3EC5A

The crystal structure of thioflavin-t (tht) binding ospa mutant
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
316
structure length
316
Chain Sequence
b'KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTYELFNEKGELSLKYITRADKSSTYELFNEKGELSLKYITRADKSSTYELFNEKGELSEKKITRADKSSTYELFNEKGELSLKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer Surface Protein A
publication title Molecular mechanism of thioflavin-T binding to the surface of beta-rich peptide self-assemblies
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 66
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 3ec5A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 3ec5A02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 3ec5A03
2OL8O 3EC5A 2OY5O 2G8CO 2OY1O 1RJLC 2HKDA 1FJ1E 2OY8A 2AF5A 2OL7A 5B11O 3CKGA 2PI3O 3AUMO 2OYBO 5B10O 5B2AO 5B3MO 2FKGA 2I5VO 2OL6O 2FKJA 2OY7A 1P4PA 1OSPO 3CKFA 2I5ZO
chains in the Genus database with same CATH superfamily
2OL8O 5IXGA 2G78A 1TOUA 1X8PA 2P8GA 4ZH6A 1ML7A 1STPA 4Z27A 2NNEA 4YDAA 3CXCE 3RDUA 2NNDA 1SRIA 4U8UM 2Q9SA 1GX8A 4KC8A 1X71A 4DQ3A 4WCEE 4Y0QA 5GADG 1KL3A 5HTDA 1X8UA 4COTA 3NQKA 1L6MA 2WEXA 3B2LA 1NP4A 5F7GA 1A2DA 4IMNA 3HPEA 4YFQA 1CJ5A 1YI2E 1YIVA 5EEEA 5H8TA 1I4UA 2FGSA 2X55A 4IB8A 3RDOA 2RA6A 3X00A 5D4AA 3D9WA 3IG9A 2ZJPE 2ZSCA 4Z2OA 3G71E 4GD9A 3U03A 1DZJA 3FDCA 1UYOX 4BOEA 1I04A 3NQ9A 2BHVA 1NQMA 4Z28A 3WJFA 1FE3A 4HPDA 3EW1A 3P6EA 1YWAA 1S44A 1QABE 5LJCA 4I60A 1Z24A 3P6CA 1BM5A 4ORWA 1I06A 3WJEA 1RSTB 1MX7A 4Y0PA 1NJIG 1ICMA 4CPIA 3TGCA 1E2TA 4LKPA 1KL5A 2IZHB 4ORXA 1O1UA 1GXAA 1SWCA 2PY1A 1KL4A 4ODDA 1YIJE 1LKEA 1AVDA 4WBKA 1JZUA 1HN2A 3WJDA 2X8SA 3SAOA 1KC8G 1SRFA 3T6LA 5JR8A 1JYJA 2Q4NA 5CYBA 1SWHA 2L5PA 2WQ9A 4Y0RA 5F58A 4GJVA 3PP6A 1A18A 1LELA 4ORRA 1SWAA 3N91A 3KQ0A 3FIQA 3F9DA 1LNMA 4QAEA 2A2UA 2UZ2A 2RTMA 5CSEA 3ZW0A 5LJHA 4BX5A 3MX7A 1PTSA 1KT3A 4TKJA 2POAA 2BC3A 3DTQA 2WR6A 4U8UN 3CCUE 1FENA 1BSOA 1JMXA 2E4JA 2WEWA 3FW4A 1OEJA 2Q39A 2X34A 1NP1A 1EW3A 3TF6A 3FYFA 5B27A 4ORUA 2KT4B 1VWAB 4BGFA 3NP1A 4M7MA 1SWKA 2L68A 4LZVA 3FELA 3JQOA 3ZUOA 5F6ZA 2RTIB 1E06A 1DZPA 4CDEA 4TKHA 3TZSA 3CMEE 1MEPA 3SZJA 3B2HA 1I05A 2RCQA 2JU8A 1SWOA 2LFOA 3KFHA 1I9HA 3HWGA 4GZVA 4XMEA 1SRHA 3VU1A 4QZUA 2OY7A 1TOWA 3S5XA 3FA9A 3CD6E 2RTDB 2FR2A 1YWCA 5GAGG 1U18A 1LIBA 1LCWA 1RXHA 3ZW0B 4TKBA 4BX5B 1X89A 2I5ZO 5IRAA 4YVBA 5EZ2A 1N4JA 4IO9E 3FMZA 3PDFA 1NGLA 5JD2A 4GDZA 3RKGA 3KFFA 4HPBA 2OF8A 4GKCA 1U17A 1BWYA 1LDQA 3UEUA 1RXJA 1XCAA 5HZ9A 1IKEA 4CSBA 3CBCA 1VWLB 4YGGA 2OY1O 1CRBA 3EMMA 5H9AA 1GKAA 3P6DA 1GT4A 3VHMA 1SWBA 4D6BA 2RCTA 2F73A 1B0OA 4NV8A 3CQRA 2GH7A 3S60A 3D4RA 4YFRA 2FHLA 4GH7A 2OY5O 4QQ1A 3FW5A 3WJBA 2QO5A 3HWEA 5LJGA 4AZOA 1QY1A 5C0NA 3APXA 4NV7A 3T2WA 1VWKB 3CCVE 2KW1A 3B2JA 2RTCB 5HAEA 4IMOA 2BLGA 1G7NA 1RL6A 4TJZA 1Y55X 2ASNX 4TQ2A 4I9SA 1IFBA 1MUPA 3FR2A 3F6ZB 1RAVA 1GX3A 2M4LA 3RDXA 3WZOA 5DM6E 4BCSA 1SXUA 1UZ2X 2G8CO 4XMHA 1R0UA 1DF8A 2Q2PA 4NYRA 3FA7A 3I17A 5B5GA 1CBIA 1LPJA 1MX8A 3I0AA 1JV4A 4XMCA 4WFAE 4RUUA 2Z4IA 1JMZA 1X8QA 1AELA 3BDRA 1KGLA 2X8FA 4ORYA 3KFIA 4O49A 2XKLA 1Y53X 1IFCA 2CBRA 1GKAB 3U0DA 1VQ4E 1NDJA 2AT6X 3BX8A 2F09A 1EIOA 2WWPA 3B2KA 1DV9A 2CAMA 3IGEA 4HPCA 4U46A 1N8RG 4YGHA 1SWRA 2ZAGA 4GNWA 1NQNA 3CR6A 4LKTA 3HOEA 2A5CA 2LBAA 3GAQA 3OE3A 2AH7X 3U9PC 1SY1A 1EPAA 3ZZVA 4CDDA 1X8OA 1EALA 5FQ8E 1AB0A 1OBPA 2O62A 4BQUA 1K3BA 1ALBA 5CE4A 1S72E 4AZPA 1DC9A 4BX7A 2Z4HA 4MVLA 1STSB 2C1QA 4RUNA 1SWPA 1GT3A 2LA7A 2A3FX 1SRGA 2HZRA 2OY8A 1GGLA 1UYNX 2A2GA 5IRWA 2RTLA 4ZH9A 1PMPA 1U0XA 4NYQA 4I95A 1B56A 3CF5E 4O3ZA 5K06A 5L8IA 3S5VA 1VWNB 1LICA 2GJ5A 1T8VA 2OFMX 4U8UO 4AYHA 5HZ8A 2ACPX 4ZHCA 5LKEA 2QOMA 4OKAA 1HBPA 3FA8A 4A8ZA 5DPQA 1JIWI 2QA4E 1HMRA 1W4TA 2IZDB 5AJCA 1SWUA 4U67E 1LCVA 1HMTA 4R0BA 1ICNA 4YH0A 3DLLE 1BSYA 1EPBA 4XMFA 1G5WA 1RSUB 1SA8A 4NNTA 3PH5A 4MEEA 2OZQA 3F8AA 3ZW1B 4K19A 3EM0A 1LF7A 1HQQA 1FELA 1HXLA 3JSQA 1K73G 2OYBO 4I9RA 1PBYA 3K3LA 2I5VO 3D95A 4CDFA 4AZNA 3CC2E 2CZUA 1Q82G 4OS8A 4BX7B 2ACOA 1VQPE 1QG5A 1VPRA 4OS0A 2DJGA 2OVAA 3MG5A 1Y52X 3RSWA 1VQME 4ZHHA 2X32A 3G6EE 3I55E 4HFOA 1HQPA 4YBPA 2RTKA 1PEEA 3OBLA 1SWEA 1W5RA 2GTLM 5BVTA 4UY8G 3T6FA 3RDQA 3WJGA 1W6FA 3S26A 1IIUA 2WUTA 1LIDA 4CPHB 4BBOA 2AL0X 2FKGA 3KFGA 3ZQ3A 1VWDB 2R73A 1YWBA 1QY0A 4YGZA 2ZAIA 4ZR2A 4ARHA 4O4SA 4YDBA 4QYPA 3TGAA 2G79A 4U3QA 1Q86G 3HWFA 5B2AO 3AKMA 3VG2A 3C78X 1A57A 1P4PA 3VG5A 2IZLB 2IFBA 3HWDA 3JS1A 1SWLA 4GK9A 4ZFXA 1EIIA 1ZNHA 5H9LA 3QKGA 5HBSA 3CMAE 1VWJB 2XSTA 1LDOA 4ALOA 4NLIA 4WHIA 1DZMA 3P6HA 2OVDA 1QVGE 1SWNA 1TVQA 1CBQA 4EFGA 1W2BE 1KD1G 4OELA 1VQNE 1I78A 2JN3A 3HTYA 1N0SA 3LV4A 3VE1A 1IKJA 4BX6A 2DM5A 2X56A 5HCDC 4KCAA 3RE6A 3CCLE 3MVFA 4JHQA 2X8TA 1HBQA 3ZUIA 1SWGA 1WBIA 1SLEB 3VG3A 5DM7E 5IO5A 4LZUA 2W2FA 2VFCA 1LFOA 2CM4A 2Y32A 3C76X 3WXQA 1RLBE 3G4SE 1QQSA 4INNA 1KT5A 2RTPB 4CPEA 1TXLA 2MHDA 5JVHE 1YWDA 3ELZA 3ELXA 1AQBA 3OJYC 1E5PA 3CC7E 3RY1A 2IZJA 1E00A 1MVGA 1SLGB 1SWFA 4O4XA 3O2YA 4KIIA 2YG2A 3IFBA 5AQ6A 4CK4A 2QEXE 3NADA 4MVKA 2FWVA 5LJEA 1XKIA 2OFRX 3E3CA 2RTRB 5F1EA 1Y0GA 5EPQA 1YJ9E 3VGWA 4C5PA 2OVEA 1VQ8E 1S7DA 1RJLC 1PM1X 4BX6B 4ALBA 2MJIA 2RTBB 3CQNA 4CV7A 1TW4A 1LUQA 1QVFE 1JYDA 5JVGE 1MK5A 4ID2A 3PIOE 2EU7X 4FBRA 1VQLE 4Y5DA 4O4OA 2OL7A 3VHHA 3C77X 3HK1A 3LHNA 4YKOA 1D2UA 1M1KG 3P02A 3CWKA 2Y3EA 3BX7A 1SRJA 3CCSE 2OVSA 2F01A 2ANSA 2VFBA 2BT9A 5HL7E 1SLDB 5HTEA 5EDBA 4WFUA 3VG4A 1SWTA 2GTFX 3WYPA 3WZPA 3BY0A 1VQ5E 3T1DA 1K24A 1FEMA 2BS6A 3G7XA 1SWQA 4A60A 2HNXA 1B4MA 2AF5A 1VQ7E 1SWSA 2N93A 1NBXA 3PECA 1SMPI 4DNEA 1K8AG 5HCCC 1VQ9E 1MDCA 1RXKA 5H9NA 1SY2A 3BLGA 3OW2E 4O3XB 4QNIA 1AVEA 2RTGB 2QMIA 2RTQB 5B11O 1ZNKA 3FLLA 3D97A 3NBXX 1QY2A 4AZMA 3HOLA 4ORSA 2IZKA 4OEMA 5H9KA 4HWMA 3CCME 4HPAA 4ZHFA 1ZNEA 5B29A 5HA0A 3P24A 2RTAA 4QGWA 2FR3A 1IW2A 5KIDA 1Q81G 4I6SA 1VWQB 1JJUA 1BRPA 2MWHA 1DZKA 1BSQA 3B2IA 1VWMB 4LQZA 1JJXA 3EW2A 3ZI8A 1GX9A 4GUZA 1E02A 4NLJA 4GGTA 2KTDA 5FQ7E 1VYGA 3OD9A 1LIFA 3AUMO 2LKKA 4A1HA 4ZHDA 2NP1A 1T0VA 3PK2A 1SXYA 3ZW1A 3CPWE 1Q7YG 2YMSA 3BRNA 2RD7C 5KHPA 4AZQA 2LB6A 3P6FA 4Y0SA 1YJWE 2IZBA 1M90G 4IB9A 1VWCB 5HA1A 4BVMA 3CBSA 1P6PA 3CCQE 1UREA 3PQUA 3WBGA 2G7BA 3O19A 4GJSA 3RZYA 3NPOA 1ACDA 1QWDA 5B10O 1BEBA 3NX2A 1SLFB 5GAEG 2RTJA 5F2BA 1VQOE 1YP7A 3APWA 2AMMX 4FGIB 4CPHA 4YKMA 2ZJRE 1KZXA 1G85A 1OBUA 3CCJE 5HZQA 2AVIA 4EDEA 1BRQA 2KD2A 2FS7A 3IA8A 4IBAA 4YFPA 4I3BA 3J7ZG 3PH6A 1SXXA 3L4RA 2Q2MA 1KXOA 2CZTA 4IRWA 2WQAE 1YP6A 1HY2A 5GAHG 1VQ6E 4WFNE 1EUOA 4DQ4A 4ZJ0A 3PPTA 2X4MA 2Y3FA 3SLOA 1OBQA 4A1YA 4IOCE 5LKFA 1N9MA 4IOAE 4I3DA 3GE2A 3EBWA 4MIRA 5AJBA 1OPAA 4TLJA 4N7CA 1CBRA 1STRB 1JBHA 2GTLO 5HCEC 1YJNE 4O9SA 2IZFB 5D47A 3RDMA 3UEXA 1X8NA 3WZQA 3VG7A 1Y9LA 1SY0A 1D3SA 1VYFA 3MBTA 2JW1A 2QO6A 2QO4A 1ZNDA 4DCBA 4GU8A 5FFHA 2NNQA 2K62A 1LIEA 2RTHB 3BSZE 3V8UA 2ZJQE 1O1VA 4TNNA 2OFBA 1KFFA 1VWRB 3UEWA 5F6BA 1H91A 3WOVA 2FS6A 1RBPA 1FJ1E 1HMSA 3APUA 2JGSA 2MO5A 3Q34A 2RTOB 2A0AA 3CC4E 1VWEB 2WPUA 4KT5A 5HWZA 4PJ2A 1OEKA 4FBVA 2A5BA 3RY2A 1CBSA 4D6AA 3LTWA 1MM9A 1S2PA 2BSZA 1N9YA 1QFVA 5EDCA 4EQAC 5HZ6A 3CMPA 4GGZA 3Q6LA 3AKNA 3DSZA 1K9MG 3EYCA 4Z2VA 2GC9A 2RQ0A 1G74A 3STKA 3FA6A 2FTBA 4KH8A 4OMXA 3ZW2A 1YHQE 2JMBA 2FRSA 1ZNGA 1VYOA 2OTJE 5IRUA 4NW4A 5EEDA 2MM3A 5AEOA 1AVGI 1FDQA 1DF3A 1IJ8A 5B3MO 2GTLN 1Y9TA 3AEHA 2HLVA 4IB6A 3SLTA 2A8GA 2L9CA 2FLJA 3P6GA 4Z2PA 4ZGUA 4N7DA 4YBUA 5FAZA 3RBYA 1VWPB 4ML7B 1EXSA 3PEDA 5IO6A 2OTLE 1SWDA 4IB7A 5L3YA 2FKJA 1KZWA 3BS2A 4XMGA 5MLCH 3D96A 1LCZA 3SOTA 2W2BA 4OMWA 2IZEB 2IZCB 4YCEA 2PI3O 3UEVA 2C4IA 4GDAA 4WF9E 3FEPA 1BJ7A 1N7YA 1SXWA 4BJ8A 5K68A 1VWGB 3WZNA 3FR4A 2AKQA 4YCHA 4YMYA 4IAXA 3RE5A 3CKGA 4WFVA 1EQDA 1NC9A 5H1SI 5D45A 4FQBB 1SREA 5BYPA 1YITE 1N43A 4AZRA 1T68X 5D48A 4QYNA 3TGBA 2AT8X 4L1NA 2UYWA 4EXZA 1BBPA 2R56A 1O8VA 3T2XA 1JJ2E 5IO7A 2VDFA 4UU3A 4ON1A 4ES7A 5FQ6E 1DFVA 3KZAA 1VWBB 2JOZA 2L67A 2AT0X 2BS5A 1ERXA 1YUPA 1SWJA 5L8OA 4ZHGA 1KT6A 4JNJA 3MM0A 3CCRE 2LBVA 4O3YA 3KVNA 1VWHB 3SZIA 3NR3A 1ZRYA 2DJFA 2KTSA 2OL6O 1JQPA 4XMDA 1KOIA 1VWFB 2HYSA 2ALLX 4PSQA 4MVEA 1ERBA 2W2AA 2G5LA 1VQKE 4ZCBA 4UU2A 4QGXA 3FR5A 3WVMA 1OPBA 4JO6A 3ZWEA 4I3CA 1KQWA 3CCEE 2IZGB 1A3YA 4IABA 3BU9A 3PIPE 2HKDA 4O4UA 4MISA 4ZGFA 5D8JA 1GM6A 5BVSA 3NQ3A 5FENA 4GRJA 4NNSA 3VE2A 3QQ2A 5L8NA 2QM9A 3EC5A 3H3IA 1GT5A 4Y59A 3WJCA 2QOSC 3FEKA 2X46A 4GE1A 4GNYA 1FTPA 2OFAA 3VG6A 1JJJA 4QZTA 3VPJE 2AT3X 5KICA 1BLRA 4NP1A 5AN9B 4M6SA 2FHNX 2JU7A 4B55A 2MF6A 3STNA 3PQSA 2CBSA 2IZAA 4AW8A 3BU1A 2R74A 3I56E 3FIDA 1WUBA 4O3WA 4OS3A 3O22A 3RDSA 1OEEA 1VWOB 4IAWA 1ZNLA 1OSPO 4QGVA 4FBOA 4EEJA 1KT7A 3NX1A 4KC7A 2K23A 1GT1A 5K67A 1QFTA 4JGLA 3UAQA 4WFBE 3SLJA 2A13A 1MOYA 1EI5A 2HMBA 2OF9A 1KQSE 2IZIA 4CDCA 5B5FA 5LJBA 3CKFA 1KT4A 1SY3A 2QCBA 1HXZA 3WYQA 2RTFB 2AT5X 2HZQA 1PBOA 1KQXA 4MVIA 2C1SA 5CHKA 2CM9A 2CQLA 1VWIB 1B8EA 3STMX 2RTNB 1ADLA 5LJDA 3SZHA 4GGRA 4GETA 5HZ5A 3VHIA 3RWXA 4CPFA 5DG4A 4L3RA 5LJKA 5BVQA 2JU3A 4QRLA 2X45A 3FENA 2WSJA 3EBKA 4Z6JA 3APVA 4U9CA 2FT9A 2RN4A 2RTEB 4EKVA
chains in the Genus database with same CATH topology
2OL8O 3EC5A 2OY5O 2G8CO 2OY1O 1RJLC 2HKDA 1FJ1E 2OY8A 2AF5A 2OL7A 5B11O 3CKGA 2PI3O 3AUMO 2OYBO 5B10O 3IGEA 5B2AO 5B3MO 2FKGA 2I5VO 2OL6O 2FKJA 3IG9A 2OY7A 1P4PA 1OSPO 3CKFA 2I5ZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL8 O;  3EC5 A;  2OY5 O;  2G8C O;  2OY1 O;  1RJL C;  2HKD A;  1FJ1 E;  2OY8 A;  2AF5 A;  2OL7 A;  5B11 O;  3CKG A;  2PI3 O;  3AUM O;  2OYB O;  5B10 O;  5B2A O;  5B3M O;  2FKG A;  2I5V O;  2OL6 O;  2FKJ A;  2OY7 A;  1P4P A;  1OSP O;  3CKF A;  2I5Z O; 
#chains in the Genus database with same CATH topology
 2OL8 O;  5IXG A;  2G78 A;  1TOU A;  1X8P A;  2P8G A;  4ZH6 A;  1ML7 A;  1STP A;  4Z27 A;  2NNE A;  4YDA A;  3CXC E;  3RDU A;  2NND A;  1SRI A;  4U8U M;  2Q9S A;  1GX8 A;  4KC8 A;  1X71 A;  4DQ3 A;  4WCE E;  4Y0Q A;  5GAD G;  1KL3 A;  5HTD A;  1X8U A;  4COT A;  3NQK A;  1L6M A;  2WEX A;  3B2L A;  1NP4 A;  5F7G A;  1A2D A;  4IMN A;  3HPE A;  4YFQ A;  1CJ5 A;  1YI2 E;  1YIV A;  5EEE A;  5H8T A;  1I4U A;  2FGS A;  2X55 A;  4IB8 A;  3RDO A;  2RA6 A;  3X00 A;  5D4A A;  3D9W A;  3IG9 A;  2ZJP E;  2ZSC A;  4Z2O A;  3G71 E;  4GD9 A;  3U03 A;  1DZJ A;  3FDC A;  1UYO X;  4BOE A;  1I04 A;  3NQ9 A;  2BHV A;  1NQM A;  4Z28 A;  3WJF A;  1FE3 A;  4HPD A;  3EW1 A;  3P6E A;  1YWA A;  1S44 A;  1QAB E;  5LJC A;  4I60 A;  1Z24 A;  3P6C A;  1BM5 A;  4ORW A;  1I06 A;  3WJE A;  1RST B;  1MX7 A;  4Y0P A;  1NJI G;  1ICM A;  4CPI A;  3TGC A;  1E2T A;  4LKP A;  1KL5 A;  2IZH B;  4ORX A;  1O1U A;  1GXA A;  1SWC A;  2PY1 A;  1KL4 A;  4ODD A;  1YIJ E;  1LKE A;  1AVD A;  4WBK A;  1JZU A;  1HN2 A;  3WJD A;  2X8S A;  3SAO A;  1KC8 G;  1SRF A;  3T6L A;  5JR8 A;  1JYJ A;  2Q4N A;  5CYB A;  1SWH A;  2L5P A;  2WQ9 A;  4Y0R A;  5F58 A;  4GJV A;  3PP6 A;  1A18 A;  1LEL A;  4ORR A;  1SWA A;  3N91 A;  3KQ0 A;  3FIQ A;  3F9D A;  1LNM A;  4QAE A;  2A2U A;  2UZ2 A;  2RTM A;  5CSE A;  3ZW0 A;  5LJH A;  4BX5 A;  3MX7 A;  1PTS A;  1KT3 A;  4TKJ A;  2POA A;  2BC3 A;  3DTQ A;  2WR6 A;  4U8U N;  3CCU E;  1FEN A;  1BSO A;  1JMX A;  2E4J A;  2WEW A;  3FW4 A;  1OEJ A;  2Q39 A;  2X34 A;  1NP1 A;  1EW3 A;  3TF6 A;  3FYF A;  5B27 A;  4ORU A;  2KT4 B;  1VWA B;  4BGF A;  3NP1 A;  4M7M A;  1SWK A;  2L68 A;  4LZV A;  3FEL A;  3JQO A;  3ZUO A;  5F6Z A;  2RTI B;  1E06 A;  1DZP A;  4CDE A;  4TKH A;  3TZS A;  3CME E;  1MEP A;  3SZJ A;  3B2H A;  1I05 A;  2RCQ A;  2JU8 A;  1SWO A;  2LFO A;  3KFH A;  1I9H A;  3HWG A;  4GZV A;  4XME A;  1SRH A;  3VU1 A;  4QZU A;  2OY7 A;  1TOW A;  3S5X A;  3FA9 A;  3CD6 E;  2RTD B;  2FR2 A;  1YWC A;  5GAG G;  1U18 A;  1LIB A;  1LCW A;  1RXH A;  3ZW0 B;  4TKB A;  4BX5 B;  1X89 A;  2I5Z O;  5IRA A;  4YVB A;  5EZ2 A;  1N4J A;  4IO9 E;  3FMZ A;  3PDF A;  1NGL A;  5JD2 A;  4GDZ A;  3RKG A;  3KFF A;  4HPB A;  2OF8 A;  4GKC A;  1U17 A;  1BWY A;  1LDQ A;  3UEU A;  1RXJ A;  1XCA A;  5HZ9 A;  1IKE A;  4CSB A;  3CBC A;  1VWL B;  4YGG A;  2OY1 O;  1CRB A;  3EMM A;  5H9A A;  1GKA A;  3P6D A;  1GT4 A;  3VHM A;  1SWB A;  4D6B A;  2RCT A;  2F73 A;  1B0O A;  4NV8 A;  3CQR A;  2GH7 A;  3S60 A;  3D4R A;  4YFR A;  2FHL A;  4GH7 A;  2OY5 O;  4QQ1 A;  3FW5 A;  3WJB A;  2QO5 A;  3HWE A;  5LJG A;  4AZO A;  1QY1 A;  5C0N A;  3APX A;  4NV7 A;  3T2W A;  1VWK B;  3CCV E;  2KW1 A;  3B2J A;  2RTC B;  5HAE A;  4IMO A;  2BLG A;  1G7N A;  1RL6 A;  4TJZ A;  1Y55 X;  2ASN X;  4TQ2 A;  4I9S A;  1IFB A;  1MUP A;  3FR2 A;  3F6Z B;  1RAV A;  1GX3 A;  2M4L A;  3RDX A;  3WZO A;  5DM6 E;  4BCS A;  1SXU A;  1UZ2 X;  2G8C O;  4XMH A;  1R0U A;  1DF8 A;  2Q2P A;  4NYR A;  3FA7 A;  3I17 A;  5B5G A;  1CBI A;  1LPJ A;  1MX8 A;  3I0A A;  1JV4 A;  4XMC A;  4WFA E;  4RUU A;  2Z4I A;  1JMZ A;  1X8Q A;  1AEL A;  3BDR A;  1KGL A;  2X8F A;  4ORY A;  3KFI A;  4O49 A;  2XKL A;  1Y53 X;  1IFC A;  2CBR A;  1GKA B;  3U0D A;  1VQ4 E;  1NDJ A;  2AT6 X;  3BX8 A;  2F09 A;  1EIO A;  2WWP A;  3B2K A;  1DV9 A;  2CAM A;  3IGE A;  4HPC A;  4U46 A;  1N8R G;  4YGH A;  1SWR A;  2ZAG A;  4GNW A;  1NQN A;  3CR6 A;  4LKT A;  3HOE A;  2A5C A;  2LBA A;  3GAQ A;  3OE3 A;  2AH7 X;  3U9P C;  1SY1 A;  1EPA A;  3ZZV A;  4CDD A;  1X8O A;  1EAL A;  5FQ8 E;  1AB0 A;  1OBP A;  2O62 A;  4BQU A;  1K3B A;  1ALB A;  5CE4 A;  1S72 E;  4AZP A;  1DC9 A;  4BX7 A;  2Z4H A;  4MVL A;  1STS B;  2C1Q A;  4RUN A;  1SWP A;  1GT3 A;  2LA7 A;  2A3F X;  1SRG A;  2HZR A;  2OY8 A;  1GGL A;  1UYN X;  2A2G A;  5IRW A;  2RTL A;  4ZH9 A;  1PMP A;  1U0X A;  4NYQ A;  4I95 A;  1B56 A;  3CF5 E;  4O3Z A;  5K06 A;  5L8I A;  3S5V A;  1VWN B;  1LIC A;  2GJ5 A;  1T8V A;  2OFM X;  4U8U O;  4AYH A;  5HZ8 A;  2ACP X;  4ZHC A;  5LKE A;  2QOM A;  4OKA A;  1HBP A;  3FA8 A;  4A8Z A;  5DPQ A;  1JIW I;  2QA4 E;  1HMR A;  1W4T A;  2IZD B;  5AJC A;  1SWU A;  4U67 E;  1LCV A;  1HMT A;  4R0B A;  1ICN A;  4YH0 A;  3DLL E;  1BSY A;  1EPB A;  4XMF A;  1G5W A;  1RSU B;  1SA8 A;  4NNT A;  3PH5 A;  4MEE A;  2OZQ A;  3F8A A;  3ZW1 B;  4K19 A;  3EM0 A;  1LF7 A;  1HQQ A;  1FEL A;  1HXL A;  3JSQ A;  1K73 G;  2OYB O;  4I9R A;  1PBY A;  3K3L A;  2I5V O;  3D95 A;  4CDF A;  4AZN A;  3CC2 E;  2CZU A;  1Q82 G;  4OS8 A;  4BX7 B;  2ACO A;  1VQP E;  1QG5 A;  1VPR A;  4OS0 A;  2DJG A;  2OVA A;  3MG5 A;  1Y52 X;  3RSW A;  1VQM E;  4ZHH A;  2X32 A;  3G6E E;  3I55 E;  4HFO A;  1HQP A;  4YBP A;  2RTK A;  1PEE A;  3OBL A;  1SWE A;  1W5R A;  2GTL M;  5BVT A;  4UY8 G;  3T6F A;  3RDQ A;  3WJG A;  1W6F A;  3S26 A;  1IIU A;  2WUT A;  1LID A;  4CPH B;  4BBO A;  2AL0 X;  2FKG A;  3KFG A;  3ZQ3 A;  1VWD B;  2R73 A;  1YWB A;  1QY0 A;  4YGZ A;  2ZAI A;  4ZR2 A;  4ARH A;  4O4S A;  4YDB A;  4QYP A;  3TGA A;  2G79 A;  4U3Q A;  1Q86 G;  3HWF A;  5B2A O;  3AKM A;  3VG2 A;  3C78 X;  1A57 A;  1P4P A;  3VG5 A;  2IZL B;  2IFB A;  3HWD A;  3JS1 A;  1SWL A;  4GK9 A;  4ZFX A;  1EII A;  1ZNH A;  5H9L A;  3QKG A;  5HBS A;  3CMA E;  1VWJ B;  2XST A;  1LDO A;  4ALO A;  4NLI A;  4WHI A;  1DZM A;  3P6H A;  2OVD A;  1QVG E;  1SWN A;  1TVQ A;  1CBQ A;  4EFG A;  1W2B E;  1KD1 G;  4OEL A;  1VQN E;  1I78 A;  2JN3 A;  3HTY A;  1N0S A;  3LV4 A;  3VE1 A;  1IKJ A;  4BX6 A;  2DM5 A;  2X56 A;  5HCD C;  4KCA A;  3RE6 A;  3CCL E;  3MVF A;  4JHQ A;  2X8T A;  1HBQ A;  3ZUI A;  1SWG A;  1WBI A;  1SLE B;  3VG3 A;  5DM7 E;  5IO5 A;  4LZU A;  2W2F A;  2VFC A;  1LFO A;  2CM4 A;  2Y32 A;  3C76 X;  3WXQ A;  1RLB E;  3G4S E;  1QQS A;  4INN A;  1KT5 A;  2RTP B;  4CPE A;  1TXL A;  2MHD A;  5JVH E;  1YWD A;  3ELZ A;  3ELX A;  1AQB A;  3OJY C;  1E5P A;  3CC7 E;  3RY1 A;  2IZJ A;  1E00 A;  1MVG A;  1SLG B;  1SWF A;  4O4X A;  3O2Y A;  4KII A;  2YG2 A;  3IFB A;  5AQ6 A;  4CK4 A;  2QEX E;  3NAD A;  4MVK A;  2FWV A;  5LJE A;  1XKI A;  2OFR X;  3E3C A;  2RTR B;  5F1E A;  1Y0G A;  5EPQ A;  1YJ9 E;  3VGW A;  4C5P A;  2OVE A;  1VQ8 E;  1S7D A;  1RJL C;  1PM1 X;  4BX6 B;  4ALB A;  2MJI A;  2RTB B;  3CQN A;  4CV7 A;  1TW4 A;  1LUQ A;  1QVF E;  1JYD A;  5JVG E;  1MK5 A;  4ID2 A;  3PIO E;  2EU7 X;  4FBR A;  1VQL E;  4Y5D A;  4O4O A;  2OL7 A;  3VHH A;  3C77 X;  3HK1 A;  3LHN A;  4YKO A;  1D2U A;  1M1K G;  3P02 A;  3CWK A;  2Y3E A;  3BX7 A;  1SRJ A;  3CCS E;  2OVS A;  2F01 A;  2ANS A;  2VFB A;  2BT9 A;  5HL7 E;  1SLD B;  5HTE A;  5EDB A;  4WFU A;  3VG4 A;  1SWT A;  2GTF X;  3WYP A;  3WZP A;  3BY0 A;  1VQ5 E;  3T1D A;  1K24 A;  1FEM A;  2BS6 A;  3G7X A;  1SWQ A;  4A60 A;  2HNX A;  1B4M A;  2AF5 A;  1VQ7 E;  1SWS A;  2N93 A;  1NBX A;  3PEC A;  1SMP I;  4DNE A;  1K8A G;  5HCC C;  1VQ9 E;  1MDC A;  1RXK A;  5H9N A;  1SY2 A;  3BLG A;  3OW2 E;  4O3X B;  4QNI A;  1AVE A;  2RTG B;  2QMI A;  2RTQ B;  5B11 O;  1ZNK A;  3FLL A;  3D97 A;  3NBX X;  1QY2 A;  4AZM A;  3HOL A;  4ORS A;  2IZK A;  4OEM A;  5H9K A;  4HWM A;  3CCM E;  4HPA A;  4ZHF A;  1ZNE A;  5B29 A;  5HA0 A;  3P24 A;  2RTA A;  4QGW A;  2FR3 A;  1IW2 A;  5KID A;  1Q81 G;  4I6S A;  1VWQ B;  1JJU A;  1BRP A;  2MWH A;  1DZK A;  1BSQ A;  3B2I A;  1VWM B;  4LQZ A;  1JJX A;  3EW2 A;  3ZI8 A;  1GX9 A;  4GUZ A;  1E02 A;  4NLJ A;  4GGT A;  2KTD A;  5FQ7 E;  1VYG A;  3OD9 A;  1LIF A;  3AUM O;  2LKK A;  4A1H A;  4ZHD A;  2NP1 A;  1T0V A;  3PK2 A;  1SXY A;  3ZW1 A;  3CPW E;  1Q7Y G;  2YMS A;  3BRN A;  2RD7 C;  5KHP A;  4AZQ A;  2LB6 A;  3P6F A;  4Y0S A;  1YJW E;  2IZB A;  1M90 G;  4IB9 A;  1VWC B;  5HA1 A;  4BVM A;  3CBS A;  1P6P A;  3CCQ E;  1URE A;  3PQU A;  3WBG A;  2G7B A;  3O19 A;  4GJS A;  3RZY A;  3NPO A;  1ACD A;  1QWD A;  5B10 O;  1BEB A;  3NX2 A;  1SLF B;  5GAE G;  2RTJ A;  5F2B A;  1VQO E;  1YP7 A;  3APW A;  2AMM X;  4FGI B;  4CPH A;  4YKM A;  2ZJR E;  1KZX A;  1G85 A;  1OBU A;  3CCJ E;  5HZQ A;  2AVI A;  4EDE A;  1BRQ A;  2KD2 A;  2FS7 A;  3IA8 A;  4IBA A;  4YFP A;  4I3B A;  3J7Z G;  3PH6 A;  1SXX A;  3L4R A;  2Q2M A;  1KXO A;  2CZT A;  4IRW A;  2WQA E;  1YP6 A;  1HY2 A;  5GAH G;  1VQ6 E;  4WFN E;  1EUO A;  4DQ4 A;  4ZJ0 A;  3PPT A;  2X4M A;  2Y3F A;  3SLO A;  1OBQ A;  4A1Y A;  4IOC E;  5LKF A;  1N9M A;  4IOA E;  4I3D A;  3GE2 A;  3EBW A;  4MIR A;  5AJB A;  1OPA A;  4TLJ A;  4N7C A;  1CBR A;  1STR B;  1JBH A;  2GTL O;  5HCE C;  1YJN E;  4O9S A;  2IZF B;  5D47 A;  3RDM A;  3UEX A;  1X8N A;  3WZQ A;  3VG7 A;  1Y9L A;  1SY0 A;  1D3S A;  1VYF A;  3MBT A;  2JW1 A;  2QO6 A;  2QO4 A;  1ZND A;  4DCB A;  4GU8 A;  5FFH A;  2NNQ A;  2K62 A;  1LIE A;  2RTH B;  3BSZ E;  3V8U A;  2ZJQ E;  1O1V A;  4TNN A;  2OFB A;  1KFF A;  1VWR B;  3UEW A;  5F6B A;  1H91 A;  3WOV A;  2FS6 A;  1RBP A;  1FJ1 E;  1HMS A;  3APU A;  2JGS A;  2MO5 A;  3Q34 A;  2RTO B;  2A0A A;  3CC4 E;  1VWE B;  2WPU A;  4KT5 A;  5HWZ A;  4PJ2 A;  1OEK A;  4FBV A;  2A5B A;  3RY2 A;  1CBS A;  4D6A A;  3LTW A;  1MM9 A;  1S2P A;  2BSZ A;  1N9Y A;  1QFV A;  5EDC A;  4EQA C;  5HZ6 A;  3CMP A;  4GGZ A;  3Q6L A;  3AKN A;  3DSZ A;  1K9M G;  3EYC A;  4Z2V A;  2GC9 A;  2RQ0 A;  1G74 A;  3STK A;  3FA6 A;  2FTB A;  4KH8 A;  4OMX A;  3ZW2 A;  1YHQ E;  2JMB A;  2FRS A;  1ZNG A;  1VYO A;  2OTJ E;  5IRU A;  4NW4 A;  5EED A;  2MM3 A;  5AEO A;  1AVG I;  1FDQ A;  1DF3 A;  1IJ8 A;  5B3M O;  2GTL N;  1Y9T A;  3AEH A;  2HLV A;  4IB6 A;  3SLT A;  2A8G A;  2L9C A;  2FLJ A;  3P6G A;  4Z2P A;  4ZGU A;  4N7D A;  4YBU A;  5FAZ A;  3RBY A;  1VWP B;  4ML7 B;  1EXS A;  3PED A;  5IO6 A;  2OTL E;  1SWD A;  4IB7 A;  5L3Y A;  2FKJ A;  1KZW A;  3BS2 A;  4XMG A;  5MLC H;  3D96 A;  1LCZ A;  3SOT A;  2W2B A;  4OMW A;  2IZE B;  2IZC B;  4YCE A;  2PI3 O;  3UEV A;  2C4I A;  4GDA A;  4WF9 E;  3FEP A;  1BJ7 A;  1N7Y A;  1SXW A;  4BJ8 A;  5K68 A;  1VWG B;  3WZN A;  3FR4 A;  2AKQ A;  4YCH A;  4YMY A;  4IAX A;  3RE5 A;  3CKG A;  4WFV A;  1EQD A;  1NC9 A;  5H1S I;  5D45 A;  4FQB B;  1SRE A;  5BYP A;  1YIT E;  1N43 A;  4AZR A;  1T68 X;  5D48 A;  4QYN A;  3TGB A;  2AT8 X;  4L1N A;  2UYW A;  4EXZ A;  1BBP A;  2R56 A;  1O8V A;  3T2X A;  1JJ2 E;  5IO7 A;  2VDF A;  4UU3 A;  4ON1 A;  4ES7 A;  5FQ6 E;  1DFV A;  3KZA A;  1VWB B;  2JOZ A;  2L67 A;  2AT0 X;  2BS5 A;  1ERX A;  1YUP A;  1SWJ A;  5L8O A;  4ZHG A;  1KT6 A;  4JNJ A;  3MM0 A;  3CCR E;  2LBV A;  4O3Y A;  3KVN A;  1VWH B;  3SZI A;  3NR3 A;  1ZRY A;  2DJF A;  2KTS A;  2OL6 O;  1JQP A;  4XMD A;  1KOI A;  1VWF B;  2HYS A;  2ALL X;  4PSQ A;  4MVE A;  1ERB A;  2W2A A;  2G5L A;  1VQK E;  4ZCB A;  4UU2 A;  4QGX A;  3FR5 A;  3WVM A;  1OPB A;  4JO6 A;  3ZWE A;  4I3C A;  1KQW A;  3CCE E;  2IZG B;  1A3Y A;  4IAB A;  3BU9 A;  3PIP E;  2HKD A;  4O4U A;  4MIS A;  4ZGF A;  5D8J A;  1GM6 A;  5BVS A;  3NQ3 A;  5FEN A;  4GRJ A;  4NNS A;  3VE2 A;  3QQ2 A;  5L8N A;  2QM9 A;  3EC5 A;  3H3I A;  1GT5 A;  4Y59 A;  3WJC A;  2QOS C;  3FEK A;  2X46 A;  4GE1 A;  4GNY A;  1FTP A;  2OFA A;  3VG6 A;  1JJJ A;  4QZT A;  3VPJ E;  2AT3 X;  5KIC A;  1BLR A;  4NP1 A;  5AN9 B;  4M6S A;  2FHN X;  2JU7 A;  4B55 A;  2MF6 A;  3STN A;  3PQS A;  2CBS A;  2IZA A;  4AW8 A;  3BU1 A;  2R74 A;  3I56 E;  3FID A;  1WUB A;  4O3W A;  4OS3 A;  3O22 A;  3RDS A;  1OEE A;  1VWO B;  4IAW A;  1ZNL A;  1OSP O;  4QGV A;  4FBO A;  4EEJ A;  1KT7 A;  3NX1 A;  4KC7 A;  2K23 A;  1GT1 A;  5K67 A;  1QFT A;  4JGL A;  3UAQ A;  4WFB E;  3SLJ A;  2A13 A;  1MOY A;  1EI5 A;  2HMB A;  2OF9 A;  1KQS E;  2IZI A;  4CDC A;  5B5F A;  5LJB A;  3CKF A;  1KT4 A;  1SY3 A;  2QCB A;  1HXZ A;  3WYQ A;  2RTF B;  2AT5 X;  2HZQ A;  1PBO A;  1KQX A;  4MVI A;  2C1S A;  5CHK A;  2CM9 A;  2CQL A;  1VWI B;  1B8E A;  3STM X;  2RTN B;  1ADL A;  5LJD A;  3SZH A;  4GGR A;  4GET A;  5HZ5 A;  3VHI A;  3RWX A;  4CPF A;  5DG4 A;  4L3R A;  5LJK A;  5BVQ A;  2JU3 A;  4QRL A;  2X45 A;  3FEN A;  2WSJ A;  3EBK A;  4Z6J A;  3APV A;  4U9C A;  2FT9 A;  2RN4 A;  2RTE B;  4EKV A; 
#chains in the Genus database with same CATH homology
 2OL8 O;  3EC5 A;  2OY5 O;  2G8C O;  2OY1 O;  1RJL C;  2HKD A;  1FJ1 E;  2OY8 A;  2AF5 A;  2OL7 A;  5B11 O;  3CKG A;  2PI3 O;  3AUM O;  2OYB O;  5B10 O;  3IGE A;  5B2A O;  5B3M O;  2FKG A;  2I5V O;  2OL6 O;  2FKJ A;  3IG9 A;  2OY7 A;  1P4P A;  1OSP O;  3CKF A;  2I5Z O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...