3EC7A

Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
336
structure length
336
Chain Sequence
b'MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAEQKNGKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAIYETLIHEIDVMHWLLNEDYKTVKVYFPRQSSLVTTLRDPQLVVMETTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAVRKAAKYSTDILVDWKQRFIDAYDIEFQDFFDRLNAGLPPAGPTSWDGYLAAVTADACVKSQETGNTEIVELPSKPDFYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dehydrogenase
publication title Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 103
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3ec7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ec7A01
4UVIA 3ZHZA 3GVHA 1U7HA 3F1KA 4IDGA 2NTNA 5FI3A 3K73O 1DHTA 3NTOA 1MGOA 1UXKA 2XXJA 3AFMA 3F46A 3PLRA 4FFPA 1RPNA 4UEKA 4ALIA 5CEJA 5JFOA 1BW9A 2NACA 2O3QA 2IZ1A 3LZ6A 5FFFA 4MVJP 2QRKA 1I3NA 3DQPA 3GG9A 3E5RA 4BKRA 4AJ1A 3FNHA 1T26A 2HSDA 1KVTA 4II2A 5DULA 3U5TA 3ROKA 4E31A 3VDRA 4YJHA 3H9QA 4WOJA 4MO2A 3KYCB 2IZ0A 2Y1DA 4IXWA 4YJGA 4MVJI 1ZKMA 2ZCVA 3DZHA 4XRRA 3GZNB 5KVQA 3UH1A 4ALJA 2G0TA 3E9MA 5T8KA 2O7SA 4PLTA 1RWBA 4GI2A 4XDZA 3FR7A 2H63A 1YDEA 4YAKA 4WLVA 4GX1A 1L7EA 1R12A 3HN2A 5G4KB 1QORA 4BO7A 2Y1EA 2A4KA 1FDVA 1LI4A 2GLXA 4Q3AA 2J5KA 5U4QA 1GYQA 4CM4B 2GN4A 4EEZA 1I36A 4J7CA 3ICPA 5FF9A 4DREA 1I3MA 4O6VA 3ZW8A 1S7CA 4CQLB 4PVCA 3DHEA 3R1IA 3DZBA 4RZHA 1P1RA 3ICCA 3MOGA 4NFSA 1PGJA 3AI3A 1E7SA 3H9UA 4JCOA 4IDBA 3FNFA 1IHYA 3KUXA 5KVVA 2XXBA 5JDIC 3EMKA 3IMFA 2NVUB 4BNWA 4CV3A 4O63O 2JCXA 2Z5LA 4N5LA 2FOIA 1HETA 1E92A 2ZJ1A 1YGYA 1JVSA 2VTDA 3U4CA 1E3EA 1X1EA 2NSDA 1WMAA 3VPGA 1ZFNA 2OP1A 2WD7A 5I8ZA 5JO0A 5IDQA 1ISJA 4LCJA 3FD8A 3EW7A 3WDSA 3WNQA 3JCZA 3UICA 2CMDA 1PL8A 3W6UA 2R00C 5G0SA 4GLLA 1W4ZA 2I3AA 3WIDA 4XGKA 2B36A 3WTCA 2QQ5A 5A5FA 3ROQA 1P77A 4NBTA 4NJOA 1J4AA 2D4AA 5C7LO 3PQDA 3ROMA 4BNNA 1DLIA 4I5FA 4J6FA 5ES3A 3W8EA 1KS9A 4YJDA 3BHJA 1YL6A 4DIBA 1BSVA 9LDBA 4RZIA 3QV1A 3EVNA 4TRNA 3AOEA 3FN4A 3AU9A 4IIVA 1Q0QA 1ZJYA 1GU7A 1OFGA 4F3YA 4R01A 4UUOA 1XU9A 4BIIA 3V5NA 3CINA 3NJ4A 2CDAA 3HG7A 4BNZA 3I9MA 2NTJA 5AOVA 4CMKA 1MFPA 4QTZA 3FRJA 1HSOA 5F3RA 1JAYA 4WEOA 5IZCC 2Y93A 1QYCA 2VZ8A 1U5AA 4GKBA 1LDBA 4KDFA 1MA0A 4EUEA 1FJHA 1QYWA 4JLWA 1QYVA 5EN4A 3QW2A 3H5RA 4FFMA 2VUUA 1RKXA 3PZBA 1D1TA 1TEHA 1ZK2A 1NR7A 1P3DA 3RU9A 2J3KA 3E03A 1U2GA 4LN1A 4XDYA 3MOIA 2Z1NA 2BELA 1NP3A 4IINA 2I5PO 5J9GA 1N7GA 4C7KA 1JVBA 1C3VA 2YUTA 1EVJA 1XWFA 3F1LA 3PDUA 4BO0A 2VHYA 2BI7A 4YRBA 2IXAA 2YYYA 4BNKA 1YL7A 1GQQA 2GN9A 4RORA 3TDKA 1I3LA 1LRLA 3M2PA 5DCUA 3TOZA 4R3NA 1NFQA 1T2EA 1HYHA 1WNTA 1UAYA 2EW8A 2PV7A 4J91A 1H6AA 3UXYA 5BR7A 4DMMA 3QWFA 2FZWA 5TJ9A 3UF0A 1U7TA 3H5AA 4XYEA 3K2BA 1CYDA 3NJ8A 1P1FA 2VT2A 3R0IA 5TQVA 2I99A 4AJJA 2JAPA 3WGIA 1OAAA 3JQ6A 4PLYA 4PFJA 5CHEA 4I08A 4CM9A 1Z75A 1H6CA 2CF5A 3DZKA 3PI7A 4J0FA 2WJPA 3GPIA 3RJ9A 3DZJA 4PCVA 1RM0A 1U9JA 1NHGA 3RSHA 2E37A 3WGYA 1N9GB 2VUSA 4D41A 3NX4A 4F45A 2VYVD 1I30A 5JAIA 3WWYA 5GZ6A 4WJZA 3TRIA 2Z1MA 5IZ4A 1ENPA 1ZUD1 3D4PA 1P31A 2CY0A 1Q7CA 2OL4A 1U3VA 4MVJG 3RBXA 2VT3A 4UVHA 4P8RA 4BKQA 1LX6A 3VZPA 3E5MA 4E5YA 1VM6A 1PS9A 2X8LA 4E21A 1IPEA 1NHWA 3JQ7B 4ZA2A 2C20A 3M1LA 5F5NA 1PJTA 3F3SA 1KC1A 4KQWA 3CTMA 4XIYA 4U8GA 2GF2A 3I1JA 2FR0A 5EJ2A 1HRDA 2BFMA 1R16A 3D3WA 4LRTB 3RIHA 1P45A 2D5CA 4GKVA 4OH1A 3MCVA 1LDEA 2ZB7A 3OEYA 1E3WB 3AY7A 3JQ8A 5C7OO 4YDRA 3T7EA 3IQDB 3ZNPA 1WZIA 2DTDA 2DFVA 1BMDA 2AQKA 2Q2WA 3WMWA 2W2KB 3VZSA 3WGHA 3A9WA 3LT1A 3PHIA 1E3LA 2EERA 4XQCA 2NV6A 2VHVA 2Y0DA 3GMSA 5H81A 4XIJA 4IQ8A 5BSEA 4M89A 5TT0A 3H3JA 4L74A 1NVGA 5JC8A 2CNBA 4YJFB 2PLAA 5CDTA 1Z74A 4KP7A 4BNIA 4YT2A 4A73A 4FB5A 5IFLA 5A02A 4A27A 2PGLA 2X58A 4B7XA 2PD6A 4KTTE 4Q3DA 5LDGA 4JQCA 5BSGA 1EMDA 1SO8A 1A4IA 2VUTA 4MVJM 3HHPA 4A5OA 4MIOA 3I9OA 3DFZA 3VPFA 3WOHA 1IZ0A 1QYDA 1ZK3A 4L8VA 1QKIA 4JX8A 1KVSA 3WWZA 3CPSA 5L4SA 3I5MA 4WPGA 1ENZA 4GWGA 3MTJA 4PGFA 3WJ7A 1E1KA 2IRWA 3BXXA 3DOJA 4UUMA 3DWFA 3B1KA 4W7HA 3OIFA 4G65A 1X13A 3KSZO 4C4OA 1PIWA 1V8BA 3GHYA 3OJOA 2C2YA 3ZV3A 5C5IA 2EKLA 5B4TA 4XYLA 1DBVO 1DIHA 1KBZA 5HS4A 1NFRA 4ZICA 5I7SA 4XWYA 2P4HX 5CDUA 1W6UA 1E7RA 2CVQA 4E32A 1KY4A 2WEKA 1HXHA 1GV1A 1VPDA 2CDBA 2E6UX 4U6SA 3DB2A 3IJRA 1B16A 3JQGB 1A7AA 1IUKA 1HL3A 5TS3A 4CLRA 4WLFA 1EVYA 2ZTLA 3DHYA 1PGQA 2O23A 4HX5A 4ZQGA 3W4IA 3WICA 1NWCA 1BHSA 1T2AA 4FFLA 1I10A 1YB1A 3TJRA 4XYMA 2G17A 1ZEMA 3QE3A 2VRCA 2VYVA 1GQ2A 1PZGA 4FGWA 2P91A 2HAEA 1G0OA 2YV2A 3UAGA 5K9ZA 3NTRA 1LSSA 3VH2A 1YVEI 1DAPA 1EQ2A 4DC1A 4NU5A 2QZ9A 1E1LA 3GNTA 1V6AA 1RM4A 3VKUA 3OETA 4J1SA 2DAPA 1O94A 1E7QA 5JC1A 1XELA 5BQFA 4KWHA 2PZKA 4L4SA 4ESOA 5ITWA 4E6PA 4N5MA 4EITA 5KJ6A 3GOHA 3B20A 3BHIA 3O8QB 4XA8A 5IAAA 5ER6A 2Q99A 3EVTA 4M55A 1GYRA 1PGPA 3WGZA 2C5AA 2GZ1A 1LRKA 2J8ZA 4KUGA 4JJFA 3VZQA 4NK4A 1VLLA 4BUCA 4R1TA 3DR3A 1IY8A 2AW5A 2PY6A 4CM8A 5I9LA 4OXYA 5I7EA 4GVXA 4OM8A 4HXYA 4RGBA 1ISMA 3ONFA 1DIGA 4BV9A 3G0OA 4YTEA 3BA1A 5T6BA 3RUFA 1CERA 2EGHA 2HMSA 3B6ZA 2DU8A 2TMGA 3GVIA 4Y67A 3UCFA 3FPCA 1DOHA 4W9NA 3OP4A 2AA3A 2P4QA 2ZQYA 2HLPA 4PLZA 3ZDFA 4FW8A 5HM8A 3LYLA 2O2SA 2WTBA 3L0DA 1ISIA 2O3SA 2X0JA 3PQEA 1MG5A 3K30A 3VH4A 2BI8A 1AUPA 2EP5A 3BTSA 2HDHA 1UDBA 2WD8A 1DSSG 3E48A 1YBAA 4LK3A 4MKRA 4PG4A 4CLOA 2Q50A 1DAOA 4EDFA 3PHHA 3MJTA 3QSGA 4EUFA 5I9NA 2HRZA 2EIHA 1VRWA 4J3FA 1ADFA 4ND2A 3VKVA 5C37A 3SVTA 2OZPA 3SJUA 4N54A 2R6JA 5EPOA 5F21A 1Y5RA 5JE8A 5CDGA 3ZWCA 3PGXA 5JMWA 3HQ4O 3B70A 4ZJUA 4L76A 1E0DA 1NQOA 2WMDA 4FSHA 2ZATA 5TIIA 4P4GA 4MKXA 1SB8A 1YBMA 3BZUA 4Q3CA 4R5MA 1R6DA 1ZK4A 1SNYA 3U4DA 2EW2A 1VJ1A 4YBZA 1VKNA 2NM0A 4GH5A 5DBFA 2DFDA 4LVUA 3KBOA 3JQCA 3NGXA 4KWIA 4KUEA 4G5HA 1Y8RB 3BTUA 1HF3A 1NAIA 1GEGA 1HYGA 2ZB3A 3Q9NA 4ND5A 3WG9A 4DQUA 3ZWBA 1EK6A 2ZYAA 2HJSA 2HMWA 3HUDA 1QYXA 4QXMA 1AHIA 5EQFA 9LDTA 1KY5A 1LUAA 1R4NA 1ZK0A 3CSDA 5M6DA 2NU8A 3UHAA 4EJ6A 2RAFA 4WLOA 1GL3A 2Y05A 5TRTA 5GY7A 4Q3NA 2O7QA 4OO3A 4Z0TA 4PRLA 4ZRNA 4CMIB 2IYOA 3DOCA 5TX7A 3VVBA 1HDZA 1P74A 4DIOA 3L6DA 4A0SA 2YFHA 3L4BC 1NQTA 4B79A 1Z73A 4QO8A 1GTMA 3L77A 4AL4A 4FOSA 2JD0A 1E6WA 1C1XB 3WBFA 6ADHA 3GUYA 4GL4A 2J6IA 2FZEA 3GK3A 3NDIA 2NLOA 1WLYA 3C7DB 3GN1A 4BQRA 3O9ZA 2NWQA 3E8XA 4WASA 3PP8A 3EZLA 3LK7A 4RVSA 2Q4EA 1H94A 2VCYA 2YZ7A 3WQSB 1OBFO 1RM5A 5L45A 3ETGA 1EBFA 2B4TO 4ROSA 3H9GA 3FNGA 3ANNA 1G6KA 3TL2A 2VRBA 4U7WA 3OJFA 1UXHA 2P9EA 1U28A 4JJIA 3BMQA 2B83A 4DLAA 4L73A 3OF2A 1DXYA 2C2XA 4IQGA 3DO5A 4IJUA 4R68A 4CMCA 3ZV6A 4JK3A 3PYLA 4TRRA 4Y6SA 1B26A 1NBOA 2CVZA 4E3ZA 1RM3A 4GSKA 4R1NA 4RVHA 4IJKA 1S6YA 4RVDA 2FSSA 3KRTA 3OICA 4XGIA 2O3TA 3PFWO 2VN8A 3I6IA 3AY6A 4OHUA 4NK5A 4ZQBA 3UN1A 4ZGWA 4ND1A 2XOXA 2IZZA 1DLJA 3OECA 3FI9A 4K6CA 1MFZA 5AQ1A 2FR8A 2OOSA 1K5HA 2DBVO 2PWZA 2QX7A 1KVRA 1JAXA 4IDDA 1J6UA 2GD1O 2HK8A 5DOVA 1D4FA 4BNLA 4IIUA 1BWSA 4DVJA 2GPTA 5THKA 4XR9A 1U5CA 1VI2A 4EJ0A 3I4FA 3G1TA 2RBEA 4INAA 3WIEA 4XYGA 1JDJA 1EUDA 4YRAA 3LT2A 2GERA 3ITKA 1QSGA 2OGUA 3NRCA 4O0LA 3RC9A 3ZWAA 1HLDA 4J49A 1B7GO 3AUTA 5IDXA 4D3FA 1K6XA 2A94A 4E2YA 4YT8A 4WKGA 1ULSA 2FPPA 1BXKA 3WQQA 1HE3A 2ZK7A 3KM0A 3GDFA 1ZXBA 1AXGA 3C3XA 3GUCA 1Y1PA 3FPLA 4G81A 2BGKA 3LLVA 1E6UA 4Z9XA 3WGTA 5KTKA 3F4LA 4FFOA 4FJ0A 4BS9A 2GNAA 4ITUA 1E1NA 3F5QA 4BNUA 3EK2A 2YHIA 5BNIA 3E6AA 3WYBA 1XHLA 4D7AA 1MB4A 1UZMA 3JQDA 2O3RA 5KVCA 1NPYA 4CMBA 4BO5A 1R4MA 3RFTA 4RDHA 4BNYA 4P4LA 5BSHA 1K3TA 5TC4A 3IP1A 3QVOA 5IN4A 1OI7A 1YB4A 4WLNA 2JCVA 3Q11A 3DBLB 1Q2XA 3FHLA 4DQVA 3L07A 1N7HA 4RF3A 1EVIA 3EZYA 3PQFA 4H7PA 3WFJA 1VSVA 3WMXA 3VTZA 3BMOB 2VNAA 3D1LA 4N5NA 1PJCA 2ZYDA 1P0CA 3PHJA 1LXCA 1HDXA 5EL0A 2PZJA 1NPTO 4RL6A 1E5LA 1XG5A 5HTOA 1SC6A 4W6ZA 3K5PA 1DFGA 3CUKA 3ZNOA 4PZDA 4IS3A 4WCFA 3I23A 3AY3A 3JQEA 3QY9A 2X0NA 4UVEA 2A9FA 2JAHA 4DL9A 3WTBA 3RFXA 3D4NA 3VTFA 3BAZA 4LGVA 4H16A 5L3ZA 1I2CA 5KWEA 2WSBA 1GCOA 3NDRA 4TRJA 3FTNA 1I2ZA 4P4NA 4XKJA 3ZWVA 3RVDA 1CETA 2NU9A 2GZ2A 3QWHA 1K0UA 1SZJG 2HK9A 4CQMA 4LSWA 4ALMA 3H9JA 5F5LA 1BRMA 3IKTA 3OM9A 5A9SA 1C1DA 4GLOA 5FEUA 3PPIA 2XAAA 4DTIA 2GUGA 1X0VA 4XB1A 3RUCA 1SEVA 2H5LA 2HO5A 1ZK1A 4CM9D 2ILTA 3KO8A 4GX0A 1WW8A 3JYQA 3IS3A 2J5RA 2JHGA 2O2YA 5TLSA 2O48X 4NZ9A 1GADO 4Y6RA 4NI5A 4E13A 5CPBA 1DC4A 4PLVA 5A05A 3H8VA 1KIFA 5EINA 1Y5MA 1J5PA 2PZMA 3TPCA 2GN8A 3U3XA 1WAMA 4CV1A 3R3JA 1YL5A 3PIDA 2X7HA 3DONA 1NQ5A 4BNGA 4ZN6A 2BD0A 4EI2A 3OEWA 4YYZA 4L0QA 1GZ4A 3RKRA 2V6BA 2AHRA 4ONEA 4MINA 1V9LA 1XKQA 2AEMA 1PZEA 3ZHYA 4EBFA 2EHDA 3K31A 2QW8A 1KEWA 1F12A 3IJPA 2FP4A 3N74A 4DC0A 5J23A 3RU7A 3CXRA 1NVMB 1N9GA 3PLNA 4FPXA 4GGOA 1C14A 5DCWA 3JQBA 3AM5A 5COAA 3DMTC 1HZJA 2YY7A 4JIGA 2DT5A 1DRWA 3W4JA 4Y9DA 3M6IA 3H7AA 4NBRA 1P1HA 4XQGA 4Z0PA 1BG6A 5AXBA 3KLPX 4LRSB 4Z9YA 1PS0A 1V35A 1YBVA 2I76A 3C24A 3LU1A 4J4TA 1GAEO 5G0WA 2EKPA 3E9QA 2AXQA 1VL6A 4Y6PA 1HE4A 3U0BA 1TXGA 4J16A 1T24A 1UXJA 4LISA 3KSUA 1PSDA 3AI1A 1YB5A 4GQAA 1LLQA 5T5QA 3TFOA 2D59A 4BNTA 4MIYA 4EJMA 3QHAA 1H9AA 1A4UA 4DYVA 4Q3EA 4YACA 5KIAA 2O3JA 2HK7A 4E5KA 1YE3A 3EDMA 4RVUA 4JJGA 2WYUA 4ALLA 4RO0A 1ZBQA 1R0SA 3BHMA 1PJLA 3DTYA 2FHSA 2V65A 4MKZA 1E6EA 4II3A 4NDNE 4FJ2A 2CZCA 1E3SA 1PL7A 3DZIA 1P1KA 1ZIDA 3GNQA 1NVTA 4RVFA 4B3JA 2YFQA 2OUIA 3JD2A 2BRUA 5JCJD 3RC1A 1EEHA 4EUHA 3GNSA 3JSAA 1B3RA 3ZV4A 3UOGA 1BW9B 3KEOA 3GEMA 2H9IA 3AM3A 4YCAA 4H3VA 1X7GA 3F9IA 3V2UA 1EK5A 4GWKA 5DNAA 2JL1A 5AXDA 1TVEA 3FWNA 1JWAB 3KZVA 4U5QA 1YOVB 3CZRA 1VKOA 1D8AA 2BF7A 1IB6A 4IM7A 4E5PA 2GSDA 4F6CA 4GMFA 3ONDA 3MTGA 3HSKA 3IUPA 4C7JA 4YJHB 2VHWA 5JXWA 4W7IA 1E7WA 5DDIP 1M6HA 3WQRA 4AJNA 1D7OA 3I4CA 4IMRA 4S1VA 2RHRA 3NEPX 1BGVA 3SBOA 3QVTA 2GO1A 2VOJA 3K8ZA 4I8XA 3KVOA 5AYVA 3TZKA 1KVQA 4R41A 3ANMA 2JFHA 1Y8QA 3KSDO 1C0LA 4PRKA 1GZ3A 4M49A 4BKOA 4UUNA 4CV2A 3LVFO 4R3WA 4J43A 1Y9AA 3EYWA 2V6GA 1DC3A 1C0KA 5JO9A 3TN7A 4PZCA 1CIVA 2DBZA 3ZHBA 3PJGA 4PZEA 3GT0A 2B37A 1HDCA 1XYGA 4O59O 5HRUA 2WYVA 2VRCD 3DAGA 4HWKA 3WNVA 5CDSA 2F1KA 3PXXA 4CL8A 1UJMA 5CFZA 4BL5A 3HB4X 4XYBA 1DO8A 1YONA 2JKVA 3DBRA 2VQ3A 4NFHA 3ASUA 4WOKA 4E2WA 5G0VA 3X2EA 2PH5A 4IJVA 2X9NA 1H2HA 3TFQA 3GDGA 8LDHA 4F6LA 1A9YA 3PHGA 5HBRA 1EE2A 3UKOA 2WD7B 4FQ8A 1KERA 5HA5A 1O8CA 4D44A 1QRRA 3QVXA 1SMKA 3WX0A 4NHEA 1FMCA 1BDMA 3CMMA 3GMDA 4H15A 5H82A 2YDXA 5JAZA 2CVOA 1X7DA 5KNLA 5FI5A 2ZKLA 3AUSA 1E3JA 1BDBA 1NXQA 1R15A 1UP6A 3F5SA 2WYWA 3O8QA 3S1LA 2AE1A 3NTQA 5JSFA 3SLKA 5EESA 5IXSA 3LLSA 3ONEA 1LSJA 1L1FA 5KKAA 1GUFA 4IDCA 2YW9A 1KOLA 1U3UA 2NVWA 1B8VA 2X22A 1U3TA 2PK3A 1BVRA 3WBBA 3IKVA 3U4IA 4RV9A 1ISHA 1T1SA 2DUUA 4I5EA 4CLDA 4ZQHA 1O9BA 4OXKA 1T4BA 3E82A 1V0JA 3FBTA 5JDCC 5DOZA 2EJWA 4MP6A 5BNFA 2GGSA 4J9VA 5I8WA 3JQAD 4FC6A 4IJWA 5JYAA 2AE2A 3JQFA 4DYDA 4GBJA 4NPCA 3EAGA 1GPJA 2CSUA 3OBBA 4ALKA 1HDOA 3QVSA 5JCJA 3QP9A 4YPOA 3EUWA 4PG6A 5L7YA 5B4UA 4BNFA 4TKLA 4IDFA 2Y1OA 3ZW9A 3ZWMA 4AG3A 4D3DA 3SEFA 4R1UA 3ZWWA 4YA6A 3TL3A 2QIOA 2D2IA 1IE3A 1ZCJA 3OFSA 5DF1A 3ETDA 3GG2A 4U0KA 3VH1A 1GV0A 2PA3A 1F14A 3K9QO 4GX5A 1ISGA 1BXGA 4TVOA 1R37A 2RCYA 2BLLA 3D64A 1IZ9A 2FSVA 4AJKA 3BMCB 1CDOA 2W2LD 5JLAA 1E1MA 3DDNA 1HLPA 2G82A 3HNPA 1LLCA 4RF4A 3ZU2A 1H6DA 2C7GA 2W4QA 3GN2A 3H6KA 3N58A 5JY1A 1DB3A 3RJ5A 4KOAA 1LQUA 1A71A 1Y7TA 2IYPA 4I9NA 5BSFA 1ORRA 3D0OA 1B8PA 3LT4A 5ER9A 3RUAA 4ZHSA 1EUZA 3JD0A 4URFA 4W82A 3GLQA 5JCXA 4AJEA 2EP7A 3PYMA 1Y9EA 3H9EO 2HU2A 4YAEA 3KYDA 3GQVA 3ZCXA 2QZZA 1WXDA 4CMJA 3K96A 3PYXA 3ADPA 1KEVA 2DBQA 2OO5A 3JYPA 3GEDA 4I5DA 3D5TA 3ROPA 4CLHA 2PGJA 1N1GA 1ZZEA 4RPKA 4L9RA 2X0RA 4AJLA 4CMIA 3NYWA 3KV3O 4R9RA 4PLFA 2RH8A 5IN5A 2J5QA 2B4QA 5JDIA 4JXKA 4BQPA 1ZEJA 3I52A 5L53A 3GRKA 1LDNA 1MC5A 1GFSA 3PZRA 3LF2A 3T4XA 3GR6A 4GX2A 1PL6A 1GZ6A 1UP4A 1YDWA 3ULKA 5FYDA 3W4KA 3H65A 4NIMA 3DMTA 2EGGA 2VYND 2R00A 2DTXA 4FR5A 1IPFA 4QSMA 4CV0A 1D1SA 3DAPA 4CUKA 5IJZA 5K6AC 3D3WB 1DFHA 1KETA 3K2EA 1I3KA 3MJVA 3SC6A 5AXCA 5BT9A 4BHTA 1Q0HA 4MDHA 2J3HA 4K28A 2TMDA 2QYSA 3JQ8B 3AI2A 1TA4A 3P2YA 4CM3A 1ULUA 4NBUA 1BTOA 3V2GA 2ZYGA 4OXNA 4RPHA 3STHA 1I0ZA 1YO6A 4WGGA 4ILKA 4IQ0A 4BO3A 2VWQA 5IZCA 1TLTA 3H2ZA 4XD2A 5A3VA 4NJMA 1UP7A 1LU9A 1J49A 3JQAA 4M54A 2QRJA 3U49A 4YAGA 5L4LA 2OMEA 3B1JA 2Y99A 4CM7A 3DOOA 4XCVA 2POQX 4HFRA 4PLPA 3DBHB 4WE3A 4UULA 4I1IA 4EW6A 1B8UA 2JD1A 1OC2A 4E12A 5A3JA 5DP1A 3JQ9C 3TNLA 2HKIA 4WCDA 2AQIA 4RPGA 3GF4A 2YDYA 4FC7A 4UVGA 5CG1A 5I7VA 5KVSA 2AG8A 1NM5A 3V1UA 1A9ZA 1HKUA 3GGGA 4JROA 5DCYA 1HYEA 3A14A 5HWSA 3I83A 4J4HA 3ADOA 1O0SA 4YRDA 2DKNA 2C82A 4FOOA 3CZMA 2OP0A 2W2LA 4UVDA 4PG8A 1WWKA 1EE9A 2FPGA 3IP3A 5ICMA 4XZ3A 1PU2A 3FNEA 3F6YA 3ZWOA 3QQPA 4WNCA 4YXFA 5L9AA 1Y6JA 2Q4BA 3V1TC 4NH4A 2X5KO 3AOEC 5CP8A 1ADGA 2IEDA 1HTBA 4MVJA 1M6WA 5KKCA 4OSPA 1ISFA 3O26A 5L7TA 4CLRB 3MEQA 2Y68A 3INRA 2C07A 1CEQA 1B15A 5JYEA 2I6TA 4DBVO 1R0KA 1EDOA 3LF1A 3KHUA 3ZNQA 4DRYA 1JWBB 3AUAA 3WXBA 3OJ0A 3IDSA 2VZ0A 3HDHA 4FFNA 1LDMA 1XIVA 2WE7A 3EGOA 2E4AA 1MXHA 4IZHA 3BMNA 4FN4A 4NU6A 3ZN2A 3IUSA 5DBIA 3WB9A 2JFFA 3HDJA 4D79A 1DRUA 1UDAA 4B4VA 1V3VA 2SCUA 4J1TA 3GFGA 5JY6A 1KEUA 2Q2QA 4O5OA 4OOFA 2PH3A 4A10A 1GR0A 4CQMD 5DT9A 4HFMA 1XU7A 4JBHA 5ENVA 2FY8A 1I8TA 4I9HA 2ZQZA 1G1AA 2NU7A 3GC6A 3C1TA 1VE9A 4RF5A 4I9UA 1UZLA 4QO7A 1PJQA 4YAJA 2VYNA 2RHCA 3HB5X 1SB9A 2HQ1A 4B8ZA 4RDIA 1FDUA 4CM8B 1SAYA 2Q1UA 3VPHA 2E48A 2HRBA 3ENNA 3ETEA 4BO9A 3KYCA 3ASVA 1VL8A 4PN3A 2GZ3A 2UDPA 5A9TA 1AE1A 3RUDA 4ZQEA 5I7FA 3GZNA 4DPMA 2Y67A 1B3BA 5CEFA 2VWPA 2JCYA 5HS6A 5I9MA 3UUWA 1I24A 3L9WA 4UREA 4MPDA 3ZWNA 5KJEA 4UEOA 5CG2A 4Q39A 1XDWA 3NT4A 5EMHA 4EYEA 2CFCA 1B0AA 2E49A 1U4SA 5G4KA 4RQTA 2RIRA 4B4OA 3G1UA 4CM5A 1LLUA 2YV1A 4CM4A 3LC2O 4WEQA 1ZO8A 3AW9A 3WFIA 4HY3A 5JDCA 4CLOB 3D7LA 3NGLA 1E3IA 1P44A 4XR4A 1HSZA 1WZEA 3OIDA 4CQLA 1LDGA 3RWBA 3O03A 4JNKA 3S2IA 4E2XA 1DIRA 4ZD6A 1T1RA 1NASA 2DLDA 5COQA 3OIGA 4KDEA 1G0NA 2EF1A 2AG5A 3HWRA 4GAEA 3M2TA 1A27A 5EIOA 2BGMA 1XSEA 2X23A 2X5OA 3PJDA 4R16A 5G0TA 3MWDB 4BO2A 1GDHA 2YHUA 3ON5A 2PR2A 3HN7A 5LCXA 3OJLA 5KCZA 1H6BA 2NVUA 3VDQA 5JBIA 2BH9A 1FXSA 3LC1O 1PWZA 2CDCA 3COSA 6LDHA 4U6QA 1V3TA 4BV8A 3WSVA 1WMBA 2B5VA 2V6FA 3T4EA 3PJEA 4B7UA 3WGQA 1DFIA 1LBEA 4HADA 5A9RA 5KJ1A 1DPGA 2Q3EA 3G3EA 4XJTA 5L4NA 1PTJA 4YEDA 4CMEC 4ZRMA 1FDSA 2ZTUA 4B8WA 3DMYA 2HMUA 4CR7A 1HT0A 3U4HA 2HCTA 1Z7EA 2G1UA 3GAFA 3GHHA 2XPCA 4OKNA 4BKPA 3AM4A 2VWGA 3HDQA 3SX2A 4BNJA 4UUPA 1GD1O 4RPLA 3WLFA 3FTPA 4AFNA 2NTVA 3I3OA 1IYZA 4YVFA 4TSKA 1J0XO 4A03A 4DLLA 2D8AA 2IXBA 1I5RA 1UZNA 1DC6A 3EY4A 3DL2A 4Y98A 5JMPA 1M75A 5TNXA 1C0PA 4BMSA 1N92A 4BGIA 3S2EA 5IXYA 5TGDA 2W98A 3H5NA 3I6QA 1MG0A 4CPDA 5FWNA 1O95A 4BGUA 2C0CA 2W90A 1TT5B 5GZ1A 3WYEA 5GMOA 4YQZA 3CH6A 2FPIA 4R51A 1GQYA 1XQ6A 3DC2A 3RC2A 1IL0A 3ZWPA 7ADHA 4Z3DA 2PD4A 1U8FO 1JQBA 3JTMA 2EXXA 4QT0A 4YR9A 1BVUA 2UVDA 3KXDA 3NDJA 4FJ1A 5DZSA 3BMQB 3MJ4A 1YJQA 1PGNA 5IDYA 4Z9FA 4DQXA 3ENKA 5DBGA 1CJCA 1YH3A 3QWAA 2O4UX 2OORA 3S2FA 3V8BA 4UEJA 1SOVA 1YOVA 3KB6A 1PJBA 1X0XA 2FWMX 1DJQA 3K6JA 4BO1A 3C7CB 1GEEA 1WP4A 2BGLA 2QG4A 1ENOA 2UV8A 4OAQA 1PGOA 3FWZA 3OHSX 2OBYA 3EC7A 2QYTA 3SC4A 5K6AA 1GUZA 1NQAO 5L95A 1P1JA 1P0FA 4K26A 2JFGA 3L9XA 4QEDA 5T67A 4TROA 4FIZA 3JD1A 1EZ4A 3VHRA 4BGEA 1JKIA 5B4VA 3Q3CA 4L75A 4RLSA 3O4RA 4AJIA 1ID1A 2FR1A 2UUOA 1MP0A 1P33A 1XA0A 4J9UE 2C7VA 3E9NA 3PVZA 1U1IA 1XCBA 5CDYA 5K0ZA 1TT7A 1PZHA 3LT0A 2IE0A 3ABIA 2DPGA 4PLCA 4NMHA 1FDWA 3ORFA 4RVGA 3NAQA 4X54A 5L40A 1NWHA 4XJSA 3RD5A 2YJZA 4IDEA 5F1KA 1PS8A 4GVLA 2Q1WA 4BGVA 1XLTA 1QG6A 1N5DA 1LEHA 4Z6KA 2YV3A 4MIEA 2Z95A 4FDAA 4ZVVA 1PZFA 3TZ6A 4IDAA 4LMRA 2WM3A 1F8GA 1ZXLA 1T2DA 1ZMTA 1SEPA 3KEQA 1HDGO 2AMFA 2EJVA 3IC5A 1AN9A 3JQ9A 4RQUA 5T73A 3HZZA 3OH8A 4GGPA 3SLGA 3ZWXA 3NT2A 1DRVA 1QXSA 1I2BA 4P22A 3JQ7A 3IL2A 2X6TA 4ZU3A 4NBVA 4YWJA 2YHIB 3FCOA 3R3SA 4DWVA 1W0CA 1PQUA 3G49A 5CAEA 1V3UA 2ZB8A 1K6IA 1R4MB 3BTVA 4LSMA 3NUGA 3WR5A 2EKQA 3UCEA 2IDZA 3GVPA 3PK0A 3VAZA 3UFXA 1ML3A 3Q2IA 3WSWA 3KETA 4J1QA 4NFYA 3ZV5A 4W9NC 1E3WA 1H93A 4Z0HO 1M67A 2Y66A 2VOEA 4FD3A 1Z7BA 2FN7A 3V2HA 3PRJA 3WGGA 3MJCA 4DBZA 2ET6A 3CE6A 1JU9A 4HP8A 5JAQA 1LTHR 4D43A 1OZAA 2W2KA 1EBUA 2NQ8A 3DBVO 3L4BA 4D0SA 3AFNA 2GRAA 2FRDA 1ADCA 1I33A 4A7PA 4WCFB 2O4CA 4IS2A 5JYFA 2FMUA 1PR9A 4CUJA 4NR0A 4LCEA 4YJFA 1LSOA 2ZTMA 1QMGA 3E18A 1NNUA 4I5GA 4QQRA 4RPJA 5B1YA 4WK6A 2PZLA 4M87A 5LDHA 3N7UA 4FS3A 5ITVA 2B35A 3AWDA 5IF3A 3H4VA 4ZQFA 1YS4A 3AUUA 4BNXA 1O5IA 2DVMA 4DLBA 4CMHA 4YJGB 1GCUA 2DTEA 4XB2A 2IEBA 4PVDA 1F17A 2O50A 3SXPA 4MJLA 5JPIA 2D3TA 2AQ8A 2E82A 2H6EA 3S8MA 4CQMB 3IAHA 5A4DA 1NTOA 1K6JA 2BFPA 4Y8VA 1FDTA 1Q7BA 1VSUA 3R6DA 5KOIA 4B3IA 2NU6A 5A9SB 1C1DB 3KOUA 4CM1A 1L7DA 1ARZA 4JGBA 5F1OA 1PJ3A 3CEAA 1OOEA 5U1PA 1XGKA 4BMVA 4JP2A 5DP2A 2GCGA 3AOGA 3JV7A 1DHRA 3JD3A 3BMCA 2P68A 3D4OA 4TZTA 3RUHA 4OL9A 2O3UA 1T2CA 5TJHA 2RH4A 3Q1LA 4ALNA 2QHXA 1RYDA 3VPSA 3GY0A 4AJ2A 4E5NA 5G0UA 1QV6A 2VZ9A 1ADBA 4J2OA 5B37A 2A35A 2Q49A 2CD9A 3B1FA 4S3MA 1XEAA 1ONOA 4EZBA 3NV9A 1I01A 3JQGA 4DIFA 1AGNA 3MJSA 1TB4A 1E77A 3ZZNA 2UUPA 3RKUA 5ENDA 1ZSYA 5JS6A 3TZQA 3LQFA 1DIBA 2Q45A 2OHXA 2UYYA 4JBIA 3VC7A 2P9GA 3HJAA 4L4XA 5JW6A 4BB6A 3S55A 4AICA 4DPKA 4D42A 3P7MA 1LSUA 3Q0EA 3GAZA 4RCVA 4J2HA 5JAMA 4OYRA 4PLGA 3MZ0A 1E5QA 2PNFA 3C1AA 5L7WA 1CQJA 1H2BA 4AJ4A 3I9JA 3BYZA 3D3EA 1BXZA 2BFAA 4IPTA 4XQ9A 1Z82A 4KMSA 1QP8A 4J90A 1YKFA 4R69A 2HMVA 3UCXA 1R66A 2G5CA 3H3FA 4KUHA 4HNHA 1ZVMA 3PTZA 2ZB4A 1U2DA 4LMPA 1O6ZA 2DQ4A 3GPDG 2AQHA 3PWSA 3BTOA 4JN6B 3DTTA 3LDHA 1PJ2A 5BNTA 2ZIZA 2PKRA 1FF9A 5B12A 1A5ZA 2X1HA 1T25A 4OSOA 3OA2A 4CMEA 5ADHA 3NT5A 1MC4A 3S2GA 4KZPA 1M66A 1SCUA 4HUJA 1B2LA 1NR1A 1ZSNA 3CKYA 3TOXA 5THQA 1WVGA 2GN6A 3RBVA 4PG7A 4DUPA 3PWKA 4R9SA 3GVCA 5L51A 2NUAA 2WE8A 2BHLA 2P5YA 1PQPA 1W8DA 2I65A 4YB8A 3LSYA 5C3MA 3RBZA 3RROA 1DIAA 3Q9UA 4PLHA 4PG5A 2VHXA 2X4GA 1H9BA 4TVBA 4AJOA 5G2OA 4WLEA 3ZGYA 2HMTA 1HE2A 5ILOA 2DUWA 3RCBA 4ND3A 3ZU3A 4BMNA 1VJ0A 3QWBA 5EQDA 4DXHA 4NQZA 1JTVA 4U0JA 1AHHA 4BKUA 3OQ1A 3Q6IA 4CLXA 2CF6A 5A06A 4CMAA 4BNHA 1HZZA 2PTGA 3INGA 3SJ7A 3DBHA 4BO6A 1F8FA 3LC7O 2PFGA 3TSCA 3E1KA 2Y1FA 1X1TA 3A06A 5ICSA 2QRLA 4E4YA 3KLMX 4HBGA 4IZIA 1CQIA 1EDZA 1M76A 3L4SO 1UXIA 1K2WA 5EERA 2DM6A 3DZGA 3K92A 3A1NA 3GEGA 4QFCA 2R2GA 2BFOA 5T64A 1Y8QB 5A04A 4MVJD 1Q7GA 4E5MA 3M1AA 2Q46A 4E30A 4J0EA 1NPDA 3G17A 4OQZA 3KTDA 1UAGA 1Y8RA 3W8FA 3RFVA 1ZH8A 4BNVA 5KJFA 1LLDA 3Q2KA 4JBGA 5ILGA 4MP8A 3I9NA 1OC4A 2HJRA 4D3SA 2NNLD 2C59A 3IOYA 4OQYA 1WDKA 2Q2VA 4NG5A 5AXAA 4R5HA 4XRGA 3JYNA 1I32A 7MDHA 3GVXA 4CUZA 1EFLA 3EHEA 4A2CA 1HDRA 1LC3A 5MDHA 4OGWA 4Z3KA 1N1EA 2YQ5A 3ANLA 3DBRB 4WUVA 1H5QA 1PJSA 2GR9A 3G79A 1JA9A 5A5EA 3DFUA 3U09A 1NFFA 2DBRA 3L6EA 4KQXA 4WCFC 1C1XA 3HFGA 1LDYA 1YJ8A 2B4RO 1WDLA 2NADA 2PKQO 1M2WA 4EEXA 4IUYA 1EQUA 1TI7A 2YQ4A 3DHNA 4N18A 1QV7A 4YAIA 3PGJA 2BMAA 4D0RA 3WYCA 3VH3A 3RUIA 3ITDA 1YWGO 3PDJA 4M1QA 4D45A 3U62A 3ZH2A 1PEDA 4RLHA 3VZRA 1SBYA 2B69A 3W1VA 1LNQA 3OQBA 2I66A 5JNLA 3OMLA 4IXTA 1QLJA 5T8KC 4IGFA 1YQXA 3VPXA 4QUKA 3C85A 1D3AA 2B0JA 1GY8A 4NBWA 1YRLA 3ZI0A 3GZ4A 3ZU4A 1F06A 3PHLA 4ID9A 4OKIA 1X7HA 4E2ZA 1U4OA 1N8KA 4MOWA 2X9VA 1DC5A 4PIVA 4WECA 5TSDA 3ST7A 4TZKA 1A7KA 1RJWA 4TMFA 4UAGA 4KTVE 1B14A 3UW3A 1P1IA 2Q22A 4Q9NA 4XGNA 3X2FA 3ZNNA 1A72A 1U8XX 4OMUA 3C1OA 3T7CA 2CUKA 3AJRA 4FBGA 5MGBA 1MV8A 1T4DA 4BO4A 2X86A 5A1TA 4EGFA 4F46A 1JKJA 3GDOA 4OIMA 1HWYA 1HE5A 4MVJF 2Q1SA 5T57A 2H1SA 3QJ5A 4W4TA 4W99A 1LC0A 4FGSA 1LQTA 1IHXA 1EUCA 4FFRA 1Z45A 1CF2O 3JQBC 4PLWA 2Y1CA 3TZHA 1ZW1A 4QX6A 1PWXA 4OJNA 5U9CA 2JJYA 4B7CA 1BXGB 2X0IA 5COBA 1DJNA 2ZCUA 4YT4A 1EFKA 3F4BA 1NAHA 1YQGA 3JYOA 4K6FA 4CL3A 2LDXA 1IULA 1JLLA 4TKMA 4Q3BA 3HDYA 5DN9A 2C5EA 4CM6A 2V6MA 3P2OA 3UGKA 4R4JA 4LVCA 4TRMA 4MVJE 3GA0A 3PWZA 4B4WA 1UUFA 3QWIA 1KEPA 3A4VA 3KYBA 3JYLA 3W8DA 3CIFA 3WS7A 2VWHA 1P9LA 3AK4A 3GGOA 3GGPA 1N2SA 1UH5A 4TWRA 5CPFA 4HNGA 2VNSA 3CMCO 3WJAA 2OBNA 2I3GA 3PIIA 2WWRA 1HDYA 2J3IA 4BNMA 1VC2A 2I67A 4J4BA 3WLEA 2DC1A 4BO8A 3KYDB 3DBLA 4GMGA 4DA9A 4CLEA 2Y1GA 1X15A 4B3HA 1QR6A 2IODA 4E0BA 2BKAA 5A03A 3DZFA 1DDOA 1JKFA 3JD4A 5TT1A 3BMOA 3RAJA 3BIOA 1XQ1A 5KJCA 1WPQA 1LRJA 2P2SA 2G76A 4NNJA 2JD2A 3PJFA 1MXFA 1F0YA 1KVUA 1E7YA 1ZMOA 2D0IA 1HEUA 4IBOA 3PEFA 1CWUA 4RF2A 3RQSA 3ZU5A 5IDWA 2WDZA 4CR8A 1Y81A 4DGSA 2Q1TA 4CMGA 2GASA 2A92A 4BB5A 2ZJ0A 3QVWA 2DPHA 4G2NA 1VJTA 1TT5A 1MLDA 3UVEA 8ADHA 4TQGA 1MX3A 1PX0A 1RYEA 1U3WA 2NQTA 2PGDA 3AU8A 5LC1A 2EG9A 3MJEA 4LW8A 4QFDA 2AEFA 4BVAA 4B4UA 3VVCA 4OOEA 4XEHA 5G4LA 1O89A 2X5JO 3RI3A 4N7RA 2W8ZA 3GFBA 3TWOA 1XR3A 2JHFA 3FR8A 1W73A 3RUEA 3MWEB 1PQWA 4HKTA 1E7MA 2C29D 2D5AA 3FF4A 1ONNA 2VTEA 4ND4A 4J7UA 1GPDG 2V7PA 4FCCA 3A28A 1R0LA 2P5UA 3P5SA 2ZTVA 1LJ8A 1WDMA 3FBGA 3FSRA 4IMPA 1JW9B 3GH3A 1AXEA 1Q1NA 3TQHA 4D46A 1NX6A 1LA2A 4A26A 1PR3A 3ZHXA 5IG2A 4DPLA 3C8MA 3OSUA 4IY1A 3DEYX 4NJMB 4BOYA 4HFJA 2EV9A 3JQAB 2I9PA 4AVYA 4CJXA 5TF4A 3GRPA 4R1SA 2LDBA 1K89A 1SOWA 4YT5A 3DXFA 4GPD1 1GYPA 4XX0A 1T2FA 2OFPA 4WLUA 4GSLA 4J7XA 3PFFA 3NKLA 4RJTA 1C0IA 4K1LA 1CRWG 3RC7A 2D1YA 2NVBA 1UDCA 3OJEA 4CR6A 4YQYA 1DEHA 1PJ4A 3O38A 3U9LA 4R54A 3P19A 1JN0A 4J1NA 1KC3A 3HE3A 5CEEA 1H0KA 2Y0CA 4CODB 4K9DA 3TF5A 2PD3A 4MP3A 3C7AA 5AVOA 3VOSA 1YQDA 1Q0LA 1YXMA 5H83A 1UXGA 1ZSVA 1SPXA 2F00A 2J3JA 3INTA 2GYYA 2P9CA 4M86A 5F1PA 3QLJA 3IIEA 1GUYA 3WGOA 2OXIA 1R4NB 4DMLA 4M8SA 5C7IO 3V1YA 2B5WA 2UAGA 5JYDA 2VHZA 3ZWYA 1Z6ZA 2XF8A 3QIVA 1UR5A 4JP3A 2X9GA 2AEJA 4AJPA 2HUNA 1ZNQO 3OQ6A 3QRWA 4L4RA 2PKQP 3DAFA 5GZ3A 4P38A 3TZCA 3QA9A 1NYTA 4MVJH 1X14A 1OMOA 2Y0EA 4O1MA 1IOLA 3RASA 1QLHA 3D5QA 1ZJZA 2C54A 3H2SA 4XQEA 3HADA 1FK8A 1ONPA 1MUUA 4HV4A 2EWMA 3I9KA 4HFNA 4AJHA 2GDZA 3W6ZA 1KYQA 2EEZA 3L6OO 1VL0A 4IGEA 4WNIA 3BMNB 3OA0A 3HFSA 4QECA 1ENYA 1EVZA 3F47A 3I9LA 3JQFC 4E33A
chains in the Genus database with same CATH superfamily
1DRJA 1Q0UA 1ZNZA 3ZHZA 3EE6A 1ESZA 3IKJA 1UXKA 3EUAA 5J4LA 3B1XA 1SD1A 3WL8A 3QYJA 4QXPA 3EOBI 1YA6A 4E5UA 5CEJA 1YZHA 4L8WB 3KQVA 2ZT8A 3KTFA 4WUTA 5FFFA 3T0IA 5JS8A 1BC5A 1FXWA 1V96A 2FDXA 4HL6A 4MQEB 5CUQA 1U8ZA 3DQPA 2V97A 4MW4A 1AVTA 3GYBA 3G7NA 4HK4A 1V25A 1R5OA 4I1SA 3E5RA 5EP1A 2ICAA 3MJDA 1FXUA 4LJ5A 1YHYA 3FNHA 4H0CA 4AJ1A 1DG3A 4BKRA 2ZRQA 1T26A 3PTLA 2VXYA 4AX4A 3BG5A 3B12A 5DULA 4EJSC 4HQ6A 3B1WA 4CTMA 3VI4B 4OI0A 1JPVA 5A6VA 1HOTA 2IZ0A 4IXWA 5CLQA 3QX3A 4MVJI 1X7XA 2EQBA 4XRRA 4HNUA 5CA1B 5AHOA 1XCGB 3UH1A 2QGFA 2G0TA 1KO1A 2XGJA 2RHTA 3E9MA 1XRLA 2X41A 3D7MA 3M1IA 5T8KA 1P2TA 1UBEA 3FVQA 4F86A 2BR3A 1RWBA 4GI2A 1YDEA 4OHKA 4H7IA 2WHPA 1WXHA 1L7EA 2G88A 1K27A 3UHOA 4DLYA 2A4KA 2IPLA 1FDVA 1YIOA 2X2OA 5H5JA 2PKEA 5U4QA 3MPOA 3WNDA 3KD3A 4QYSA 4CKCB 1GYQA 4CM4B 1XD2B 3B2QA 1GKLA 2XF2A 2PT9A 1EUDB 3OCCA 3L06A 3Q3GE 3UK1A 4MCIA 1LH0A 1S7CA 1G66A 4GPZA 4R2WA 4UJ5A 3R1IA 3RF7A 4YROA 2PJRA 4OLFA 3NVAA 2OO5C 3ZS9A 3RTBA 4ZJPA 4JD5A 3PUIA 3AI3A 2J7PD 3SHOA 1WVIA 1O9GA 3H9UA 4JCOA 2ZDHA 4IDBA 2QEQA 2YCBA 2OVFA 1XTJA 1BU8A 2BKVA 4MR9A 5KVVA 3V4LA 4EW1A 2P11A 3T1TA 4DR4B 1ZI9A 1UCFA 3FVTA 3EMKA 3Q8XB 1JHMA 3RSSA 3ZHRA 2JCXA 3GRUA 5DWDA 3QVGA 4Y0NA 1L5HA 1JFTA 2VTDA 3V97A 2NSDA 4DN6A 2OP1A 5HUHA 1NW5A 5JO0A 3WSTA 1MIOB 1ISJA 4M8LA 4PPYA 4H4CA 2BOVA 2I7CA 4OGFA 5EMKA 3WNQA 1PWEA 3ANYB 2R4UA 3JCZA 3OZAA 2CMDA 1PL8A 4GF5A 2RJOA 3UICA 3W6UA 2RE8A 2C42A 1EFVB 2VAMA 1W4ZA 3NBMA 3WIDA 4C7XA 3JR3A 3S27A 3F96A 1ST2A 5LA6F 2QQ5A 3ROQA 3LUKA 1HT3A 4L6IA 3RS8A 1SH7A 2WWIA 3B82A 2O6HA 3UMMA 3HCFA 1J4AA 2Q3MA 3D8SA 3U4AA 1DWOA 3LRTA 4BNNA 3K9WA 4BJ1A 1V8FA 1POWA 4I55A 1W0JD 3TLKA 4V0OA 2MR5A 1T5SA 1KS9A 2GX6A 2QKYA 4R05A 3DPUA 4YJDA 2XZPA 3GCWA 3QV1A 3QKSB 3EVNA 3L40A 4YCLA 3IHKA 4N5DA 1RJ9B 1ZJYA 5BRNA 3V9AA 4Y18A 2RH9B 1WEKA 4ZVOA 2NXEA 5A0VA 1UWVA 3WGLA 4C1BA 1E6KA 2GD0A 2ZYRA 2J48A 2NTJA 4N7BA 3RODA 5AOVA 6ABPA 4DSZA 1KFCB 1NA5A 1MFPA 4I4IA 4Q12A 3CVYA 4DNQA 4WEOA 2VAXA 3ZE9A 3CX4A 3MTQA 4B85A 4P3YA 5TQ2B 1JLRA 1L7MA 4BPRA 4HPWA 1XPRA 1NF8A 5CJ2A 3B2NA 1QYWA 4JLWA 2REQA 4DR1B 2CHFA 5EN4A 4HEHA 5EJEA 2QQEA 4P4SA 1KPHA 1Z2DA 1RKXA 2CXHA 3EA0A 5D84A 3QEKA 4BC0A 1MOQA 4PZZA 4EQ6A 1G55A 2AKYA 3ZD9A 2V4ZA 4DIEA 1ZK2A 2AFVA 5B6PA 3WA6A 5BSVA 2BGGA 1DOZA 3SQDA 3BD6A 4KSCA 4WK2B 2R6CA 3IP7A 3PFIA 3IIMA 3WV4A 2HNAA 4IINA 5DTRA 4V38A 1GZSA 1X8LA 1JVBA 1C3VA 2AB0A 2YUTA 3P2EA 1KBOA 1Z6YA 2UVQA 3PDUA 4QLAA 4U2CA 1Q0TA 2XE7A 2Y76A 2YYYA 4PYIA 5KTYA 2GN9A 4ZDIA 2VTVA 3I5XA 3SS7X 3M2PA 2A9PA 3AKEA 2JGDA 4R3NA 3KPYA 1XNJA 2FMFA 1II8B 3KR0A 5K05A 1EWKA 5CH3A 1HYHA 1WNTA 5TQ0A 1BD4A 3BULA 3N5KA 4CHTA 3T4PA 2N47A 3MT9A 4NE2A 3BIXA 2MYPA 5BR7A 1E3QA 3IVRA 4FS8A 5TJ9A 3ZDXB 4AO6A 4ER6A 5TY0A 2QN9A 1VQ1A 2A33A 1VB3A 3OLZA 3S70A 4D96A 5E1MA 2R6GA 1ONBA 2JHCA 1CJTC 4YFYA 1DAFA 1MU0A 3O1HB 2IJGX 1RBYA 2I99A 3AB7A 3HR7A 1E2FA 2PSSA 1VPTA 1MB3A 1NDUA 2Z2XA 1MAWA 1KJWA 3VPCA 1ISPA 4ZVPA 3ZDEA 1CVIA 1VJCA 2OC4A 2ONKA 5FPHA 3KYIB 2HA2A 4TS9A 1KYIA 1SD2A 5I9TA 2O0MA 4K0KB 2FP4B 1U9JA 3A3KA 5EEGA 2XOKA 3RNOA 3VKWA 3WGYA 4V0NA 1XNHA 2FF5A 4I9FA 2DFLA 1N5LA 2WU1A 2O0HA 1FJGB 1GGFA 3V33A 1YOBA 2IWRA 1JXQA 5K0EA 4I36A 5KTPA 3CLVA 1D2RA 2C7PA 4NYIQ 5ED4A 2GAIA 2N0SA 3DKIA 1Y5IA 3E7XA 1NUUA 1NVKA 3MOSA 2CY0A 2PQ0A 4EARA 2BDEA 3U1BA 2GFHA 2OL4A 1N6PA 4EPRA 4M0KA 4REOA 2YFYA 1JT2A 1Q84A 5FKJA 2OFFA 4P8RA 2B1GA 1LX6A 1RWKA 2R6DA 1XCOA 2ZUUA 3VZPA 3E5MA 1G63A 3H75A 1PS9A 2X8LA 3QFFA 3IHWA 4HRXA 4KO1S 2WTXA 2A0YA 5YASA 4HDSA 2BM8A 2GH1A 3P1JA 1CY1A 4FHGA 4NV1A 4DR3B 4ACAA 1DO2A 5F5NA 1PJTA 3A4NA 2CHQA 3CTMA 3HCNA 3O2QB 2GF2A 4L50A 3I1JA 4V1CB 5EJ2A 1YJ5A 5KQGA 3O1JC 1B00A 3EDCA 3CF2A 4YP7A 5A2GA 2HJGA 3E9EA 2HF2A 1BXRA 1EP2B 2AFHA 3D3WA 4BEJA 1J2YA 3UFXB 4E51A 2ERCA 3IE1A 1IU9A 2Q27A 2QJOA 2ZI4A 1H2EA 2ZB7A 3S44A 1QCDA 2R7AA 2OZEA 2W6JA 3EGWA 5IVIA 3DZDA 4YNBA 1IMJA 3WLSA 3D2AA 3T7EA 1RAAA 2HQOA 4MPRA 2ZI3A 4YI3A 1W1WA 3KL2A 1DBQA 3RSCA 3VMFA 1J0EA 1Q1AA 2VP0A 4M3NA 5C81A 1JFFB 3QEMA 3ZK9A 1XZHA 4PNPA 2AQKA 2VEDA 2XUOA 3WMWA 2AVDA 3BWYA 1NX9A 4G0MA 1EJBA 3LT1A 2V96A 5H9VA 1UBHS 2VHVA 4RK4A 2AYXA 4IQ8A 1NRXA 1SVOA 2N46A 3DJFA 3ZXYA 1XI2A 1OKKD 4L5IA 4L74A 4QNNA 4YJFB 2V58A 2QVZX 1Z74A 5LA6B 4G0UA 4FOLA 3HKEB 5FI1B 3KQYA 3VQTA 3CJTA 2QN3A 2PGLA 4A27A 4B7XA 4KXYA 4U7PB 1JSRA 1OUMA 3BAFA 4GR5A 3HY4A 3MS7A 4MVJM 4DZRA 1NJ8A 4ZDJA 1QMIA 1KK0A 3BXOA 2XTNA 3DFZA 3UGJA 2JKYA 1T2VA 3STXA 1RIFA 3MFQA 1OX6A 4L8VA 1QKIA 2X1MA 1DG1G 1KVSA 5AOAA 5L4SA 4C22A 1QLWA 3VR2A 1HNXB 3N2KB 2JFVA 1ENZA 4GWGA 1YFKA 4PGFA 4UD6A 4ZWNA 2IRWA 3TLZA 3W06A 5I7AA 3UUEA 2PX0A 1BEEA 1URPA 3LHFA 2G40A 2HR1A 4W7HA 3TMAA 1BJTA 2OZVA 5BW5A 3GLIB 3UHJA 5JSZA 1FE8A 2Z56A 1XZMA 2OG1A 3KSZO 1PT7A 5KTSA 3F2IA 3RF6A 1V8BA 3TQSA 4KK4A 5IVKA 4NMMA 1JLKA 1QH8A 3ZV3A 2W37A 2EKLA 3M6VA 1P73A 4XYLA 1NTRA 5TVGA 4NEQA 1DBVO 2LGJA 3GLTA 1DIHA 3G2LA 1M2VA 1R1DA 3QI2A 3G6WA 1NFRA 2FQQA 2HF9A 1N6IA 3SPXA 4F8YA 5I7SA 4CT0A 2WWVD 3DHVA 2P4HX 5JH7A 2C96A 1E7RA 3FHOA 4FYYA 4E32A 2V3CC 1KY4A 2WEKA 3ND8A 2OPHA 1VPDA 4PO9A 4D56A 4HYEA 1KMHB 1OQAA 3DB2A 3IJRA 1S9HA 3DZ5B 4REMA 3WGMA 4IJQA 3II6X 3CONA 1KYWA 1FUIA 3JQGB 4U2BA 2ECPA 4H9GA 4NKRA 5TS3A 3TRJA 3FDZB 2V55B 4WLFA 2ZTLA 2VRWA 2CN1A 1R4AA 1SXJC 1PGQA 3GUHA 4OB7A 4ZDKA 5ECGC 3AHFA 5CA0A 1VG8A 2B1JA 1OXUA 4AZ0B 3PHBE 1T2AA 2HH9A 3VYUB 3MRTA 5TEVA 4FW9A 2OFOA 4KQHA 4EYOA 4XYMA 1BYIA 5JI2E 3X1YA 3MK31 1ZEMA 1TJ3A 3BK7A 4DBLE 4P2BA 3QE2A 1LBQA 2HAEA 4BFTA 3UWMA 4CFZA 3T7IA 4OK5A 5C7YA 4OHYA 2CC2A 5B3AA 1X1RA 2C2OA 4DC1A 2QZ9A 2VP5A 4IHJB 1V6AA 1RM4A 1T8SA 3I01A 3JQQA 3P97A 4DHWA 2W2OA 2YJGA 2D2FA 3C8DA 3B89A 3CLTC 4L0CA 1E7QA 1L5GB 4MPPA 5JC1A 5J58A 2O6LA 1XELA 2OV4A 4KWHA 1UOOA 2LXNA 2RGBA 4BRWA 4GICA 4N5MA 1WUHS 2R1VA 3S5UA 1FSPA 3B20A 1A7UA 3BHIA 1V1RB 4D4JA 2Y8EA 5IAAA 4MB6A 5ER6A 2M6LA 3EVTA 3IQHX 2F3RA 2QRNA 2J8ZA 1PHPA 2JANA 4M0CA 4M83A 1CUWA 2JCBA 3VZQA 3RVKA 4YIHA 1GZ5A 2ID4A 1XTKA 5DGCA 2XUIA 2C7RA 1CJVC 2P9QA 4FSXA 4GQBA 2C5FA 3KAKA 4R1TA 5E8RA 4C4YA 2PY6A 4NX2A 4GVXA 4YREA 2C2GA 3E9DA 1TYBE 2BZ0A 4A23A 1ZI6A 2O1EA 3G7SA 3G0OA 4YTEA 3NP9A 5E7MA 1CERA 4PX5A 2FCRA 4QT4A 3IXQA 2PBZA 2TMGA 1ZGCA 3GVIA 3HHEA 5MN6A 4Y67A 3M6AA 3FPCA 4RJKA 1DOHA 2ZYHA 1P6QA 2IOQA 1HX7A 2QBYA 1MCZA 1FDRA 1NP6A 3EH1A 4PLZA 3EEBA 4L4YA 4WJKB 1P5HA 4NJEB 5DX8A 2NUAB 4XTRA 1R0YA 2O2SA 2WTBA 3T61A 4LY6A 4TMYA 4EYGA 3ZUGA 1TUEA 2ZUFA 1D6SA 2IHBA 2BI8A 2O07A 3LY7A 3FAKA 4M2LA 3VH4A 3D8HA 1JBQA 4HH1A 4F5EA 4ZT2A 1WCIA 3DT6A 3A4IA 4UFPA 4MKRA 3RR2A 3D8TA 1CS4C 2C9YA 2QT9A 1F2TB 2ZIFA 3LX8A 3QXCA 5F2EA 3PHHA 3MJTA 4EDFA 5MFPA 2CT8A 3SKXA 4EUFA 2HRZA 2EIHA 1D4ZA 1ADFA 1IBRA 1LW6E 5C37A 3SSAA 1OXBB 2A57A 2AI1A 3IQFA 3OQJA 5AH0A 2QN7A 2QVYX 1Z2OX 5JJLA 2QU7A 2YBEA 1M1YE 3BWMA 5EPOA 1DINA 1FVOA 3LUHA 5JE8A 1VMDA 3HQ4O 3A9TA 3AP3A 2ZRFA 4L76A 1XYYA 4CLQA 3FJ1A 1NQOA 4FSHA 3NMUF 2YZGA 3QKWA 3B6EA 2CXRA 2QAGC 1SB8A 2ZJ4A 5HK8A 4DV5B 3OD1A 1TC2A 2BKXA 2Q29A 5FTNA 4MGYR 4LV5B 1JQAA 5FBVB 1R6DA 1CQIB 1W4BA 1J56A 1ZK4A 1I1QB 2W4MA 3LPNA 2AF3C 3K70D 1VJ1A 3K32A 2NM0A 5AUNB 3TR0A 3D8RA 3GGDA 2PZEA 2WU8A 1VGRA 2F48A 3FBWA 3LOUA 1I2AA 4XVUA 1TD9A 3OTQA 2G9NA 3AW8A 2P75A 4YXWD 2H2WA 3NGXA 2CEAA 1R6TA 1Y8RB 3BTUA 2C94A 5A71A 1Q2UA 3G82C 1NAIA 2ZB3A 5E0KB 1JFLA 5DGHA 1NG1A 4OV6B 4DQUA 3ZWBA 2UXDB 3N6RA 4L9AA 4NOLA 1OE0A 1Y1QA 2CE2X 1ECPA 4L0DA 4WDRA 4B84A 4CZ2A 1AHIA 4R2IA 3R7LA 9LDTA 1KY5A 1R4NA 5AVVA 1OFUA 4JB8A 2PQ6A 2GVNA 3PGA1 5EIWA 5M6DA 1G98A 4DAOA 4L07A 1EX7A 1BIFA 1F5SA 3A58B 3VNQA 4ND6A 3EGIA 2PH1A 4MS4B 4K9KA 4G9BA 4EFKA 3VNBA 5DSTA 4EPVA 4WLOA 4XGQA 4F4FA 3CLRD 1GL3A 4QOSA 2DLCX 3OIYA 2J5BA 2VUHB 1UFVA 3AETA 3NU1A 4ZRNA 1WCYA 2O20A 4HZUB 4HQ0A 5CB4B 3LIIA 2YXBA 3DDWA 2DULA 3IXLA 4XCQA 3OOWA 4A0SA 4A36A 2YFHA 3GCDA 1NQTA 5ESWA 4JI3B 2PSHA 2RI0A 2YVKA 1H1DA 5JARA 1LS1A 2GKOA 3L77A 1XO1A 2C95A 4M76B 3WBFA 4S0ZA 3GBVA 3NNNA 3WKBA 3FH0A 4DADA 1MB0A 4UM9B 5IEJA 4G37A 5K20A 3R74A 5AUPB 2H1FA 2HZBA 2NLOA 3GN1A 3BHNA 1J0BA 2VTKA 2Q3JA 4D3YA 1T6NA 4WASA 2P3LA 4HTAA 4LK2A 5AJUA 4YRJA 1I1NA 3L3BA 3D4BA 4L27A 3WY9A 4G5QA 5KU1A 3AR4A 1MDFA 3IE0A 3PDIB 3WJ1A 4TYYA 3PUXA 1O5OA 5L45A 5HGXA 4G36A 4FQ5A 1JQ3A 1HMPA 4AS1A 3B9PA 5CH8A 4TKVA 2Y2VA 3A10A 3IRUA 4GSYA 1G6KA 1GL9B 1TJNA 3N0RA 4PHTA 3AQIA 2F3TA 3BMQA 2WF9A 3OX1A 2XNDA 5KOHB 3CZAA 3DO5A 1K7EB 4IKEA 4IJUA 1B0PA 4R68A 5JRZA 2A1UB 3EP5B 3PYLA 4JK3A 1B26A 4E3ZA 1L5KA 3HUEA 4YX9A 4H18A 1YZQA 1GG2A 3DTVB 4R1NA 4R3UC 4HGQA 3VYRB 1U0NA 3UGTA 2Q5JA 4PU0A 4XGIA 2O3TA 1XZCA 4MW6A 3AY6A 3QHQA 4ZGWA 5BMVA 1CZHA 5CA1A 2XOXA 3ZE0B 3OECA 3FI9A 2YCLA 4UNSA 5C1PA 2C58A 5IYZA 4OYHA 2BONA 1VSQA 2CFRA 3VU8A 3TOSA 3WWCA 3RNLA 2WIAA 2GD1O 1QG2A 1YCGA 3HL0A 3PXBA 4DVJA 5FNVB 1GSOA 1W1UA 2XT0A 4X7BA 2ZWVA 5DFAA 1RAGA 2CMFA 2GCEA 4HG2A 2AS0A 5THKA 4EJ0A 2WJ6A 3P2IA 2RBEA 2WOOA 3I12A 5KWVA 3NOOA 2XTJA 3Q0TA 4J7AA 1XD2A 4XYGA 3TTTA 1VTKA 1EUDA 3KOZA 3QXJA 3FGPA 3FYTA 3LLCA 2VJLA 3NYIA 5REQA 5BWBA 2OGUA 4TUYB 4LNAA 3W9YA 5FA8A 2ZUEA 1WY5A 1D5CA 2GPSA 4B3TB 1L0BA 1F20A 1BA3A 4H17A 1B7GO 3BXHA 4J49A 2R6R1 1H0HA 1UMCA 2QJWA 4D3FA 2IW1A 4OHBA 4J0DA 1B6TA 4P08A 5DI3B 5CLGA 4N39A 3HTXA 3WQQA 3FCEA 4MKFA 1G8KA 5HP4A 1AT1A 3O83A 1JJIA 2B4KA 1AXGA 1YR7A 3CH4B 2VJKA 1QGDA 2W11A 1T5TA 3DEZA 1E4VA 3PKZA 3R20A 4G81A 4LBZA 4NABA 3SYKA 3QPBA 4BLTA 1DU4A 5HJ5A 1WB4A 1OFUX 4LZAA 4NH0A 4AXXA 5LQDA 5IJWA 4ZOLB 1V7CA 5KTKA 2UZ3A 3A9SA 3REGA 4BS9A 2GNAA 4R1QA 3TLGA 3VJRA 4ITUA 3P4XA 3F5QA 2GMWA 1UM8A 2O05A 3RVOA 3EK2A 1ESMA 5KVCA 1N8SA 1Q11A 1NPYA 5HF9A 4AYTA 3LOQA 1GIAA 5CDFE 1T6XA 2EJCA 2IC5A 2GKGA 3AEQB 3W04A 4UEWA 5IN4A 1DCFA 3MUEA 2WTNA 4X95A 2R47A 3DBLB 3DWIA 1EK1A 4NZZA 1VIAA 4ETWA 1L4HA 2OXCA 4DQVA 2ODAA 4HDOB 1W6RA 1NLFA 2GN2A 3GPBA 3NBKA 2EQ5A 2WJIA 4H4DA 3PQFA 4HEJA 5EHNA 1Q0ZA 3WMXA 1JJ7A 2OCXA 5ALVA 1JTFA 3BMOB 4NDAA 4OA5A 3SS9X 1L9KA 3PHJA 1RRFA 1WR8A 1NPTO 1NN1A 5IT9A 4FMPA 3U5ZB 5K5EA 1E5LA 1SXJA 2A9RA 1RCTE 3HI6A 1ZW6A 5TS2A 2A59A 4W6ZA 1QJ4A 3CUKA 4M6WB 2RAPA 2OCKA 1KJ8A 2LD4A 4B4DA 2AOWA 3IEMA 2GN1A 1SURA 3BQMB 4G8JA 4KR2A 4M8IA 2WJYA 3GFFA 1MENA 2HLNA 1AD2A 2JAHA 1NLYA 1MT0A 4DA7A 2IYQA 5JWRA 1Y0BA 5E1DA 3EPJA 5C5CA 3TLBA 4JI5B 3T3PB 2FFHA 2X0EA 4ZVKA 4CDGA 3CU5A 4DNPA 2JLZA 3OZEA 5KWEA 2BR5A 1WDTA 3WDMA 1ODCA 3RFUA 2Q4RA 4P4NA 1NJ6A 3MQ2A 3RVDA 1ZPDA 1HFEL 1YRWA 2A86A 2FLWA 4IG9A 1E59A 4TKZA 5E4JA 2HK9A 4G0YA 4IV5A 1KTIA 3U4MA 3AR2A 1K97A 3UB3A 2LRHA 4NP6A 5I4BA 5C31A 3CCBA 1IONA 4EKNB 5D5HA 4G1VA 2HADA 2IXDA 4IIJB 3EZ6A 4Y3UA 3IQXA 4B6OA 4CT5A 1F60A 4PWZA 2P3OA 3HCPA 4HRYA 4ZMRA 5B6JA 2KYRA 2HO5A 1COWD 4OFWA 3DV0B 3TTVA 2IZ5A 3B1VA 3JYQA 2DWOA 1CHNA 2BJWA 1P6UA 4BDTA 5TLSA 1F8YA 2Q1XA 2WVGA 1ELOA 2E85A 4NZ9A 1R9GA 1GADO 1GTG1 2XSZD 3VMMA 3FCXA 1RXVA 2BEWB 1M0SA 4RW0A 4E13A 3AEKA 5A05A 2BCJQ 3Q7TA 3H8VA 4QGBA 1T6YA 4F4DA 1Y5MA 4JODA 3R23A 4NCXA 1R50A 2PZMA 4RSRA 2GN8A 3U3XA 2QAJA 1SUDA 1QGOA 2PT7A 1WAMA 2CXNA 2K6GA 3H8SA 4Q01A 3A32A 2X7HA 3DONA 4BNGA 3ELBA 4HH0A 4Z1MA 4Z8YA 4EI2A 5KNBA 3STTA 3RKRA 1TPZA 1XYVA 3ETNA 1U2RA 2GXUA 3OE7A 5A4IS 4MINA 4X24A 2H48A 4QUBA 2C04A 2PSJA 2H00A 4ZO8A 1N6OA 1T36B 4EBFA 5B6IA 2EHDA 3VR3A 4NAUA 1VCHA 2A5DA 4KMMA 3AL2A 1UM9B 1VIMA 4HAUA 1F12A 3UHPA 1IVYA 2FP4A 2RGXA 2WPNA 4KPUA 3RSOA 1I6WA 4OI4A 2VK4A 4K3UA 3E3NA 4PSUA 3F2VA 4FPXA 4G89A 2CYBA 1CQWA 1E6MA 2JHAA 3IVAA 4JP8A 4LHWA 5DWVA 3U3MA 3KFLA 1D6JA 4BTLA 3JQBA 4XPIA 1ZD3A 3A6DA 3RIGA 2I8LA 3EPAB 1PWHA 2DT5A 1DRWA 1CULC 1FU4A 1Q92A 1MC1A 4NBRA 4DMGA 5CVTA 3W9UA 5IASA 1BG6A 1E69A 1Y82A 3A9CA 2I6QA 2QAGA 1YBVA 3P71T 1QTNA 5BOSB 1IXSB 2ODEA 2A0XA 3LU1A 3ZHUA 1XNGA 2JFOA 3R5JA 5G0WA 1OLUA 4Y6PA 3M5PA 3U0BA 3OKFA 3OZWA 2XADA 4HLQB 2W6JD 4KMOA 2OC9A 3IB6A 1UXJA 3JWJA 2Q5HA 4RSGA 1JP7A 4URWR 5LJIA 4JXZA 1OWPA 3G2MA 3WQBA 1NGSA 4Q18A 2ZTSA 4MIYA 1H1LA 5ALIA 1T2UA 1FRFS 3RAPR 5EJ7A 2OSBA 4DYVA 1DE0A 3F9RA 1X8KA 4V1CA 3NTUA 4YHBA 2ACEA 3D7KA 3T6KA 1OFHA 2XQJA 3KJQA 4MULA 4RVUA 4M1KA 4JJGA 5DH9A 4ALLA 4NOMA 1ZM2A 5SY6A 3LFHA 1PJLA 2V65A 2E4UA 4MKZA 1XZKA 2O8NA 3E3AA 1OCEA 1JHVA 1JIUA 3DZIA 1J2UA 2EAUA 4TL9A 4YRRA 3T9AA 2AG0A 2ZRLA 2IYYA 3HU1A 3JD2A 2PGIA 3C3EA 3FNBA 4W8HA 4MR7B 3U56A 3RC1A 1FMLA 1GDDA 2A9OA 3L8GA 1C3JA 3ZV4A 1Y4SA 1KU0A 3RVMA 5K6TA 4MRPA 1K1EA 3KEOA 1O1YA 2XGOA 2SKCA 4HX2A 1NJSA 1YUMA 2F3QA 5LIPA 4K8OA 3GA5A 2G09A 3V2UA 3VR2D 2C2HA 3KQMA 1FW8A 3L4KA 4GLJA 5B1IA 3TGPA 4OQ4A 2FPXA 3TG2A 2UUCB 1L3BA 3MMXA 3R7AA 1IB6A 3ZOZA 4E5PA 3IAUA 2Y6VA 1VL5A 4AO7A 4RMHA 3KQUA 3MTGA 1IWPB 3PQ6A 4OKSA 4YJHB 1OVMA 5JXWA 1ITZA 4B2PA 1M6HA 1KI7A 3HRHA 4FI3F 4UDNA 3TW8A 2AV6A 3EXHB 3I4CA 1U8TA 4IJ6A 1TO2E 5M2QA 2C92A 2PXCA 4HWGA 3OKCA 1R0BA 5CB8A 1XDZA 4HB4A 5D1NA 4I8XA 5AYVA 3HBLA 3TZKA 3PLAE 2VSXA 2WHEA 3H0EA 3T3DA 1QF7A 2ZIVB 3M3HA 5HDBB 5ALOA 3BRQA 3TXXA 3EVBA 4O2LA 5JFTA 4R8VA 1Y8QA 1CNMA 4BKOA 2VQ6A 4CV2A 4NDZA 1BJRE 1BMTA 3WLIA 3KTAA 1DC3A 4GVPA 1C0KA 1DCTA 3TN7A 2IZ7A 3AR3A 4B3BA 1HE8B 2B8TA 3EMVA 2ZI5A 4XVCA 5FWXB 3W5CA 5LFAA 4EA9A 2IOHA 2PUWA 2DRIA 3DUFB 4KEAA 3GT0A 3TLMA 3WL4A 4UU1A 4FHCA 4PGMA 4D9BA 2WYVA 3WYNA 2CNLA 1JXMA 4CKBB 2ZWAA 3ILHA 3WNVA 1M83A 1TFRA 5FRDA 4F2GA 3H19A 3P0FA 4XVRA 3U3OA 4D3XA 1SCKA 3PX3A 4K86A 3OEHD 4RPIA 4Y1FA 5ALEA 4CL8A 3OY7A 1KH2A 3KJZA 4BL5A 3NORA 1IIBA 1BYUA 1YONA 3DBRA 4YAFA 2IHNA 1RCUA 2Z09A 3ASUA 2RMKA 3FDZA 3Q9SA 1TVCA 1KO8A 4IH9A 4INPA 1GGHA 2X9NA 3PITA 3PS9A 4PS0A 8LDHA 3T1QA 2ZRBA 5HBRA 3I5AA 3A9VA 4I1RA 1QMHA 5CBPB 5EMNA 3NXKA 1SY7A 4WADA 4AECA 1U7OA 3ORQA 1WL8A 2YZMA 3JPWA 2QNBA 2YKGA 1FMCA 1R0ZA 2NSYA 3EDOA 4KXNA 4PX3A 4IHJA 1E1CA 2C5GA 2V4MA 3GMDA 2PLNA 2HU5A 3PQ4A 4H15A 4LGYA 5K0BA 3KPJA 1X7DA 1JJAA 1WO8A 3I4LA 3QGMA 3SAJA 2ZKLA 3HJNA 5TB5A 3SNKA 3HKDB 5DX0A 3U9TA 3B52X 4JOSA 4YMUA 1NY5A 2J7KA 2XWJI 1JAIA 3OC6A 1KFKB 2NUPB 1B6SA 2WYWA 3F5SA 3OTIA 1O57A 2IHJA 5GTDA 1Y48E 4FE4A 4H0NA 5BQOA 3MC1A 5LZ9A 5FUXA 3EP8B 3T38A 1JJFA 4BZWA 1VMEA 3TYXA 4F5WA 1PAUA 3EXFB 1CUFA 3LLSA 4W8GA 3TUJC 2HSZA 1Q5PA 2W0MA 4OU5A 4DKXA 1NW7A 3ZOKA 4IDCA 9MHTA 2W58A 4RZ3A 1KOLA 1U3UA 3DGEC 3PT9A 1KWKA 3VR4H 2VDRB 3IURA 4I6GA 4DRZA 3IKVA 4RV9A 2WRZA 1ZCAA 3I05A 2A1TS 1O9BA 4P4UA 2MWMA 4FMCF 4QBGB 3TLCA 5JDCC 3G0HA 4H6VA 5BNFA 1D03A 2IDJA 1NW3A 4EMUA 1IQPA 3A2MA 2GGSA 1WQ1R 4L2IA 2KS6A 2ZSEA 5JHGB 2JJ1A 4JUBA 3PPXA 3DVAB 4YRLA 4D9GA 4GP6A 3FNIA 5DSXA 2IYNA 4KE8A 4NJEA 3WFZA 4DYDA 2I78A 2XKJE 4GBJA 3V8PA 4JBWA 1CUVA 3EAGA 1GPJA 1T9HA 3OBBA 1QF6A 1T5BA 4YR7A 3QVSA 4Q7MB 2A9JA 2CCKA 3MWFA 4G0XA 1SZPA 1TGVA 3GJ8A 5L7YA 3ZE8A 1KK2A 1OREA 4H1HA 4N12A 1IPHA 3BMXA 1FSFA 4QJBA 3R8CA 1U02A 3ZWMA 3B48A 3M49A 1QGZA 4HZIA 4HYTA 4R1UA 3K0AB 4TSFA 4LFAB 1GPWB 2B7LA 2QIOA 5K0GA 1ZCJA 1J23A 1NONA 1IG0A 3NIFB 3DM5A 4DWOA 1GG9A 3OFSA 3NRJA 4Y6OA 5DF1A 5E6RA 2KBFA 3LUBA 2JPDA 5AM1A 1NRWA 2ZS9A 5EFOA 5FULA 5JADA 2I2XB 4ZAXA 4GX5A 4TVOA 1LFDB 3CC8A 1R37A 2P5TB 2QQFA 3GB9A 5DBOA 4QBKA 1IZ9A 3NHSA 3NHFA 1Z63A 3BMCB 3JRXA 4LZZA 1VECA 5JLAA 4EUKA 2FQXA 3QLUC 1DKPA 3AHGA 1NW8A 1EHCA 5AJYA 3CSUA 4DQLA 4YT4A 3LSTA 1XZIA 2QWXA 1EZ1A 3AO0B 3DFFA 3GN2A 5AT1A 3WV5A 3ZW7A 3H6KA 3A7DA 1GNPA 1PD0A 3N58A 4BNDB 5A5EA 5JY1A 3OX2A 1XLUA 4LE2A 4H7DA 4AN4A 1O0BA 1NSYA 4UJ3A 1M10A 1B8PA 3LT4A 4TV9B 3RUAA 2R79A 2WNHA 3OLYA 3ZKWB 3TH5A 2G4CA 2F8SA 5J1SB 5EJAA 4AJEA 1PBTA 1Y9EA 4GOXA 2C2MA 3SYRA 4C2UA 1DWUA 2PXAA 3RAEC 1KZ7B 4MUKA 1F1BA 4HPXB 2BEUB 4MR8B 1PDOA 3PFBA 3BXGA 4WK0B 4EJ2A 3N07A 3PYXA 2DBQA 1XXHE 4PQEA 1U90A 4HYYA 5IP5A 1H22A 2WZBA 2FLVA 3ROPA 2FWPA 2EZ8A 3L92A 1ZZEA 2R65A 3EFEA 1P80A 2I2WA 3HXTA 1GNQA 2X0RA 1WMSA 2WV7A 3IO3A 4R9RA 1UMBA 4PHCA 4NLLA 2EX0A 4J0HA 1O8BA 5A3SA 4JUFA 4U7DA 3I34X 2DECA 1UYJA 3LF2A 1MC5A 3PFGA 1GFSA 2GK7A 2P27A 4RVNA 4EB3A 2CFTA 4EMBA 4AURA 1SELA 1RYYA 1VI6A 1OIXA 1XDSA 2XNDD 2YJ5A 3G2PA 1F0PA 3EULA 3L0SA 4B6RA 5DB4A 5JS7A 2AMVA 2ZZKA 4ZO7A 2IYLD 1Z37A 2H8KA 2NZYA 5AJHA 4G5GA 2VYND 2GTHA 1M73E 4A2QA 5K0CA 4Z4GA 1PVDA 2HFJA 3QF4B 1SBIA 1IAVA 4CV0A 1OXXK 2IX3A 4R1OA 1WXFA 3PDIA 3GRFA 3MSCA 4M7RA 1YFJA 3E3LA 4IOJA 5DM4A 1E96A 1P8JA 2QORA 3EXHC 1RQRA 1P7ZA 1AMNA 1MNQA 1VZ2A 1G5TA 1PZNA 4IEEA 4BDSA 1RC1A 1HYQA 4F9FA 4MQBA 3RO7A 2GILA 3STYA 1N2IA 3G5AA 1CIPA 1UJ2A 3FYDA 3TOCA 4WKBA 2OXRA 2FPOA 1RMTA 3R3WA 2A1UA 1TADA 2NYVA 4CTJA 3FF1A 3H3XA 2ZYGA 4PZ0A 6CHYA 3U0VA 3E05A 3KP1A 3R5FA 3H2BA 3WP0A 1JDSA 5C8XA 4RPHA 5EC8A 3BCHA 4B2LA 4BX3A 3RADC 4YJ3B 1DC8A 3HSYA 1IZZA 4ILKA 1XRNA 3IODA 4BO3A 4EG7A 5IT4A 3H2ZA 2LVBA 1OR8A 2GEDA 4TXMA 5MFZA 2BM1A 5KTRA 5A3VA 1ZN9A 4LJ8A 1W46A 1DCKA 4M7OA 3SCZA 3V1KA 4B9AA 2Q8QA 2P4UA 2PYZA 1OIVA 3TIVA 1BDHA 4KVZA 4G4SP 4NYJR 5JDIC 3KS9A 1J49A 2N1BA 4M54A 5JYCA 2QRJA 1KJ9A 3NDBB 4B6SA 4OMCA 4KLCA 3ABQB 3CZ4A 3KC2A 5JS2A 2O57A 4JGIA 5K3DA 4ROTA 1AF4A 2POQX 1DRKA 3VAYA 4UCWA 4UZFA 4I1IA 4EW6A 2I3BA 2JGFA 1JXAA 2QRPA 3KL4A 5ICFA 1OC2A 1FNSA 1OPXA 1DNPA 4L16A 5DP1A 1OPRA 4XDHA 3LY8A 1Z06A 3TNLA 1N8TA 1LK5A 2CK3A 4QGAA 4TT3D 3GF4A 4WCDA 1S1MA 4FC7A 4F3CA 1UZUA 4R81A 4X62B 1XC7A 3CX7A 3MTAA 1HQCA 1NM5A 5FWYB 3V1UA 3GLGA 3JVVA 3Q15C 2J46A 4JROA 1G60A 5K09A 3A14A 2FXVA 3I83A 4LYEA 4IIXA 4FLEA 3UMJA 1SUEA 2Y2UA 4J0CA 1FL9A 1GJRA 3ADOA 3U40A 3H0KA 1LNZA 2C82A 2JEYA 3ONNA 3UAXA 3GJXC 5KMGA 3CZMA 2OP0A 4PW0A 2AOUA 1HNZB 2RHHA 3QTBA 5DHRA 4YRMA 5A4KA 4JEMA 3OOHA 3K15A 1B43A 4WNCA 1SVIA 1MVNA 4JLAA 2B8JA 4O29A 1QG0A 2C9DA 3V1TC 5MHTA 3AOEC 1UC5B 1ZOOA 4FE3A 1ADGA 3RAGA 2IEDA 3AONB 3HBFA 1M6WA 2OB1A 3P8ZA 5ITSA 5KKCA 2UYHA 1IOZA 2VQFB 2BGTA 3MEQA 4LGCA 5CXSA 4BLSA 2Q0HA 2C07A 3INRA 1UADA 3O74A 4C14A 1XRPA 5I4KA 4LOAA 1CEQA 4JS0A 1JBEA 3KNZA 1PFWA 2I6TA 1YS9A 1YUBA 5JSUA 1ESCA 3QPVA 1EFRA 1JWBB 3KXKA 3AUAA 4TKUA 4PO3X 3Q5EA 5LYYA 3QVVA 2VZ0A 4BZPA 3HDHA 4RS3A 4XOIA 1YJAA 1LDMA 4FFNA 2UZ0A 3EGOA 4KU4A 4LE0A 4GPTA 1OYWA 1H1TA 4FN4A 4XVHA 3TQIA 3ZN2A 2RGEA 3IPXA 1QIKA 4CIVA 3WB9A 1GSAA 1ZJ4A 2JFFA 3VO9A 3FLBA 4CIXA 2JF0A 3CLTD 3MPUA 2ZJ6A 1S89A 1Y5LA 4JSTA 3HY3A 4B4VA 2LP4Y 2WT8A 2XGGA 3L0IB 4J1TA 2OV2A 1DXHA 4PONA 4QC2A 5JY6A 1E98A 1NL3A 4O5OA 4R9VA 1C8KA 3TXYA 4QNRA 1J8VA 3U4QA 4A10A 1FYFA 1KI4A 2Q9CA 3L1KA 4HFMA 2ZR7A 1CIJA 1QRSA 1MHMB 2FY8A 4I9HA 1BS2A 1G1AA 3C45A 5ULLA 4TWZA 4ENTA 3EQ2A 1HYBA 1E0AA 1UMDA 4I9UA 1A76A 1E20A 1PJQA 2BJVA 1W85B 4UC0A 5BNWA 1H2RS 1YQWA 3D6MA 1SB9A 2XDQA 2ZANA 4B8ZA 1VG9B 4FEGA 2QMQA 1X92A 3CG4A 3E15A 3OLXA 1Z3CA 3TJZA 2W71A 3UQZA 2KBEA 3WHKA 3DNMA 4CT4B 3KYCA 3ASVA 4MYDA 1XVTA 5LNK1 2HA6A 2IUYA 1J22A 2WFMA 1S1CA 2PPLA 4DPMA 1MRSA 1B3BA 5CEFA 1L7PA 1VRVA 2VWPA 3F8TA 2ZIXA 4JLVA 5FBLB 1HDIA 1M54A 5I9MA 3VYTB 3INYA 2RBKA 4JJEA 3C3AA 1CR6A 4UMVA 4Z1MD 5CG2A 1EA5A 3KLOA 5DHSA 1XDWA 3NT4A 4OJKA 5EMHA 4FIDA 1ZITA 2R96A 3MMSA 3SKYA 2F3SA 2PX6A 2CFCA 4G1EB 3TD9A 2E49A 2J4FA 3W78A 3IDOA 2MSLA 3DV0A 3AR9A 3VHLB 4KJZA 5TEWA 2KSQA 3PT5A 3LQRA 1LLUA 1Y37A 3VR3D 2D7DA 4WEQA 5HUQA 1ZO8A 2BEWA 3AW9A 4HY3A 1N2OA 4CBVA 5JDCA 4PAWA 3D7LA 1VGQA 3NGLA 4JIMA 1E3IA 1O9HA 2BBWA 4MB2A 2EZ4A 2FGKA 4I4TB 3QNWA 1SIOA 1MEEA 4TV8A 4U7GA 3UWDA 2ZS7A 3OIDA 4CQLA 4WINA 2ENWA 3OZVA 2W2NA 4JMLA 2FZ5A 3S2IA 4A1FA 3UXEA 1DIRA 2WY2D 2ZRMA 1XROA 1T1RA 2ZRNA 2WFAA 2QXTA 2CJXA 3OIGA 4UM8B 1BQ4A 1M1YB 1MQAA 2AG5A 2GESA 5CGZA 3M2TA 5EIOA 1XRSB 3EG9A 4HXYA 1GDHA 4FOTA 2PR2A 3HN7A 1WUKS 4G4IA 2BFFB 1JLLB 4U7FA 1QQAA 3A6Z