A;  1OHO A;  3H3H A;  3JUM A;  2B1X B;  3EHC A;  3G0K A;  1O7P B;  4HM7 B;  1O7N B;  3NV0 A;  3I0Y A;  1JB2 A;  2GEY A;  3MG2 A;  2BMQ B;  3LYG A;  1O7G B;  4XDV A;  4WWU C;  4MJD A;  3E99 A;  2XSH B;  4H3U A;  5IG4 A;  1GYB A;  3S5C A;  3A76 A;  5BXQ A;  1SJW A;  3Q90 A;  5KP4 A;  3KZT A;  2RGQ A;  3GRD A;  3CNX A;  3VGN A;  4J8T A;  4HJL B;  4WYK A;  1Q40 A;  4R9K A;  4XM4 A;  4R1K A;  3CNM A;  1TUH A;  3GWR A;  1O7H B;  4LEH A;  5AEW B;  2YFJ B;  2UX0 A;  3EN8 A;  5DRV A;  1WQL B;  3OWS A;  4N3V A;  1EA2 A;  3D9R A;  3KSP A;  3GZB A;  4K1V A;  1OH0 A;  2RFR A;  4WP5 A;  1OPY A;  1HKX A;  1QJG A;  4XBX A;  5AII A;  3HZP A;  3FKA A;  3IPT A;  2F99 A;  3F8X A;  2F98 A;  3HX8 A;  2GBX B;  2QIY A;  3SOY A;  5TGN A;  1OGX A;  1OUN A;  3ER7 A;  3EBT A;  4HVN A;  2GEX A;  3FH1 A;  3MG3 A;  1CQS A;  4GB5 A;  3EQQ B;  3UNL A;  4HM0 B;  3MG1 A;  5AIG A;  5JPP A;  4HZ9 B;  1JKG A;  3OV4 A;  1GS3 A;  5IG5 A;  7STD A;  5HGR A;  4XB5 A;  5BVB A;  3GZR A;  1W01 A;  1STD A;  1DMQ A;  4HM1 B;  4FCJ A;  1ASK A;  5EVH A;  3KKG A;  3B4P A;  1JKG B;  3MHE A;  2A15 A;  3DUK A;  4KVH A;  2HML B;  1NWW A;  1UUW B;  3HK4 A;  5CF1 A;  1E3V A;  3NV0 B;  4U13 A;  1ZO2 A;  1VZZ A;  5AIF A;  1DMM A;  3G16 A;  4XBT A;  4XDW A;  4IIA A;  4LGQ A;  3F7S A;  1W6Y A;  3BB9 A;  3DMC A;  3B8L A;  2PZV A;  3EC9 A;  2YFL B;  3GZY B;  1NDO B;  3NM2 A;  3BLZ A;  3NHX A;  5IEO A;  2OWP A;  3OXA A;  1O7W B;  5KP1 A;  2I9W A;  3F40 A;  5AEU B;  2BMR B;  5AIH A;  4WYK B;  3FZW A;  1Q40 B;  2GXF A;  3FLJ A;  4L8P A;  1NU3 A;  2CKF B;  3EJV A;  5D83 A;  4FCM A;  3FGY A;  1GY7 A;  3JUP A;  4STD A;  1GY6 A;  3F7X A;  3ROB A;  2BMO B;  1W00 A;  1JB5 A;  3LZA A;  3SOA A;  5AI1 A;  3B4O A;  5DRE A;  3RGA A;  1K41 A;  5KP3 A;  2Z7A A;  1OHS A;  3OWU A;  1JN5 A;  3GZX B;  3FF0 A;  2HMJ B;  3CPO A;  1DMN A;  4LMI A;  3DM8 A;  3KE7 A; 
#chains in the Genus database with same CATH topology
 1I0V A;  3CCL 3;  2XSO B;  3X41 A;  2SBL A;  3FCS B;  3NBB A;  3G71 3;  4HAA A;  1W5Z A;  4J9A A;  1OGZ A;  1JJ2 2;  1UCK A;  1B2S A;  4HM8 B;  3IMA B;  3GSP A;  3LXU X;  3K7C A;  3PS8 A;  1BRI A;  4LYL B;  3NX0 A;  1A2K A;  3WMD A;  1IT7 A;  2W2C A;  2XFS A;  2F86 B;  2CG1 A;  1ROV A;  3QK9 A;  1KSI A;  5D81 A;  2QA4 3;  1K73 4;  1IQ8 A;  6STD A;  2GU1 A;  3JUO A;  1N9J A;  4OVM A;  1Q82 4;  3S28 A;  4FMC A;  3HIG A;  2CX0 A;  5FW5 A;  2O9U X;  3ZG5 A;  4CDL A;  5CF2 A;  3LTA A;  5LC6 A;  4HM6 B;  5IEP A;  5JPU A;  3D5G A;  2XEP A;  3ZG0 A;  3OWY A;  4PEJ A;  5LC7 A;  3G4S 3;  2CH9 A;  4XBY A;  1FW7 A;  5IEN A;  1IDP A;  4CJN A;  1AR0 A;  1LOY A;  3F14 A;  1FGM A;  4AEQ A;  3MYT A;  4Q53 A;  1BAN A;  4X2H A;  3D4A A;  1SQW A;  2CHC A;  2LQV A;  1RN1 A;  2F5W A;  2L1S A;  3Q2P A;  1UCI A;  1KC8 4;  1BOX A;  1LVN A;  1QMA A;  2QEX 3;  3CXC 2;  2JQ5 A;  2CG0 A;  1I2E A;  1PYL A;  3KII A;  4OUQ A;  4X2O A;  1GOY A;  1JB4 A;  2HMN B;  3EN1 B;  1BUQ A;  5RNT A;  1I2G A;  1U8C B;  1Z1S A;  1JBT A;  2CK3 H;  2R41 A;  3CCJ 3;  1K8A 4;  1CYV A;  1U5O A;  1Q42 A;  3LTD A;  4I5Q A;  1X1X A;  3S27 A;  1RTU A;  4H61 A;  1ZX2 A;  3WA3 A;  1B2Z A;  2WOH A;  3STD A;  3NM7 A;  2HMO B;  1TFK A;  8CHO A;  2B24 B;  4NRE A;  1YJN 3;  2IY2 A;  1L5G B;  2W6J H;  1N8Q A;  1BNS A;  1OHP A;  1IK3 A;  3RGR A;  1RDS A;  3NUV A;  1IQY A;  5IG3 A;  3CU3 A;  2STD A;  2Z77 A;  3MSO A;  4L8O A;  3SYU A;  3CCE 3;  1ZS7 A;  3K63 A;  5ELJ A;  4O2H A;  1NB5 I;  2BIR A;  4WFO A;  3M8C A;  2KF6 A;  5CLK A;  2K54 A;  2W9P A;  2MC8 A;  1PFP A;  1GOU A;  2JDI H;  3OX9 A;  3VSY A;  1D6Z A;  1S72 3;  1RGL A;  3EF8 A;  5FGO A;  1N8R 4;  3NXJ A;  3FF2 A;  3UL6 A;  3MWZ A;  2KCD A;  1BSC A;  1DYU A;  3F8H A;  4GSP A;  4O8S A;  4R9L A;  5EQL A;  3UJM A;  1MWS A;  1TP6 A;  3T0U A;  3K0Z A;  1M9G A;  3ALA A;  3NBR A;  4QWT A;  4HM4 B;  4HM3 B;  3T8U A;  1V74 A;  3MPH A;  2QGU A;  3SXX A;  1YJ9 3;  1G02 A;  1GD3 A;  1STF I;  1IVU A;  3NBJ A;  5IF6 A;  4HM2 B;  1ULJ B;  3PZW A;  3MKI A;  1IU7 A;  1IYY A;  4HZB B;  5CK6 A;  3LOY A;  1LNI A;  4RNT A;  1W02 A;  4L7K A;  4HM5 B;  1JBS A;  3WHO A;  1Q7H A;  1IVX A;  2KF3 A;  3Q1C A;  2Y74 A;  4NHF A;  5M18 A;  2GBW B;  4K1U A;  1RRH A;  4ORL A;  1JZD A;  4MMY B;  5IW9 A;  5IER A;  1LNH A;  1WMN A;  3AGO A;  3AMO A;  1B3S A;  3JUQ A;  4HOH A;  5G2G A;  1RNB A;  1LQG C;  4BTY A;  3WOE B;  1IV7 A;  4RZM A;  3U1W A;  1RGC A;  5HOH A;  1AV4 A;  1GY5 A;  2IMJ A;  2BHM A;  5EEO A;  2YFI B;  5IG0 A;  2R4I A;  3B7C A;  1VQ6 3;  3AHW A;  3CD6 3;  1E3R A;  2W56 A;  1AVL A;  3KCH A;  4BL2 A;  1M1K 4;  1UDI I;  3CCM 3;  2RCD A;  1OF5 A;  2P05 A;  1FGQ A;  1GMR A;  3V99 A;  1FGT A;  3A5E A;  1O7M B;  1SPU A;  1OCV A;  2HMK B;  3D5I A;  3S29 A;  3JUN A;  1ISK A;  3FSD A;  4FMA A;  3EBY A;  4ZM8 A;  2INX A;  3UL5 A;  3ECF A;  3AMO B;  1FUW A;  2BNG A;  1EG9 B;  2CFL A;  3PCS A;  2AAE A;  3V98 A;  2ML5 A;  2XR8 B;  2KF5 A;  3F9S A;  2Z76 A;  3DZL A;  3H51 A;  2XRX B;  5CXO A;  1UUV B;  1YIJ 3;  1A2V A;  1EUI C;  3T8N A;  1E97 A;  2H0G A;  2W56 B;  1D6Y A;  3EE1 A;  4J5G A;  5I97 A;  4BIR A;  1YHQ 3;  3K5T A;  3BIR A;  3S67 A;  5M19 A;  1JN5 B;  1C7H A;  3G8Z A;  1RLS A;  4EW5 A;  3CC4 3;  1OF5 B;  3SVA A;  1ULI B;  1IQX A;  1KD1 4;  3DXO A;  1GMQ A;  1UCJ A;  2HMM B;  1TTO A;  3PXM A;  5M1A A;  5STD A;  2RSX A;  4ILF A;  3N8B A;  3SED A;  1T5Y A;  5D82 A;  4I4K A;  1BNE A;  1S5A A;  3ZFZ A;  4HKV B;  3EX9 A;  1OHO A;  3CCU 3;  3H3H A;  3JUM A;  1RCK A;  3PCR A;  1PY3 A;  2B1X B;  3EHC A;  3AGN A;  3G0K A;  3CME 3;  4G1M B;  1O7P B;  4N6V 0;  4HM7 B;  1QAL A;  2BT3 A;  1O7N B;  3NV0 A;  1HYF A;  3I0Y A;  1JB2 A;  1F8N A;  4WHA A;  1VQL 3;  2GEY A;  3N9H A;  4AKZ A;  3MG2 A;  2BMQ B;  3LYG A;  1O7G B;  1YGW A;  4HYZ A;  4XDV A;  3U97 A;  2W0Q A;  1BRK A;  1RGA A;  1GD4 A;  1V57 A;  4WWU C;  2C4B A;  4MJD A;  2UUG C;  2V1L A;  3E99 A;  2XSH B;  1VQ7 3;  2F56 A;  4N6T A;  1CYU A;  3X3Y A;  4H3U A;  1RGK A;  1VQQ A;  2PNC A;  4FR9 A;  3RDE A;  3URP A;  1JRQ A;  5IG4 A;  4MEI A;  3I56 3;  2WO0 A;  4FMD A;  1GYB A;  1NO3 A;  4N6O B;  1FGO A;  1BNJ A;  1ZGX A;  4LZI A;  3A76 A;  3S5C A;  4EC6 A;  1T2I A;  5BXQ A;  1SJW A;  2W9Q A;  1Q9E A;  3GAX A;  4GHO A;  1DVD A;  2F4Y A;  3Q90 A;  3CC7 3;  7GSP A;  1KWI A;  5KP4 A;  1UGI A;  4IPB A;  2Z6B A;  3DGL A;  3KZT A;  2H0I A;  1AQZ A;  1V58 A;  4O02 B;  2CWU A;  1IV9 A;  2O3O A;  2OQE A;  3DH2 A;  2RGQ A;  1DE3 A;  2WGQ A;  3GRD A;  1MWT A;  3CCR 3;  1A2P A;  1BRJ A;  1W4N A;  5AYR B;  3CNX A;  2HOH A;  3VGN A;  4FMB A;  4N6M A;  1T2H A;  2M7O A;  1BRG A;  2FNQ A;  4J8T A;  6RNT A;  1MGW A;  4HJL B;  4WYK A;  1Q40 A;  3BU4 A;  5JBS A;  3L0R A;  4R9K A;  1M1X B;  2H0H A;  3JVC A;  4XM4 A;  1LOW A;  2J8X B;  1C54 A;  4R1K A;  1BUJ A;  3OW2 2;  4K61 A;  2E2U A;  3CNM A;  1YVS A;  2CFG A;  1Q86 4;  4KFE A;  1BNG A;  1TUH A;  2WGO A;  3GWR A;  3PGB A;  4K90 B;  1O7H B;  4NPB A;  1TIJ A;  2OOV A;  3DY5 A;  4LEH A;  5AEW B;  1LOX A;  2YFJ B;  1VQ9 3;  2UX0 A;  4TX4 A;  1W6G A;  3EN8 A;  5DRV A;  3V92 A;  1X1W A;  1BNI A;  1WQL B;  2P0M A;  3OWS A;  4N3V A;  3CCS 3;  1DET A;  4MMX B;  1I8V A;  3CCQ 3;  1W2Z A;  1EA2 A;  1JV2 B;  2IA7 A;  1TU5 A;  3Q3F A;  3D9R A;  3KSP A;  3GZB A;  4K1V A;  1JZO A;  3LT8 A;  1OH0 A;  1N5H A;  4FCZ A;  4BTW A;  1BRS A;  2RFR A;  1B27 A;  4WP5 A;  2BO9 B;  1I70 A;  1OPY A;  2FGT A;  1AVK A;  2RNT A;  1YVB I;  3KSE D;  3HI7 A;  3AHS A;  1HKX A;  1WNH A;  2D42 A;  1BSB A;  1QJG A;  1BVI A;  3N54 B;  4XBX A;  3J7Y d;  1VQ5 3;  1J2B A;  5AII A;  1SAR A;  1UW1 A;  2IUK A;  3HZP A;  1AY7 A;  1RSN A;  3FKA A;  1B2M A;  3IPT A;  1YJW 3;  2E2V A;  3WOD G;  1FYS A;  1LRA A;  4N6N B;  2F99 A;  3F8X A;  2AAD A;  1SII A;  2YX9 A;  1I2F A;  1QAF A;  2F98 A;  3DGO A;  3HX8 A;  1RN4 A;  1M90 4;  2GBX B;  2LYX A;  2QIY A;  3SOY A;  2KF4 A;  1RCL A;  5G1L A;  5TGN A;  3LTB A;  1HZ1 A;  1BIR A;  1OGX A;  1OUN A;  6GSP A;  4BTX A;  2KAA A;  1LOV A;  1BRN L;  1B2U A;  5BU4 A;  3I55 3;  3ER7 A;  1FGR A;  2SAR A;  3EBT A;  3KN4 A;  4KFD A;  4OK0 A;  4HVN A;  1TFO A;  1DVC A;  2GEX A;  3FH1 A;  1US1 A;  1N5P A;  2Y73 A;  2XGL A;  1OAC A;  1UI7 A;  1B2X A;  1CQS A;  1MOL A;  1I0X A;  2GSP A;  3LML A;  3MG3 A;  3EQQ B;  4GB5 A;  2KXG A;  4J5K A;  2F5M A;  1I3I A;  3FG3 A;  3UNL A;  4HM0 B;  1RGE A;  1A67 A;  1YNV X;  3MG1 A;  1BRH A;  1K9M 4;  3X40 A;  5AIG A;  5JPP A;  4HZ9 B;  1JKG A;  2RBI A;  1GS3 A;  3BNB A;  3BNC A;  3OV4 A;  2ZL8 A;  7STD A;  5IG5 A;  1RNT A;  3LH4 A;  5HGR A;  1G96 A;  3NQY A;  2WOF A;  4XB5 A;  5BVB A;  3GZR A;  4DKI A;  1W01 A;  1STD A;  1MWU A;  1DMQ A;  2K3D A;  3EB8 A;  1FUS A;  1UGH I;  4HM1 B;  7RNT A;  2CC3 A;  1RRL A;  4FCJ A;  1WTH A;  1ASK A;  4AKY A;  2GU3 A;  2CFW A;  3PYJ A;  4HBR A;  1Q7Y 4;  5EVH A;  1NNV A;  2CFD A;  4LSO A;  5ELU A;  5GSP A;  1EKM A;  3KKG A;  1GSP A;  3HII A;  3WR2 A;  1MNL A;  3B4P A;  3CC2 3;  3NQZ A;  4R4K A;  2FXT A;  2CW9 A;  1JKG B;  1RN7 A;  1UCL A;  3MHE A;  2ZDJ A;  2A15 A;  2CWT A;  3FG4 A;  1KQS 2;  3DUK A;  4R80 A;  4RNY A;  1BU4 A;  2CIU A;  4KVH A;  2HML B;  1NWW A;  1R4C A;  1UUW B;  3HK4 A;  5AYS C;  1VQ4 3;  1BSE A;  3BNE A;  1BSA A;  2IYJ A;  3IJE B;  2XH9 A;  5CF1 A;  1E3V A;  1W7C A;  3WA2 X;  2C11 A;  2OTL 3;  1TRQ A;  1YGE A;  1RJO A;  2MF7 A;  3NV0 B;  4U13 A;  3D79 A;  1ZO2 A;  1QVG 2;  1VZZ A;  4KZ1 A;  1X1Y A;  3X3Z A;  1Y4K A;  5AIF A;  1DMM A;  3DGY A;  3G16 A;  4XBT A;  4XDW A;  4IIA A;  4EXR A;  3BND A;  4LGQ A;  2KRT A;  3F7S A;  2OTJ 3;  1A90 A;  1T3B A;  1EQK A;  3O8Y A;  1BNR A;  1RKY A;  1W6Y A;  4EV5 A;  3BB9 A;  3DGN A;  3DMC A;  1HU9 A;  3DGM A;  1W2B 2;  3LT9 A;  2XGN A;  1TRP A;  3B8L A;  1UUG B;  2ML6 A;  1X1U A;  3X3X A;  2PZV A;  3EC9 A;  2YFL B;  3TDG A;  2IUJ A;  4MMZ B;  4KT3 B;  3GZY B;  1FZU A;  5G1K A;  1NB3 I;  2E2T A;  1RGG A;  4JF8 A;  4N6U A;  1NDO B;  3NM2 A;  1IVW A;  3CPW 2;  1NJI 4;  3BLZ A;  3NHX A;  1MWR A;  1QVF 2;  5IEO A;  2OWP A;  4EBG A;  3OXA A;  1O7W B;  1TJD A;  1FA3 A;  2CWV A;  4BL3 A;  4GL6 A;  1R4Y A;  1SIH A;  2L4V A;  2XFT A;  1FUT A;  4JRF A;  1VQO 3;  4IT7 A;  5KP1 A;  1JBR A;  4CPK A;  1LQM B;  2I9W A;  1BGS A;  3K9M C;  3F40 A;  5AEU B;  2BMR B;  5AIH A;  4WYK B;  3FZW A;  1Q40 B;  2C10 A;  1CEW I;  2GXF A;  8RNT A;  4RBN A;  1LXE A;  3FLJ A;  4BU4 A;  2OQE C;  4O3V A;  4L8P A;  3RNT A;  1NU3 A;  1BAO A;  2CKF B;  3EJV A;  5D83 A;  1GMP A;  3D3L A;  3FGY A;  1WMO A;  1GY7 A;  1N9E A;  1ROA A;  4FCM A;  3SX1 A;  5A0O B;  1PU4 A;  3G6E 3;  1VQ8 3;  3CMA 3;  1QAK A;  3SLU A;  1RGF A;  1UI8 A;  2ZHX B;  1EEJ A;  2XF3 A;  3JUP A;  9RNT A;  2K0M A;  3KFQ C;  2W04 A;  4KFF A;  1G0T A;  4RNZ A;  1GOV A;  1IVV A;  3VF1 A;  4STD A;  1GY6 A;  3F7X A;  1MGR A;  3UB1 A;  3ROB A;  2BMO B;  1BNF A;  1W00 A;  3QRD A;  1VQP 3;  2CFK A;  2OOV C;  1WMP A;  4EYC A;  1I3F A;  1BSD A;  1JB5 A;  3LZA A;  4N6L A;  2BU4 A;  3SOA A;  2P38 A;  2Q07 A;  2W03 A;  5AI1 A;  3FG1 A;  3B4O A;  3WDG B;  2CX1 A;  1YIT 3;  5DRE A;  1RHL A;  3X42 A;  1VQN 3;  3LTC A;  3RGA A;  5BIR A;  2ZA4 A;  2D1W A;  1D6U A;  1K41 A;  4EV2 A;  1B20 A;  5KP3 A;  1RMS A;  1W6C A;  3CCV 3;  1YI2 3;  1K28 A;  2OCT A;  2Z7A A;  3HOH A;  1OHS A;  3OWU A;  1JN5 A;  1Q81 4;  3GZX B;  1JNQ A;  2UGI A;  1B21 A;  3WOF B;  1VQM 3;  3FF0 A;  2HMJ B;  4CCV A;  3CPO A;  1DMN A;  4LMI A;  1CH0 A;  3DM8 A;  3KE7 A;  1IT8 A;  1RGH A;  2P0X A;  1VQK 3;  2P09 A; 
#chains in the Genus database with same CATH homology
 3CCL 3;  2XSO B;  3X41 A;  2SBL A;  3FCS B;  3NBB A;  3G71 3;  4J9A A;  1W5Z A;  1OGZ A;  1JJ2 2;  4HM8 B;  3IMA B;  3LXU X;  3K7C A;  3PS8 A;  3NX0 A;  1A2K A;  3WMD A;  1IT7 A;  2W2C A;  2XFS A;  2F86 B;  2CG1 A;  1ROV A;  3QK9 A;  1KSI A;  5D81 A;  2QA4 3;  1K73 4;  1IQ8 A;  6STD A;  2GU1 A;  3JUO A;  1N9J A;  4OVM A;  1Q82 4;  3S28 A;  4FMC A;  3HIG A;  5FW5 A;  2O9U X;  4CDL A;  5CF2 A;  5IEP A;  3LTA A;  5LC6 A;  4HM6 B;  5JPU A;  2XEP A;  3OWY A;  4PEJ A;  5LC7 A;  3G4S 3;  2CH9 A;  4XBY A;  5IEN A;  1IDP A;  1AR0 A;  3F14 A;  1FGM A;  4AEQ A;  3MYT A;  4Q53 A;  4X2H A;  1SQW A;  2CHC A;  2LQV A;  3Q2P A;  1KC8 4;  1LVN A;  1QMA A;  2QEX 3;  3CXC 2;  2JQ5 A;  2CG0 A;  3KII A;  4OUQ A;  4X2O A;  1JB4 A;  2HMN B;  3EN1 B;  1BUQ A;  1Z1S A;  1U8C B;  2CK3 H;  3CCJ 3;  1K8A 4;  1CYV A;  1U5O A;  1Q42 A;  3LTD A;  3S27 A;  4H61 A;  1ZX2 A;  3WA3 A;  2WOH A;  3STD A;  3NM7 A;  2HMO B;  1TFK A;  8CHO A;  2B24 B;  4NRE A;  1YJN 3;  1L5G B;  2W6J H;  1N8Q A;  1OHP A;  1IK3 A;  3RGR A;  3NUV A;  1IQY A;  5IG3 A;  3CU3 A;  2STD A;  2Z77 A;  3MSO A;  4L8O A;  3CCE 3;  3K63 A;  5ELJ A;  4O2H A;  1NB5 I;  4WFO A;  3M8C A;  5CLK A;  2K54 A;  2W9P A;  2MC8 A;  1PFP A;  2JDI H;  3VSY A;  3OX9 A;  1S72 3;  1D6Z A;  3EF8 A;  5FGO A;  1N8R 4;  3NXJ A;  3FF2 A;  3UL6 A;  3MWZ A;  2KCD A;  4R9L A;  1DYU A;  3F8H A;  4O8S A;  5EQL A;  3UJM A;  1TP6 A;  3T0U A;  3K0Z A;  1M9G A;  3ALA A;  3NBR A;  4QWT A;  4HM4 B;  4HM3 B;  3T8U A;  1V74 A;  3MPH A;  2QGU A;  3SXX A;  1YJ9 3;  1GD3 A;  1STF I;  1IVU A;  3NBJ A;  5IF6 A;  4HM2 B;  1ULJ B;  3PZW A;  3MKI A;  1IU7 A;  4HZB B;  5CK6 A;  3LOY A;  1W02 A;  4L7K A;  4HM5 B;  1IVX A;  3J7Y d;  3Q1C A;  2Y74 A;  4NHF A;  2GBW B;  4K1U A;  1RRH A;  4ORL A;  4MMY B;  5IW9 A;  5IER A;  1LNH A;  1WMN A;  3AMO A;  3JUQ A;  5G2G A;  4BTY A;  3WOE B;  1IV7 A;  4RZM A;  3U1W A;  1AV4 A;  1GY5 A;  2IMJ A;  2BHM A;  5EEO A;  2YFI B;  5IG0 A;  2R4I A;  3B7C A;  1VQ6 3;  3CD6 3;  1E3R A;  2W56 A;  1AVL A;  1M1K 4;  3CCM 3;  2RCD A;  1OF5 A;  2P05 A;  1FGQ A;  3V99 A;  1FGT A;  1O7M B;  1SPU A;  1OCV A;  2HMK B;  3S29 A;  1ISK A;  3JUN A;  3FSD A;  4FMA A;  3EBY A;  4ZM8 A;  2INX A;  3UL5 A;  3ECF A;  3AMO B;  1FUW A;  2BNG A;  1EG9 B;  2CFL A;  3PCS A;  3V98 A;  2ML5 A;  2XR8 B;  3F9S A;  2Z76 A;  3DZL A;  3H51 A;  2XRX B;  5CXO A;  1UUV B;  1YIJ 3;  1A2V A;  3T8N A;  1E97 A;  3EE1 A;  2W56 B;  1D6Y A;  5I97 A;  1YHQ 3;  3K5T A;  3S67 A;  1JN5 B;  1C7H A;  3G8Z A;  3CC4 3;  1OF5 B;  3SVA A;  1ULI B;  1IQX A;  1KD1 4;  3DXO A;  2HMM B;  3PXM A;  5STD A;  2RSX A;  3N8B A;  3SED A;  1T5Y A;  5D82 A;  4I4K A;  1S5A A;  4HKV B;  3EX9 A;  1OHO A;  3CCU 3;  3H3H A;  3JUM A;  3PCR A;  2B1X B;  3EHC A;  3G0K A;  3CME 3;  4G1M B;  1O7P B;  4N6V 0;  4HM7 B;  1QAL A;  2BT3 A;  1O7N B;  3NV0 A;  3I0Y A;  1JB2 A;  1F8N A;  4WHA A;  1VQL 3;  2GEY A;  3N9H A;  4AKZ A;  3MG2 A;  2BMQ B;  3LYG A;  1O7G B;  4HYZ A;  4XDV A;  3U97 A;  2W0Q A;  1GD4 A;  4WWU C;  4MJD A;  2V1L A;  3E99 A;  2XSH B;  1VQ7 3;  4N6T A;  1CYU A;  3X3Y A;  4H3U A;  2PNC A;  3RDE A;  4FR9 A;  3I56 3;  1JRQ A;  5IG4 A;  4MEI A;  2WO0 A;  4FMD A;  1GYB A;  1NO3 A;  4N6O B;  1FGO A;  4LZI A;  3S5C A;  4EC6 A;  3A76 A;  5BXQ A;  1SJW A;  2W9Q A;  1DVD A;  3GAX A;  3Q90 A;  3CC7 3;  1KWI A;  5KP4 A;  4IPB A;  2Z6B A;  3DGL A;  3KZT A;  4O02 B;  2CWU A;  1IV9 A;  2O3O A;  2OQE A;  2RGQ A;  2WGQ A;  3GRD A;  3CCR 3;  1W4N A;  5AYR B;  3CNX A;  3VGN A;  4FMB A;  4N6M A;  2M7O A;  2FNQ A;  4J8T A;  4HJL B;  4WYK A;  1Q40 A;  5JBS A;  3L0R A;  4R9K A;  1M1X B;  3JVC A;  4XM4 A;  4R1K A;  3OW2 2;  4K61 A;  2E2U A;  3CNM A;  2CFG A;  1Q86 4;  4KFE A;  1TUH A;  2WGO A;  3GWR A;  3PGB A;  4K90 B;  1O7H B;  1TIJ A;  2OOV A;  3DY5 A;  4LEH A;  5AEW B;  1LOX A;  2YFJ B;  1VQ9 3;  2UX0 A;  4TX4 A;  1W6G A;  3EN8 A;  5DRV A;  3V92 A;  1WQL B;  2P0M A;  3OWS A;  4N3V A;  3CCS 3;  4MMX B;  3CCQ 3;  1W2Z A;  1EA2 A;  1JV2 B;  2IA7 A;  1TU5 A;  3D9R A;  3KSP A;  3GZB A;  4K1V A;  3LT8 A;  1OH0 A;  1N5H A;  4FCZ A;  4BTW A;  2RFR A;  4WP5 A;  2BO9 B;  2FGT A;  1OPY A;  1AVK A;  1YVB I;  3KSE D;  3HI7 A;  1HKX A;  1WNH A;  2D42 A;  1QJG A;  3N54 B;  4XBX A;  1VQ5 3;  1J2B A;  5AII A;  1UW1 A;  2IUK A;  3HZP A;  3FKA A;  3IPT A;  1YJW 3;  2E2V A;  3WOD G;  4N6N B;  2F99 A;  3F8X A;  1SII A;  2YX9 A;  1QAF A;  2F98 A;  3DGO A;  3HX8 A;  1M90 4;  2GBX B;  2LYX A;  2QIY A;  3SOY A;  5TGN A;  3LTB A;  1OGX A;  1OUN A;  4BTX A;  3I55 3;  3ER7 A;  1FGR A;  3KN4 A;  3EBT A;  4KFD A;  4OK0 A;  4HVN A;  1TFO A;  1DVC A;  2GEX A;  3FH1 A;  1US1 A;  1N5P A;  2Y73 A;  2XGL A;  1OAC A;  1UI7 A;  1MOL A;  1CQS A;  3MG3 A;  3LML A;  4GB5 A;  3EQQ B;  2KXG A;  3FG3 A;  3UNL A;  4HM0 B;  1A67 A;  3MG1 A;  1K9M 4;  3X40 A;  5AIG A;  5JPP A;  4HZ9 B;  1JKG A;  3BNB A;  1GS3 A;  3BNC A;  3OV4 A;  7STD A;  2ZL8 A;  5IG5 A;  3LH4 A;  5HGR A;  1G96 A;  3NQY A;  2WOF A;  4XB5 A;  5BVB A;  3GZR A;  1W01 A;  1STD A;  1DMQ A;  3EB8 A;  4HM1 B;  2CC3 A;  1RRL A;  4FCJ A;  1WTH A;  1ASK A;  4AKY A;  2GU3 A;  2CFW A;  3PYJ A;  4HBR A;  1Q7Y 4;  5EVH A;  2CFD A;  4LSO A;  5ELU A;  1EKM A;  3KKG A;  3HII A;  3CC2 3;  3B4P A;  1MNL A;  3NQZ A;  4R4K A;  2FXT A;  2CW9 A;  1JKG B;  1RN7 A;  3MHE A;  2ZDJ A;  2A15 A;  2CWT A;  3FG4 A;  1KQS 2;  3DUK A;  4R80 A;  4RNY A;  2CIU A;  4KVH A;  2HML B;  1NWW A;  1R4C A;  1UUW B;  3HK4 A;  5AYS C;  1VQ4 3;  3BNE A;  3IJE B;  2XH9 A;  5CF1 A;  1E3V A;  1W7C A;  3WA2 X;  2C11 A;  2OTL 3;  1YGE A;  1RJO A;  2MF7 A;  3NV0 B;  4U13 A;  1ZO2 A;  1QVG 2;  1VZZ A;  4KZ1 A;  3X3Z A;  1Y4K A;  5AIF A;  1DMM A;  3G16 A;  4XBT A;  4XDW A;  4IIA A;  4EXR A;  3BND A;  4LGQ A;  2KRT A;  3F7S A;  2OTJ 3;  1A90 A;  1EQK A;  3O8Y A;  1RKY A;  1W6Y A;  4EV5 A;  3BB9 A;  3DGN A;  3DMC A;  1HU9 A;  3DGM A;  1W2B 2;  3LT9 A;  2XGN A;  3B8L A;  2ML6 A;  3X3X A;  2PZV A;  3EC9 A;  2YFL B;  3TDG A;  2IUJ A;  4MMZ B;  3GZY B;  1NB3 I;  2E2T A;  4JF8 A;  4N6U A;  3CPW 2;  1NDO B;  3NM2 A;  1IVW A;  1NJI 4;  3BLZ A;  3NHX A;  1QVF 2;  5IEO A;  2OWP A;  4EBG A;  3OXA A;  1O7W B;  1FA3 A;  2CWV A;  4GL6 A;  2L4V A;  1SIH A;  2XFT A;  4JRF A;  1VQO 3;  4IT7 A;  5KP1 A;  2I9W A;  3K9M C;  3F40 A;  5AEU B;  2BMR B;  5AIH A;  4WYK B;  3FZW A;  1Q40 B;  2C10 A;  1CEW I;  2GXF A;  4RBN A;  1LXE A;  3FLJ A;  2OQE C;  4O3V A;  4L8P A;  1NU3 A;  2CKF B;  3EJV A;  5D83 A;  3D3L A;  3FGY A;  1WMO A;  1GY7 A;  1N9E A;  1ROA A;  4FCM A;  3SX1 A;  5A0O B;  1PU4 A;  3G6E 3;  1VQ8 3;  3CMA 3;  1QAK A;  3SLU A;  1UI8 A;  2XF3 A;  3JUP A;  2K0M A;  3KFQ C;  2W04 A;  4KFF A;  4RNZ A;  1IVV A;  3VF1 A;  4STD A;  1GY6 A;  3F7X A;  3UB1 A;  3ROB A;  2BMO B;  1W00 A;  3QRD A;  1VQP 3;  2CFK A;  2OOV C;  1WMP A;  4EYC A;  1JB5 A;  3LZA A;  4N6L A;  3SOA A;  2P38 A;  2Q07 A;  2W03 A;  5AI1 A;  3FG1 A;  3B4O A;  3WDG B;  1YIT 3;  5DRE A;  1VQN 3;  3X42 A;  3LTC A;  3RGA A;  2D1W A;  1D6U A;  1K41 A;  4EV2 A;  5KP3 A;  1W6C A;  3CCV 3;  1YI2 3;  1K28 A;  2OCT A;  2Z7A A;  1OHS A;  3OWU A;  1JN5 A;  1Q81 4;  3GZX B;  1JNQ A;  3WOF B;  1VQM 3;  3FF0 A;  2HMJ B;  4CCV A;  3CPO A;  1DMN A;  4LMI A;  3DM8 A;  3KE7 A;  1IT8 A;  2P0X A;  1VQK 3;  2P09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...