3EC7A

Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
336
structure length
336
Chain Sequence
MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAEQKNGKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAIYETLIHEIDVMHWLLNEDYKTVKVYFPRQSSLVTTLRDPQLVVMETTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAVRKAAKYSTDILVDWKQRFIDAYDIEFQDFFDRLNAGLPPAGPTSWDGYLAAVTADACVKSQETGNTEIVELPSKPDFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2
rcsb
molecule keywords Putative Dehydrogenase
molecule tags Oxidoreductase
source organism Salmonella typhimurium
total genus 103
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3ec7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ec7A01
3L4SO 1I2BA 2BHLA 2LDXA 5H82A 1A71A 1BWSA 4YAKA 3AUUA 4XYBA 2BFPA 5JO0A 5DCYA 3MEQA 3H5RA 1SPXA 1RKXA 3DDNA 3W6UA 2NTNA 4E4YA 4RORA 3RUEA 1V3TA 3GHYA 3KYBA 1I5RA 1N1GA 3BMCB 1EZ4A 4LVUA 3MJCA 2Y0CA 4RPKA 2IZ1A 2B5VA 2VOEA 3ZV3A 1D3AA 3X2FA 5G4LA 2ZKLA 4EEXA 1Q7BA 5BT9A 4Q39A 1DO8A 3ROQA 4J0FA 4MOWA 3QIVA 4ZQHA 4KOAA 4R5MA 1QYVA 4W4TA 4UVDA 3ABIA 3FPLA 2FPPA 4S1VA 3GEGA 3KYCB 2PFGA 1A4UA 4MP6A 4E3ZA 1EUZA 1Q2XA 1UH5A 2X7HA 4Y6SA 1V35A 1RM5A 1I2CA 5KKAA 2DM6A 4ZJUA 2X0NA 1VLLA 2Z95A 4LSWA 2Q22A 3BIOA 4HP8A 2VYVD 1H5QA 2PKQP 3DL2A 1VE9A 4CM1A 5JAQA 1GY8A 2Y1CA 1DIAA 4C4OA 2PWZA 1E7SA 1SCUA 5A02A 2O3UA 2TMGA 3RASA 2FMUA 3QV1A 1R37A 1ZW1A 4KUGA 4XWYA 1UXJA 2BH9A 3I4CA 3FTNA 4TMFA 2YV2A 4WOKA 4BNMA 1P31A 2PK3A 5A5EA 4PLZA 2NQ8A 4BO5A 2A35A 4YJGA 1VC2A 4R1UA 1W73A 3K73O 4OSOA 5AOVA 4D46A 4ALMA 3D3WA 1F12A 3WYBA 3E48A 5ITWA 1DFHA 1EVJA 4YPOA 5FEUA 1DPGA 2XOXA 2Y0EA 2EWMA 3AY6A 4PVCA 3BMOA 1T2AA 3ZHXA 4RGBA 3W6ZA 4CMGA 5J9GA 5T73A 3JQDA 3RVDA 4R68A 4BL5A 2BKAA 4MVJA 4YJHA 1BRMA 4MVJH 4RPJA 1Z82A 3L6DA 3INRA 3KBOA 3C85A 3B1JA 5CPBA 1I30A 4JCOA 4MVJM 3GZ4A 1U7HA 5CFZA 3SVTA 1I24A 2NU9A 3C7DB 4HFNA 1OZAA 3LT1A 1OMOA 5CEJA 1B15A 3HUDA 4FOSA 4XQCA 2Q2WA 5AXBA 2EP5A 2IEBA 1NQ5A 2I3AA 2FR8A 3S8MA 3WNQA 5ER6A 4PCVA 2X1HA 4W82A 4ILKA 1EQUA 4F3YA 4A26A 4D0RA 3GGGA 2VUSA 3IP1A 3JQFA 3A06A 3PQFA 4YT5A 2R6JA 3I6QA 3M2PA 1JVSA 5GZ1A 4GVLA 5IDXA 1ZVMA 5C37A 4KWIA 2BI7A 4A10A 2E6UX 3VVCA 1HTBA 4XD2A 4O0LA 2I66A 4IDBA 2XXJA 4Q3EA 4IXTA 5U1PA 1PQUA 2HQ1A 4G65A 3RD5A 2VN8A 3IC5A 4A03A 3H65A 1LQUA 2CUKA 1B8UA 5GY7A 1XDWA 3MJ4A 3JQAB 1WW8A 3WGTA 5FI3A 4D3SA 1F0YA 5DBGA 3SC4A 3PHJA 4Y8VA 1H6BA 2WE8A 4YDRA 3ZV6A 1M6HA 4FD3A 5DDIP 4PLWA 4DPMA 2B36A 3BMCA 5CEFA 4M49A 3ZHZA 1G6KA 4M54A 1ZJYA 4ND3A 1G1AA 2YV1A 2F00A 3DXFA 4JJFA 3OHSX 2RIRA 1FJHA 3QA9A 4PG5A 1YBVA 2NU6A 2YHIB 3G49A 1U3WA 1LA2A 1I2ZA 4RQTA 4EW6A 4MJLA 2VRBA 3OQ1A 4IJKA 5A05A 3F9IA 3KYCA 4PZEA 5I8WA 1DFIA 2AW5A 3JCZA 4IS3A 3RBVA 3AY7A 3LDHA 1C0IA 2O3SA 2CVOA 5HA5A 3MWDB 4D3FA 2D5CA 2D2IA 4BO3A 3GVHA 4XJSA 1FDUA 4HUJA 4BNLA 1VSVA 5T64A 4DC0A 4E13A 4NHEA 2DFVA 1UR5A 1NWCA 3ZWPA 1LXCA 1IOLA 3C1AA 1ENOA 4UAGA 3JD1A 3D64A 3VPFA 4OL9A 3KZVA 3KSDO 1UZNA 3L9XA 3LK7A 3WGOA 3I52A 4CM3A 2YQ5A 3ANLA 3PK0A 3WIEA 1M2WA 2V65A 4IZHA 3ZN2A 2OGUA 1M6WA 5DZSA 1HF3A 2ZYDA 4II2A 4X54A 1PWZA 4R54A 4XIYA 4XYMA 3PHLA 1NXQA 4E5NA 4E5PA 2Z5LA 3LC7O 4EUEA 3QY9A 4XB2A 3OIDA 2J5KA 5A04A 2J3JA 3NJ4A 5JS6A 3OMLA 2D59A 1BXKA 3IMFA 4BNXA 3UHAA 1QLJA 5IZCA 2ZYAA 4QX6A 1U5CA 3OJFA 4P22A 1HDCA 3WQQA 4RJTA 2Z1NA 1X13A 2YW9A 5IN4A 2I9PA 2Q1TA 4KQXA 4WK6A 3H7AA 2Q1UA 1WDKA 1Y1PA 3FD8A 2X23A 3OETA 5ES3A 3OA2A 3VZQA 5JNLA 4EEZA 1PL6A 1KVSA 3OP4A 5G0WA 1MXHA 3MOIA 3ZWCA 3M6IA 2F1KA 4WEQA 1PR3A 5B1YA 3ICPA 1BW9B 4BMNA 1DC4A 2HK9A 3AOEA 1IL0A 4XYEA 2BELA 4J6FA 1P1KA 4J43A 5G0TA 2OL4A 2Y68A 5T5QA 1QYDA 5TNXA 3S55A 4QXMA 5L51A 5JYEA 3GNSA 3BHMA 5COQA 1DC5A 3D4NA 4HNHA 2Q4BA 4M1QA 3WFJA 4WE3A 3GQVA 1ZXBA 2IYPA 3HNPA 3PRJA 4JJGA 3FWNA 3AUSA 2PD6A 4UEOA 3H5AA 3K2BA 4A0SA 3OJ0A 1SAYA 3V2HA 3I9LA 4KUHA 5JLAA 1E1LA 5THKA 2VCYA 3OQBA 1YBMA 1P1IA 3D5QA 4GVXA 5AXCA 2JFFA 3AI1A 4PRKA 2V7PA 2X58A 2VHZA 3H9QA 1J49A 3GNTA 2Q1SA 1U3UA 3GH3A 5GMOA 1X1TA 3TZCA 1LTHR 3KV3O 5COBA 4B3HA 3PHHA 3WDSA 1AN9A 2WM3A 3DZJA 2PZLA 4IDDA 3PGJA 3DHEA 3QSGA 1MXFA 4QFDA 2OBYA 5I7EA 1JA9A 3FN4A 1HDYA 2HKIA 3NYWA 4H3VA 5IFLA 5IZCC 3IKTA 1E1NA 4NBWA 2CDCA 2ZB7A 5JAIA 4LGVA 1H94A 3D4OA 4D7AA 3JQAA 1D1SA 3KTDA 1TXGA 5FI5A 3HN2A 4WCDA 4WCFB 1M66A 1IZ0A 3LLSA 4B4OA 4JXKA 4MDHA 3M1AA 5TJ9A 2EJVA 1HSOA 5BSGA 1HZJA 3HG7A 3PXXA 1ORRA 4JIGA 2GYYA 2YHIA 2EEZA 2NVUB 4RV9A 1E0DA 3MOGA 3TN7A 3AOEC 1ZK4A 4OJNA 1H9BA 1VKOA 3G17A 4YAEA 4ALKA 3WOHA 3LT2A 1EFLA 3D4PA 1YQXA 2VRCA 3WICA 1NQAO 2A4KA 3L77A 4RDHA 1IPEA 5TS3A 3ZV4A 4BKPA 2FR0A 1LDMA 1O8CA 2O3QA 4QT0A 2GN4A 2WEKA 3IP3A 2AQHA 3VVBA 5T6BA 1SEPA 3KLMX 1DC6A 1SC6A 3WG9A 1ENZA 2O3JA 3VH3A 4W7IA 2PLAA 5I7VA 1KIFA 4CUKA 4AJHA 2HRZA 3E5RA 4LK3A 1E7QA 3KO8A 1L1FA 3W4JA 3DZKA 5G4KB 2Z1MA 3GFBA 3GPIA 2YQ4A 4UVEA 4CMBA 3PLRA 1U1IA 1LSJA 5K0ZA 1O94A 4K9DA 3S2GA 4BNIA 4CV1A 1VSUA 3MCVA 2X86A 4DIOA 1U4SA 2QZZA 5KNLA 4XB1A 3RUIA 1JAXA 1A27A 1GYPA 4HBGA 4I9HA 3I9OA 3KUXA 3IJRA 1EK6A 1DBVO 1LDYA 1P44A 4RVUA 2DBVO 3RIHA 4R1SA 5F5NA 4WASA 5K6AA 4YJFA 3SXPA 5HS6A 4BQPA 3I9JA 1PWXA 4BNKA 3TF5A 3RUDA 1XIVA 4CV0A 4LISA 3VPSA 4FFMA 4IJWA 1XKQA 2J5RA 4K26A 5DOVA 2VT3A 2HCTA 4B8ZA 2AEJA 1QLHA 3NJ8A 3V1TC 4J49A 2P9GA 2W2KB 3KYDB 3UGKA 3H6KA 1JLLA 3NRCA 4JROA 1Q0LA 1NBOA 2E37A 1LDGA 1CJCA 1HYEA 1I3MA 5H83A 3WQSB 3IUSA 3RROA 1YOVB 4YQYA 1PJ3A 1NYTA 4NBUA 3AU8A 3DAGA 4ZA2A 5A5FA 4HADA 5ICMA 5DCUA 2EHDA 4ZVVA 4CMJA 5L40A 1BDBA 1T2CA 4J2OA 3DOJA 4N18A 2O48X 4GWKA 2NU7A 1X1EA 2Q2QA 3JQ8B 1G0NA 1WDLA 1JVBA 2GR9A 4U6SA 4DREA 2ZYGA 3QRWA 4HNGA 1D8AA 1NFFA 1YL6A 4Y67A 3RC7A 2DBRA 2Q46A 1GUYA 4YEDA 4IMRA 3PJDA 1PJCA 2PH3A 4CL8A 1LDEA 1U5AA 3ZWVA 1KVQA 7ADHA 4R69A 3X2EA 4D3DA 1PTJA 4H7PA 4M89A 4M8SA 5L4NA 1EVYA 3BZUA 3H9UA 3OJLA 4A73A 4CM4B 1K5HA 1YBAA 2P91A 1LLQA 2P9CA 4UVIA 4GMFA 2UVDA 3B1KA 4EJMA 3R3SA 1GYRA 1NR1A 2DKNA 2Q49A 5DP1A 2BFAA 2GZ2A 1KERA 2C54A 2VTEA 3E9QA 3UN1A 4YTEA 3ETEA 1YRLA 3DO5A 1Q7CA 2WYUA 4Z0HO 3QVTA 4G81A 4XA8A 5DBIA 1EUDA 1QP8A 2I6TA 3U49A 5EJ2A 2OBNA 4GBJA 5IF3A 4R9SA 1KEUA 4DIFA 5K6AC 1BXGB 3JYPA 1EUCA 3AUTA 4EYEA 3HDJA 4J2HA 3P19A 2PH5A 4WCFA 1EQ2A 1GQQA 4IIVA 1UXHA 2PZKA 2VWGA 3S2FA 4GMGA 4JQCA 1J4AA 1PEDA 5FWNA 4FJ1A 4QQRA 5G0VA 2DC1A 3RFVA 1LSOA 2Y93A 3OA0A 3FPCA 3CMCO 1CIVA 4BNHA 4R51A 5JPIA 3KXDA 3CXRA 4ND1A 3Q11A 1XLTA 4GWGA 3B70A 5FF9A 2GCGA 1TT5B 3PYXA 5BR7A 3KETA 1KY5A 3K8ZA 5KVCA 1E3EA 3Q6IA 3F4BA 5JW6A 4E32A 5A4DA 2AA3A 1P1JA 3GPDG 1GUZA 4FSHA 3U62A 3WIDA 5JMWA 4BO0A 1CWUA 4LVCA 2NU8A 2CVQA 4G2NA 1NVMB 5KWEA 4QO8A 3UOGA 1PL7A 3JQGB 3U4HA 4WJZA 5JYAA 1C1XB 8LDHA 2QRJA 4XRRA 3DZHA 4O59O 3JQ7A 4K1LA 2DTDA 1KEPA 3DONA 2CZCA 3PGXA 1R16A 5G4KA 4Q3CA 4UEJA 1NAIA 1QSGA 3NX4A 2IODA 4YWJA 1ONPA 3OIGA 3KHUA 1H6AA 2IZZA 2JFHA 1MC4A 4ID9A 2AQIA 5I7SA 3WJAA 1DHRA 3ANNA 3RC9A 4DLAA 2P5UA 4CM6A 3QJ5A 1Y7TA 4DPKA 2EJWA 1ZJZA 4W9NA 3OM9A 5F5LA 2AG5A 2CDBA 2VOJA 2GUGA 2X4GA 1FK8A 1WPQA 4LCEA 3K5PA 2P68A 1ZO8A 3H2SA 2E49A 2BRUA 4TSKA 4LN1A 3ZCXA 1FF9A 3WTBA 2VQ3A 5JDCC 3DFUA 4WCFC 4RF2A 3K2EA 2W2KA 3KYDA 3V1YA 2E4AA 1HYGA 1H9AA 4OKIA 2E82A 2VUUA 4IM7A 1IYZA 1YOVA 4RPHA 2R2GA 3OFSA 4Z9YA 3M2TA 3PTZA 1W4ZA 1XQ6A 4BNUA 1VJ1A 3LLVA 1R0SA 2GN9A 1Z45A 2NSDA 3VPXA 4P4LA 1CF2O 4I08A 3WSVA 3DC2A 1F8GA 3JQEA 4GSLA 2H63A 1Y9EA 4CLHA 8ADHA 2PKRA 5KIAA 3JQ8A 5GZ6A 3PHGA 3F1KA 1NWHA 1V0JA 5ER9A 2VZ0A 3TPCA 1O5IA 1EMDA 4IQ0A 1WP4A 3EY4A 3GN2A 3KSUA 3BAZA 3R3JA 2Y1FA 1E3SA 3L07A 4HXYA 3GMDA 3VDRA 3DBRB 2UDPA 4FW8A 1GU7A 4LCJA 2PV7A 4NBRA 5ITVA 1WNTA 4DA9A 5TGDA 4CM4A 4WOJA 4LW8A 5CDTA 1ZIDA 3JYLA 1YB4A 4QEDA 3E82A 2WMDA 4XDYA 4J3FA 1KOLA 1PZHA 1NQOA 4B7XA 1IPFA 3JD3A 3OBBA 4NPCA 1X7DA 2LDBA 3V5NA 4XGKA 4NJMB 4Y98A 4GGPA 3ZV5A 4CLOB 5IXYA 3NTRA 3COSA 3DZGA 2C2XA 2ZJ0A 3GAFA 3TL2A 4Q3DA 3P5SA 4Q3AA 4QTZA 1ADCA 2EV9A 3RUHA 4W9NC 4I5DA 4IQGA 3DWFA 4I5EA 4WNIA 1KVRA 3AM4A 3LQFA 4FOOA 4NDNE 2O3TA 2J5QA 4XX0A 1IHXA 4WKGA 1BXGA 2GN6A 5A9SB 3IIEA 1R0LA 2I67A 2BGLA 2O23A 3DBHB 2PR2A 5HS4A 4UREA 4BO6A 1NVGA 5JMPA 1NQTA 2NADA 2D3TA 4WECA 3I6IA 3VZRA 3QVWA 1M75A 3I5MA 3DR3A 1XEAA 2EIHA 2ZJ1A 4ALJA 4J4HA 3ICCA 1C0PA 1O9BA 4RLHA 1O6ZA 3UKOA 3V8BA 3VPHA 2DQ4A 2IEDA 4K6CA 3VPGA 3ZWOA 3ORFA 1TT5A 1HKUA 3E1KA 5CDUA 4JK3A 4NG5A 5EINA 2V6MA 1GCOA 4B7CA 2B69A 4E2YA 5CP8A 4XYGA 4LRTB 4MP3A 1H0KA 5L45A 5A3JA 5B4TA 4YRBA 5ILOA 4BV9A 1KVTA 4Z3KA 3WGIA 3Q9NA 3GR6A 1YO6A 3FR8A 3CINA 4QUKA 3RUCA 3SX2A 4BO4A 1B8VA 1V3UA 5JCJA 1ISJA 1N5DA 3VZSA 4D44A 3KEOA 3JQGA 2VHWA 3JQBA 4BS9A 1OAAA 1C1XA 5KJEA 3B1FA 2HMWA 2QZ9A 1N1EA 3PEFA 4R9RA 2UAGA 1ULUA 1GEGA 5BSHA 4AJKA 4NH4A 1DRUA 2Q99A 3R0IA 1VKNA 1Q0HA 1XCBA 4HFRA 4I5GA 3U9LA 4CM9D 1ZK3A 3OECA 3TOZA 2FPGA 3F6YA 1I3KA 4UVHA 4OIMA 3VH2A 2Y05A 1Y8RB 3CZRA 1NHGA 1ISIA 4OM8A 4DQVA 1B2LA 4MVJE 3TFOA 1GDHA 1I3NA 4JNKA 1CDOA 1AGNA 2P4QA 4MO2A 3WQRA 1DLIA 1BSVA 2WTBA 1LLCA 4GLLA 4A5OA 4EJ0A 3WGQA 4IJVA 1CEQA 2DFDA 3BHIA 5JO9A 4OOEA 4GX0A 2AQ8A 1UZMA 3GAZA 2QRLA 1NPDA 3PZBA 1EE2A 3RBZA 4DWVA 5M6DA 2FOIA 2GPTA 4OSPA 3JV7A 3FNFA 1NHWA 1OBFO 4R01A 1DEHA 3W8FA 4PLTA 4BO2A 4TZTA 1JDJA 4MVJP 2AHRA 1MC5A 4BMSA 3WTCA 4A2CA 3W4IA 2EF1A 2QHXA 4BV8A 4QFCA 4UUMA 1OOEA 5CDGA 3PQEA 1IHYA 4BNWA 2YFQA 1VPDA 1GZ3A 1SEVA 2FN7A 4O63O 4RVGA 4HFJA 1T24A 5JY6A 3EVTA 3JD2A 3ZH2A 1ZBQA 4J0EA 1PS8A 5EMHA 1E92A 1IZ9A 1FXSA 5F21A 5BNIA 1ENPA 4J7UA 2A94A 4PFJA 1C3VA 3Q2KA 3U5TA 4R3NA 1DFGA 1VL8A 4PIVA 1A9ZA 3DBRA 3H9GA 2YDYA 3JQBC 2ILTA 3U4IA 5BSEA 4B3JA 5JYFA 1E6EA 4RZIA 4YT8A 4JGBA 2HSDA 2JAPA 5TT0A 1SNYA 4EGFA 3EK2A 5G0SA 4XKJA 3DOCA 3WBBA 4FBGA 4ND2A 4AG3A 3PJGA 4TVBA 1HE4A 3DOOA 5BNTA 4BO1A 2JL1A 4NJMA 9LDBA 1PGPA 4RF3A 2C5EA 4JBIA 3OEWA 4Y9DA 3DHYA 3DZIA 2JHGA 1RWBA 4J90A 4DBZA 2YYYA 4Y6PA 1YL5A 2VWHA 5JBIA 4I9UA 2B5WA 2DUWA 3C24A 3TZKA 3RFXA 4LSMA 3N7UA 2CY0A 4YRDA 1IE3A 3O8QB 1E7YA 5A9SA 1ONNA 1CQJA 3W8EA 3QVOA 5LDHA 4TQGA 3DBHA 2CF6A 4YBZA 3L0DA 2VYNA 4BNZA 1GZ6A 3UW3A 4E5YA 3EW7A 1HDZA 1QKIA 5AXAA 2I99A 3I9MA 3TJRA 2DPGA 4MVJI 4FR5A 1I36A 3GDFA 2JD0A 4JX8A 4M86A 5EN4A 4CR6A 1WMBA 2Y1DA 3O9ZA 4Q3NA 4AICA 1LQTA 2GGSA 1GZ4A 3DBLB 4FFLA 4PLVA 1DSSG 5C7OO 5KJ6A 4PG8A 1JWBB 1R15A 1LEHA 3H9JA 5CEEA 1YDWA 3DEYX 1O95A 2NLOA 5CHEA 2HU2A 1Y8QB 2FP4A 4C7JA 1ZSVA 2I65A 4EZBA 5HBRA 3NEPX 4MVJD 3HE3A 1Z7EA 1XG5A 4GL4A 3C3XA 1ID1A 4ROSA 4GI2A 1Y9AA 4GLOA 4WGGA 3OJOA 4NJOA 2VHYA 3ZWXA 4NK4A 4FC6A 4BOYA 1UDAA 4UEKA 5KJFA 4PZCA 4DBVO 1LI4A 3WX0A 4MKXA 3JSAA 1L7EA 1OC4A 2B83A 1QXSA 3ST7A 2DT5A 1Z6ZA 2WD7B 5EQFA 2QG4A 1N9GB 1JTVA 3E03A 3G1TA 3PWZA 5EQDA 3V2GA 1U8XX 1P1FA 1SBYA 3CH6A 5TF4A 3IS3A 2EKPA 4E12A 1SMKA 3C7AA 2QX7A 3NUGA 1E7RA 4O5OA 2XF8A 3RI3A 3QWHA 1YS4A 1Y8RA 3RU9A 2JKVA 1WDMA 3GHHA 3PJFA 2GD1O 3DQPA 4PGFA 4L75A 4ND5A 1U8FO 1UAYA 3N58A 5JDIA 3BHJA 2B4QA 3GRPA 4ALIA 5A06A 2NTJA 1HYHA 1X14A 2DBZA 1ML3A 1BVUA 5TIIA 4ZICA 4K6FA 5B12A 2ZTMA 3P2YA 3DZBA 1HL3A 2O2YA 4BNGA 3O03A 1ADGA 1E6WA 4URFA 3CPSA 3FHLA 4ZGWA 4YAGA 4MIYA 1HE2A 2CD9A 3BTSA 1A7KA 2IYOA 1UJMA 3ROPA 2C0CA 4BKUA 4RF5A 2O7SA 4BGVA 2DPHA 2WE7A 2FZWA 3R1IA 4CM7A 1A5ZA 4N7RA 4XIJA 3VH4A 3BMQB 3K92A 3GMSA 4J1QA 4PG6A 3SJUA 4AJIA 1R4NB 1PJBA 2IE0A 1PJ2A 4YAIA 5DOZA 5CAEA 4NI5A 2B4TO 5IZ4A 3CSDA 2OFPA 4BNYA 1KEVA 3UVEA 3RUAA 1KS9A 1DLJA 1KBZA 3ETGA 1T1SA 5IDWA 2VNAA 4OO3A 3JYNA 1C1DB 3FF4A 4W99A 4BHTA 1KETA 2VNSA 2X8LA 4DTIA 5KJ1A 1SZJG 1TVEA 3EZYA 4DYVA 1W8DA 4L0QA 3EC7A 3RC1A 3ZWAA 2X5KO 2OUIA 4BKQA 3H9EO 3KLPX 4ZRNA 1SB8A 1ISMA 4B4VA 3GC6A 2FWMX 4YCAA 2GASA 4BB5A 4BGUA 1SO8A 3K9QO 4DVJA 1HDOA 1LNQA 3C7CB 3F3SA 2RBEA 4CR7A 4OXNA 4CQMB 4TRMA 3U0BA 1SOVA 3UCXA 3TSCA 3ZGYA 1JN0A 5F3RA 1HDRA 4D45A 1PGNA 3ADPA 1NASA 2H1SA 1ZZEA 5DBFA 4CUJA 4D42A 4DYDA 4XQGA 1Y81A 2BF7A 5T8KC 4EBFA 2VWQA 3HB4X 1YQDA 1O89A 2FY8A 1Q7GA 1PJ4A 3HQ4O 3O8QA 1EVIA 5BNFA 5JDIC 1Z74A 1ZEJA 4OXKA 5TQVA 1AXGA 2UUOA 2YUTA 4JJIA 3UFXA 1YONA 1KC3A 4ALNA 3M1LA 3ASUA 1LLDA 4W7HA 2NV6A 3BMNB 4ITUA 3GA0A 1E6UA 2A92A 1Q1NA 2IXAA 1XYGA 2W98A 4IS2A 3ZNNA 3DBLA 4TROA 4A27A 2PGDA 1CETA 4JN6B 3T4EA 1P9LA 2UV8A 1GPJA 2CVZA 4KQWA 7MDHA 4OH1A 3Q2IA 1ZMOA 5EIOA 5T67A 4DC1A 2G0TA 3ZWYA 3TNLA 3OF2A 2J3IA 1HRDA 2HLPA 1MG0A 4GAEA 4YR9A 1KVUA 1E3WB 1MG5A 1D7OA 1DOHA 1RJWA 1VL0A 1ZMTA 3QWBA 5DP2A 5FYDA 2NACA 2G82A 3SLKA 3O4RA 1WZIA 4C7KA 4NZ9A 3ADOA 3WGYA 2D4AA 4PG7A 4R1NA 2VT2A 2WD7A 1DIRA 2G5CA 5A03A 1N9GA 1YJQA 3T7EA 1DIHA 1K6JA 3CMMA 4Q9NA 4P4GA 1MFPA 4OHUA 1MB4A 4CQLB 1RYDA 4NNJA 1E77A 3RFTA 4I8XA 3PYMA 4RF4A 2HK8A 4E33A 3UUWA 4NU6A 1BW9A 4XR4A 3HADA 1U3TA 3U4DA 2WYWA 4GX5A 4L73A 4RLSA 2DTEA 3SLGA 1PJLA 1HDXA 3WMWA 3WMXA 1ZKMA 5ICSA 2X0JA 2JCXA 3FR7A 2VHXA 3MJVA 4IBOA 5KVVA 3TZ6A 3G0OA 5JY1A 2DAPA 3DBVO 4HWKA 4WUVA 4OXYA 1LX6A 3MTJA 4IDAA 2X0RA 4RL6A 1MV8A 2ET6A 2NWQA 4JP2A 4JP3A 5IDYA 3WGZA 2IRWA 3QW2A 4RVDA 2PTGA 1JKIA 3PI7A 3FCOA 5JFOA 3ZWMA 4F45A 1HDGO 1K3TA 1KEWA 2ZB4A 4J91A 4CMHA 2X5JO 1JKJA 2O2SA 3CUKA 3ITKA 4FIZA 5HRUA 1P77A 4DLLA 4B4WA 5L7TA 3JQAD 4RVFA 5LCXA 3D3EA 4TRRA 3BMQA 3DTTA 4CLRB 3GGOA 2FSVA 3VTFA 1VJ0A 5L53A 3UH1A 3INGA 2EGHA 4XYLA 3ZU5A 1PGJA 3W8DA 1PQPA 2W8ZA 5JC8A 3NT4A 1U9JA 2OXIA 1D1TA 2GDZA 1C1DA 3PFFA 3QWIA 1E3LA 4LRSB 3H3FA 3HHPA 5J23A 5FFFA 4NQZA 3D7LA 2OMEA 4R1TA 2JD1A 2VRCD 2VZ8A 4WLUA 1YE3A 3L4BC 5B4VA 5IAAA 1F17A 1U3VA 3GVCA 1T26A 4ALLA 4E31A 3IL2A 4RVHA 4U5QA 5JDCA 4DIBA 3CKYA 2NUAA 1NX6A 3PIDA 3GN1A 1A4IA 2HUNA 4CQMA 5LC1A 3EHEA 4GX1A 1H93A 5AQ1A 4J9VA 1KC1A 1JU9A 4N5MA 1LRJA 1ZH8A 5EERA 1NR7A 3ZNQA 1A7AA 4J16A 1K6XA 3WFIA 3P2OA 4A7PA 2GLXA 3G79A 1PGOA 1LDBA 2X6TA 2NVUA 1T1RA 3JYOA 4P8RA 1XQ1A 3BXXA 1Z7BA 2VZ9A 1MGOA 3PVZA 3ROKA 2A9FA 4R16A 5EPOA 1BHSA 2P4HX 1R0KA 1DIGA 5AXDA 3W1VA 3S1LA 3AOGA 4FB5A 5CDSA 4FCCA 5TJHA 3WLFA 3HDQA 3QE3A 5CDYA 4UVGA 5THQA 1X0VA 1YKFA 2X5OA 4E6PA 4MVJF 1GADO 3A4VA 2O4CA 1XU7A 3WSWA 2V6FA 3O38A 3ONFA 4Z9XA 4OAQA 3F5QA 3EYWA 2PNFA 1BMDA 3RQSA 3VAZA 2QW8A 3TOXA 1O0SA 2QIOA 4AJ1A 4HKTA 2J3HA 4E5KA 4ZU3A 1EBUA 1PR9A 1B3RA 1QG6A 2HAEA 2AMFA 2BFOA 1LBEA 4MKRA 1K89A 4GGOA 2B0JA 4J7CA 4HY3A 1E3WA 1B8PA 4NIMA 3RAJA 3E6AA 1NFRA 3WNVA 1X15A 3FNHA 4YRAA 2X22A 1UZLA 3JD0A 3MWEB 3INTA 3PWSA 4BNFA 4UUOA 1I01A 1U4OA 1B3BA 2Y66A 4R3WA 4YYZA 5TT1A 4BQRA 3OICA 2Q3EA 3HFGA 4NK5A 3NKLA 4CQLA 1YGYA 1R6DA 3TQHA 4XEHA 5DULA 1YQGA 4XQEA 1ONOA 4P4NA 1R4MB 1C0KA 1E3IA 1W6UA 6LDHA 1TA4A 3CIFA 4UULA 5JSFA 2PZMA 1DAOA 1IB6A 1CQIA 2AE1A 3SEFA 2AG8A 2ZQZA 4KDFA 1P1RA 4DXHA 1YB5A 3GEDA 3H3JA 4IINA 1NTOA 4ZHSA 3TL3A 5A9RA 1P74A 2X0IA 3OSUA 4EJ6A 1NPTO 1TI7A 2C59A 4CPDA 2FSSA 2EXXA 4BB6A 4E30A 3ZW8A 1CRWG 3GZNB 3IQDB 1VI2A 2HMVA 3DFZA 3EDMA 4FFRA 4CLRA 3I1JA 4NFSA 3K96A 4E2XA 3KM0A 1ZSNA 3WWZA 5KOIA 1ZSYA 1E5LA 3LF2A 4FN4A 4CMAA 3RSHA 5L95A 3NDJA 1E1KA 4Q3BA 2NVBA 3PWKA 2HK7A 1GV0A 5JAZA 1F06A 1JW9B 1EE9A 1Q0QA 2Q50A 3AI3A 3F5SA 1ISHA 2JD2A 2Y1EA 3ZI0A 4QSMA 4CMEA 1B7GO 5KKCA 1K0UA 2B37A 1ADFA 2BI8A 1WWKA 2ZCVA 1K2WA 1DJQA 3PZRA 4JBGA 3KOUA 1ZCJA 2O7QA 3I3OA 4TKMA 2JCYA 1N8KA 4BVAA 2X9VA 1GEEA 2D1YA 5BSFA 1UP6A 4OQZA 5ADHA 2BGMA 4TVOA 4TRJA 2PGLA 3GDOA 2YFHA 4L4SA 3WJ7A 1PX0A 5DT9A 1AXEA 2VUTA 5TLSA 4IXWA 3A1NA 4I1IA 4ZQEA 3N74A 3RKUA 1OC2A 4CM8B 4ND4A 1SB9A 1GV1A 1AHIA 2GF2A 4FFNA 4GQAA 1FDVA 4DUPA 2BLLA 2YZ7A 4INAA 2Q2VA 1YH3A 4ESOA 3A14A 3GG9A 5A9TA 2BD0A 4HV4A 3WYEA 1QMGA 4R4JA 2I76A 1QYWA 4MP8A 1TEHA 3ZWNA 1LSSA 1YB1A 4CJXA 5IN5A 1FMCA 1E5QA 1U2GA 2NNLD 5JE8A 2BMAA 4NU5A 3GUCA 1MX3A 2RH4A 3H4VA 3HDYA 2EW8A 1BGVA 3AFNA 4E2ZA 3IUPA 4D43A 4DMLA 3GVIA 3TFQA 1UXGA 2ZTLA 4IJUA 4U0JA 1QV6A 3PIIA 5G2OA 5CG2A 2C5AA 3LVFO 2DUUA 2AXQA 5BQFA 5L3ZA 3AU9A 1ZK1A 4AJEA 3I83A 3HZZA 1EDZA 5EL0A 3K6JA 3A28A 3Q9UA 4CV2A 2PKQO 3AK4A 4Z3DA 3U3XA 4D41A 4CL3A 3KVOA 4YVFA 4L4RA 3BTOA 2GZ1A 3LU1A 4U6QA 3RWBA 1J0XO 4YB8A 5L4SA 3DB2A 3GT0A 4CMEC 4YJDA 3WGGA 1M76A 1HT0A 9LDTA 1QORA 2Q4EA 1AHHA 2C7VA 4YACA 3H8VA 3HJAA 1U7TA 5C5IA 1FDWA 5H81A 4E21A 3QVXA 2J3KA 4J9UE 4F46A 4MIEA 1F8FA 1P0CA 1DJNA 4RPGA 3FNEA 1PSDA 1T2DA 1RM3A 3E8XA 3TWOA 1LLUA 4EDFA 1BDMA 4IDGA 3K30A 5I9LA 2C29D 1CYDA 4PZDA 3ONEA 2HMTA 4ZQBA 1KYQA 2V6BA 3OIFA 3UCEA 4IUYA 1XWFA 4RVSA 1HWYA 2YV3A 1EDOA 3PDUA 4Z0PA 2RHRA 4CODB 3GEMA 4D0SA 3NGLA 1FDSA 1H6DA 4F6LA 2AEMA 1PZFA 3IJPA 3S2EA 3EUWA 4MIOA 1R4MA 1UP4A 4IZIA 5MGBA 2R00A 5GZ3A 3NAQA 3MJTA 1GFSA 2OORA 1J6UA 5JCXA 1P1HA 1LDNA 5IG2A 2V6GA 5F1KA 2GRAA 3QP9A 3HDHA 4N5LA 4TKLA 2G17A 4IIUA 1PL8A 2P2SA 1YWGO 2NTVA 1DRVA 1X7GA 4AL4A 2DLDA 2B35A 1UDBA 1YVEI 2ZQYA 5F1OA 2HJRA 4J1SA 3ZU2A 1BXZA 2C82A 5JYDA 2XXBA 1DIBA 1PJQA 4IPTA 1JAYA 1HEUA 1PZEA 3LT0A 4XZ3A 3GZNA 4KZPA 1GPDG 4FJ2A 1KY4A 4HFMA 4N54A 3CE6A 3ENKA 2IXBA 4GX2A 3WR5A 1DB3A 3DTYA 3NT5A 3A9WA 1WZEA 3STHA 3U4CA 3WXBA 4AJ4A 4DLBA 2EKLA 2W4QA 3RC2A 3Q0EA 1C0LA 4RQUA 1YXMA 1E7MA 4CLOA 1X0XA 4O6VA 2QYTA 4AFNA 4NMHA 2C07A 1YDEA 1K6IA 3LSYA 4II3A 5TRTA 1QV7A 2W2LA 2OZPA 4P38A 3AW9A 2PA3A 3ON5A 4AJ2A 3JQ9A 5IXSA 4FC7A 4KP7A 3DMTA 4L74A 3C1TA 5JCJD 2CSUA 1U28A 2D8AA 1OFGA 3UICA 4CM8A 3U09A 1GUFA 3VHRA 2AQKA 4D79A 5I9MA 3BTVA 1ZXLA 5K9ZA 3RCBA 3GF4A 2H5LA 2G1UA 3QVSA 2ZTUA 2X9GA 1A9YA 4EUHA 1I32A 1VM6A 1ENYA 2WWRA 4AJNA 5B4UA 1FDTA 4K28A 3RJ5A 4B4UA 3ZU3A 1EK5A 2R00C 1YJ8A 1ARZA 3LF1A 3Q1LA 5KVQA 1VRWA 5HM8A 5JXWA 1T2FA 4PLGA 3GK3A 4ONEA 3GFGA 4BKOA 1V3VA 4CLDA 3NTQA 2HMUA 4PLHA 2OOSA 4CUZA 4KTVE 3D1LA 1MFZA 2GERA 1GAEO 3T7CA 4GKBA 4L76A 4CMIB 4GKVA 4FFPA 3FBGA 1NM5A 2J8ZA 4IY1A 3GVXA 3JQFC 3IKVA 4DQXA 3HSKA 4AVYA 3ONDA 1N7HA 3MJSA 1HSZA 4KTTE 4FDAA 3VDQA 2CDAA 2YJZA 4PRLA 3ULKA 1PIWA 3ETDA 3F1LA 3NGXA 1LRLA 4WPGA 4R41A 1EFKA 2Y1OA 3LZ6A 4JBHA 2JJYA 5T8KA 4ZN6A 1Y6JA 1PS0A 4XR9A 3ZW9A 4FQ8A 4JLWA 4YJFB 3LYLA 1JKFA 1XHLA 2C20A 4B7UA 1HETA 2FRDA 5ENVA 4BMVA 3NT2A 3KRTA 4B79A 2EP7A 3T4XA 4G5HA 2D0IA 1RM0A 2WJPA 4TWRA 1I0ZA 3JQ9C 2B4RO 1E7WA 1IULA 4WLFA 1N2SA 4W6ZA 1QYXA 3DMTC 1ZNQO 1B14A 1GQ2A 2Q45A 1WAMA 4NBVA 2GNAA 1R66A 1WVGA 4EITA 5KJCA 3H5NA 3PJEA 3ITDA 5CPFA 3FNGA 4J7XA 2DU8A 4ZRMA 1DXYA 1E1MA 1NP3A 3FWZA 2YDXA 5U4QA 4Y6RA 3PLNA 3IDSA 4B3IA 3RJ9A 5IJZA 2ZTVA 3S2IA 3SBOA 5L9AA 3QWAA 1GQYA 3GNQA 5L7YA 3EZLA 4U8GA 3LC1O 2NVWA 3KEQA 3ZDFA 3JYQA 2VWPA 5C3MA 4MKZA 2PZJA 3G1UA 4L4XA 4AJLA 4GPD1 3VH1A 3QHAA 4H16A 5ENDA 4IGEA 2QYSA 1ZK0A 4DPLA 4IDEA 5C7IO 1TB4A 1HXHA 1T2EA 2PD4A 4WLOA 4BGIA 2W2LD 3KB6A 2J6IA 1BTOA 5KTKA 1XGKA 4BNTA 1PZGA 2ZCUA 1I3LA 1B26A 3PQDA 2RHCA 1B0AA 5DCWA 2VYND 3GLQA 1GR0A 1LC3A 4RPLA 2E48A 1GTMA 3F47A 1P33A 2CFCA 3RBXA 2VTDA 1PJSA 2PD3A 4E2WA 1UP7A 3AM5A 3WGHA 2UUPA 4OOFA 1UUFA 3ZNOA 4RO0A 3ZU4A 4L8VA 1ULSA 1LU9A 2Q1WA 1GL3A 3I9KA 2RAFA 3PPIA 4YQZA 1NFQA 4QO7A 3PYLA 1T25A 2PY6A 3AY3A 4FS3A 3I23A 3AI2A 4AJOA 4GSKA 2JHFA 5AYVA 2ZK7A 5EESA 2Y99A 4CR8A 4Z6KA 4IQ8A 2VHVA 1HE3A 3W4KA 5JAMA 4BIIA 3PP8A 3HWRA 4WEOA 1HLPA 2O50A 3O26A 5B37A 1B16A 2XAAA 3JD4A 1H2BA 3DZFA 3D0OA 4UUPA 3JQ6A 3G3EA 4YXFA 1PQWA 2FZEA 4FGWA 5HTOA 1ISFA 1U2DA 1ZUD1 4J4BA 3VKVA 3GDGA 2DBQA 1G0OA 5G0UA 1DDOA 4N5NA 4BUCA 5DN9A 1W0CA 3ZHYA 4L9RA 3EGOA 5F1PA 3FSRA 2X9NA 4Z0TA 2SCUA 4DRYA 5IDQA 1Y8QA 2NQTA 2OO5A 4OGWA 4DMMA 2Y67A 4WLVA 1XA0A 1ISGA 1QYCA 4NFYA 4YA6A 3H2ZA 3DHNA 3FI9A 4J4TA 3PFWO 3WWYA 4CV3A 3AJRA 3JQ7B 4XJTA 1EVZA 3RU7A 3C1OA 1PS9A 2GN8A 3L4BA 4CMIA 3BA1A 4PN3A 4MINA 1NAHA 3VTZA 2O4UX 2EW2A 5U9CA 3AFMA 1Y5RA 4J1NA 2YY7A 4TRNA 1QRRA 4BO9A 1MP0A 1LRKA 2WDZA 4I5FA 3GOHA 3DMYA 1OI7A 1H2HA 3BYZA 4UUNA 4PLFA 1UDCA 3MZ0A 5I9NA 3NDRA 4OQYA 2WD8A 3UCFA 3QWFA 3DAPA 1ADBA 1PGQA 2HRBA 4R5HA 3GRKA 2JCVA 4PLPA 5I7FA 3WLEA 4CM5A 5KCZA 3I9NA 2H6EA 2QRKA 2H9IA 2Y0DA 1Z73A 2DTXA 4FGSA 1X7HA 1DRWA 3TDKA 4O1MA 1PJTA 1WXDA 4RDIA 1P45A 4H15A 1HLDA 3LC2O 1HE5A 4YAJA 3VC7A 1MA0A 3AUAA 3UF0A 3VZPA 4KMSA 1N92A 1DAPA 3I4FA 1V6AA 3KSZO 4DGSA 4EUFA 4BO7A 1ZEMA 1RYEA 2EGGA 1VJTA 2POQX 1PU2A 4IDCA 4PLCA 4XDZA 1XSEA 1Z75A 1LUAA 1NVTA 4BGEA 3OJEA 1T4DA 5DF1A 2NM0A 3V2UA 1RM4A 1BVRA 3E18A 3D5TA 2HMSA 3B6ZA 1I33A 1QR6A 5ILGA 2PGJA 4OKNA 1IUKA 3JQCA 2FPIA 3TZHA 1HZZA 1GCUA 3BTUA 2HJSA 2QQ5A 1R4NA 1JWAB 2OHXA 4RZHA 3QLJA 3ENNA 3RKRA 3TRIA 1UXIA 2Y1GA 4KUEA 4PG4A 2ZB3A 2ZB8A 3QQPA 1LJ8A 3E5MA 2EERA 2EG9A 1Y5MA 4IMPA 1BG6A 1V8BA 2W90A 1TLTA 3AM3A 2I5PO 3EMKA 4ZD6A 5JC1A 1XELA 3FRJA 4PVDA 4LMPA 4DL9A 3GY0A 3FTPA 3MTGA 4NFHA 3ROMA 3ASVA 4NBTA 5L7WA 4MVJG 4DQUA 1MUUA 5T57A 1NPYA 3CTMA 5I8ZA 1GYQA 3WYCA 4CMKA 3FBTA 2HDHA 3NTOA 4HX5A 4MPDA 1ZK2A 3UAGA 3HB5X 3WB9A 4IDFA 1P0FA 2D5AA 1V9LA 4J1TA 4XGNA 3VKUA 4FFOA 5DNAA 1ZFNA 5CG1A 5KVSA 2ZATA 1EEHA 1XR3A 4AJJA 4KWHA 4KDEA 3PHIA 1EBFA 1WLYA 4CLXA 4WLEA 1L7DA 3ZHBA 2RH8A 1F14A 3ZNPA 3ZWBA 5MDHA 3R6DA 2AEFA 4OMUA 3NV9A 5TC4A 3BMNA 5AVOA 3GG2A 4M55A 3ZZNA 2OP0A 3OH8A 2HO5A 1XU9A 1J5PA 5TSDA 1YL7A 5HWSA 3EAGA 4I9NA 3WS7A 3Q3CA 2BGKA 2C7GA 4E0BA 1NNUA 1AUPA 3HN7A 4F6CA 1VL6A 3C8MA 2TMDA 2I3GA 4YT2A 1H6CA 4CMCA 3NDIA 1JQBA 4U0KA 1UAGA 4YT4A 1UXKA 2EKQA 1DC3A 4RCVA 2GZ3A 3E9MA 2BFMA 2UYYA 4EI2A 4ZQGA 3OQ6A 4YJGB 1AE1A 6ADHA 1LC0A 1WMAA 3DAFA 2VYVA 3B20A 1TT7A 2O3RA 5A3VA 4LMRA 5L4LA 3D3WB 3L6EA 2OP1A 2JAHA 4NR0A 4BKRA 1T4BA 4BNVA 2CMDA 5TX7A 3GVPA 1SOWA 3BMOB 4OYRA 3ANMA 3GGPA 4Z9FA 2C2YA 5COAA 3JTMA 4TZKA 3F46A 3AWDA 4QECA 3MJEA 4BNJA 4S3MA 3VOSA 3TZQA 3F4LA 2CF5A 4YJHB 4B8WA 2IZ0A 1M67A 3HFSA 2YHUA 4BNNA 3UXYA 3L6OO 3RUFA 1S6YA 2IDZA 1IY8A 1A72A 3IOYA 3SC6A 4FJ0A 2WSBA 4E5MA 2P5YA 2GSDA 4ZQFA 4WNCA 1LSUA 3P7MA 4WLNA 3CZMA 1P3DA 4CLEA 2WYVA 3IAHA 1E3JA 3EVNA 2G76A 3OEYA 1D4FA 1I10A 2CNBA 4XCVA 4BO8A 1R12A 5LDGA 3CEAA 2JFGA 2P9EA 2XPCA 3PDJA 4XQ9A 4CM9A 5A1TA 1C14A 4AJPA 1CERA 3SJ7A 2FR1A 4FPXA 5C7LO 2AE2A 1GD1O 1DHTA 3K31A 1RPNA 3L9WA 4IGFA 2FHSA 4GH5A 3GUYA 2GO1A 2DVMA 1S7CA 1N7GA 3E9NA 1MLDA 4XRGA 3WBFA 3V1UA 2ZIZA 4PLYA 4M87A 4XGIA 3LT4A 3ZWWA 4CQMD 2RCYA 4U7WA 1I8TA
chains in the Genus database with same CATH superfamily
4FLEA 4XX1A 3NIGB 5JD6A 5EXSA 2ZBEA 3SKVA 2QTWB 3EY9A 3FXAA 1E9FA 2X76A 2GK7A 1QBKC 4XYBA 5FJIA 3GRVA 4AQDA 2WHYA 3IMGA 1DNPA 3F9RA 2ZSBA 3H5RA 4QT4A 4TLEA 1WCWA 3TDNA 3D2AA 2ZANA 3PWTA 2ALJA 1V3TA 2AMYA 1K1EA 2QKYA 3DCYA 2XOKD 3H8JA 3DL7A 1WJGA 1Q6ZA 3LMKA 1AKNA 4JDPA 3AJ8A 2I62A 5CDFE 4E6EA 5IP5A 1C0EA 2AS0A 2Y0CA 3BIWA 2YASA 2EKDA 3MJCA 3RIYA 5HSGA 5IT5A 2B5VA 2N9UA 5LQNA 3HDVA 3WLMA 5G4LA 4YONB 2CLLB 2JIOA 2LRHA 1Q7BA 4KR0A 4KPEC 1DO8A 3F98A 1ST2A 2FFRA 2YCBA 4J0FA 3STWA 2IU3A 4MOWA 1GL6A 4R5MA 2ZJBA 1GG2A 1UPCA 4WOCA 5HJ5A 1L7RA 3ABIA 1IN5A 1GAJA 2FPPA 2ZWMA 4OHOA 4D8UA 3DV2A 2WIJA 5BQXA 3WKCA 1JHRA 2PFGA 4JGIA 1A4UA 1PUXA 2E5FA 2HXSA 2W6JD 3FJ1A 1EUZA 3FYHA 3K0FB 2VJBA 5JH7A 5LKAA 2A86A 1ZMRA 3B82A 3OCYA 1P0QA 4X20A 5JAUA 1XZKA 4LI3X 1S9DA 5KDLA 3A4NA 3IQGX 3GARA 3E3AA 5GONA 4KIWA 3A70A 2DR0A 4ZJUA 1D1PA 4HEHA 4MR9A 3IHLA 1F6BA 2ZW9A 4LY6A 4CF5A 1N2HA 1UWCA 1QR2A 2QP4A 3NTVA 3BREA 4HGRA 3QKIA 5B1DA 4YFVA 4AYWA 3DL2A 3H11A 4CM1A 3RHTA 4US0R 1VMDA 4B17A 2BFDA 2YX1A 3GWZA 3KKMA 4X90A 3IMKA 3IH5A 4Y1EA 1X1SA 3EXEB 3WL7A 5K45A 2GPYA 3HP1A 3CLHA 5AI0A 5IXJA 1NSFA 5DGCA 1EK1A 1M1YA 2AX3A 4MYDA 3IXQA 1XV5A 3MT0A 5CA0A 1GZSA 1KS2A 5E3IA 2GHRA 1EXDA 5C80A 2N1BA 2FP4B 1WHSA 3ZY4A 1XPJA 1KFCB 2JFVA 4CFZA 3HVIA 1J90A 3JASA 4QNRA 3BPSA 5CB4B 2IDKA 5A5EA 3SMQA 3FI0A 1N6NA 1UJ5A 2F17A 2NQ8A 3OFKA 2DPXA 3SYRA 5H80A 4A0FA 5EXDA 4CIBA 1ZM3A 4YJGA 4R1UA 4UDOA 3C4QA 3D8RA 4ZHQB 1H2RS 4TPKA 4OSOA 5BYAA 3GW8A 5HIAA 1TK9A 3ZE6A 2VJQA 3D3WA 1I7DA 3WYBA 1KDYA 4ZYWA 1DQRA 5FEUA 3ELBA 2ADOA 3VO8A 3G9XA 3O92A 4N6OA 4RGBA 3W6ZA 1NJ5A 3KKEA 2PL1A 3MCTA 3PF8A 1R0RE 3VUFA 1G8YA 3RVDA 4WKBA 2ATXA 2BKAA 2A78A 4MVJA 2OQVA 4DG9A 4OHPA 3JWHA 1BRMA 4MVJH 3STTA 1U63A 4ECEA 3IUNA 1K5DA 3HCPA 3J81k 5MN5A 3K72B 1BWRA 3OO1A 1RXIA 3GZ4A 2FSHA 4BFWA 5CFZA 2JAQA 5FP0A 3MTDA 2AN9A 1K8QA 4C04A 1KAGA 4FYYA 2BN4A 3CURA 3OZRA 5LD2B 2R11A 1JHMA 3IO3A 3IT0A 4B73A 3NHMA 3QKTA 3W5UA 4ZYZA 1HNXB 2IQ5A 2VT7A 4DNQA 2FN8A 2M32A 3THWB 2Y76A 3DVRX 1O03A 3UJDA 2I3AA 3I2KA 3CGWA 1PO7A 1XZLA 5AHRA 4ECAA 1MAAA 2WG2A 4G8BA 4PCVA 4BRZA 4MR7A 5EWJA 4P7FA 3DMPA 1DKRA 1OT3A 3X0DA 4ERNA 5HUJA 4BY9E 4D0RA 1U5BB 3GGGA 4ED9A 4AQ7A 2V7EA 4TYMA 3WWPA 4GGMX 5AI6A 1MT3A 1SN7A 2B8NA 3IP1A 3T5CA 3JQFA 3H86A 3P32A 3PI6A 1GHTA 3WKEA 3PQFA 1HE1C 3A0UA 2G3YA 2R6JA 2ZIWB 2VA9A 1RLJA 1UBTS 2VAXA 4JENA 3U81A 3KTAB 4UHCA 2Y71A 1RAEA 3WL5A 1V26A 3AKDA 5A4AA 2E6UX 4L6AA 3VBEA 1YJBA 4EHBA 1HTBA 1F0PA 1JMKC 1KEZA 1Z5GA 2ZJ4A 4Q3OA 1A5BB 4WW0A 4ZJYA 3RHSA 1F51E 1V1JA 5U1PA 1TTQB 3JVDA 5JVDF 2WJAA 2W6CX 1BFKA 2J6CA 4JHLA 2PVSA 4H1VA 2J3QA 4JLDA 4A03A 5AVWA 2VHJA 1LPOA 1ZM7A 3GJ5A 2CUKA 1RRVA 1VTKA 3STYA 3NVKI 5GY7A 4J0KA 1GTRA 1XDWA 3BDAA 4IICA 4UDXX 2J0UA 3R76A 3SC4A 2FPWA 5TPZA 2ATVA 4ZGGA 2FQQA 2VRNA 1GNQA 3ZV6A 3V7UA 5LWHA 4PLWA 2B36A 3NBYC 5CEFA 3ZHZA 5FHQA 1AK2A 5CVEA 1WW2A 1JKMA 2AFVA 1VL1A 2OFXA 2F00A 2YV1A 4JT9A 5FL7D 5BN3A 1YBVA 3G49A 3HXLA 1XO1A 3HVKA 1U3WA 1LA2A 1BN6A 3GWGA 4RQTA 4KJXA 5HYVA 1G66A 2OQIA 3NOOA 4ZIRA 1G8MA 2NYUA 3G0HA 4YMLA 1GGFA 1NJ2A 3KEGA 3PDHA 2W42A 2X3YA 2I2XB 1V6CA 3JCZA 4IS3A 3V8VA 4DUYB 1C0IA 5HA5A 4TKVB 3K0FA 1Z6TA 2C97A 1SK8A 3MWDB 2IJGX 1Z22A 5JS1A 4CI9A 4XJSA 2CFRA 4YCDA 1JR2A 1S89A 2AYYA 2DFVA 5LFAA 4NONA 4BX2A 2NSLA 3CVWA 1K7YA 2ETVA 4FM9A 5CXUA 3P0HA 2WD9A 1OE0A 2FSFA 1SJ9A 2E55A 4DLKA 1IM2A 1I4DD 3GELA 4KXLA 3MG9A 3AG6A 3NHLA 4DQLA 2CLKB 2CDNA 4KQ2A 2RAUA 3L9XA 4RD3A 3EXEA 2CVFA 4IGIA 4QSHA 3COPA 2PUAA 4CM3A 1RWWA 5GV8A 2O2DA 1Z4LA 2AK3A 3G7UA 3KQLA 1M2VB 3PK0A 3WIEA 4KLRA 1M2WA 3CNHA 4YIKA 2V65A 3KB1A 4LMAA 8MHTA 1DTEA 4EEKA 2WUGA 4L85A 3X43A 1M6WA 1ZGZA 4HH3C 2ZYDA 4YAUA 4M46A 1GU0A 4FXOA 2CUNA 2H59A 4NMLA 3J81A 1NBMA 3PHLA 1NXQA 2KM1A 1UCFA 2J3DA 4N65A 4E5PA 1NJ8A 2FG7C 5CB4A 4XSGA 4EUEA 4Q02A 1G3IA 1R0WA 4Z0NA 2Z43A 2XQGA 3NJ4A 2D59A 3B2NA 3RFUA 4RJ2A 4KHZA 3UHAA 1EFRA 2EFYA 3WLPA 1ZD1A 4FDVA 3WQQA 3U3RA 1EQAA 3V4PB 4N47A 4ZHQA 1X9HA 2OILA 4J0GA 1X13A 1CZOA 1K7SN 2AOXA 2VAWA 1AXRA 2WWVD 5IN4A 4A8JA 1EAYA 3H1AA 4KQXA 1LJUA 3WO0A 5EUCA 3RYCB 1BQ4A 2C2KA 2QTLA 2XE4A 2YXDA 4Y0VA 4G5GA 5FPHA 3LX8A 3MS4A 2ZT6A 3OA2A 4P5DA 5ES3A 3VZQA 3OPYI 4WKPA 1KVSA 5G0WA 3QNMA 3KSAC 4X5OA 1SQSA 4NPHA 5F7XA 3ZWCA 4NABA 1W29A 2Q3BA 1Y5IA 2PWYA 2XCIA 4WEQA 5FOQA 3O2QB 1GP2A 1BW9B 1P9WA 4AS3A 4BMNA 3C4JA 1FFEA 3CG0A 4JOCA 1B6TA 5EJAA 3ROXA 4YV0A 2BELA 3KPWA 1F0NA 2ZZMA 3ND8A 1VKRA 2O2IA 4NNPA 4AYXA 1P1KA 2HPHA 2JCBA 3COWA 2AJTA 2G6BA 2OL4A 1QYDA 3LUDA 3S55A 3UWKA 2P67A 2DE0X 3D81A 3PQ3A 4G5QA 3VKWA 5T4BA 4B3BA 4D4MA 5EXXA 2IPAB 5COQA 4PHFA 5IBRA 1JSCA 4IOKA 3C41J 2Q4BA 4WFQA 4WUTA 3KGDA 1TAHA 4MSUA 4WE3A 2GXAA 2P3OA 3SZGA 5DX8A 3ROZA 4NG4A 4YRCA 1NV9A 3L7AA 1AUQA 1ZJ6A 2WT9A 3THWA 3B12A 4PZPA 3K2BA 2E3JA 4X7PA 2P9TA 3V3KA 1ZRHA 3TW8B 2IHUA 2A0UA 3L02A 2ZYWX 3CKLA 3PE4A 1WQ4A 1YBMA 5AXCA 5LOVF 4YPVA 4DV3B 4LWZA 1U5BA 2CJYA 1XFDA 4PRKA 5TPZD 1EKXA 5IUKC 4BE9A 3IR7A 3H9QA 3FY4A 3ZXUB 3TEMA 5I4BA 2CXQA 2ZRMA 4DQ0A 1FBTA 4MB6A 3ZX4A 3GH3A 1KXZA 3PICA 5GMOA 2IOYA 3KTAA 1O9HA 3A04A 1QK5A 3KV3O 2H3HA 4TM8A 3L8CA 4HAUA 3BA6A 4LX8A 3ZR4B 5COBA 3PHHA 3WDSA 2BHTA 4KWEA 5TDHA 1BA2A 4IDDA 1GTJ1 2XLBA 3K0CC 3QSGA 5B36A 4URZR 2XQFA 1JA9A 1N3IA 2F90A 5FTKA 4E22A 4BWGA 2WM8A 2AH5A 3FAKA 3NYWA 1K8RA 4UC0A 3QG1A 4FEEA 1E1NA 5AW5A 3T4UA 5BT8A 5DM70 3IKTA 4JI8B 1NG9A 1KH1A 4OLFA 4IOMA 1E5DA 1PUIA 3IOEA 4KCGA 5NULA 4LGVA 3D4OA 2FX5A 2MSNA 4EKDA 2O8BB 1EUCB 1D1SA 2VH5R 3HN2A 1FXWF 2PNJA 3VAYA 2YS6A 2QUIA 1J9ZA 1M66A 3UHJA 1AKUA 3ISTA 3QEBZ 1QIFA 4Z4EA 5DNUA 4BFCA 4WXHA 2EF0A 4MDHA 3K94A 1HSOA 1XZIA 1F2TB 3NBUA 3HG7A 2R85A 4DR3B 2R47A 2I54A 3CLRC 2Q4OA 2ZT8A 2NVUB 3AV3A 1RCTE 2VHTA 3MOGA 5CU7A 2A0XA 3AOEC 3TN7A 4HO1X 3RIGA 3RPEA 1H9BA 5EIEA 3WA7A 1OWMA 4FE3A 3E2MA 3TE6A 4YAEA 1WW3A 2W2OA 4XXHA 5F51A 3LUGA 4C0QC 1YQXA 3OZGA 5ELXA 5DN6D 3ADCA 4C9BA 3GLRA 1IQ0A 1ZX1A 1WETA 4RDHA 1IPEA 3MWDA 2OHIA 1NBMD 2XYPA 4NICA 4EKEA 1EB9A 2ZRHA 1LDMA 1G21A 1XHEA 3IA7A 2WEKA 5ALJA 2NXWA 1SEPA 1XUOA 3TD9A 3T3EA 2H1IA 5KI6A 4DRXB 4UU8A 1G6Q1 1ENZA 1I6LA 1GG8A 2QRPA 3HXPA 4ZCSA 5IKPA 1ORTA 1QHYA 1EFRD 2FK8A 1EHCA 2YNMC 3V4ZA 5I7VA 4QBGB 1H1TA 2HRZA 1GAXA 1IEXA 3BGSA 4WESB 5HQTA 3TECE 1E7QA 1L1FA 2RHJA 1GZUA 3L7OA 1J56A 1G6HA 1KPHA 2GK3A 3DZKA 5GPBA 3GL9A 2OAQ1 4L4UA 3GFBA 4DCTA 3NWEA 4XOUA 4F1KA 2Z08A 4DB2A 1M2VA 2WTUA 3ZZUA 5CGQB 2FSUA 2G9NA 1YRWA 4IIHA 5K0ZA 4BNIA 4CV1A 1TM1E 2VTKA 3Q3EA 1K97A 1NW9B 3MCVA 2X86A 4FMPA 5KYNA 4BBAA 3IEPA 3V48A 1EG2A 2I55A 5SY4A 4HNRA 5CB6A 1I4OA 1UOPA 1GYPA 5AVSA 3K15A 3V32A 3ZBTA 1NMZA 4C5CA 1EK6A 4V38A 1U2SA 5CM9C 4B1FA 1TC2A 3JWJA 1LDYA 2CXUA 2JFYA 5J23A 4EF4A 1MQ9A 2ESRA 2ZYVX 2IU0A 2IV7A 3BL6A 4N76A 3KOZA 3A1SA 5EJ4A 3CVJA 4NL4H 2FMXA 1KI4A 1Z2NX 3IV6A 3B6IA 3USES 2UYOA 3V4VB 4XE5A 4CV0A 3RYCA 3NEJA 1D6NA 5F2NA 5MN4A 3M5DA 1NMYA 1B6RA 1W7AA 4OQDA 5AKIA 2VT3A 5DOVA 3O8CA 3KS9A 4ZOQI 4JU8A 3W5HA 5JSZB 2P9GA 4K7JA 3GFSA 5KTOA 5KNCH 1UQUA 1BMTA 1Q0LA 2G4LA 3ZTTA 1LDGA 1PDWA 4JL5A 4OP2A 5J2TB 4OHMA 2DFNA 4HDSB 5F2KA 3RROA 2X2FA 1NYTA 4NBUA 3AU8A 5A5FA 5KTRA 2JLYA 2N0SA 4HADA 4NCIA 4QPCA 2B4AA 4D9MA 5ICMA 3MHPA 4HHEA 3JWGA 4J2OA 3RRMA 3EISA 4XPZA 4DIDA 4N18A 4TUYF 4NF2A 4IL5A 5F7JA 4D25A 5EUQB 2Q2QA 3JQ8B 5DGTA 4DCNA 1T29A 2D6FA 4XTRA 4D6YA 4GPZA 1LF5A 1K6EA 1G20B 2OLJA 2DBRA 4YEDA 1BE6A 3MNFA 1UQRA 2O8FB 3CPEA 3CRRA 2GARA 5DB4A 3CX3A 2FXVA 2PH3A 4JT2A 2NZ2A 3BE6A 2P6NA 3A9TA 7ADHA 1SD5A 4PQRA 1U98A 4HUTA 4GPBA 4UBMA 2R6DA 2W6NA 3W0LB 2XQJA 3HBNA 3PB3A 3ZY2A 4CM4B 3B7GA 1K5HA 1KH3A 1LLQA 2P91A 2P9CA 2R3SA 2YY6A 4UVIA 3W78A 4EJMA 4JXZA 1GYRA 4CN9A 5AVQA 2XVZA 3N0WA 3SVZA 4IR7A 2WJ3A 3AVVA 2BFAA 5DK4A 2AFIE 2VTEA 3E9QA 3KJHA 4YTEA 5ALUA 2GXSA 2L18A 3HGQA 3ZCUA 1AHPA 1E6CA 3WL3A 3FDJA 3QH4A 2WTXA 3VR6D 2O8DB 2V58A 2IT1A 2VDWB 1GAWA 1YBHA 4RVOA 4GUDA 4PSKA 3JR7A 3N8KA 1V95A 1Z26A 4OXIA 5DBIA 1WV0A 2ZXFA 4GBGA 3RRZA 5IUJC 1UPBA 4Q01A 2FG6C 4HAOA 4Y9UA 2R6CA 2PHZA 1LNZA 3KFVA 4BVGA 2F8SA 1X2EA 1TUEA 2X4IA 2F1JA 3FNBA 5JD4A 1EUCA 2A6PA 4EYEA 3R7NA 3ZCPA 3VMFA 1ORIA 2QLNA 1EQ2A 1GQQA 4K9MA 2XMQA 3F96A 4BFUA 1RS0A 3PHCA 4ZXFA 4CHGA 4KFTA 1FFHA 2IP4A 2ORWA 4TS3A 3OFVA 2MU1A 3W7VA 3CZ5A 5FWNA 4TYYA 2WRZA 1CPYA 1NLFA 3AQ4A 4IKPA 1F2TA 1LK0A 4QQRA 2DC1A 3SHVA 3UKDA 4Q48A 3LTEA 4LV6A 4DMHA 4AP6A 4DABA 1F3OA 2QTBA 4ZMSA 1R9JA 1CIVA 5JWOA 3NRJA 8ATCA 1W4LA 1F4LA 4PO9A 3T5BA 1QC5B 2BBTA 4DTCA 4RE6A 1YI1A 4EIWA 2SKEA 3RS2A 3Q11A 1HFJA 2BKXA 2GCGA 2YQZA 3WO1A 5KSYA 3CH4B 5BR7A 1IXZA 1T3HA 2FF7A 3K8ZA 1E3EA 1NU6A 3KDSE 2MINB 2QV0A 3EAFA 5U4XA 4WRRA 5JW6A 1AGXA 2FN4A 2XSZD 2J31A 3Q1KA 1P1JA 1LWNA 2VLIA 1C3EA 4MGIR 5HE8A 5KSPA 5K4HA 4PPGA 3WIDA 1FP1D 1A1SA 1NW7A 3UGTA 4S1PA 2ONCA 3RSCA 2DUJA 2WIKA 3TPZA 1C4OA 4B87A 4BMOB 5D3ZA 3TRHA 4DRXA 1N8SA 5KWEA 1NLUA 2ZIAA 2REQB 2W2NA 2EJBA 4RW0A 1UL1X 1BO6A 1E4VA 3HJNA 4XAQA 4ARVA 4BCCA 3OLZA 4XM2A 2GPAA 4Q7JB 8LDHA 1N5JA 4QELA 1LK7A 1PTJC 1XNRB 1KEPA 2XHEA 1R16A 4Q3CA 1BE8A 1ILEA 1PWYE 2C4NA 3OIGA 3TW0A 3RUEA 1MO5A 1HYBA 3KHUA 2IZZA 1SXJD 3PXCX 4IRUB 4MQMA 5DNCA 3W5IA 1KHTA 5HOEA 5KWSA 1V96A 5LQJA 4GM4A 1U0LA 4TL9A 4CIAA 3WJAA 4WKCA 1JIJA 1IRXA 3NOXA 2OVBA 3EVFA 3FTDA 4DLAA 1XD9A 4CM6A 2KX7A 2VKQA 2FMHA 1QNLA 3ZXYA 2EJWA 3RK0A 1JKXA 2J9YB 1T3LA 1EFPA 1H3FA 1V8ZA 2AG5A 2M9MA 4M9SA 5JSQA 3LPLA 3EX7C 2TS1A 1W94A 1WPQA 4GQBA 4LSZA 3HO6A 5D86A 3RODA 4AWXA 3ZXSA 5I4IA 5CD1A 2P68A 3H2SA 3GEEA 8GPBA 4C3ZA 4CT0A 2G77B 3INNA 4AROA 1IDOA 1C9JA 1FF9A 2EL9A 3NV7A 1W4RA 4NVRA 4GXRA 5JAOA 2GTHA 4GDMA 1QCDA 4BB0A 4ACAA 1MOZA 1RXUA 4M76B 1VKZA 1MNQA 1TQHA 1K8XB 2FWAA 1IIBA 1U99A 1H9AA 2E1PA 1DX4A 3E9EA 3GFVA 4Q9KA 2RHGB 2XUQA 3N8DA 4HDSA 4CKEB 3ZQUA 3S1SA 4KMMA 5J2TA 3KEMA 3M2TA 1SHZA 4UDYX 3IX7A 1VJ1A 3LLVA 1H3EA 1VCIA 2JI8A 2VXBA 4NEHB 1QG4A 3RVJA 2BE9A 4V02A 4JLBA 2BY4A 3NMUF 1AB6A 1CF2O 1E4EB 2AK2A 2MYNA 3AUXA 3BFPA 3DC2A 4GSLA 1XLTC 3SF0A 2H63A 1NF8A 1Y9EA 3R6GA 4A9AA 8ADHA 3ET5A 4XWWA 3JQ8A 5H3CA 4Y2TA 3IWCB 3I2HA 1NWHA 5D5HA 4E4RA 1E0AA 4URVR 1THTA 1Q6YA 3JS5A 4RHFA 3RM3A 1G6OA 1G20A 2VZ0A 3TPCA 3U7GA 2XCSB 4M4SA 4IQ0A 1SQFA 4K87A 5CX1A 3EY4A 5AJZA 3PQVA 2O8FA 2Y1FA 2I8AA 1OLXB 3L07A 4HXYA 1CT9A 1K9VF 1VLJA 3H97A 1PJAA 1L7QA 3F74A 3DBRB 3QMMA 5DHTA 3TIVA 1B6SA 4FW8A 3HKDB 1I7BB 4ASUA 1M2JA 4RKQA 1R6TA 2PSFA 2PV7A 4NBRA 1G3QA 1FDRA 1LI7A 2H4HA 1WNTA 2PX0A 4DA9A 3IB6A 4EWLA 4CM4A 4WOJA 4CTKA 4HK4A 5CDTA 4FE7A 4L4ZA 3JYLA 4LTDA 4NJEB 1XEWY 3E82A 2IIVA 3IULA 3EOBI 4J3FA 5J47A 4W8OA 6AT1A 3LY7A 5F9FA 1NULA 1YZTA 4BFXA 4Q7KA 4LWPA 4YMGA 3JD3A 2BIFA 1E1CB 4NPCA 3MRTA 2YVAA 4OP3A 4QZVA 4Y98A 4CLOB 4F3CA 1BEUB 5IXYA 4GM0A 5KZMB 3DZGA 2WFZA 4RZ2A 1A69A 2BP7B 1R27A 3BJZA 5J4LA 1MR3F 3GAFA 2VDWA 3C6KA 2EX0A 4LECA 4RENA 1VP3A 1NU8A 3H84A 1XVUA 3DKIA 1KVRA 2CLMB 1OXSC 4QD3A 4E3WA 2P5SA 4DMCA 2O3TA 1MHPA 1ZUWA 1CK4A 1IHXA 1R18A 2VQFB 1W34A 5C1BA 2GN6A 2PSEA 3H19A 4MUBA 1CQJB 5J3JA 4PXYA 1W0KA 2Z2XA 3DBHB 2BGLA 4I1PA 2X2PA 1CLEA 2GI4A 1PUJA 4WNYA 4AF7A 3FOCA 3T5PA 2BRUC 2WSLA 1IQRA 3EJWA 2BGUA 4UREA 4BO6A 1NVGA 4ZO4A 5JMPA 2AOTA 5F7ZA 3S7TA 1XMQB 4JZYA 1KK1A 2X5XA 2QSJA 2AXEA 5CIQA 4UBLA 2D3TA 1LBIA 2ZE8A 4UEQA 3VVLA 2X0DA 4BLPA 3I5MA 1ELOA 3BB3A 4UCWA 2EIHA 1DV2A 3FVRA 3KT3A 3DOUA 4QM6A 2Q4RA 4IJMA 3UH0A 3ICCA 3HZRA 4FILA 2DWUA 1QC5A 4F86A 2B0CA 1O9BA 3UKOA 3V8BA 1SXGA 3VPHA 4OLAA 2YFKA 3VPGA 4YDSA 2PX2A 4BFYA 2H48A 2IHJA 3AKYA 3VR4H 4JK3A 3M6AA 5EINA 4FXPA 2ZRPA 4HG2A 1Z13A 1ESCA 2MINA 2FZ5A 3GLGE 1XPOA 3N8IA 4XYGA 4MEJA 5FLYA 1SK9A 1H0KA 4MP3A 5B4TA 1V8PA 1J1UA 3GR6A 2FEAA 3FR8A 1FYFA 3CINA 4QUKA 5J5VA 3ASYA 1H2AS 3OZUA 3TOSA 1V3UA 2QMOA 5B6IA 1OUMA 1P4RA 3D0RA 3PA8A 4CTMA 1ISJA 4D44A 2REQA 3A4TA 3KEOA 4JAVC 1Q84A 4GI1A 1WZCA 1AF4A 1XTBA 2VHWA 1GVHA 2DJIA 4NULA 1OAAA 2QU8A 4E4TA 5I7WA 2P0YA 2FCAA 2YJ3A 4RK7A 1VFPA 1FX1A 5KJEA 1GQSA 5LUBA 4BVHA 2QZ9A 3WV4A 3CRZA 4HXFB 5K8LA 5E6SB 5E7IA 1ULUA 5ADWA 3A4MA 1HLFA 3HBFA 4FW9A 4KYVA 1MJFA 1U8AA 4NH4A 3T0IA 1RBZA 3R0IA 3HWX1 1U7DA 4I5GA 1SM4A 2IYVA 4DDTA 3D0KA 3K53A 4GM1A 4LG1A 2VJDA 1QF9A 1MAHA 2RC5A 2PAFA 1VRVA 1E9SA 2FEWB 3AF0A 3NPAA 5TQ0B 3PX2A 3KXKA 4I6GA 4MW7A 1GQFA 3VH2A 3G68A 4DCSA 1ZS9A 1Z0JA 4FUTA 3FGZA 2BV3A 2O1SA 4ZC8A 1ISIA 3ZDQA 3B52X 1B2LA 4PICA 1XRQA 3TFOA 1T2VA 3BJIC 2RARA 4WY2A 1S2MA 5F12A 3T3DA 5K8VA 5KYYB 1DLIA 1UBSB 1LQ2A 3FMOB 5A7HA 3AB8A 3WHPA 1M1ZA 3LBHA 5DEOA 4GLLA 4A5OA 4HOYA 4JY7A 4EB3A 2DFDA 2WHQA 1SQ0A 3GU3A 3HYRA 2B9EA 3OO0A 4F06A 3IAM1 4U7GA 1DV1A 4QAQA 5IT0A 1TC1A 1JEEA 2FZLA 5KMGB 1TQ4A 2QNIA 1DKNA 2Q41A 3RBZA 4WA8A 1YB2A 3P0FA 5BOSB 4KLCA 4EPYA 2ILVA 1C50A 1L4UA 4GZMA 4R01A 1ZA2A 1DAIA 2I4LA 1I1QB 2VDPB 3EP3B 4PLTA 3V8PA 4HH4A 4ASUD 4X24A 1FJXA 3OAAA 3LDAA 2I1QA 2VPXA 4BO2A 3ESZA 4TZTA 4BQQA 4CKEA 2AHRA 4S2EA 2QPTA 4DIEA 4NTZA 1Z2PX 4JSTA 3TGWA 3VPBA 4A2CA 4COKA 2BEWB 2EF1A 2XGSA 4J07A 4DR1B 4QFCA 4UUMA 3K70B 2ZI6A 5AW3A 2V9ZA 1ZJJA 1OOEA 2IYXA 2OV6A 3FGOA 1IHYA 1PK7A 5AQEA 1UANA 1QVZA 4RVGA 1S4QA 2A0YA 2BW0A 5DU2A 1W1IA 3EVTA 5KQRA 1LBHA 1Z5OA 3UJHA 3P45A 4DCCA 5IUNC 4J0EA 4U2CA 5BNIA 2H85A 2OE2A 4M8IA 1LF0A 5I9TA 1UBGA 2A94A 2FGKA 1JENB 2FFBA 2FVXA 2VP2A 4LC9A 4PFJA 4QVKA 4TMVA 1OLXA 3ELWA 4ZREA 5G1PA 3LBNA 3M0EA 5F2OA 3ZVNA 1DU4A 5CYFA 1A9ZA 2MMGA 3DBRA 4S1TA 2A59A 2HA2A 1PVVA 2PTHA 3HKDA 2G70A 4US1R 2ILTA 1L5OA 4YT8A 3U44B 1DQPA 4BWFB 3MLBA 1W0KD 3QI7A 2JAPA 5BQPA 5TT0A 5KX5F 1SNYA 4LJ9A 4NJEA 4E07A 1PR4A 4JVNA 4MQ5A 4YRRA 4OHBA 3WKAA 5DGHA 3M4YA 4RJIA 1R6VA 1M0EA 3OIUA 4FBGA 3T3OA 4F5DA 2H2HA 4C3OB 1HE4A 1MNAA 5BNTA 4JP5A 4JJEA 4Q1EA 3TLMA 3EPBB 1GTZA 3WIBA 3QVLA 4LGYA 4DR6B 1PGPA 1I6WA 4P3XA 2Q5CA 2VF4X 3I0MA 3OEWA 2GAAA 2MSLA 2NO6A 1JYFA 1RD4A 2BP7A 2RGCA 3DZIA 4JSRA 3PQCA 3RARA 4F91B 4JV5B 2IOHA 3GAMA 4DCVA 2VZEA 4YQEA 3TOVA 1LFDB 3C24A 3BWDD 3TLCA 3OZSA 3TG2A 3DKPA 1UM8A 4LSMA 2QWXA 4B5LA 4EA6A 3TOCA 4ZZ2A 1IE3A 1E7YA 3K0SA 5DBHX 3OFJA 4QLOA 1ONNA 1CQJA 1PN3A 1QK4A 2I0FA 3NM5A 4UHKA 3W8EA 5CVJA 3IIKA 3DBHA 1RHMA 2CF6A 1L7XA 1XMOB 4XVQA 4LJYA 4E5YA 3NXSA 2QROA 1JXAA 3A37A 5KHAA 3WG9A 4A36A 4RK0A 2H18A 3JYHA 2GN1A 4BN0A 5H9WA 1L4BA 3I9MA 4D8TA 3SFZA 4CIWA 4FR5A 4I8IA 1I36A 5LVAA 1NQWA 2CWDA 3ML1A 4JX8A 2LZ0A 2OV2A 2IH4A 3H2IA 4WCVA 1JIXA 4JYMA 2WTNA 3DEAA 3VHLB 4Q3NA 4G8JA 4ESEA 1AK1A 3E7FA 4JCCA 4AICA 2C4VA 1JEQB 1P80A 2ICAA 2JGFA 2O1EA 2J9ZB 2ZGVA 3D6NB 3OFND 4FFLA 4PLVA 5JJCA 3CO5A 3DE4X 5KJ6A 5DYNA 4UMFA 1CFJA 4GFDA 3UM9A 4ANFA 3DEYX 5CHEA 4C7JA 1H0HA 3T4PA 2P6UA 2JCSA 3UJPA 3SIXA 2AJCA 5HBRA 3NKFA 1FOEB 2H1WA 1RT9A 1A98A 3EMBA 2XDAA 1OA0A 1RWXA 5EXPA 1ID1A 1SHJA 4GI2A 1Y9AA 3RVMA 4WGGA 2AJLI 1D4AA 3GOQA 4AKIA 3ZWXA 4UHHA 4C4SA 2HA6A 4TS1A 1DPFA 2WKSA 4QGBA 1V7PC 1VXRA 2VEOA 3CF4G 3MJFA 3DWEX 4FONA 4G1FA 1HGXA 1RLOA 4PZCA 5KJFA 3MJHA 1OC4A 2C2OA 2I71A 5E6SA 3UMYA 3K5IA 5DHSA 1WS6A 2DT5A 3WZMA 2PX6A 5EQFA 4YV2A 3VPCA 1N9GB 3V2GA 3G1TA 5JD5A 4L95C 1U8XX 3B3QA 3UV6A 4RTKA 2A30A 2EKPA 2YFYA 3DCIA 4BN5A 1VCNA 4QPDA 2V5UA 5TEVA 5TQ0A 1K8YB 3HR7A 1JEOA 4LA4A 4WV3A 1AA6A 1CEXA 2HWWA 4M0EA 3FZGA 2HI0A 2WZDA 3EFBA 3QWHA 1YS4A 3ETCA 2VQ6A 3OAAD 4JEHA 1TYDE 3RU9A 1CQWA 3IKMB 2XJ4A 5AESA 1WDMA 3PJFA 5IS2A 3GLIA 1JT9A 4PM4A 4NY1A 1J09A 3WAKA 4W5TA 5IJXA 5IBCA 1HNNA 4HQRA 4L75A 2GFIA 4BLRA 3N58A 2RK6A 3TAUA 1DTWB 3TNYA 5KYYA 2UYGA 4UUAA 1RQ2A 3BHJA 3WC4A 3L7LA 2VBIA 4L8FA 3B9PA 3ESQA 2CSXA 2X5NA 4Z7NB 1QIIA 5K3AA 1BVUA 1XD2B 3P0EA 3WWCA 3IAXA 4K6FA 3FJYA 3ZWQA 4E09A 2DEUA 2R44A 5KMGA 1B74A 2G63A 2P79A 2YNMA 1E6WA 3KR2A 3O03A 2BM9A 3FHLA 2RSLA 1HE2A 1J8VA 2EHJA 4G37A 2AFHB 3VYVA 5ICEA 4KACA 3RYHB 5LSAA 1TMKA 2MSCB 1EFVA 5LBIA 4MI1A 2EWVA 5E6UB 3GCZA 5BMVB 2WE7A 2E4XA 4N7RA 3VH4A 5J4YA 3QTLA 2QI9F 3BMQB 3K92A 4J1QA 2BEWA 2IVZA 3UOWA 3SSMA 1II0A 3C1UA 3TR6A 1CRQA 3OIVA 4X95A 1PKXA 1CUIA 1R4NB 1AGRA 4AJIA 1VLHA 1PJ2A 2PPVA 2IC5A 2YJ4A 1WEKA 1ZUNB 3BFVA 2B4TO 3QPUA 3WMRA 1N0HA 3ZS9A 1U0GA 1YU6A 1IZYA 4MRVA 1UODA 3B1ZA 1KS9A 3FZNA 1KBZA 1FTYA 2I1LA 1H1DA 4XWOA 5IDWA 3F73A 3L4EA 1TZBA 3FF4A 4Q6BA 4AKGA 2XUZA 1N25A 4BHTA 1KETA 2EWWA 1JJIA 2BE7A 2QQ0A 2VNSA 2X8LA 3VXKA 3DTVA 1U2EA 4L0QA 1SWVA 1QZTA 1YDGA 1FFCA 4A2WA 1GSOA 5GJWC 3TCNA 2N46A 3U44A 3KJZA 4LRWA 3N3AC 3OZFA 3HRHA 3K9GA 4KBYA 5KU7A 1IWPB 1E60A 1IFXA 4N03A 4EJSB 2QN9A 1MJHA 4FBLA 2PG3A 2V7UA 3ZBPA 2NUAB 3LM8A 1M7GA 3DE2X 5E0KB 1QQBA 5F7OA 4DVJA 4AMUA 1HDOA 1LNQA 2CW5A 3C7CB 2RBEA 1G7SA 1ZESA 3C8HA 2C7BA 3QK7A 4OXNA 4C87A 2GZDA 2QX9A 3IP8A 4CQMB 5JTUA 2HIMA 1I1OA 1UMBB 3FSJX 1EGAA 3HCDA 4HYTA 2X0KA 1FZQA 1KJWA 3C43A 1E1QA 1S0UA 3G5AA 5DBFA 4DYDA 3L3BA 2VATA 3PF9A 1Z6PA 2BF7A 2VP9A 5JEEA 4QATA 1TVMA 1IUNA 2J41A 4TXMA 4GKJB 3KCNA 2BM8A 4P3YA 3O8OB 3QLEA 1TU3A 4RTLA 4MA4A 2Y2UA 5JDIC 3H5TA 1FS5A 1DX6A 4R40A 4OXKA 2CZQA 4MR8B 2UUOA 4Y0NA 4ZDIA 4JJIA 3HKBB 1YONA 1M34E 1W88B 3NOVA 4KO2S 1KC3A 3DFIA 4L0DA 4IYRA 2WUWE 2FPNA 2NV6A 3QMVA 4UD6A 3W2GA 1GPAA 2ZR7A 2KLBA 4QPZA 2QUHA 4G5OA 3GA0A 2A1UB 1E6UA 1GGKA 1SELA 2CNWA 1Z2OX 3MS7A 1QWOA 2IXAA 1N3LA 4DADA 1BDHA 2C03A 2ZAMA 3Q0IA 1RAHA 2G72A 5F4BA 3RFFA 3U4GA 5HGXA 1I13A 1CETA 2WTEA 4X65B 3W5BA 1L5QA 3G23A 4JN6B 3KFXA 4F4HA 5B2ZA 1QP4A 4IKEA 1MORA 5KCMA 5G1NA 3TVTA 3CUSA 1Y3IA 4WSOA 1V48A 5CYGA 2G25A 5K0CA 4DUZB 1E9EA 1ZMOA 5EIOA 5D6OA 1AURA 5A3SA 4ZOLB 1FW6A 2G0TA 2XIJA 1K7XB 3E58A 3ZWYA 4C03A 3EFOB 3BULA 3DOFA 1KVUA 1MG5A 1D7OA 1RJWA 4CHTA 4YCMA 3QWBA 1E1RA 5EJ5A 5J2UF 3GGJA 4YRGA 3NASA 1OU0A 3GCXA 4X62B 1WZIA 1Y80A 4IMJB 4C0JA 4C7KA 4KVZA 3K32A 1HR0B 2QN6A 1ML4A 1DIRA 1N9GA 2Z2ZA 2Q29A 1IY0A 2J7KA 1KJ8A 1UBJS 2WA1A 4FHFA 3O2JA 1DIHA 2YNMD 4KU4A 2ZRAA 4HDQB 3D8BA 4Q9NA 3SJAA 3GLHA 4P4GA 3WMFA 2RGRA 3NHAA 4BFSA 3MF4A 4CQLB 1RYDA 3G2JA 3UOAB 3RFTA 3NDBB 4RF4A 3Q5GA 4C6TB 1PZNA 1JMYA 4LYYA 2NMVA 3CH7A 3KIPA 2Q7XA 4O2BF 1F6WA 4GX5A 4RLSA 2X1MA 2XZOA 5HNKA 3B5JA 4W5OA 3K70D 3N0TA 2BLNA 2HADA 3N0XA 1UKEA 3D7KA 5F4ZA 2QRQA 1TRKA 1DTWA 5F3RA 4DXAA 4UTRA 3JVVA 1LCIA 4N39A 3WMXA 4R0MA 5HZKA 1AS3A 1SHUX 2X0JA 3CISA 3RRBA 5A4JA 2VXOA 1ACMA 3DBVO 1A8PA 1CU1A 4G4JA 3VAAA 2F1OA 3MTJA 4IDAA 1T8TA 2X0RA 2XDYA 3ISVA 1VI6A 2XUIA 4JP2A 5AW9A 3TUXA 3ZD9A 5JFOA 4GZ6A 4RVDA 2AFHA 1JKIA 3DTVD 3PI7A 2PLRA 3PD7A 4J0HA 1KEWA 2PEYA 4F45A 4LF8B 3D54D 4QYSA 2QAGB 3AHCA 3CUKA 3EWAA 3ITKA 4RD0A 5E6UA 2EW1A 2Z2IA 3WGKA 4B4WA 1C7JA 2P62A 1V6SA 4MUMA 1SVSA 3V3TA 3BMQA 3FCXA 2O1XA 2PN1A 3IUMA 1GDTA 5JSHA 3IRUA 2IGBA 3UH1A 1OB5A 4XYLA 2EGHA 5JYBA 1NUSA 3LECA 3L01A 1ZUNA 3ZGVA 4RUKA 2W8ZA 4V03A 2PH1A 5EAIA 3VZDA 3BM5A 1RAGA 1PJ8A 4DWOA 4KEAA 4JJKA 1ZUIA 3ZVRA 4PEVA 4C29A 1Q3KA 3I28A 1E1QD 4XDGA 4GE3A 1XTUA 2PS9A 3LUFA 3HUFA 4YJKA 3VDXA 3H3FA 4MHTA 4Q05A 1MRSA 4IFIA 1U1EA 3D7LA 3I8SA 5HDQA 2YVLA 2JASA 3CUVA 4N7JA 3S6JA 3UB2A 1W581 1SZDA 2VRCD 1KO8A 1T3TA 2EBWA 2OHJA 3LCVB 4R9NA 4MI3A 4ZO9A 2X4LA 4Q66C 1ZR4A 3R20A 4EJSA 3IL2A 3VNVA 2ZRNA 4RTQA 4OBBA 1G16A 1KQ3A 2NUAA 3O6VA 4BV2A 2ZI4A 1KBOA 1IBRA 2XMGA 2IU4A 3MTQA 1KL7A 4GSYA 4RY9A 4CQMA 3L0ZA 1QGUB 1GT91 5ENZA 3LP6A 5AQ1A 3ZYZA 2F1HA 4J9VA 1AQUA 1UMBA 3L7NA 3QKUA 4JB3A 1NR7A 5SV2A 1A7AA 4J16A 4NAHA 2CNWD 4KPFC 3WFIA 4BAGA 3JYOA 2VQDA 3QX9A 1E63A 5JJLA 1NI5A 3RT9A 4GLFA 1MGOA 3GLVA 4WT7A 1NY6A 2AZ4A 3JRWA 3EPAB 3ONVA 5HJEA 2SHKA 1U8UA 2FFHA 3O8OA 4UHFA 4BE7B 3L6CA 2G04A 3B78A 1DIGA 1K3UB 2YUIA 4LXTA 4FEYA 1E79D 3AOGA