3EC4A

Crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
DHPLDRPVWNSLGGPQSELDVASGNLRRLDPAYGPFAAAAPGAEAGLASLLQGDADEIWLVEPEPVAPPPGTRVIRVAPLLQMIADGPVPSFDDPGIVALGETDVPEMTALALATEPGPWASGTWRYGQFYGVRIDGRLAAMAGERMRPAPNLAEVSGVCTWPEYRGRGLAARLIRKVIAGMAARGEVPYLHSYASNASAIRLYESLGFRARRAMTATLLGKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Acetyltransferase from the GNAT family
publication title Crystal structure of Putative Acetyltransferase from the GNAT family (YP_497011.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.80 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Transferase
total genus 58
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08445 FR47 FR47-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3ec4A00
1S7LA 3SXNA 1B6BA 1Z9UA 4AVCA 5IB0A 5J8FA 2QECA 1Z4RA 3JUWA 1YK3A 4XNHB 2B3VA 3FXTA 5DWMA 2P0WA 2B58A 2J8MA 1RO5A 1WWZA 2WPWA 1Q2CA 3KKWA 4ORFA 2ZW5A 1RXTA 4QBJA 3S6KA 4H6ZA 1XIXA 3H4QA 3CXQA 2FIAA 2PR8A 1V0CA 1P0HA 3EO4A 2B4BA 1BO4A 2BSWA 1NE9A 4KOTA 4PK3A 2B5GA 5KTDA 2JDCA 2QIRA 1L0CA 5JPHA 4KOUA 2I00A 4BMHA 3P2HA 4HNXB 2F5IA 2Z11A 3S6GA 2J8NA 4CRYB 3CXSA 2ARHA 1QSOA 5KTAA 1PUAA 1B87A 3OWCA 1M4DA 3BLNA 2JEVA 3W6XA 1Y7RA 3PP9A 4PSXA 4AB7A 2Q4YA 1Z4EA 4OLLA 1YLEA 2FT0A 2ZPAA 3QB8A 3TO7A 4F6AA 2REFA 3R1KA 5F47A 3FB3A 4FD5A 3EC4A 4R57A 3V8IA 2D4PA 4GS4A 4UA3A 4CS0B 4H6UA 4IUSA 1MJAA 2FSRA 3CXPA 2ZW6A 1Q2DA 3E0KA 4KOVA 4AVAA 4QC6A 3ZJ0A 2JLMA 4R3KA 2DXQA 1S3ZA 4MY3A 2GE3A 1IIDA 4LUAA 2P6GA 3PZJA 4PK2A 5I0CA 3TE4A 3G3SA 2OU2A 5HMNA 1IB1E 5H84A 2ZW4A 4JJXA 2PDOA 4B5PB 2G3AA 4KVXA 4MBUA 3FIXA 2FIWA 1OZPA 1N71A 4R9MA 4UBRA 4M85A 3VWDA 3T9YA 1XF8A 2R8VA 1SQHA 1Y9WA 3EFAA 2G0BA 2J8RA 4H89A 4E0AA 2K5TA 4PSWA 2OB0A 2VI7A 2D4OA 2IL4A 4K30A 2PC1A 2CY2A 1VHSA 1CM0A 3TFYA 4NCZA 4NF1A 5GCNA 4KOSA 3TT2A 1IYKA 5CNPA 1VKCA 3R9GA 4KVOE 4MJ8A 2PR1A 2CNMA 2GANA 4LX9A 4NXYA 5FVJA 5HH1A 4XPDC 4MY0A 4XPKA 4II9A 3F0AA 4KORA 3I9SA 3PGPA 2I79A 4JXRA 1QSTA 2A4NA 1LRZA 1GHEA 3RYOA 3SXOA 3FRMA 4RI1A 4OAEA 3ZZIA 1YVKA 3D2PA 2R7HA 3C26A 2Z10A 3S6FA 2EUIA 3BJ7A 1KUYA 4MI4A 4YRHA 1M4IA 2REEA 1S7KA 4XPDB 3R9FA 1XMTA 2EVNA 3DR6A 4HNYB 2BEIA 5JQ4A 5C88A 2OZHA 4E2AA 3NE7A 1KUXA 2B5GB 4XPLA 1UFHA 4KVME 3R9EA 2ATRA 4UWIA 1CJWA 1Q2YA 4FD4A 3TCVA 2ZW7A 4NEXA 2B3UA 3P2FA 3DDDA 2VEZA 5ISVA 2Z0ZA 3GYAA 3F5BA 2B4DA 2OZGA 4U9YA 1M1DA 4JXQA 4B5OA 1BOBA 4L8AA 4DNCA 2Q7BA 4CAXA 3R95A 2Q04A 1YREA 5DWNA 1WK4A 3EY5A 4QB9A 4KLWA 3SHPA 2OH1A 1M4GA 4ZBGA 3D2MA 1KZFA 2CNTA 4M3SA 2HQYA 3TTHA 4QVTA 2NMTA 4Y49B 2BL1A 5EC4A 2AE6A 1S5KA 2B4DB 1NSLA 4UWJA 1FY7A 5F46A 2Q44A 4QUSA 3UY5A 3T90A 4L89A 1R57A 3TOAA 4AVBA 1J4JA 4JWPA 4R3LA 2VBQA 3BJ8A 1K4JA 3TO6A 3DNSA 1QSRA 3IGRA 3TO9A 1YX0A 4CRZB 1QSNA 2G3TA 2VQYA 3MGDA 5F48A 3LODA 2WPXA 2HUZA 1M44A 1S7FA 2C27A 3LD2A 3FNCA 3B8GA 3G8WA 4KUAA 1YGHA 4U9ZA 4EVYA 2Q0YA 2R98A 3TOBA 3R96A 2FL4A 3JVNA 3WR7A 4JLYA 4I49A 4J3GA 4AG9A 1Y9KA 4FD7A 4X5KA 4ONUA 2P6EA 3FYNA 2ZXVA 1YVOA 2FS5A 4KOWA 2O28A 3FBUA 1I12A 1QSMA 4U5YA 2X7BA 2RC4A 5J8CA 1MJBA 4E8OA 3GY9A 5IX3A 3DSBA 1U6MA 1XE4A 4CAWA 2H5MA 3IWGA 3VWEA 5H86A 4HNWB 1I1DA 3K9UA 1YR0A 2R1IA 1IYLA 1MK4A 4AG7A 4JD6A 1S7NA 4KOXA 4PV6A 3W6SA 4B5PA 3W91A 1XEBA 5E96A 4Y49C 4YFJA 2OZUA 2HV2A 2PSWA 2VXKA 4YGOA 2PRBA 4MHDA 5KTCA 4NSQA 2KCWA 4RS2A 1TIQA 4F0YA 4HKFA 3D3SA 4KUBA 1MJ9A 3GKRA 4KOYA 3D8PA 3I3GA 2AJ6A 2VZYA 3S6HA 2GIVA 2JDDA 4XNHC 2BUEA 1IICA 1S60A 5C82A 2QMLA 3QAHA 5IV0A 4CAVA 4IF5A 4R87A 2Q4VA 3F8KA 4OADA 1PU9A 3N7ZA 3DR8A 1ON0A 5EBVA 2P6FA 2FCKA 3EXNA 2FE7A 2CNSA 2FXFA 2PQ8A 1NMTA 1I21A 2Y0MA 4KZTA 4KLVA 1P4NA 2VZZA 1KUVA 4FD6A 5F49A
chains in the Genus database with same CATH superfamily
2ZOGA 1S7LA 3SXNA 4CGMA 1B6BA 1Z9UA 4BBHA 2C1CA 3GUXA 3S9MA 4AVCA 5IB0A 3K2KA 5J8FA 2QECA 1Z4RA 2ABZA 2QJ8A 2DF5A 3FEDA 3VATA 3JUWA 1YK3A 4XNHB 2B3VA 3FXTA 5DWMA 5LYDA 1ZG7A 4G1PA 4MFPA 2Z3NA 1AUGA 4B13A 5K8NA 1ZLIA 2P0WA 2B58A 3B35A 2J8MA 3D66A 1RO5A 1WWZA 3CT9A 4B14A 2WPWA 1Q2CA 3KKWA 4M6GA 2AFOA 4ORFA 4P4EA 2ZW5A 5J1QA 4A32A 1RXTA 2FVGA 4BD9A 4OC3A 4P4FA 4QBJA 3PB9X 3S6KA 4MHYA 4C7IA 1UWYA 4P4DA 4H6ZA 2CTBA 1XIXA 2V8HA 3WC6A 8CPAA 2V8VA 4UEFA 3H4QA 2Z3KA 5ELYA 1YSJA 3CXQA 2FIAA 2PR8A 4NJQA 1V0CA 1XMBA 1P0HA 3EO4A 4OC0A 2AFZA 5LRGA 4M6IA 2B4BA 4KSFA 1BO4A 2BSWA 3IO1A 2ZEHA 5A28A 3WC7A 1NE9A 1YMEA 4KOTA 1AMPA 2B5GA 4MXUA 4PK3A 3BHXA 5KTDA 2JDCA 2QIRA 3FEEA 4A38A 5I4MA 3FJUA 1L0CA 2YGWA 5BWAB 5JPHA 5JM6A 2GU2A 4KOUA 4YU9A 1F57A 2I00A 4BMHA 5JGFA 3P2HA 4MCPA 4HNXB 2Z3OA 2F5IA 5K8MA 2Z11A 3S6GA 1LAMA 3NH4A 2J8NA 4CRYB 4CYNA 3CXSA 2ARHA 1QSOA 1YW4A 5KTAA 1PUAA 1B87A 1Z8TA 3OWCA 4PXBA 4UF4A 1M4DA 3BLNA 2Q43A 4A94A 3LACA 2JEVA 1TKJA 4OP4A 1CPSA 4NGRA 3D7DA 4P10A 3MN8A 3BI1A 4WWVA 1ARLA 3W6XA 1Y7RA 1LCPA 2PJ2A 1QQ9A 2EO8A 3PP9A 4OKOA 4PSXA 3RO0A 4UCMA 2ZEEA 4AB7A 2Q4YA 1Z4EA 4YWYA 4OLLA 1YLEA 1R43A 2FT0A 2O53A 2WYRA 4P4IA 2ZEGA 2ZPAA 3FX6A 3B3VA 2PJCA 3IWEA 3K9TA 2PJ9A 1X12A 3QB8A 3TO7A 3FF3A 4PXEA 4F6AA 2REFA 3R1KA 5F47A 4Q7AA 3FB3A 1VIXA 4FD5A 3D67A 4NJRA 4EMEA 5CBMA 3EC4A 4R57A 3V8IA 2D4PA 3D7GA 4GS4A 4UA3A 2Q4ZA 3S9LA 4NGMA 1LOKA 5EMIA 4CS0B 3FMCA 4A39A 3CZXA 2PJ8A 1LFWA 2CXAA 4H6UA 4IUSA 1MJAA 2FSRA 4PPZA 5CPAA 2WZNA 2ZW6A 1Q2DA 3CXPA 2WUUA 3E0KA 4KOVA 4AVAA 4R7MA 4QC6A 4UEEA 1BLLE 4NGQA 2JLMA 3ZJ0A 2O4HA 3TX8A 1NSAA 4R3KA 2CIJA 1XJOA 2DPSA 2DXQA 1S3ZA 4MY3A 4A2ZA 4UFWA 5JH9A 2AFWA 6CPAA 2GE3A 1IIDA 4LUAA 2P6GA 1LANA 3PZJA 4PK2A 5I0CA 4PXDA 2WSAA 7CPAA 4MMOA 4CYQA 4WJBA 3ISXA 3RNZA 3TE4A 3G3SA 1ZO0A 2OU2A 4X8IA 2ZEMA 2PIYA 5HMNA 4X3RA 3KGQA 1IB1E 5H84A 2ANPA 4F9UA 2ZW4A 3KASA 1FT7A 4CYOA 4JJXA 2PDOA 4CAEA 4B5PB 2AFUA 3CPAA 2G3AA 4FAIA 1F2OA 3KL9A 4CGLA 2PCUA 4KVXA 4MBUA 2CTCA 1Z2LA 3FIXA 4ZY1A 2FIWA 2GLFA 1OZPA 1N71A 4K3NA 4R9MA 4UBRA 3IU1A 4M85A 5AG5A 3VWDA 3T9YA 4HPSA 4DUKA 3BXMA 1XF8A 4CGPA 2R8VA 4FBEA 2HB6A 5K8OA 4A31A 1SQHA 1Y9WA 2QYVA 2G0BA 3EFAA 2J8RA 1CBXA 4H89A 4RN7A 4E0AA 1CP6A 4CAFA 2K5TA 4CGOA 1X10A 4P4JA 4PSWA 1RTQA 5IB9A 1ZG9A 2OB0A 1DE4C 2VI7A 2D4OA 2IL4A 3SJEA 3IFEA 2ZEDA 4MFZA 4K30A 2C6PA 2PC1A 4ZX9A 4O23A 2CY2A 1VHSA 4P45A 1CM0A 2PJ6A 4X2TA 3V38A 3NE8A 3TFYA 4R6TA 2C6CA 4NCZA 2BOAA 4NF1A 3D7FA 5GCNA 1IOIA 4KOSA 3TT2A 2PJ3A 1IYKA 4UIAA 5CNPA 3T8WA 1VHOA 1VKCA 4MFKA 3R9GA 4KVOE 4MJ8A 2PR1A 2CNMA 1H8LA 2GANA 4OIDA 1M4LA 4NGNA 4LX9A 4NGSA 1XRYA 4NXYA 1CPXA 1QMUA 1VHEA 3PB8X 3WABA 1KWMA 1ELMP 5FVJA 5HH1A 4XPDC 4MY0A 4XPKA 3RZAA 5A27A 4II9A 3F0AA 4KORA 3I9SA 1Z8LA 4FUUA 3PGPA 2I79A 3I1UA 4JXRA 4F9VA 1QSTA 2PE3A 2A4NA 1ARMA 1PYTB 4ZGYB 1XOVA 1LRZA 4A30A 3KR5A 1GHEA 3B3WA 1IU8A 1VGYA 2NSMA 3RYOA 2JEWA 2G9DA 3SXOA 5LYLA 3FRMA 3B2YA 3SI0A 2Q7SA 4RI1A 4GM5A 4OAEA 3ZZIA 3IEHA 1YVKA 1TF9A 2R7HA 3D2PA 3TC8A 4MFJA 3C26A 2Z10A 5AG7A 5G1ZA 3S6FA 2EUIA 2ODFA 3BJ7A 4MHNA 1KUYA 4P6YA 3L2NA 4MI4A 4YRHA 1AYEA 1M4IA 2REEA 1OBRA 1S7KA 2PJBA 4R76A 4XPDB 3R9FA 1XMTA 4PXCA 3LWUA 2J9AA 2IJZA 2EVNA 3DR6A 4HNYB 2BEIA 2PJ1A 3KQZA 5JQ4A 4NGTA 3VARA 5C88A 4P4BA 2OZHA 4NFRA 3KHXA 4E2AA 3NE7A 2ZEPA 1KUXA 2B5GB 4XPLA 1UFHA 3D7HA 3PFOA 4KVME 4JZ0A 4W9YA 2PJ0A 1EE3P 4MFQA 3R9EA 4Z65A 2ATRA 4UWIA 2PJ5A 5LRJA 3H8EA 4UFVA 1TF8A 1CJWA 1Q2YA 4FD4A 3TCVA 2QVPA 2ZW7A 4NEXA 1FNOA 2B3UA 3P2FA 5G22A 2DPTA 3DDDA 2VEZA 1IGBA 2EK8A 5ISVA 3GB0A 1YLOA 3KQXA 1R3NA 2Z0ZA 3GYAA 3F5BA 2B4DA 2OZGA 4OC4A 3IWWA 4U9YA 1M1DA 4IK2A 3FH4A 1Q7LA 4JXQA 4B5OA 1BOBA 4L8AA 2XEIA 4DNCA 4JYWA 2Q7BA 2C6GA 4IHMA 4CAXA 4FWUA 3R95A 2Q04A 5THWA 1YREA 1BPNA 1CG2A 5DWNA 1WK4A 3EY5A 3GLJA 4ONWA 4QB9A 2CF4A 4KLWA 4UIBA 3SHPA 4DJLA 4KS9A 2OH1A 4PQAA 4KSAA 2ZOFA 1M4GA 4Q38A 4ZBGA 3V7ZA 3D2MA 1KZFA 2XEGA 2CNTA 2PJ4A 4M3SA 4MCSA 1F2PA 2HC9A 2HQYA 3IU2A 5D8NA 3TTHA 4QVTA 4C2XA 2Z3PA 2NMTA 3H5ZA 2ZEFA 2ZELA 1CP7A 3FVLA 3JTKA 4Y49B 2BL1A 5EC4A 3SJGA 4AXVA 4EFDA 2F7VA 4OIWA 2EK9A 2AE6A 1S5KA 1PCAA 3SJXA 2ZEOA 5HVGA 1BPMA 4MCRA 3IJ3A 5LRKA 1HDUA 4MFLA 2B4DB 1NSLA 4RUHA 4UWJA 1FY7A 5F46A 2Q44A 2RFHA 4QUSA 3UY5A 2IMOA 2AFSA 2PJ7A 4OC2A 3T90A 2GFQA 3QNVA 1GYTA 4L89A 2V8GA 4GXHA 2BCOA 2XEJA 4LQGA 3MRUA 1R57A 4F0XA 3QAYA 3TOAA 4AVBA 1J4JA 2OR4A 3PBEA 4JWPA 1XBUA 4R3LA 2VBQA 3BJ8A 1K4JA 3SJFA 2Z3LA 3TO6A 1LAPA 4ZYQA 3DNSA 1QSRA 3PB4X 3IGRA 3A9LA 3TO9A 3JRUA 3SI2A 1YX0A 3PEIA 1QSNA 2YNCA 4CRZB 3SI1A 4MHPA 2EWBA 4OMEA 4A95A 2G3TA 2VQYA 4M6HA 2IQ6A 3B3CA 2YNCC 2EBJA 3MGDA 4Q36A 5F48A 3LODA 3FECA 2RB7A 2WPXA 2HUZA 1M44A 1S7FA 2C27A 4ZI6A 3GIUA 3LD2A 4F8ZA 3FNCA 5D29A 4UCPA 3B8GA 3G8WA 4IAVA 2OOTA 4KUAA 2JBJA 1Y0RA 5DS0A 4ZY2A 1YGHA 1TXRA 3NH8A 4KSIA 2AFXA 5AG4A 3LMSA 1JQGA 2PJAA 5HVFA 2AFMA 1Z5RA 3IIBA 4U9ZA 4EVYA 2Q0YA 2V8DA 3KI9A 4B11A 4CPAA 2R98A 3TOBA 3R96A 3B3SA 4A33A 2FL4A 4ZX8A 3D68A 3JVNA 4CGNA 3WR7A 5LYIA 4JLYA 4I49A 4J3GA 1HEEA 3KHZA 4AG9A 4C7HA 1Y9KA 3CPXA 4UCNA 4UEZA 3HLPA 4FD7A 4TWEA 5G21A 4X5KA 5F09A 4ONUA 2P6EA 1JWQA 3FYNA 2ZXVA 5HVHA 4R8FA 1YVOA 2FS5A 4KOWA 3WT4A 1CX8A 2O28A 3FBUA 1I12A 5K8PA 1QSMA 4U5YA 2X7BA 3RAMA 5LYFA 3N5FA 2XEFA 2RC4A 5J8CA 2V77A 2PVWA 1MJBA 4E8OA 3GY9A 4C68A 5IX3A 3DSBA 2VL1A 4OC5A 1U6MA 1XE4A 2YNEA 3PB6X 3HUVA 3PFEA 1IY7A 4C2YA 4CAWA 2H5MA 2Q51A 3IWGA 4EWTA 3VWEA 5H86A 1Y7EA 1BAVA 1I1DA 1YR0A 3K9UA 3PBBA 4HNWB 1A2ZA 3NFZA 2R1IA 3S9NA 1Y0YA 4MCQA 1IYLA 1DTDA 2NYQA 1MK4A 3KZWA 4AG7A 4JD6A 4NGPA 3NA6A 1TKFA 2ZENA 3NH5A 4MRIA 4B10A 5G20A 1S7NA 4KOXA 4PV6A 2F8HA 2JBKA 5AG6A 4CYPA 3W6SA 4B5PA 3W91A 1XEBA 4P44A 4Y49C 5E96A 1YQEA 1Z8XA 3H8GA 4YFJA 2OZUA 4OC1A 2HV2A 4UFXA 3D4UA 3IC1A 4A37A 2PSWA 5HXDA 2GLJA 2VXKA 4YGOA 2PRBA 4MHDA 5KTCA 2I3CA 4NSQA 2GREA 5AGEA 4H2KA 4B12A 2KCWA 4RS2A 2PIZA 2Z3MA 4LQ6A 4BINA 1TIQA 4F0YA 3DGVA 4HKFA 3D3SA 2DEAA 4KUBA 1MJ9A 1Z8WA 3GKRA 4KOYA 3D8PA 3BI0A 3I3GA 4C2ZA 1YW6A 2AJ6A 2POKA 2VZYA 3S6HA 3PRTA 3WC5A 4B6ZA 2GIVA 2JDDA 2YNDA 1ZLHA 4XNHC 3B7IA 2PVVA 2BUEA 1IICA 3RBUA 1S60A 5C82A 2QMLA 4MHZA 3KR4A 1HDQA 3QAHA 4TNUA 5IV0A 3ISZA 2BO9A 1XFOA 4CAVA 4IF5A 4R87A 1IOFA 2Q4VA 3B3TA 3CDXA 3F8KA 4OADA 3VH9A 1PU9A 3N7ZA 3DR8A 1ON0A 5EBVA 2P6FA 2FCKA 2FE7A 3EXNA 2CNSA 2FXFA 2PQ8A 1ELLP 1NMTA 2PRQA 1TKHA 1I21A 2Y0MA 4KZTA 4ZY0A 4KLVA 3H8FA 1P4NA 3DLJA 4DYOA 2VZZA 3PB7X 1KUVA 4FD6A 5F49A 1ZG8A
chains in the Genus database with same CATH topology
1S7LA 3SXNA 4CGMA 1B6BA 1Z9UA 4AVCA 5IB0A 5J8FA 2QECA 1Z4RA 3JUWA 1YK3A 4XNHB 2B3VA 3FXTA 5DWMA 4MFPA 2Z3NA 4B13A 2P0WA 2B58A 2J8MA 1RO5A 1WWZA 4B14A 2WPWA 1Q2CA 3KKWA 4ORFA 2ZW5A 4A32A 1RXTA 4QBJA 3S6KA 4C7IA 4H6ZA 1XIXA 3H4QA 2Z3KA 3CXQA 2FIAA 2PR8A 1V0CA 1P0HA 3EO4A 2B4BA 4KSFA 1BO4A 2BSWA 5A28A 1NE9A 4KOTA 4PK3A 2B5GA 5KTDA 2JDCA 2QIRA 1L0CA 2YGWA 5BWAB 5JPHA 4KOUA 2I00A 4BMHA 3P2HA 4HNXB 2Z3OA 2F5IA 2Z11A 3S6GA 2J8NA 4CRYB 4CYNA 3CXSA 2ARHA 1QSOA 5KTAA 1PUAA 1B87A 3OWCA 1M4DA 3BLNA 2JEVA 3W6XA 1Y7RA 3PP9A 4PSXA 4UCMA 4AB7A 2Q4YA 1Z4EA 4OLLA 1YLEA 2FT0A 2ZPAA 3IWEA 3QB8A 3TO7A 4F6AA 2REFA 3R1KA 5F47A 3FB3A 4FD5A 3EC4A 4R57A 3V8IA 2D4PA 4GS4A 4UA3A 4CS0B 4H6UA 2CXAA 4IUSA 1MJAA 2FSRA 3CXPA 2ZW6A 1Q2DA 3E0KA 2WUUA 4KOVA 4AVAA 4QC6A 3ZJ0A 2JLMA 4R3KA 4A2ZA 2DPSA 2DXQA 1S3ZA 4MY3A 4UFWA 2GE3A 1IIDA 4LUAA 2P6GA 3PZJA 4PK2A 5I0CA 2WSAA 4CYQA 3TE4A 3G3SA 1ZO0A 2OU2A 5HMNA 1IB1E 5H84A 2ZW4A 4CYOA 4JJXA 2PDOA 4CAEA 4B5PB 2G3AA 4CGLA 4KVXA 4MBUA 3FIXA 2FIWA 1OZPA 1N71A 4R9MA 4UBRA 3IU1A 4M85A 5AG5A 3VWDA 3T9YA 1XF8A 4CGPA 2R8VA 4A31A 1SQHA 1Y9WA 3EFAA 2G0BA 2J8RA 4H89A 4E0AA 4CAFA 2K5TA 4CGOA 4PSWA 2OB0A 2VI7A 2D4OA 2IL4A 4MFZA 4K30A 2PC1A 2CY2A 1VHSA 1CM0A 3TFYA 4NCZA 4NF1A 5GCNA 4KOSA 3TT2A 1IYKA 5CNPA 1VKCA 4MFKA 3R9GA 4KVOE 4MJ8A 2PR1A 2CNMA 2GANA 4LX9A 4NXYA 5FVJA 5HH1A 4XPDC 4MY0A 4XPKA 5A27A 4II9A 3F0AA 4KORA 3I9SA 3PGPA 2I79A 4JXRA 1QSTA 2A4NA 4ZGYB 1LRZA 4A30A 1GHEA 3RYOA 3SXOA 3FRMA 4RI1A 4OAEA 3ZZIA 1YVKA 3D2PA 2R7HA 4MFJA 3C26A 2Z10A 5AG7A 5G1ZA 3S6FA 2EUIA 3BJ7A 1KUYA 4MI4A 4YRHA 1M4IA 2REEA 1S7KA 4XPDB 3R9FA 1XMTA 2EVNA 3DR6A 4HNYB 2BEIA 5JQ4A 5C88A 2OZHA 4E2AA 3NE7A 1KUXA 2B5GB 4XPLA 1UFHA 4KVME 4MFQA 3R9EA 2ATRA 4UWIA 4UFVA 1CJWA 1Q2YA 4FD4A 3TCVA 2ZW7A 4NEXA 2B3UA 3P2FA 5G22A 2DPTA 3DDDA 2VEZA 5ISVA 2Z0ZA 3GYAA 3F5BA 2B4DA 2OZGA 4U9YA 1M1DA 4JXQA 4B5OA 1BOBA 4L8AA 4DNCA 2Q7BA 4CAXA 3R95A 2Q04A 1YREA 5DWNA 1WK4A 3EY5A 4QB9A 4KLWA 3SHPA 4KS9A 2OH1A 4KSAA 1M4GA 4Q38A 4ZBGA 3D2MA 1KZFA 2CNTA 4M3SA 2HQYA 3IU2A 3TTHA 4QVTA 4C2XA 2Z3PA 2NMTA 3H5ZA 3JTKA 4Y49B 2BL1A 5EC4A 2AE6A 1S5KA 4MFLA 2B4DB 1NSLA 4UWJA 1FY7A 5F46A 2Q44A 4QUSA 3UY5A 3T90A 4L89A 1R57A 4F0XA 3TOAA 4AVBA 1J4JA 4JWPA 4R3LA 2VBQA 3BJ8A 1K4JA 2Z3LA 3TO6A 3DNSA 1QSRA 3IGRA 3A9LA 3TO9A 1YX0A 4CRZB 1QSNA 2YNCA 4A95A 2G3TA 2VQYA 2YNCC 3MGDA 4Q36A 5F48A 3LODA 2WPXA 2HUZA 1M44A 1S7FA 2C27A 3LD2A 3FNCA 4UCPA 3B8GA 3G8WA 4KUAA 1YGHA 5AG4A 4U9ZA 4EVYA 2Q0YA 4B11A 2R98A 3TOBA 3R96A 4A33A 2FL4A 3JVNA 4CGNA 3WR7A 4JLYA 4I49A 4J3GA 4AG9A 4C7HA 1Y9KA 4UCNA 4FD7A 5G21A 4X5KA 4ONUA 2P6EA 3FYNA 2ZXVA 1YVOA 2FS5A 4KOWA 2O28A 3FBUA 1I12A 1QSMA 4U5YA 2X7BA 2RC4A 5J8CA 1MJBA 4E8OA 3GY9A 4C68A 5IX3A 3DSBA 1U6MA 1XE4A 2YNEA 4C2YA 4CAWA 2H5MA 3IWGA 3VWEA 5H86A 4HNWB 1I1DA 3K9UA 1YR0A 2R1IA 1IYLA 1MK4A 4AG7A 4JD6A 4B10A 5G20A 1S7NA 4KOXA 4PV6A 5AG6A 4CYPA 3W6SA 4B5PA 3W91A 1XEBA 5E96A 4Y49C 4YFJA 2OZUA 2HV2A 4UFXA 2PSWA 2VXKA 4YGOA 2PRBA 4MHDA 5KTCA 4NSQA 5AGEA 4B12A 2KCWA 4RS2A 2Z3MA 1TIQA 4F0YA 4HKFA 3D3SA 4KUBA 1MJ9A 3GKRA 4KOYA 3D8PA 3I3GA 4C2ZA 2AJ6A 2VZYA 3S6HA 2GIVA 2JDDA 2YNDA 4XNHC 2BUEA 1IICA 1S60A 5C82A 2QMLA 3QAHA 5IV0A 4CAVA 4IF5A 4R87A 4BBHA 2Q4VA 3F8KA 4OADA 1PU9A 3N7ZA 3DR8A 1ON0A 5EBVA 2P6FA 2FCKA 3EXNA 2FE7A 2CNSA 2FXFA 2PQ8A 1NMTA 1I21A 2Y0MA 4KZTA 4KLVA 1P4NA 2VZZA 1KUVA 4FD6A 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7L A;  3SXN A;  1B6B A;  1Z9U A;  4AVC A;  5IB0 A;  5J8F A;  2QEC A;  1Z4R A;  3JUW A;  1YK3 A;  4XNH B;  2B3V A;  3FXT A;  5DWM A;  2P0W A;  2B58 A;  2J8M A;  1RO5 A;  1WWZ A;  2WPW A;  1Q2C A;  3KKW A;  4ORF A;  2ZW5 A;  1RXT A;  4QBJ A;  3S6K A;  4H6Z A;  1XIX A;  3H4Q A;  3CXQ A;  2FIA A;  2PR8 A;  1V0C A;  1P0H A;  3EO4 A;  2B4B A;  1BO4 A;  2BSW A;  1NE9 A;  4KOT A;  4PK3 A;  2B5G A;  5KTD A;  2JDC A;  2QIR A;  1L0C A;  5JPH A;  4KOU A;  2I00 A;  4BMH A;  3P2H A;  4HNX B;  2F5I A;  2Z11 A;  3S6G A;  2J8N A;  4CRY B;  3CXS A;  2ARH A;  1QSO A;  5KTA A;  1PUA A;  1B87 A;  3OWC A;  1M4D A;  3BLN A;  2JEV A;  3W6X A;  1Y7R A;  3PP9 A;  4PSX A;  4AB7 A;  2Q4Y A;  1Z4E A;  4OLL A;  1YLE A;  2FT0 A;  2ZPA A;  3QB8 A;  3TO7 A;  4F6A A;  2REF A;  3R1K A;  5F47 A;  3FB3 A;  4FD5 A;  3EC4 A;  4R57 A;  3V8I A;  2D4P A;  4GS4 A;  4UA3 A;  4CS0 B;  4H6U A;  4IUS A;  1MJA A;  2FSR A;  3CXP A;  2ZW6 A;  1Q2D A;  3E0K A;  4KOV A;  4AVA A;  4QC6 A;  3ZJ0 A;  2JLM A;  4R3K A;  2DXQ A;  1S3Z A;  4MY3 A;  2GE3 A;  1IID A;  4LUA A;  2P6G A;  3PZJ A;  4PK2 A;  5I0C A;  3TE4 A;  3G3S A;  2OU2 A;  5HMN A;  1IB1 E;  5H84 A;  2ZW4 A;  4JJX A;  2PDO A;  4B5P B;  2G3A A;  4KVX A;  4MBU A;  3FIX A;  2FIW A;  1OZP A;  1N71 A;  4R9M A;  4UBR A;  4M85 A;  3VWD A;  3T9Y A;  1XF8 A;  2R8V A;  1SQH A;  1Y9W A;  3EFA A;  2G0B A;  2J8R A;  4H89 A;  4E0A A;  2K5T A;  4PSW A;  2OB0 A;  2VI7 A;  2D4O A;  2IL4 A;  4K30 A;  2PC1 A;  2CY2 A;  1VHS A;  1CM0 A;  3TFY A;  4NCZ A;  4NF1 A;  5GCN A;  4KOS A;  3TT2 A;  1IYK A;  5CNP A;  1VKC A;  3R9G A;  4KVO E;  4MJ8 A;  2PR1 A;  2CNM A;  2GAN A;  4LX9 A;  4NXY A;  5FVJ A;  5HH1 A;  4XPD C;  4MY0 A;  4XPK A;  4II9 A;  3F0A A;  4KOR A;  3I9S A;  3PGP A;  2I79 A;  4JXR A;  1QST A;  2A4N A;  1LRZ A;  1GHE A;  3RYO A;  3SXO A;  3FRM A;  4RI1 A;  4OAE A;  3ZZI A;  1YVK A;  3D2P A;  2R7H A;  3C26 A;  2Z10 A;  3S6F A;  2EUI A;  3BJ7 A;  1KUY A;  4MI4 A;  4YRH A;  1M4I A;  2REE A;  1S7K A;  4XPD B;  3R9F A;  1XMT A;  2EVN A;  3DR6 A;  4HNY B;  2BEI A;  5JQ4 A;  5C88 A;  2OZH A;  4E2A A;  3NE7 A;  1KUX A;  2B5G B;  4XPL A;  1UFH A;  4KVM E;  3R9E A;  2ATR A;  4UWI A;  1CJW A;  1Q2Y A;  4FD4 A;  3TCV A;  2ZW7 A;  4NEX A;  2B3U A;  3P2F A;  3DDD A;  2VEZ A;  5ISV A;  2Z0Z A;  3GYA A;  3F5B A;  2B4D A;  2OZG A;  4U9Y A;  1M1D A;  4JXQ A;  4B5O A;  1BOB A;  4L8A A;  4DNC A;  2Q7B A;  4CAX A;  3R95 A;  2Q04 A;  1YRE A;  5DWN A;  1WK4 A;  3EY5 A;  4QB9 A;  4KLW A;  3SHP A;  2OH1 A;  1M4G A;  4ZBG A;  3D2M A;  1KZF A;  2CNT A;  4M3S A;  2HQY A;  3TTH A;  4QVT A;  2NMT A;  4Y49 B;  2BL1 A;  5EC4 A;  2AE6 A;  1S5K A;  2B4D B;  1NSL A;  4UWJ A;  1FY7 A;  5F46 A;  2Q44 A;  4QUS A;  3UY5 A;  3T90 A;  4L89 A;  1R57 A;  3TOA A;  4AVB A;  1J4J A;  4JWP A;  4R3L A;  2VBQ A;  3BJ8 A;  1K4J A;  3TO6 A;  3DNS A;  1QSR A;  3IGR A;  3TO9 A;  1YX0 A;  4CRZ B;  1QSN A;  2G3T A;  2VQY A;  3MGD A;  5F48 A;  3LOD A;  2WPX A;  2HUZ A;  1M44 A;  1S7F A;  2C27 A;  3LD2 A;  3FNC A;  3B8G A;  3G8W A;  4KUA A;  1YGH A;  4U9Z A;  4EVY A;  2Q0Y A;  2R98 A;  3TOB A;  3R96 A;  2FL4 A;  3JVN A;  3WR7 A;  4JLY A;  4I49 A;  4J3G A;  4AG9 A;  1Y9K A;  4FD7 A;  4X5K A;  4ONU A;  2P6E A;  3FYN A;  2ZXV A;  1YVO A;  2FS5 A;  4KOW A;  2O28 A;  3FBU A;  1I12 A;  1QSM A;  4U5Y A;  2X7B A;  2RC4 A;  5J8C A;  1MJB A;  4E8O A;  3GY9 A;  5IX3 A;  3DSB A;  1U6M A;  1XE4 A;  4CAW A;  2H5M A;  3IWG A;  3VWE A;  5H86 A;  4HNW B;  1I1D A;  3K9U A;  1YR0 A;  2R1I A;  1IYL A;  1MK4 A;  4AG7 A;  4JD6 A;  1S7N A;  4KOX A;  4PV6 A;  3W6S A;  4B5P A;  3W91 A;  1XEB A;  5E96 A;  4Y49 C;  4YFJ A;  2OZU A;  2HV2 A;  2PSW A;  2VXK A;  4YGO A;  2PRB A;  4MHD A;  5KTC A;  4NSQ A;  2KCW A;  4RS2 A;  1TIQ A;  4F0Y A;  4HKF A;  3D3S A;  4KUB A;  1MJ9 A;  3GKR A;  4KOY A;  3D8P A;  3I3G A;  2AJ6 A;  2VZY A;  3S6H A;  2GIV A;  2JDD A;  4XNH C;  2BUE A;  1IIC A;  1S60 A;  5C82 A;  2QML A;  3QAH A;  5IV0 A;  4CAV A;  4IF5 A;  4R87 A;  2Q4V A;  3F8K A;  4OAD A;  1PU9 A;  3N7Z A;  3DR8 A;  1ON0 A;  5EBV A;  2P6F A;  2FCK A;  3EXN A;  2FE7 A;  2CNS A;  2FXF A;  2PQ8 A;  1NMT A;  1I21 A;  2Y0M A;  4KZT A;  4KLV A;  1P4N A;  2VZZ A;  1KUV A;  4FD6 A;  5F49 A; 
#chains in the Genus database with same CATH topology
 2ZOG A;  1S7L A;  3SXN A;  4CGM A;  1B6B A;  1Z9U A;  4BBH A;  2C1C A;  3GUX A;  3S9M A;  4AVC A;  5IB0 A;  3K2K A;  5J8F A;  2QEC A;  1Z4R A;  2ABZ A;  2QJ8 A;  2DF5 A;  3FED A;  3VAT A;  3JUW A;  1YK3 A;  4XNH B;  2B3V A;  3FXT A;  5DWM A;  5LYD A;  1ZG7 A;  4G1P A;  4MFP A;  2Z3N A;  1AUG A;  4B13 A;  5K8N A;  1ZLI A;  2P0W A;  2B58 A;  3B35 A;  2J8M A;  3D66 A;  1RO5 A;  1WWZ A;  3CT9 A;  4B14 A;  2WPW A;  1Q2C A;  3KKW A;  4M6G A;  2AFO A;  4ORF A;  4P4E A;  2ZW5 A;  5J1Q A;  4A32 A;  1RXT A;  2FVG A;  4BD9 A;  4OC3 A;  4P4F A;  4QBJ A;  3PB9 X;  3S6K A;  4MHY A;  4C7I A;  1UWY A;  4P4D A;  4H6Z A;  2CTB A;  1XIX A;  2V8H A;  3WC6 A;  8CPA A;  2V8V A;  4UEF A;  3H4Q A;  2Z3K A;  5ELY A;  1YSJ A;  3CXQ A;  2FIA A;  2PR8 A;  4NJQ A;  1V0C A;  1XMB A;  1P0H A;  3EO4 A;  4OC0 A;  2AFZ A;  5LRG A;  4M6I A;  2B4B A;  4KSF A;  1BO4 A;  2BSW A;  3IO1 A;  2ZEH A;  5A28 A;  3WC7 A;  1NE9 A;  1YME A;  4KOT A;  1AMP A;  2B5G A;  4MXU A;  4PK3 A;  3BHX A;  5KTD A;  2JDC A;  2QIR A;  3FEE A;  4A38 A;  5I4M A;  3FJU A;  1L0C A;  2YGW A;  5BWA B;  5JPH A;  5JM6 A;  2GU2 A;  4KOU A;  4YU9 A;  1F57 A;  2I00 A;  4BMH A;  5JGF A;  3P2H A;  4MCP A;  4HNX B;  2Z3O A;  2F5I A;  5K8M A;  2Z11 A;  3S6G A;  1LAM A;  3NH4 A;  2J8N A;  4CRY B;  4CYN A;  3CXS A;  2ARH A;  1QSO A;  1YW4 A;  5KTA A;  1PUA A;  1B87 A;  1Z8T A;  3OWC A;  4PXB A;  4UF4 A;  1M4D A;  3BLN A;  2Q43 A;  4A94 A;  3LAC A;  2JEV A;  1TKJ A;  4OP4 A;  1CPS A;  4NGR A;  3D7D A;  4P10 A;  3MN8 A;  3BI1 A;  4WWV A;  1ARL A;  3W6X A;  1Y7R A;  1LCP A;  2PJ2 A;  1QQ9 A;  2EO8 A;  3PP9 A;  4OKO A;  4PSX A;  3RO0 A;  4UCM A;  2ZEE A;  4AB7 A;  2Q4Y A;  1Z4E A;  4YWY A;  4OLL A;  1YLE A;  1R43 A;  2FT0 A;  2O53 A;  2WYR A;  4P4I A;  2ZEG A;  2ZPA A;  3FX6 A;  3B3V A;  2PJC A;  3IWE A;  3K9T A;  2PJ9 A;  1X12 A;  3QB8 A;  3TO7 A;  3FF3 A;  4PXE A;  4F6A A;  2REF A;  3R1K A;  5F47 A;  4Q7A A;  3FB3 A;  1VIX A;  4FD5 A;  3D67 A;  4NJR A;  4EME A;  5CBM A;  3EC4 A;  4R57 A;  3V8I A;  2D4P A;  3D7G A;  4GS4 A;  4UA3 A;  2Q4Z A;  3S9L A;  4NGM A;  1LOK A;  5EMI A;  4CS0 B;  3FMC A;  4A39 A;  3CZX A;  2PJ8 A;  1LFW A;  2CXA A;  4H6U A;  4IUS A;  1MJA A;  2FSR A;  4PPZ A;  5CPA A;  2WZN A;  2ZW6 A;  1Q2D A;  3CXP A;  2WUU A;  3E0K A;  4KOV A;  4AVA A;  4R7M A;  4QC6 A;  4UEE A;  1BLL E;  4NGQ A;  2JLM A;  3ZJ0 A;  2O4H A;  3TX8 A;  1NSA A;  4R3K A;  2CIJ A;  1XJO A;  2DPS A;  2DXQ A;  1S3Z A;  4MY3 A;  4A2Z A;  4UFW A;  5JH9 A;  2AFW A;  6CPA A;  2GE3 A;  1IID A;  4LUA A;  2P6G A;  1LAN A;  3PZJ A;  4PK2 A;  5I0C A;  4PXD A;  2WSA A;  7CPA A;  4MMO A;  4CYQ A;  4WJB A;  3ISX A;  3RNZ A;  3TE4 A;  3G3S A;  1ZO0 A;  2OU2 A;  4X8I A;  2ZEM A;  2PIY A;  5HMN A;  4X3R A;  3KGQ A;  1IB1 E;  5H84 A;  2ANP A;  4F9U A;  2ZW4 A;  3KAS A;  1FT7 A;  4CYO A;  4JJX A;  2PDO A;  4CAE A;  4B5P B;  2AFU A;  3CPA A;  2G3A A;  4FAI A;  1F2O A;  3KL9 A;  4CGL A;  2PCU A;  4KVX A;  4MBU A;  2CTC A;  1Z2L A;  3FIX A;  4ZY1 A;  2FIW A;  2GLF A;  1OZP A;  1N71 A;  4K3N A;  4R9M A;  4UBR A;  3IU1 A;  4M85 A;  5AG5 A;  3VWD A;  3T9Y A;  4HPS A;  4DUK A;  3BXM A;  1XF8 A;  4CGP A;  2R8V A;  4FBE A;  2HB6 A;  5K8O A;  4A31 A;  1SQH A;  1Y9W A;  2QYV A;  2G0B A;  3EFA A;  2J8R A;  1CBX A;  4H89 A;  4RN7 A;  4E0A A;  1CP6 A;  4CAF A;  2K5T A;  4CGO A;  1X10 A;  4P4J A;  4PSW A;  1RTQ A;  5IB9 A;  1ZG9 A;  2OB0 A;  1DE4 C;  2VI7 A;  2D4O A;  2IL4 A;  3SJE A;  3IFE A;  2ZED A;  4MFZ A;  4K30 A;  2C6P A;  2PC1 A;  4ZX9 A;  4O23 A;  2CY2 A;  1VHS A;  4P45 A;  1CM0 A;  2PJ6 A;  4X2T A;  3V38 A;  3NE8 A;  3TFY A;  4R6T A;  2C6C A;  4NCZ A;  2BOA A;  4NF1 A;  3D7F A;  5GCN A;  1IOI A;  4KOS A;  3TT2 A;  2PJ3 A;  1IYK A;  4UIA A;  5CNP A;  3T8W A;  1VHO A;  1VKC A;  4MFK A;  3R9G A;  4KVO E;  4MJ8 A;  2PR1 A;  2CNM A;  1H8L A;  2GAN A;  4OID A;  1M4L A;  4NGN A;  4LX9 A;  4NGS A;  1XRY A;  4NXY A;  1CPX A;  1QMU A;  1VHE A;  3PB8 X;  3WAB A;  1KWM A;  1ELM P;  5FVJ A;  5HH1 A;  4XPD C;  4MY0 A;  4XPK A;  3RZA A;  5A27 A;  4II9 A;  3F0A A;  4KOR A;  3I9S A;  1Z8L A;  4FUU A;  3PGP A;  2I79 A;  3I1U A;  4JXR A;  4F9V A;  1QST A;  2PE3 A;  2A4N A;  1ARM A;  1PYT B;  4ZGY B;  1XOV A;  1LRZ A;  4A30 A;  3KR5 A;  1GHE A;  3B3W A;  1IU8 A;  1VGY A;  2NSM A;  3RYO A;  2JEW A;  2G9D A;  3SXO A;  5LYL A;  3FRM A;  3B2Y A;  3SI0 A;  2Q7S A;  4RI1 A;  4GM5 A;  4OAE A;  3ZZI A;  3IEH A;  1YVK A;  1TF9 A;  2R7H A;  3D2P A;  3TC8 A;  4MFJ A;  3C26 A;  2Z10 A;  5AG7 A;  5G1Z A;  3S6F A;  2EUI A;  2ODF A;  3BJ7 A;  4MHN A;  1KUY A;  4P6Y A;  3L2N A;  4MI4 A;  4YRH A;  1AYE A;  1M4I A;  2REE A;  1OBR A;  1S7K A;  2PJB A;  4R76 A;  4XPD B;  3R9F A;  1XMT A;  4PXC A;  3LWU A;  2J9A A;  2IJZ A;  2EVN A;  3DR6 A;  4HNY B;  2BEI A;  2PJ1 A;  3KQZ A;  5JQ4 A;  4NGT A;  3VAR A;  5C88 A;  4P4B A;  2OZH A;  4NFR A;  3KHX A;  4E2A A;  3NE7 A;  2ZEP A;  1KUX A;  2B5G B;  4XPL A;  1UFH A;  3D7H A;  3PFO A;  4KVM E;  4JZ0 A;  4W9Y A;  2PJ0 A;  1EE3 P;  4MFQ A;  3R9E A;  4Z65 A;  2ATR A;  4UWI A;  2PJ5 A;  5LRJ A;  3H8E A;  4UFV A;  1TF8 A;  1CJW A;  1Q2Y A;  4FD4 A;  3TCV A;  2QVP A;  2ZW7 A;  4NEX A;  1FNO A;  2B3U A;  3P2F A;  5G22 A;  2DPT A;  3DDD A;  2VEZ A;  1IGB A;  2EK8 A;  5ISV A;  3GB0 A;  1YLO A;  3KQX A;  1R3N A;  2Z0Z A;  3GYA A;  3F5B A;  2B4D A;  2OZG A;  4OC4 A;  3IWW A;  4U9Y A;  1M1D A;  4IK2 A;  3FH4 A;  1Q7L A;  4JXQ A;  4B5O A;  1BOB A;  4L8A A;  2XEI A;  4DNC A;  4JYW A;  2Q7B A;  2C6G A;  4IHM A;  4CAX A;  4FWU A;  3R95 A;  2Q04 A;  5THW A;  1YRE A;  1BPN A;  1CG2 A;  5DWN A;  1WK4 A;  3EY5 A;  3GLJ A;  4ONW A;  4QB9 A;  2CF4 A;  4KLW A;  4UIB A;  3SHP A;  4DJL A;  4KS9 A;  2OH1 A;  4PQA A;  4KSA A;  2ZOF A;  1M4G A;  4Q38 A;  4ZBG A;  3V7Z A;  3D2M A;  1KZF A;  2XEG A;  2CNT A;  2PJ4 A;  4M3S A;  4MCS A;  1F2P A;  2HC9 A;  2HQY A;  3IU2 A;  5D8N A;  3TTH A;  4QVT A;  4C2X A;  2Z3P A;  2NMT A;  3H5Z A;  2ZEF A;  2ZEL A;  1CP7 A;  3FVL A;  3JTK A;  4Y49 B;  2BL1 A;  5EC4 A;  3SJG A;  4AXV A;  4EFD A;  2F7V A;  4OIW A;  2EK9 A;  2AE6 A;  1S5K A;  1PCA A;  3SJX A;  2ZEO A;  5HVG A;  1BPM A;  4MCR A;  3IJ3 A;  5LRK A;  1HDU A;  4MFL A;  2B4D B;  1NSL A;  4RUH A;  4UWJ A;  1FY7 A;  5F46 A;  2Q44 A;  2RFH A;  4QUS A;  3UY5 A;  2IMO A;  2AFS A;  2PJ7 A;  4OC2 A;  3T90 A;  2GFQ A;  3QNV A;  1GYT A;  4L89 A;  2V8G A;  4GXH A;  2BCO A;  2XEJ A;  4LQG A;  3MRU A;  1R57 A;  4F0X A;  3QAY A;  3TOA A;  4AVB A;  1J4J A;  2OR4 A;  3PBE A;  4JWP A;  1XBU A;  4R3L A;  2VBQ A;  3BJ8 A;  1K4J A;  3SJF A;  2Z3L A;  3TO6 A;  1LAP A;  4ZYQ A;  3DNS A;  1QSR A;  3PB4 X;  3IGR A;  3A9L A;  3TO9 A;  3JRU A;  3SI2 A;  1YX0 A;  3PEI A;  1QSN A;  2YNC A;  4CRZ B;  3SI1 A;  4MHP A;  2EWB A;  4OME A;  4A95 A;  2G3T A;  2VQY A;  4M6H A;  2IQ6 A;  3B3C A;  2YNC C;  2EBJ A;  3MGD A;  4Q36 A;  5F48 A;  3LOD A;  3FEC A;  2RB7 A;  2WPX A;  2HUZ A;  1M44 A;  1S7F A;  2C27 A;  4ZI6 A;  3GIU A;  3LD2 A;  4F8Z A;  3FNC A;  5D29 A;  4UCP A;  3B8G A;  3G8W A;  4IAV A;  2OOT A;  4KUA A;  2JBJ A;  1Y0R A;  5DS0 A;  4ZY2 A;  1YGH A;  1TXR A;  3NH8 A;  4KSI A;  2AFX A;  5AG4 A;  3LMS A;  1JQG A;  2PJA A;  5HVF A;  2AFM A;  1Z5R A;  3IIB A;  4U9Z A;  4EVY A;  2Q0Y A;  2V8D A;  3KI9 A;  4B11 A;  4CPA A;  2R98 A;  3TOB A;  3R96 A;  3B3S A;  4A33 A;  2FL4 A;  4ZX8 A;  3D68 A;  3JVN A;  4CGN A;  3WR7 A;  5LYI A;  4JLY A;  4I49 A;  4J3G A;  1HEE A;  3KHZ A;  4AG9 A;  4C7H A;  1Y9K A;  3CPX A;  4UCN A;  4UEZ A;  3HLP A;  4FD7 A;  4TWE A;  5G21 A;  4X5K A;  5F09 A;  4ONU A;  2P6E A;  1JWQ A;  3FYN A;  2ZXV A;  5HVH A;  4R8F A;  1YVO A;  2FS5 A;  4KOW A;  3WT4 A;  1CX8 A;  2O28 A;  3FBU A;  1I12 A;  5K8P A;  1QSM A;  4U5Y A;  2X7B A;  3RAM A;  5LYF A;  3N5F A;  2XEF A;  2RC4 A;  5J8C A;  2V77 A;  2PVW A;  1MJB A;  4E8O A;  3GY9 A;  4C68 A;  5IX3 A;  3DSB A;  2VL1 A;  4OC5 A;  1U6M A;  1XE4 A;  2YNE A;  3PB6 X;  3HUV A;  3PFE A;  1IY7 A;  4C2Y A;  4CAW A;  2H5M A;  2Q51 A;  3IWG A;  4EWT A;  3VWE A;  5H86 A;  1Y7E A;  1BAV A;  1I1D A;  1YR0 A;  3K9U A;  3PBB A;  4HNW B;  1A2Z A;  3NFZ A;  2R1I A;  3S9N A;  1Y0Y A;  4MCQ A;  1IYL A;  1DTD A;  2NYQ A;  1MK4 A;  3KZW A;  4AG7 A;  4JD6 A;  4NGP A;  3NA6 A;  1TKF A;  2ZEN A;  3NH5 A;  4MRI A;  4B10 A;  5G20 A;  1S7N A;  4KOX A;  4PV6 A;  2F8H A;  2JBK A;  5AG6 A;  4CYP A;  3W6S A;  4B5P A;  3W91 A;  1XEB A;  4P44 A;  4Y49 C;  5E96 A;  1YQE A;  1Z8X A;  3H8G A;  4YFJ A;  2OZU A;  4OC1 A;  2HV2 A;  4UFX A;  3D4U A;  3IC1 A;  4A37 A;  2PSW A;  5HXD A;  2GLJ A;  2VXK A;  4YGO A;  2PRB A;  4MHD A;  5KTC A;  2I3C A;  4NSQ A;  2GRE A;  5AGE A;  4H2K A;  4B12 A;  2KCW A;  4RS2 A;  2PIZ A;  2Z3M A;  4LQ6 A;  4BIN A;  1TIQ A;  4F0Y A;  3DGV A;  4HKF A;  3D3S A;  2DEA A;  4KUB A;  1MJ9 A;  1Z8W A;  3GKR A;  4KOY A;  3D8P A;  3BI0 A;  3I3G A;  4C2Z A;  1YW6 A;  2AJ6 A;  2POK A;  2VZY A;  3S6H A;  3PRT A;  3WC5 A;  4B6Z A;  2GIV A;  2JDD A;  2YND A;  1ZLH A;  4XNH C;  3B7I A;  2PVV A;  2BUE A;  1IIC A;  3RBU A;  1S60 A;  5C82 A;  2QML A;  4MHZ A;  3KR4 A;  1HDQ A;  3QAH A;  4TNU A;  5IV0 A;  3ISZ A;  2BO9 A;  1XFO A;  4CAV A;  4IF5 A;  4R87 A;  1IOF A;  2Q4V A;  3B3T A;  3CDX A;  3F8K A;  4OAD A;  3VH9 A;  1PU9 A;  3N7Z A;  3DR8 A;  1ON0 A;  5EBV A;  2P6F A;  2FCK A;  2FE7 A;  3EXN A;  2CNS A;  2FXF A;  2PQ8 A;  1ELL P;  1NMT A;  2PRQ A;  1TKH A;  1I21 A;  2Y0M A;  4KZT A;  4ZY0 A;  4KLV A;  3H8F A;  1P4N A;  3DLJ A;  4DYO A;  2VZZ A;  3PB7 X;  1KUV A;  4FD6 A;  5F49 A;  1ZG8 A; 
#chains in the Genus database with same CATH homology
 1S7L A;  3SXN A;  4CGM A;  1B6B A;  1Z9U A;  4AVC A;  5IB0 A;  5J8F A;  2QEC A;  1Z4R A;  3JUW A;  1YK3 A;  4XNH B;  2B3V A;  3FXT A;  5DWM A;  4MFP A;  2Z3N A;  4B13 A;  2P0W A;  2B58 A;  2J8M A;  1RO5 A;  1WWZ A;  4B14 A;  2WPW A;  1Q2C A;  3KKW A;  4ORF A;  2ZW5 A;  4A32 A;  1RXT A;  4QBJ A;  3S6K A;  4C7I A;  4H6Z A;  1XIX A;  3H4Q A;  2Z3K A;  3CXQ A;  2FIA A;  2PR8 A;  1V0C A;  1P0H A;  3EO4 A;  2B4B A;  4KSF A;  1BO4 A;  2BSW A;  5A28 A;  1NE9 A;  4KOT A;  4PK3 A;  2B5G A;  5KTD A;  2JDC A;  2QIR A;  1L0C A;  2YGW A;  5BWA B;  5JPH A;  4KOU A;  2I00 A;  4BMH A;  3P2H A;  4HNX B;  2Z3O A;  2F5I A;  2Z11 A;  3S6G A;  2J8N A;  4CRY B;  4CYN A;  3CXS A;  2ARH A;  1QSO A;  5KTA A;  1PUA A;  1B87 A;  3OWC A;  1M4D A;  3BLN A;  2JEV A;  3W6X A;  1Y7R A;  3PP9 A;  4PSX A;  4UCM A;  4AB7 A;  2Q4Y A;  1Z4E A;  4OLL A;  1YLE A;  2FT0 A;  2ZPA A;  3IWE A;  3QB8 A;  3TO7 A;  4F6A A;  2REF A;  3R1K A;  5F47 A;  3FB3 A;  4FD5 A;  3EC4 A;  4R57 A;  3V8I A;  2D4P A;  4GS4 A;  4UA3 A;  4CS0 B;  4H6U A;  2CXA A;  4IUS A;  1MJA A;  2FSR A;  3CXP A;  2ZW6 A;  1Q2D A;  3E0K A;  2WUU A;  4KOV A;  4AVA A;  4QC6 A;  3ZJ0 A;  2JLM A;  4R3K A;  4A2Z A;  2DPS A;  2DXQ A;  1S3Z A;  4MY3 A;  4UFW A;  2GE3 A;  1IID A;  4LUA A;  2P6G A;  3PZJ A;  4PK2 A;  5I0C A;  2WSA A;  4CYQ A;  3TE4 A;  3G3S A;  1ZO0 A;  2OU2 A;  5HMN A;  1IB1 E;  5H84 A;  2ZW4 A;  4CYO A;  4JJX A;  2PDO A;  4CAE A;  4B5P B;  2G3A A;  4CGL A;  4KVX A;  4MBU A;  3FIX A;  2FIW A;  1OZP A;  1N71 A;  4R9M A;  4UBR A;  3IU1 A;  4M85 A;  5AG5 A;  3VWD A;  3T9Y A;  1XF8 A;  4CGP A;  2R8V A;  4A31 A;  1SQH A;  1Y9W A;  3EFA A;  2G0B A;  2J8R A;  4H89 A;  4E0A A;  4CAF A;  2K5T A;  4CGO A;  4PSW A;  2OB0 A;  2VI7 A;  2D4O A;  2IL4 A;  4MFZ A;  4K30 A;  2PC1 A;  2CY2 A;  1VHS A;  1CM0 A;  3TFY A;  4NCZ A;  4NF1 A;  5GCN A;  4KOS A;  3TT2 A;  1IYK A;  5CNP A;  1VKC A;  4MFK A;  3R9G A;  4KVO E;  4MJ8 A;  2PR1 A;  2CNM A;  2GAN A;  4LX9 A;  4NXY A;  5FVJ A;  5HH1 A;  4XPD C;  4MY0 A;  4XPK A;  5A27 A;  4II9 A;  3F0A A;  4KOR A;  3I9S A;  3PGP A;  2I79 A;  4JXR A;  1QST A;  2A4N A;  4ZGY B;  1LRZ A;  4A30 A;  1GHE A;  3RYO A;  3SXO A;  3FRM A;  4RI1 A;  4OAE A;  3ZZI A;  1YVK A;  3D2P A;  2R7H A;  4MFJ A;  3C26 A;  2Z10 A;  5AG7 A;  5G1Z A;  3S6F A;  2EUI A;  3BJ7 A;  1KUY A;  4MI4 A;  4YRH A;  1M4I A;  2REE A;  1S7K A;  4XPD B;  3R9F A;  1XMT A;  2EVN A;  3DR6 A;  4HNY B;  2BEI A;  5JQ4 A;  5C88 A;  2OZH A;  4E2A A;  3NE7 A;  1KUX A;  2B5G B;  4XPL A;  1UFH A;  4KVM E;  4MFQ A;  3R9E A;  2ATR A;  4UWI A;  4UFV A;  1CJW A;  1Q2Y A;  4FD4 A;  3TCV A;  2ZW7 A;  4NEX A;  2B3U A;  3P2F A;  5G22 A;  2DPT A;  3DDD A;  2VEZ A;  5ISV A;  2Z0Z A;  3GYA A;  3F5B A;  2B4D A;  2OZG A;  4U9Y A;  1M1D A;  4JXQ A;  4B5O A;  1BOB A;  4L8A A;  4DNC A;  2Q7B A;  4CAX A;  3R95 A;  2Q04 A;  1YRE A;  5DWN A;  1WK4 A;  3EY5 A;  4QB9 A;  4KLW A;  3SHP A;  4KS9 A;  2OH1 A;  4KSA A;  1M4G A;  4Q38 A;  4ZBG A;  3D2M A;  1KZF A;  2CNT A;  4M3S A;  2HQY A;  3IU2 A;  3TTH A;  4QVT A;  4C2X A;  2Z3P A;  2NMT A;  3H5Z A;  3JTK A;  4Y49 B;  2BL1 A;  5EC4 A;  2AE6 A;  1S5K A;  4MFL A;  2B4D B;  1NSL A;  4UWJ A;  1FY7 A;  5F46 A;  2Q44 A;  4QUS A;  3UY5 A;  3T90 A;  4L89 A;  1R57 A;  4F0X A;  3TOA A;  4AVB A;  1J4J A;  4JWP A;  4R3L A;  2VBQ A;  3BJ8 A;  1K4J A;  2Z3L A;  3TO6 A;  3DNS A;  1QSR A;  3IGR A;  3A9L A;  3TO9 A;  1YX0 A;  4CRZ B;  1QSN A;  2YNC A;  4A95 A;  2G3T A;  2VQY A;  2YNC C;  3MGD A;  4Q36 A;  5F48 A;  3LOD A;  2WPX A;  2HUZ A;  1M44 A;  1S7F A;  2C27 A;  3LD2 A;  3FNC A;  4UCP A;  3B8G A;  3G8W A;  4KUA A;  1YGH A;  5AG4 A;  4U9Z A;  4EVY A;  2Q0Y A;  4B11 A;  2R98 A;  3TOB A;  3R96 A;  4A33 A;  2FL4 A;  3JVN A;  4CGN A;  3WR7 A;  4JLY A;  4I49 A;  4J3G A;  4AG9 A;  4C7H A;  1Y9K A;  4UCN A;  4FD7 A;  5G21 A;  4X5K A;  4ONU A;  2P6E A;  3FYN A;  2ZXV A;  1YVO A;  2FS5 A;  4KOW A;  2O28 A;  3FBU A;  1I12 A;  1QSM A;  4U5Y A;  2X7B A;  2RC4 A;  5J8C A;  1MJB A;  4E8O A;  3GY9 A;  4C68 A;  5IX3 A;  3DSB A;  1U6M A;  1XE4 A;  2YNE A;  4C2Y A;  4CAW A;  2H5M A;  3IWG A;  3VWE A;  5H86 A;  4HNW B;  1I1D A;  3K9U A;  1YR0 A;  2R1I A;  1IYL A;  1MK4 A;  4AG7 A;  4JD6 A;  4B10 A;  5G20 A;  1S7N A;  4KOX A;  4PV6 A;  5AG6 A;  4CYP A;  3W6S A;  4B5P A;  3W91 A;  1XEB A;  5E96 A;  4Y49 C;  4YFJ A;  2OZU A;  2HV2 A;  4UFX A;  2PSW A;  2VXK A;  4YGO A;  2PRB A;  4MHD A;  5KTC A;  4NSQ A;  5AGE A;  4B12 A;  2KCW A;  4RS2 A;  2Z3M A;  1TIQ A;  4F0Y A;  4HKF A;  3D3S A;  4KUB A;  1MJ9 A;  3GKR A;  4KOY A;  3D8P A;  3I3G A;  4C2Z A;  2AJ6 A;  2VZY A;  3S6H A;  2GIV A;  2JDD A;  2YND A;  4XNH C;  2BUE A;  1IIC A;  1S60 A;  5C82 A;  2QML A;  3QAH A;  5IV0 A;  4CAV A;  4IF5 A;  4R87 A;  4BBH A;  2Q4V A;  3F8K A;  4OAD A;  1PU9 A;  3N7Z A;  3DR8 A;  1ON0 A;  5EBV A;  2P6F A;  2FCK A;  3EXN A;  2FE7 A;  2CNS A;  2FXF A;  2PQ8 A;  1NMT A;  1I21 A;  2Y0M A;  4KZT A;  4KLV A;  1P4N A;  2VZZ A;  1KUV A;  4FD6 A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...