3EC7A

Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
336
structure length
336
Chain Sequence
MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAEQKNGKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAIYETLIHEIDVMHWLLNEDYKTVKVYFPRQSSLVTTLRDPQLVVMETTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAVRKAAKYSTDILVDWKQRFIDAYDIEFQDFFDRLNAGLPPAGPTSWDGYLAAVTADACVKSQETGNTEIVELPSKPDFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dehydrogenase
publication title Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 103
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3ec7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ec7A01
4CLOB 3DMTC 2VZ8A 5EL0A 4YB8A 1ENZA 1I30A 5JO0A 3F3SA 3WGHA 1OC4A 1M75A 2DBZA 2V7PA 3PPIA 3RIHA 1P1KA 2NVUA 3PWSA 3PP8A 4JX8A 3LSYA 3UGKA 3K73O 2FZWA 1GQYA 1JQBA 1VJ1A 4CMJA 1U7TA 2Y68A 1TVEA 4BMVA 4CQMD 2VOEA 1PWZA 4WE3A 3D5TA 1B14A 4YT2A 1E1MA 2XAAA 5KKCA 2YZ7A 4JXKA 2R6JA 4MP8A 4RF4A 4E13A 5KTKA 1F17A 1NFFA 4Z9FA 3R3JA 4RPHA 5JYEA 4KWIA 1Y81A 3W8DA 1QXSA 3M1AA 4NJMA 3HE3A 4TROA 4NHEA 2NTJA 1QSGA 3L9XA 2XPCA 5KJ1A 3WOHA 5TJHA 4CMEA 5L40A 5AXCA 1U8XX 4GL4A 3ABIA 4YDRA 1LA2A 3TN7A 4L0QA 1GZ3A 1XA0A 3VPGA 4BVAA 3PLNA 3EAGA 4PG5A 4OMUA 2CVQA 2GZ3A 1CEQA 1SAYA 3F4LA 1DC3A 3D64A 2ZYGA 5KJEA 3DMTA 2ZATA 3NJ8A 2OORA 5IXYA 1H9AA 4U8GA 4BNKA 4TZTA 1E6EA 3EUWA 1RM4A 3FNEA 3ICPA 2RIRA 4P38A 3SVTA 3MJTA 3HUDA 1Z73A 4LMRA 3D7LA 3PFFA 4A10A 4BB6A 4NFSA 1SOWA 2GN4A 3A4VA 4U6QA 2B4TO 4DLBA 3PJDA 5BSGA 2FOIA 2E82A 1XKQA 2G76A 3IUSA 1I24A 4GVLA 2Q99A 2VZ9A 1BGVA 1GZ6A 3RFTA 1PR9A 3PQFA 1SPXA 4CLRB 5G4LA 4D0SA 5C37A 4OKNA 3WYEA 2I99A 1KS9A 3GEMA 2GNAA 1R16A 5A4DA 4IDGA 1PJBA 2IXBA 4MVJP 4E2ZA 2H6EA 4DYDA 1EVZA 1V3UA 2IE0A 1PGPA 3VDRA 1NPYA 3TFOA 3O4RA 4XDYA 3IL2A 4Q3NA 3T7CA 1U3TA 1WDLA 1RM5A 1I2CA 4MVJF 4U7WA 1E7YA 1MLDA 3AI1A 3F4BA 4QT0A 3DBHB 4UUOA 4HFMA 4IINA 4YBZA 3MJ4A 4I9NA 4G81A 3F47A 1LC0A 1B7GO 4GKBA 1LDEA 2CMDA 2Z95A 3ULKA 4CMKA 3WNQA 3KYBA 4RF2A 2ZTVA 3AY6A 3C7AA 2POQX 3TJRA 5KNLA 1I8TA 1WW8A 2J5QA 2DUUA 5JAZA 4GI2A 1DO8A 1E3JA 1M2WA 3I52A 3TZCA 1PL8A 1I33A 4PZDA 4GPD1 2JFFA 2Q2VA 4WNIA 3WBBA 2D3TA 4MDHA 1JW9B 4DPLA 3MJEA 4RPJA 3EY4A 3ZV4A 2CF5A 1UXIA 3AOEC 3VAZA 2I9PA 1OOEA 4W7HA 3WSVA 2IZZA 5IDWA 2W2LA 4BB5A 4F6CA 1KVUA 2C5AA 1G0OA 2P5YA 2VOJA 1A5ZA 2IZ1A 3LF1A 4U5QA 2VT3A 4CQLA 1MC4A 4ND3A 5I7EA 4K28A 1PGOA 4YYZA 1X13A 1QRRA 2ZJ1A 2O7QA 1NQOA 4FOSA 1XIVA 5DT9A 3ROPA 4BO9A 3IJPA 3BIOA 4AVYA 2UDPA 3WYCA 3ZZNA 2B5WA 4WLFA 4E31A 4R68A 4WCFC 5HM8A 2YQ4A 1ADGA 4K6FA 5I8ZA 4GMFA 4KTTE 3U5TA 3NGXA 1P33A 3CZMA 2GGSA 1O8CA 4MVJE 4YR9A 5DBIA 1OI7A 1ISJA 5JO9A 4BGUA 4CQMA 4MVJG 1VJTA 1UP6A 1TB4A 2YYYA 4A26A 3I83A 4XYBA 3H4VA 4INAA 3GEDA 1ORRA 4W9NC 5B4TA 1ENPA 5JSFA 3ZNQA 3X2FA 4BNJA 4JJFA 3DTYA 3JQEA 4NBVA 1ISGA 5CPFA 3ZW9A 3G79A 1VSVA 4RJTA 2OZPA 2VYVD 2WE8A 2DLDA 2NUAA 3TZKA 4EITA 1EFKA 2X0JA 4BO8A 3KB6A 3VTZA 2BD0A 1YS4A 1E7SA 3AOEA 1EDZA 2A4KA 4J1SA 2O3SA 4PLFA 4YRBA 4H15A 2HLPA 1FXSA 2HMVA 4PLPA 4FW8A 4E0BA 2JKVA 3PYLA 3EZLA 3WFIA 1XLTA 4J4BA 1LX6A 3BTSA 1KERA 2Y05A 4HUJA 4ZRNA 5AXAA 1A9YA 4IS3A 4OYRA 1E77A 4HY3A 4JNKA 3A14A 1ZSVA 3SC6A 2JD1A 3KTDA 4XGKA 5JLAA 2DVMA 3E5RA 4WCFA 4Q3DA 3D3WA 2X23A 4MVJD 4R51A 1GV0A 4BO3A 1Y8QB 2C20A 1KEVA 1WMAA 1XU9A 3RC1A 1ZZEA 3B1JA 3G0OA 3RC2A 3JQ8B 2YFHA 4PG7A 1PL7A 5IFLA 1Y8RA 2P91A 1BWSA 2FHSA 2ZB8A 1DC5A 1MFPA 2EG9A 4W9NA 4D46A 1LRLA 4EGFA 4WECA 1F12A 2VTDA 6ADHA 1VSUA 1ISFA 5IJZA 2EW8A 2PFGA 5JE8A 2GZ1A 1XQ6A 5G0TA 5CDYA 5IN5A 1EQUA 3MCVA 2NSDA 1UR5A 3EC7A 1RYDA 3JYLA 3NT2A 4OL9A 2X5OA 1YWGO 4B79A 4QSMA 1SEVA 3CZRA 4CLOA 1I3MA 3NDJA 1P45A 1WVGA 3NRCA 4LMPA 5F5NA 3OQ1A 3K92A 1XEAA 1FDSA 1WLYA 2WYVA 2X86A 2DPHA 3CE6A 4IGFA 1E1NA 1B16A 4MVJI 3VH3A 3D4OA 4PCVA 4D44A 2B35A 1DXYA 1NBOA 3KLPX 4LISA 5FF9A 3H65A 1MX3A 3WB9A 1DDOA 5L95A 2X58A 2QYTA 5I8WA 3OIDA 3GVPA 1A71A 2P9GA 1LSSA 3ITDA 4WK6A 5H82A 2VUTA 2HKIA 4G65A 4DBZA 1B8UA 1BSVA 2GN6A 4LN1A 4EEZA 2Y66A 1WAMA 2IDZA 2E48A 1XWFA 2C0CA 1G6KA 4DA9A 5A06A 1M76A 1LDNA 4RVUA 4XJTA 3S1LA 4OXNA 2D1YA 2FZEA 1JN0A 1Q0QA 4BMNA 3JQCA 3LC7O 3QE3A 5T64A 3BHMA 5U9CA 3BA1A 5HA5A 5DNAA 2FPGA 1P3DA 4B7UA 2DC1A 4LSMA 3Q11A 2O23A 4N7RA 4RVFA 1IULA 4RVDA 4A2CA 4DQXA 2IZ0A 3NJ4A 4NQZA 1RPNA 3JD0A 1ZK3A 1T2AA 1PZFA 1E3EA 2CZCA 4BNHA 4DREA 3D4PA 2GRAA 1EBUA 2G1UA 5M6DA 4IQGA 2EW2A 4FD3A 2O4CA 4NG5A 4L9RA 4UUPA 1VJ0A 1WDMA 4BOYA 4ND1A 2GCGA 1C0LA 4I08A 5LC1A 4GH5A 3QWIA 1UAYA 2O3QA 3PK0A 5TGDA 1R12A 1FDUA 4LVUA 2FR0A 4ROSA 4W99A 3ZU4A 3IS3A 4Q3EA 3E8XA 4KOAA 1DB3A 1ZUD1 2FPIA 3GR6A 4DGSA 5J23A 4CV2A 4CLRA 2E37A 4YQYA 4EJ6A 3GNQA 2EERA 4JQCA 4D42A 1SB9A 2VYVA 1Q0LA 3TF5A 5ER6A 3MJVA 4U6SA 2VTEA 4OO3A 4R3WA 1HF3A 1R4MB 3ORFA 2C7VA 2I65A 3VC7A 2P2SA 2F00A 3BTOA 5G0SA 4D7AA 4R3NA 1QYWA 2Y93A 3EHEA 1U4SA 1B3BA 3OMLA 4ZRMA 1RJWA 3FCOA 3WICA 4MJLA 3NTRA 5DDIP 3DBHA 1DOHA 3ROKA 1ZMTA 2PKQP 4PGFA 3QVSA 1A9ZA 3ZHZA 5C5IA 3PHGA 1TA4A 1N7HA 3NX4A 1B8PA 4CM8B 2LDBA 4IDDA 5GY7A 2V6FA 5G0UA 1FJHA 1AE1A 3C1OA 2Y1FA 4MVJA 5EQDA 4M89A 2D8AA 1QKIA 2X5JO 5JPIA 1M66A 4ZQEA 1JWBB 2GO1A 8LDHA 3BMCB 3INGA 4ALIA 1LLUA 1BVRA 3ZGYA 4XRGA 4WLEA 4AJ1A 3GK3A 4A5OA 3DZGA 3GT0A 3ZWPA 1E3IA 1T2FA 4I5GA 2D4AA 2E6UX 1CQIA 4RF3A 3ROQA 4JGBA 3A06A 4CMHA 2A94A 1SC6A 1PGNA 3Q6IA 2OHXA 1CWUA 4JP3A 3W6ZA 3OJFA 1N92A 2AQ8A 3IMFA 1IE3A 4CR8A 2ZB4A 1L1FA 4CUJA 3DO5A 4M1QA 4C7KA 1LNQA 2Y99A 2VT2A 3CINA 1EDOA 1NHWA 3V2GA 2DPGA 4LGVA 2I3AA 5EQFA 3ZU2A 5CP8A 1DRUA 1E7QA 1E1KA 1G0NA 3EGOA 3DOJA 1B2LA 1UUFA 3H8VA 3HFSA 4BO4A 2HU2A 1XU7A 1I3NA 3DDNA 5BSFA 2QZ9A 4QTZA 1ZSNA 3S2IA 4DWVA 2X9VA 4BNGA 1CYDA 3NT5A 4EYEA 3ICCA 1TI7A 3DAFA 2Q2QA 3AUSA 4NU6A 1P1FA 3PTZA 1MV8A 2B4QA 2H9IA 4FCCA 3CMCO 1O94A 3F1LA 2GZ2A 3R0IA 4NBTA 2OGUA 2O3UA 2P4QA 1W6UA 4Q39A 4YRDA 1TT7A 2F1KA 4JJGA 2WYUA 1R6DA 2Q1WA 3JD2A 3WIEA 5TX7A 4CODB 2GERA 2YV1A 2W4QA 1K89A 4DTIA 3WNVA 1FF9A 4AJ2A 1UXKA 3NV9A 2YDYA 5TJ9A 4F3YA 2YFQA 3GN1A 2RH4A 1LQTA 5JCJD 4KTVE 4OOEA 4XQCA 2AXQA 3BYZA 1VKNA 1BXZA 3JQ9C 4ID9A 1I01A 1FMCA 2VUSA 3HB5X 3ITKA 1YOVB 4EUHA 3GMSA 1J0XO 5JMPA 3W4JA 1WNTA 1Y8QA 1NYTA 4PG6A 5F5LA 5L45A 3JQ8A 3JQ6A 5H83A 3W8EA 1SNYA 3FN4A 4UVDA 1SZJG 1C0IA 1YVEI 4R69A 3ENKA 1K0UA 1BTOA 4B3HA 1T4BA 5GZ3A 2Y0EA 3CMMA 4R1NA 5L9AA 5TS3A 1P0FA 1QR6A 5BR7A 3A1NA 5T8KA 3RFVA 1E6WA 1Y9EA 3Q9UA 4MP6A 1P9LA 1PWXA 2FRDA 2X8LA 3FWNA 1D8AA 1B15A 1MGOA 2IODA 5FYDA 1CETA 3GUCA 3I9MA 3PHIA 1Z7BA 1TEHA 4ILKA 3QLJA 3ONDA 1EUZA 2EXXA 1KYQA 2Y0DA 1F0YA 5MGBA 2Q4EA 2O2YA 4XJSA 2TMGA 1BRMA 1CQJA 4IMPA 4BMSA 4RVHA 1ULUA 3H9EO 1VL0A 2ZYDA 3GHYA 3P7MA 5FI3A 4UAGA 4YTEA 4A73A 4PLYA 4Q3CA 3WDSA 1DFIA 1WXDA 2WE7A 5DCWA 3JQ9A 5HTOA 3SLGA 2X6TA 5FFFA 1F06A 4LK3A 1GTMA 2G17A 4P8RA 3VH2A 1HDYA 4Z0PA 2NVBA 3LC2O 2VCYA 4S3MA 4Y6SA 3BMQB 3H7AA 3STHA 3E5MA 2G5CA 1YB5A 2GLXA 2BFMA 2YDXA 3ADPA 4J7UA 4KP7A 3RBXA 3PIIA 3SBOA 2PGDA 1U5AA 1HSOA 3P19A 4E2XA 4AJLA 4M55A 4QECA 1C1XB 3K31A 4XZ3A 5CPBA 1Y5MA 5U4QA 1LI4A 4TZKA 2BHLA 3ONFA 1KEUA 1B26A 3DHEA 3QP9A 5JCXA 1E7WA 3A28A 1LSOA 4IDCA 4Q3BA 3COSA 4Z9XA 4N5MA 1E7RA 3RAJA 3HQ4O 1X7HA 3JQAB 5JY6A 4OSOA 3QY9A 4YWJA 4KUGA 1LEHA 1H6AA 1P77A 4BQPA 3KYCA 4CMIA 1U3UA 2NV6A 2TMDA 1LSJA 3P2YA 2B83A 1AHIA 1LDGA 1ONOA 1UAGA 3H3FA 4WPGA 4YJFB 2PWZA 3QVWA 5L53A 1M6WA 4BO6A 5T73A 2FWMX 3WWYA 1YXMA 4YA6A 2X5KO 3PQEA 1U3WA 1KETA 2DU8A 2RCYA 1BXKA 1MG5A 2B36A 1LTHR 3ZWCA 3WSWA 5IXSA 4BV8A 1Q7CA 1T1RA 2Z5LA 3TL2A 1TT5B 3CKYA 3GRPA 4ALMA 1NVTA 4FGSA 1L7DA 1R0KA 3VH4A 1T4DA 4FB5A 3E9QA 2QX7A 1PS8A 3V1YA 4Z6KA 1GV1A 2GD1O 1R4MA 4J16A 2PY6A 1BDMA 2FN7A 3QA9A 1J4AA 1ZK1A 3R6DA 1HYHA 1H2HA 5TIIA 3GGPA 1ZO8A 3I9OA 5KCZA 2PV7A 5JCJA 1V9LA 1UJMA 3ETGA 4O63O 4J49A 1N5DA 4WJZA 1OFGA 1X0XA 1DIAA 4TSKA 5DZSA 1CERA 2VRCD 4CM8A 3AI2A 4DC0A 5KJ6A 5JFOA 2DUWA 4PLCA 3JQGB 3FI9A 4NR0A 1LC3A 1WWKA 1HDZA 5T5QA 5IDYA 2X0RA 2SCUA 3BMCA 4GVXA 4WASA 3V2HA 3CXRA 1U8FO 4TKLA 4AJNA 2J6IA 1HKUA 4HFNA 1DJNA 4RDHA 4BNVA 5IDQA 4AJPA 1A27A 1ZH8A 1V35A 4Z0HO 5TQVA 4XGIA 1PGQA 1W4ZA 3LK7A 3QSGA 3S55A 1GCOA 1PJLA 3EDMA 4YCAA 4OIMA 1SB8A 1X1EA 4N5LA 2FR1A 1UDBA 4ZD6A 4L76A 3HDQA 5JC8A 1LLDA 4PLGA 4GGOA 1ID1A 3MEQA 2BGKA 1Y9AA 3IQDB 3I9LA 4F46A 2ZQZA 2OFPA 4JBHA 3GFBA 5L4SA 4O0LA 4IDAA 1JKIA 5FI5A 2OP1A 4BNLA 5L4LA 4D43A 3JQAD 5CFZA 1I5RA 5EESA 2WM3A 3U0BA 3RFXA 2CY0A 3JQ7B 3WIDA 4JROA 3BTVA 3KBOA 1CF2O 2JHFA 3AFNA 2HMWA 4D79A 3P5SA 5JDIC 5IG2A 1HLDA 4ZICA 3S2FA 2WD8A 5K6AC 3GDGA 2GASA 1KVQA 4WEQA 4CJXA 3SXPA 4CM5A 3WLFA 1FDVA 4EDFA 4RVGA 3DOOA 1XHLA 4MKXA 4FFMA 4DXHA 1YGYA 1EQ2A 5JXWA 3RASA 3HFGA 1YL7A 3ZWBA 1GFSA 5AVOA 4RZIA 2X1HA 3B1FA 1HTBA 4WGGA 5DP1A 3MTJA 4YAGA 5JY1A 5FWNA 2IYOA 3LF2A 3TDKA 2WWRA 3HDJA 3HNPA 1V8BA 4RORA 2CNBA 2B5VA 1MB4A 3X2EA 4XKJA 5A02A 4DC1A 4DQVA 5F1OA 4BNTA 1VC2A 1U5CA 2B37A 1H0KA 4NNJA 3I4FA 1K3TA 4KQWA 1O9BA 1YOVA 3IOYA 4YEDA 5KWEA 2C82A 2XXBA 3WMXA 1JDJA 5L3ZA 3C8MA 2Y0CA 4E5KA 1E6UA 2D2IA 5GMOA 4EJ0A 1GADO 1PZHA 3U4HA 5JDIA 4ND5A 3SLKA 1IZ9A 3W8FA 5K6AA 3GZ4A 1R0SA 2HSDA 2RHCA 5U1PA 4HX5A 4MINA 4YAJA 5A3JA 3RVDA 5G4KB 4NBWA 1OAAA 1PJTA 3PHLA 5EN4A 4UVGA 3F46A 2VHWA 1NR1A 1GY8A 3RC7A 4Q9NA 4P4NA 4ALJA 2W8ZA 4W7IA 3QVTA 1GYPA 3ZCXA 3LT4A 4KZPA 5COBA 3NDIA 1B8VA 4GLLA 5TLSA 1ARZA 3UN1A 3W4KA 2O3RA 3ZNNA 3CSDA 1B0AA 4E21A 4UUMA 1ISIA 2CDCA 1PQWA 3MOGA 4N18A 3GRKA 5JDCC 5IZCC 2OO5A 3OBBA 3TZQA 4CM1A 4FOOA 1U28A 4B4OA 2DFVA 4MP3A 2NLOA 4TVBA 1B3RA 4CV0A 3MOIA 3AUTA 2YW9A 1VLLA 2GDZA 3BTUA 2VRCA 3S2GA 1J5PA 3DHYA 5KKAA 3K9QO 4ALLA 4EUFA 4EJMA 4HV4A 1DAOA 1Y5RA 2BGMA 4RPLA 1WMBA 3PEFA 5COAA 3WGQA 2JL1A 3BMQA 3OIGA 4OKIA 5THKA 5ICSA 1GL3A 5IZ4A 4ZA2A 3IC5A 4GWKA 3FTPA 2WYWA 3ANLA 4NZ9A 5A9SB 3T7EA 1PIWA 1UXHA 2YHIB 5C7LO 4E12A 2WEKA 2Q46A 3EZYA 1Q7BA 1ZBQA 1C1XA 1U3VA 3D5QA 1LQUA 3Q2IA 2HRBA 1GZ4A 3DTTA 3TWOA 3PQDA 1JAXA 4WLVA 4DVJA 2UUPA 1HDRA 2NQTA 3QWHA 4PZCA 2RBEA 4H7PA 2WDZA 1CIVA 1RM0A 3D3EA 4Y8VA 3RUCA 3BHJA 1L7EA 1R4NA 3F6YA 1LRKA 3RCBA 1VL8A 1VPDA 3JQAA 1E1LA 2PKRA 3ON5A 2EKLA 3TQHA 5I7FA 1VE9A 5BSEA 3IP1A 1P1JA 4UEKA 1LBEA 2BKAA 1PSDA 5IZCA 5JDCA 3DONA 1ZKMA 2AEFA 1ML3A 1PJ3A 3IKVA 1UP7A 3PLRA 1AGNA 4YJFA 4BO0A 3DR3A 1D1TA 3AUUA 3GPDG 3C7DB 3DZFA 3OJEA 4BS9A 3IJRA 4BNUA 2Y1OA 4YAEA 3WGYA 4X54A 2DBVO 3DXFA 5GZ6A 4JCOA 4J4TA 1K6IA 2W98A 3QW2A 1WZEA 1TT5A 1HE5A 1QYDA 3VDQA 1ZJZA 3B70A 2NTNA 2DAPA 4IBOA 3RUDA 1JU9A 3ZHXA 2EF1A 1VRWA 1T1SA 3ASUA 1HYEA 2NWQA 2PD4A 4TKMA 3K30A 4UVEA 3KETA 1H6CA 4FFLA 3PFWO 5DOVA 3O8QB 2Q45A 3PJGA 3QQPA 4PIVA 3RU9A 2E49A 3FNHA 3INTA 1U4OA 5BQFA 3AM5A 2ZYAA 4L74A 2IYPA 3H5NA 4HFJA 1VKOA 1PGJA 4C7JA 3UCXA 3F9IA 1KBZA 4RVSA 2Z1MA 1U1IA 4XYGA 4JBIA 2I6TA 4E33A 1O89A 4CM4B 3HB4X 3ONEA 1PEDA 4BGIA 3FF4A 4CM6A 1U2DA 2AE2A 2PZLA 3JQGA 2CD9A 4DIFA 4YT4A 1EE2A 1YBMA 3OEYA 3D4NA 1MUUA 2D5CA 4BQRA 2EHDA 1Z74A 2Q22A 4G2NA 4O6VA 4CLDA 4CMCA 1K6JA 2Y1DA 4UUNA 4CMBA 4IXTA 4LRSB 2X7HA 3NUGA 4HP8A 2OMEA 2D0IA 4IIUA 4J2OA 1DIBA 1LXCA 1HDXA 3FRJA 2HK9A 3KOUA 1HXHA 2HRZA 3W6UA 1YKFA 2FP4A 4QFCA 1N7GA 3RBZA 5BT9A 4IXWA 3QRWA 2EV9A 1V0JA 2FMUA 4NBUA 4B4UA 4WLOA 3L4SO 4CR7A 1E5QA 2CDBA 3TPCA 1T24A 5LCXA 2OOSA 5HS4A 3H3JA 3JQ7A 4FJ0A 1JVBA 4QXMA 1E3SA 3K6JA 3OQBA 4R4JA 5CEFA 1GYQA 3NAQA 3VPSA 1XSEA 2HJRA 1KVSA 4BNMA 3PGXA 4WOJA 1I2ZA 5F1PA 3PDUA 3OQ6A 4J0EA 4WEOA 1PJSA 2B0JA 4Z3DA 4NK5A 4WLUA 3RUAA 1TXGA 2E4AA 5EPOA 1BXGB 2PGJA 3GDFA 4HKTA 5BNTA 4I5EA 1PU2A 4U0KA 4L4SA 4RPKA 4E5PA 4I8XA 1UXGA 3RBVA 1A72A 3GUYA 9LDBA 5A9TA 4IDFA 2GUGA 3DHNA 3DZJA 5JYDA 1PS9A 4Y9DA 1JKJA 1ZK0A 3RUEA 2C54A 4N54A 4DMLA 3N74A 4FJ1A 5EINA 1KY4A 2VHYA 1PTJA 4A03A 2HQ1A 1EVIA 1M6HA 3L0DA 3IAHA 4YQZA 2AW5A 3KYDB 1D4FA 1NAHA 5LDGA 4BO2A 3ZDFA 1FDTA 2JAHA 3M2TA 3BXXA 3DFUA 3WWZA 4D3FA 4IGEA 3R3SA 4M8SA 1I32A 4PLTA 1X14A 4GSKA 4TRNA 2AG8A 1N1EA 1Z6ZA 1DHRA 2NU8A 4AFNA 4AJHA 5HBRA 1EFLA 3PJEA 4XWYA 4J6FA 4K26A 4RZHA 2PK3A 2JJYA 3PHJA 1A4UA 2NNLD 2GSDA 1YQGA 1ZXBA 3INRA 3ZWNA 3BHIA 1T2CA 1DHTA 4AICA 4S1VA 3OFSA 4XQ9A 2C2XA 3WBFA 4L4XA 4JP2A 1GPJA 4FSHA 4HFRA 1UH5A 2IEDA 3JYQA 3DZIA 5DN9A 1ZK2A 3CIFA 4XB1A 5G4KA 4BNFA 2BRUA 3HHPA 5J9GA 1MA0A 5IAAA 2VHZA 3GEGA 2UUOA 2VWGA 4DQUA 5I7SA 2CUKA 5CHEA 2O7SA 3JQBC 2Q50A 4DLAA 1EUCA 3H9UA 1ENYA 2HK8A 3ZW8A 3EK2A 3AU9A 1DIRA 2H5LA 3FPCA 4BNWA 3JD3A 1YL5A 1GD1O 1CDOA 4BGEA 3PI7A 4D0RA 5AXBA 1YL6A 1BVUA 5AYVA 2QG4A 4XX0A 2HMUA 4J3FA 5JMWA 2NU6A 1Y1PA 2O3JA 1GEEA 5I9NA 4GSLA 1QYXA 3WTCA 2BI8A 1ZW1A 4IQ8A 2DM6A 1LJ8A 1ADBA 3PZRA 4J0FA 1ISMA 4URFA 1O0SA 3ZWMA 5A9SA 1XELA 3HSKA 2VWPA 2X0IA 2BF7A 3DL2A 4IZHA 1I10A 2YHIA 4ZU3A 3EVNA 1OMOA 3DC2A 5K0ZA 3ZH2A 2G0TA 3DOCA 1YRLA 1DFHA 3LT2A 4M87A 2IXAA 2QHXA 2AG5A 1Q0HA 2VWQA 3AFMA 3E6AA 1F8GA 3GA0A 3FHLA 1NP3A 5A05A 3VZSA 2QIOA 1HDGO 4AJ4A 2EP5A 2JFHA 4FIZA 2J5RA 3RJ9A 2DFDA 1UZMA 1UDAA 2FSSA 2EP7A 5GZ1A 3JQBA 2BH9A 4H3VA 1QV6A 3VPHA 1ONNA 1KIFA 3AI3A 1I3LA 3UW3A 1PJQA 1UDCA 1OBFO 4NIMA 5L7WA 1I36A 4Q3AA 3LLSA 4XQGA 3E1KA 3TNLA 2V6GA 2UVDA 3C3XA 1YONA 1EK5A 4FDAA 4Z9YA 4IJUA 1Q7GA 4GX0A 4D45A 2ZTLA 3JQFC 5H81A 3GNTA 4E6PA 5CEJA 4IQ0A 3GG9A 3QIVA 4EUEA 3WGTA 4TRRA 4YAKA 3JQDA 4BV9A 4PRLA 3HZZA 4XD2A 5AXDA 3ZNPA 1WP4A 3GAFA 3T4XA 3DAPA 1HYGA 3U4CA 1YB1A 4IJVA 4IPTA 4OQZA 4CR6A 5ITVA 3WLEA 1DPGA 4ONEA 4KQXA 1Z7EA 1SOVA 3NTOA 1D1SA 1S6YA 3VVCA 3O8QA 3I3OA 1YB4A 5I9LA 3VOSA 2FY8A 5EIOA 1UZNA 3F1KA 2NQ8A 3W4IA 4ZQHA 2CF6A 3F5SA 2A9FA 2GYYA 1O95A 2RH8A 3VPFA 3LU1A 3DBLB 5K9ZA 3Q9NA 4CM4A 4NDNE 2G82A 9LDTA 3MJCA 3U4IA 4Y98A 1LDBA 3E03A 1AXGA 1KY5A 3O03A 5G0VA 1NQ5A 4AJIA 2NM0A 5G0WA 3WFJA 1DC4A 1I2BA 2DTEA 3R1IA 2PD6A 2O4UX 2BFPA 3JQFA 3ZHBA 1Z75A 2A35A 4W4TA 3DEYX 3WS7A 2R2GA 4LCEA 5TT1A 2DT5A 3TL3A 1UZLA 2I67A 2BFAA 4I5FA 1JLLA 3VZQA 1V6AA 1XDWA 1YE3A 4CM3A 4ITUA 3IP3A 3BMNB 4BKUA 2C7GA 3E48A 3MTGA 4HXYA 1CJCA 1ISHA 4FQ8A 4CM9D 5KJFA 1LLCA 1ZIDA 1J6UA 5A5FA 3QHAA 4UVHA 4YJHB 3TZ6A 1ZVMA 3LLVA 3NKLA 4OXYA 3UXYA 4DIBA 5A3VA 2EWMA 4C4OA 1GUFA 2VRBA 5JYAA 3BZUA 3CEAA 4PZEA 3SX2A 5TNXA 1O5IA 3DBRB 4ZVVA 4OJNA 3KVOA 1LUAA 3GFGA 4IS2A 4PLVA 5TSDA 1ZSYA 3DFZA 4TRMA 3ENNA 1YJ8A 2PGLA 3A9WA 4J7CA 2GPTA 4BNIA 4OAQA 2QQ5A 2ZKLA 3C24A 2PZMA 1FDWA 3ZU5A 1C3VA 5DF1A 4P22A 3L77A 1DIGA 5L51A 4U0JA 1P0CA 3O9ZA 1NM5A 5B4UA 1IHXA 1BXGA 3EVTA 4JBGA 2PNFA 1HRDA 1HZJA 1DLJA 4QX6A 1A7KA 1TLTA 2DTXA 3G17A 2WMDA 1EE9A 2LDXA 3Q2KA 3WXBA 4M86A 5T67A 1HLPA 1KC1A 2Q3EA 3IDSA 4OGWA 2JD2A 1DLIA 1QG6A 1GDHA 5A1TA 5KVVA 2FPPA 4FBGA 1ONPA 3OETA 4J9UE 4B4WA 1CRWG 1NX6A 2D59A 1LDYA 1ZFNA 4J91A 3AOGA 3K8ZA 2AEMA 4RLSA 5CAEA 1DEHA 1NASA 1C1DB 4UVIA 2JCYA 4BGVA 5F21A 4J1QA 1VL6A 1AN9A 4HADA 1NFRA 3KYDA 3GVIA 3G1UA 3ZNOA 4PN3A 2UYYA 5DULA 5ILOA 4LW8A 4OOFA 1A7AA 4D3SA 1ADFA 3DB2A 1I0ZA 1A4IA 4P4GA 4E4YA 4JN6B 3L6DA 3UUWA 1E3WB 1BDBA 3QV1A 4XDZA 1JKFA 2HO5A 4QO7A 3N7UA 3D0OA 4F45A 1H2BA 2QYSA 5B37A 2Y1EA 4B7XA 4FC7A 5F3RA 3GH3A 4EI2A 3RWBA 4F6LA 1U7HA 4FS3A 4XIYA 3OJLA 2PA3A 4RV9A 2DBQA 4YJGB 2HDHA 4B4VA 3JCZA 5ILGA 2JAPA 2Q1TA 3I6IA 3PJFA 2Y1CA 3UOGA 1KEPA 4LVCA 3I1JA 4KDFA 3GGGA 4R1TA 3PXXA 4PRKA 1EEHA 4LSWA 2QZZA 1ZCJA 2ZTUA 4II2A 5KJCA 3SJUA 4MVJH 2HAEA 3F5QA 3LDHA 1H5QA 4GX5A 2QW8A 3K5PA 1P1RA 4L8VA 2YHUA 5IDXA 3RKUA 3NTQA 4B7CA 1X15A 3D1LA 2UAGA 5CDGA 3KEQA 2P5UA 4E32A 3FSRA 1AXEA 1K2WA 4QEDA 1P44A 3KRTA 3ZWXA 4CUKA 4A7PA 5ES3A 4YACA 3OICA 4NI5A 5JC1A 3PRJA 4YAIA 5ICMA 4EBFA 3ZWWA 4GAEA 3KZVA 3U3XA 4R1UA 3N58A 3OJOA 3VPXA 1ZEMA 1P1IA 2J3KA 4R01A 1MP0A 1BW9B 4AJJA 4CPDA 1EZ4A 5AQ1A 4NH4A 1H6DA 1EK6A 1GQ2A 1KOLA 4AL4A 1RWBA 2VNAA 3H5AA 5EJ2A 3WGIA 2V6MA 1P1HA 3ZU3A 3K96A 2OP0A 4YT5A 5KVSA 1EVJA 3FBGA 4Z3KA 4IDBA 2EKPA 2QRJA 2YV2A 3VHRA 1RM3A 5JAQA 2AQKA 2ZCUA 1XQ1A 3UVEA 1LSUA 1QORA 2NTVA 3CH6A 4CM9A 4RO0A 4DPMA 4P4LA 4J1NA 4NU5A 3OEWA 3FNFA 3ANMA 1DAPA 3JYOA 5A03A 2XF8A 2WSBA 4FR5A 1IL0A 1MXFA 4XEHA 3TRIA 2Q49A 4OHUA 3HDYA 3GPIA 3KO8A 3TSCA 4YT8A 2PH5A 1DC6A 3PWKA 2ZK7A 5L7TA 4OQYA 3KUXA 1IPEA 3FD8A 1MG0A 3OSUA 4YJDA 5HWSA 5THQA 1YBVA 1YDEA 1YDWA 1PZEA 2OBYA 2W2KB 2DTDA 1P31A 1VI2A 2UV8A 3U62A 4DBVO 2JCXA 1O6ZA 3ADOA 2Y67A 1H94A 2BGLA 5FEUA 5TC4A 2I3GA 5B4VA 3T4EA 4IUYA 4BKOA 2Q1SA 4NBRA 4L4RA 4E5NA 3OA2A 3H2SA 4I9UA 1N9GB 2VZ0A 3E82A 4BNZA 4E5MA 2C2YA 3DMYA 3VZPA 4FGWA 4J4HA 3U9LA 3PDJA 1NQAO 1F8FA 2VUUA 3HDHA 4R5MA 3JYNA 4BO5A 3B1KA 1HE2A 3DZBA 3MZ0A 4BHTA 1H9BA 5ADHA 1NPDA 3GC6A 4GQAA 3ASVA 4GGPA 3PZBA 4FN4A 4R54A 1DRVA 7ADHA 1T2DA 1LRJA 3ROMA 4Z0TA 3RUHA 1JWAB 5B12A 3DBLA 4GLOA 1XR3A 4W82A 5LDHA 1H6BA 3V8BA 2ET6A 3IKTA 5JW6A 4ZN6A 4M49A 4HWKA 2WD7B 3GVCA 3I5MA 5TT0A 5C3MA 1P74A 3I23A 3GY0A 4ND4A 3RU7A 1X0VA 2Y1GA 4NFHA 4R41A 4RL6A 1PX0A 5C7IO 3HG7A 4R5HA 1NWHA 3LVFO 5IF3A 3B20A 2I66A 3RJ5A 1DFGA 3EMKA 3QVOA 3KSUA 4YRAA 3L9WA 1YQDA 4JLWA 4FC6A 3ZN2A 4A27A 4FJ2A 5ENVA 3BMNA 5CG1A 1DSSG 4FFNA 2BELA 3QWBA 4FFRA 2VNSA 3GLQA 2BMAA 4YJHA 3AW9A 1NNUA 5TRTA 1AUPA 3KEOA 3UAGA 3RSHA 3U49A 3Q0EA 4KUEA 4GMGA 1BMDA 1QMGA 1QP8A 2O3TA 4DYVA 3M2PA 4TWRA 5B1YA 5I7VA 4CLXA 3DBRA 1E7MA 3U4DA 2QRLA 3GQVA 3AK4A 3FPLA 4WCDA 4E3ZA 4NPCA 3WG9A 3UF0A 3NT4A 2AMFA 3JYPA 4PLHA 2GN8A 2NVWA 3WR5A 3BMOB 3JD4A 1GPDG 5L7YA 4Y6RA 3LT0A 1H93A 4GX2A 2X9GA 3BAZA 1YH3A 3HJAA 1DRWA 2JFGA 4IMRA 4MVJM 1PQPA 2PKQO 1NQTA 3RKRA 2I76A 1HDOA 2YUTA 1RKXA 4K1LA 3RROA 1IZ0A 4AJEA 1IUKA 1PJCA 2HMTA 4J2HA 4MIYA 1KEWA 3DAGA 4AJOA 4GX1A 3QWFA 4IDEA 4OXKA 4B8WA 2V6BA 1E92A 3TOXA 1LDMA 3FBTA 3G3EA 4NJOA 3GZNB 2QRKA 4BNYA 2C5EA 4CV1A 1AHHA 1C0PA 5F1KA 5G2OA 4ESOA 1C1DA 4R16A 4R9SA 2XOXA 3LYLA 2Q2WA 4DLLA 3CPSA 1T25A 2VWHA 4MO2A 3AU8A 3ZWAA 4XR9A 4PVCA 4EZBA 4BKQA 3C1TA 3GVHA 1NVGA 3O38A 1JTVA 1SO8A 4CMGA 3H9GA 1RYEA 3TZHA 1EMDA 1ZXLA 2Z1NA 3GMDA 4ZJUA 2X0NA 1E3WA 5DCYA 4CL8A 4M54A 2EEZA 2YV3A 1X7GA 2OBNA 2NADA 5I9MA 3C7CB 3L07A 2HJSA 3GVXA 3NGLA 4JIGA 2YY7A 2VHXA 4XGNA 1YJQA 3DZKA 3UKOA 4J90A 1NHGA 3G49A 3OF2A 4YJGA 1KC3A 3WJ7A 2ZJ0A 4JJIA 2J3JA 2DBRA 2P4HX 4QO8A 5JAMA 3AM3A 5ER9A 5A5EA 3WGOA 3PIDA 3UICA 3KLMX 4WOKA 3PYXA 4UEJA 2IRWA 4CMAA 3WQSB 1OC2A 3NEPX 3UFXA 3Q3CA 4RQTA 1G1AA 1V3VA 4RDIA 2A92A 5KVCA 1HE4A 4ZHSA 2GN9A 3OM9A 3V1UA 2C29D 1W8DA 5ENDA 8ADHA 2J3HA 2J5KA 3DWFA 1Q2XA 4FFOA 5JS6A 2P68A 1R37A 2NU7A 2HCTA 3KXDA 5CEEA 3I9NA 5BNIA 1W73A 3VZRA 3V5NA 4KUHA 3UHAA 1IY8A 7MDHA 2ZIZA 4KDEA 4MOWA 5L4NA 3FNGA 1HETA 4NMHA 2AQIA 3TOZA 1NXQA 1D7OA 4A0SA 2B69A 1GEGA 2H63A 1BW9A 4MPDA 1HE3A 1X7DA 1PJ2A 5T57A 5HRUA 4WUVA 4XCVA 4E5YA 4B3IA 4G5HA 3KYCB 1QV7A 4CMIB 3LT1A 4TVOA 4PLWA 4OM8A 3ZWOA 1PJ4A 3H5RA 1EUDA 3I9JA 3C85A 3L6EA 3WYBA 3L4BC 1DIHA 2NU9A 5KIAA 1SEPA 2J8ZA 2PZJA 3RD5A 3UCFA 3KSDO 3PWZA 2X4GA 1XCBA 1Y6JA 4ALKA 1ADCA 3M1LA 4R9RA 4MIOA 1ZK4A 2ZB3A 4XRRA 1LU9A 4IY1A 1QYVA 2BI7A 2BLLA 4IJWA 2YQ5A 3WMWA 4H16A 4BUCA 3GG2A 1D3AA 1GR0A 1PR3A 1R0LA 3DQPA 5COQA 2W2KA 4Y67A 3VVBA 2VHVA 1NTOA 5TF4A 1HZZA 2NVUB 3I6QA 3RC9A 1JA9A 2NACA 4YVFA 3LZ6A 3V1TC 1EBFA 3QJ5A 2PR2A 3MWEB 4UEOA 4UREA 2C07A 4IJKA 4RF5A 1NPTO 2PLAA 2YJZA 4XIJA 2OUIA 3G1TA 4GKVA 1GU7A 4CL3A 4ND2A 1QYCA 3VKUA 3K2BA 1N9GA 5CDUA 3WJAA 3UH1A 5KOIA 1HWYA 4BKPA 1T26A 5A9RA 1N1GA 1IPFA 4L73A 4I5DA 1R15A 3EW7A 3VTFA 1MC5A 3L4BA 1JAYA 4NJMB 4KWHA 2I5PO 4JK3A 2ZQYA 2EJVA 3E18A 1ZMOA 3KSZO 4R1SA 4WLNA 2V65A 4B8ZA 2HUNA 5JNLA 2P9EA 4QUKA 5BNFA 1GUZA 2RAFA 2EGGA 3CUKA 4AJKA 4CLHA 4XYMA 1Z45A 1IHYA 4E2WA 5DCUA 4PLZA 5MDHA 1N8KA 1K6XA 4J1TA 2J3IA 1FK8A 4WKGA 6LDHA 2CSUA 1Y7TA 1PZGA 4MKZA 2WD7A 4XA8A 3L6OO 3DZHA 4D41A 3SJ7A 1R66A 1S7CA 4KMSA 3RI3A 3I9KA 1UP4A 1YO6A 3OP4A 4GBJA 4GWGA 3S8MA 3JTMA 1IOLA 3OH8A 3GAZA 3DBVO 2IEBA 3PVZA 3JV7A 4II3A 3KHUA 1MFZA 3AWDA 1NR7A 1ULSA 2CVOA 4O1MA 3M6IA 4K9DA 1QLJA 2ILTA 4I9HA 4XYEA 1MXHA 2JCVA 5CG2A 1XGKA 3H9JA 5IN4A 4XYLA 4CLEA 3HN2A 2PZKA 4MIEA 3U09A 4HBGA 1PL6A 4FPXA 2WTBA 1V3TA 5KVQA 2VYND 2FR8A 3TFQA 1QLHA 4NK4A 5T8KC 3WGGA 3CTMA 3VH1A 4YPOA 5DBFA 1JVSA 2PD3A 4RQUA 4FFPA 1GAEO 3WGZA 1NFQA 3W1VA 3OHSX 1ZJYA 2ZTMA 4BO7A 3BMOA 4UULA 2B4RO 5JAIA 3AJRA 1DJQA 2EIHA 1T2EA 2C59A 4XR4A 4ZQFA 1U9JA 5EERA 1C14A 3WX0A 4DMMA 3AY7A 5JYFA 1HEUA 3HWRA 3FTNA 4TQGA 5EMHA 2EGHA 4XB2A 1IB6A 2P9CA 4EEXA 2AEJA 4TMFA 3EYWA 5T6BA 3ST7A 1U2GA 4CUZA 3H9QA 3ZI0A 4IIVA 2JHGA 2BFOA 3HADA 5CDTA 4QFDA 4IM7A 2AHRA 2OL4A 3C1AA 3QWAA 3KV3O 1BG6A 4RLHA 4K6CA 3GZNA 1GCUA 2JD0A 4N5NA 5AOVA 3AM4A 3ZWVA 2PTGA 2O48X 2R00C 2CVZA 3K2EA 3B6ZA 3PGJA 4I1IA 3HN7A 4XQEA 1DBVO 1ENOA 4AG3A 2EKQA 3UCEA 1NWCA 4TRJA 2EJWA 3LQFA 3JD1A 1M67A 2Q4BA 4HNHA 3NYWA 3V2UA 1NVMB 3JSAA 1Z82A 3AUAA 3P2OA 3GN2A 5A04A 1XYGA 4LRTB 4HNGA 5C7OO 4CQLB 3PYMA 3OIFA 3GF4A 2AE1A 2VQ3A 1E5LA 3GDOA 3NDRA 1K5HA 1NAIA 4J7XA 1HT0A 1GYRA 3ETDA 4BNXA 1YBAA 4E2YA 1KVRA 1SCUA 4NFYA 4E30A 2W90A 5HS6A 3GGOA 1UXJA 1WDKA 3FWZA 1PQUA 1I3KA 3I4CA 1ZEJA 4J43A 2X9NA 3O26A 4L75A 4MKRA 4W6ZA 2O2SA 3OJ0A 4CQMB 2CDAA 4BL5A 4B3JA 1F14A 4QQRA 1C0KA 2AQHA 1Q1NA 2X22A 4DPKA 1SBYA 1N2SA 1HL3A 4D3DA 4DUPA 4O59O 2DKNA 1GQQA 4WNCA 2D5AA 3OA0A 3ZWYA 3GHHA 1VM6A 3SC4A 3RUIA 3ANNA 1SMKA 2WJPA 5JBIA 2H1SA 1KVTA 4LCJA 4PFJA 3Q1LA 4EW6A 3KM0A 3RUFA 2FSVA 4OH1A 4YXFA 2R00A 3IIEA 1X1TA 4J9VA 4DL9A 4BO1A 1WZIA 3SEFA 2RHRA 3E9MA 3AY3A 3E9NA 2HK7A 3H2ZA 3WQQA 3H6KA 2GR9A 4DRYA 2ZB7A 4IZIA 4CV3A 5CDSA 1E3LA 3MWDB 1HDCA 4ZGWA 4BIIA 2GF2A 3QVXA 3ETEA 3WTBA 3S2EA 1R4NB 2HMSA 4PG8A 5ITWA 1WPQA 3ZV3A 3ZV5A 4Y6PA 4ALNA 1IYZA 1HSZA 2AA3A 2DQ4A 3PHHA 4WCFB 3D3WB 2OXIA 3OECA 1OZAA 4ZQGA 4BKRA 1XG5A 4DIOA 5DOZA 2O50A 3WQRA 3FR8A 1BHSA 2XXJA 1YQXA 4O5OA 4RCVA 3ZV6A 1ZNQO 1LLQA 3MJSA 2PH3A 1W0CA 1GUYA 1Y8RB 3VKVA 4RPGA 1E0DA 4CMEC 2VYNA 4OSPA 2VN8A 3LC1O 2CFCA 2ZCVA 3GOHA 5DBGA 4ZQBA 5DP2A 4CM7A 4RGBA 1EVYA 3IUPA 2W2LD 4PVDA 3FR7A 4BNNA 1PS0A 3GNSA 1J49A 3RQSA 3ZHYA 2Q1UA 4PG4A 5BSHA
chains in the Genus database with same CATH superfamily
3T9CA 4CLOB 4DARA 2NXWA 5EL0A 3BGDA 1I30A 4YAOA 5KYUA 2WI8A 1J21A 4MUIA 1PUIA 3DLHA 2FLVA 3MB5A 4N4AA 4HB2A 2V7PA 4N7JA 1C3LA 3FTFA 4NXMB 1P1KA 2NVUA 2VNJA 1SD5A 3PITA 1MX5A 4YRJA 3VV2A 3SQXA 1QRAA 3LSYA 2O8NA 3UGKA 1JSLA 3WK9A 2P9QA 1NI4B 4RHTA 2FZWA 4YAFA 2MR5A 3SJCA 4EZIA 4N8EA 4YUWA 2H1RA 3ELUA 3KJGA 4CMJA 2QBYA 2L2QA 1L5NA 2B3DA 4WBNF 3AVYA 4YJKA 4IXNA 4BMVA 5A62A 4LWPA 4HAUA 2G4LA 3CISA 4UPVA 4K40A 3KAKA 2R6JA 4XPIA 1DKLA 4E13A 3FOCA 5KSWB 2V55B 3D8RA 2PBLA 3R3JA 3DXXA 4QNMA 1SC4A 3M1AA 3PDCA 2Q27A 1Z5ZA 2BHRA 4MK4A 1RAEA 3HJCA 4NHEA 4TROA 1HT3A 2OZKA 4OP3A 3WRVA 1QH1B 2X0KA 3GARA 3MD0A 4L1KA 1N6LA 1OY1A 1IU9A 1QHHA 3L9XA 2XPCA 5KJ1A 1OBOA 4OB8A 1JBKA 1GG9A 1U8XX 1UBOS 3D54D 4FYJA 3A32A 5JMTA 1N2CB 5BP7A 4YDRA 1LA2A 3TN7A 3ND7A 4MUMA 5CIWA 2FP4B 4IEEA 1DQNA 1E5VA 1FX0B 1UMDB 1F0NA 1XNGA 4QVGA 4R7GA 3ROXA 3VPGA 4RD1A 5KHOC 4PG5A 4PO1A 3FYTA 2CVQA 3UAWA 2XTZA 3CN9A 1CEQA 5AFSA 3REQB 3LH5A 3O4GA 3ESRA 1E9RA 1DC3A 1POXA 1VRCA 1EI9A 1NSTA 1US8B 3ISTA 4TL7A 1TF5A 3EXAA 2HLNA 4OVKA 3CCCA 4TZTA 4DRXB 4ZOAA 2FLWA 4OU4A 2A86A 2Y1KA 1YR9A 4OFWA 4P38A 4Y18A 3RYHA 3U4MA 4KR9A 1TW3A 3D7LA 4LF6B 4G09A 1QIGA 1CUZA 4PSCA 3L7OA 1RRMA 5J63A 3L7YA 1SOWA 4DLBA 4U6QA 2B4TO 3PJDA 4EGAA 2QN8A 3CR7A 4F8JA 2W00A 3VVLA 1ZUNA 2A1TR 3A6GA 2C77A 4RBNA 1P2SA 3A3YA 4U1RA 1LGYA 2FPIB 4L5CA 4RIFA 1HT2E 5EWJB 5KOHB 2FMTA 2OXTA 4YXWA 1JMVA 1HFJA 3Q15C 2I1WA 4D0SA 1AKRA 1OLUA 3PC8C 5IEBA 3TRJA 2I99A 5HP4A 1XPOA 3K15A 3CR8A 2I6UA 1GLGA 2C94A 2JJQA 2VPTA 3F8WA 3TOCA 1AOXA 4E2ZA 2BP7A 5CA0A 4AYTA 2CXRA 2OZEA 3AUKA 4UZFA 6GPBA 3PUKA 4EI8A 1V8DA 1WHSB 1ZCZA 1UWCA 3VDRA 3KKOA 4QXRA 1I79B 1L5MA 1PYOA 3NXKA 3UXMA 1IXZA 3MUFA 1WDLA 5G41A 2H52A 5EHGA 5K4AA 2C1EA 4DCPA 4MVJF 3IBFA 1Y63A 3AI1A 4G1MB 2GBLC 3RBAA 5CW2A 1E6LA 1QZZA 4E5DA 5CIYA 2HXGA 1LCIA 4GKBA 5KO2A 5CR9A 1LDEA 5KTRA 4BE9A 1DQPA 2DSNA 3B89A 3UENA 3CXUA 3C4VA 1BC5A 1S1MA 1FTQA 5FL3A 1SBTA 1KMNA 2UYHA 3QF4A 1ABFA 3R7BA 2HW8A 4RF2A 4ZCQA 1I7BB 1ULHA 1U81A 3AR2A 3C7AA 3LYUA 3PNVA 2POQX 3TOSA 3VO9A 3ZVRA 5KNLA 1YVRA 4GI2A 1DO8A 1NSYA 4J3JA 3TZCA 4BEWA 1VECA 1Y80A 1E4YA 3CRZA 2JFFA 3ZV7A 1VB5A 2CUTA 1FS4A 1UPTA 1V8FA 4MDHA 1ZRMA 1JW9B 2OWDA 1BQEA 3MJEA 3GLIA 1C8VB 1EGQA 5ICCA 1TUGA 3W3AA 4OHFA 1UOPA 3AOEC 1OLXB 2I9PA 4FBMA 4FMDF 4YFVA 3RSLA 2X2EA 1JAHA 3OX3A 4C4SA 1M3SA 3ZZUA 4MRAA 2QVZX 1QG4A 5KSYA 1N2XA 1HDEA 2J08A 1T6BY 2LV8A 2QENA 2VT3A 3I2JA 2ETVA 2H8GA 2NO5A 1OXVA 5I7EA 2WD9A 1L7RA 2C2MA 1X13A 4EKIA 3AF2A 1JDZA 3D7RA 3IJPA 2HNAA 2O5CA 1S02A 3ZLVA 3O7WA 2Z8YM 2E87A 3K1JA 1GL6A 2B20A 2AUTA 2HU5A 3DD5A 3WYCA 1M2NA 2ECQA 3ZZNA 5LBIA 5HM8A 4WCFC 4UBLA 1E5TA 2YQ4A 2YRFA 4AKHA 5PGMA 3ISVA 4FOPA 1WE2A 1FU4A 1ZY2A 3U5TA 1P33A 3F97A 4HYQA 4JDPA 1K86A 4ZMSA 4X00A 4MVJE 1C3OB 3GW8A 3A6PC 4U63A 3NOVA 1OI7A 2FW9A 1VJTA 2GEBA 4ZC1A 1UP6A 3PUZA 1TB4A 2G7MC 2NU6B 2H92A 3EDQA 1NJFA 3ZJ5A 4B87A 3L6RA 1VE7A 3IHWA 5FNZA 4W9NC 1URPA 1W9HA 1EGHA 5ERXA 1ENPA 3WQHA 1DO0A 5B4TA 3ZDBA 2OBLA 1UBNA 4JJFA 1BJTA 4X94A 3DTYA 2YN0A 1TC1A 5L3VA 4Q3OA 4V0OA 5CPFA 2O2JA 4A2WA 1F0KA 2JFYA 3G79A 3R41A 4WFJA 4B3DA 2CFTA 2OZPA 2NZXA 3IQEA 4HD8A 5CUQA 1TVKA 2JEZA 3V42A 4DIEA 1E61A 1EFKA 2X0JA 1ZQ9A 3KB6A 4EY4A 1QGDA 4OM7A 1YS4A 3PX3A 5UKDA 1EDZA 4QJBA 2ATEA 3DZCA 4YRBA 4H15A 2FTKE 4WVLA 2LTAA 1FXSA 2EQAA 1NA5A 4OF4A 3T5BA 4C03A 4D9BA 3V8MA 2JKVA 2P2DA 3PYLA 2FVYA 4MYCA 2X76A 2VPQA 3SICE 1KERA 3HV2A 4TLMB 5H9WA 4RADA 1USGA 5AH0A 1B73A 4HY3A 4JNKA 1IQRA 2JD1A 2DVMA 3FH0A 3HPRA 4Q3DA 4KPFC 2O6HA 3N2KB 2FEOA 1Z5GA 4R51A 2PEZA 4OK3A 1GV0A 4BO3A 3V4PB 1Y8QB 1FBNA 2ZRBA 1KEVA 1RI3A 2C0PA 3LDAA 4P7GA 5LQJA 2NPIA 3I5XA 4EJSC 3QK7A 1E79D 1UFQA 3RC1A 2JGRA 4H59A 3B1JA 4HEHA 4NZOA 3VTAA 2WZDA 3RC2A 3NOQA 3R0QA 3JQ8B 2XMGA 3HR4A 3M70A 5EP4A 3T7RA 1GHTA 2P1RA 4HNRA 3E7DA 2JAQA 3IBCA 3HYNA 2P91A 2OXRA 2FF7A 4YV0A 4EFKA 3OQMA 4QBIA 3WWPA 4GIBA 1N3YA 2QPAA 3PQ2A 2I6GA 3OLVA 4EGJA 3B3QA 3BH7A 4AM8A 1Z0IA 3NQ41 1ISFA 4JKIA 3V80A 1NJ5A 5DTRA 2JK1A 3UO8B 2QZPA 4TQ9A 4C0KA 4D0NA 2PFGA 1JLSA 1I9GA 1QBKC 4BMDA 2BIFA 2GZ1A 3HJHA 3WO0A 4JR0A 5CDYA 5IN5A 4PNHA 1M1XB 1QO0D 3IVXA 3EC7A 3O8BA 3QU5A 3JYLA 1YB6A 1EVKA 2QN7A 4IIBA 2O8VA 5U4XA 2VHEA 4KV9A 4B6SA 2QW0X 4CLOA 1XJCA 3LUCA 1J22A 2OTCA 1Z15A 3DO8A 5G0UA 3HH8A 3NDJA 4LMPA 3OQ1A 2CNWA 3HU2A 3N8NA 4WZBB 4DOMA 4ZTUB 2HSEA 5KWIA 1WLYA 1WR8A 3U31A 3BULA 4F4CA 3A1SA 4IGFA 3T3OA 1NI4A 1B16A 1E1QD 3NPAA 4D44A 1FNDA 4PANA 1OLOA 5FDFA 1EG2A 1EU1A 1BMFD 1W2WB 1DXYA 4KQIA 1Q57A 3U81A 1XTSA 3AILA 5LA6F 5C32A 4TSFA 1W48A 2EG5A 4PC7A 3H65A 3NONA 1DDOA 5CCXA 3HKEA 1QFXA 1YR7A 2YKGA 3BF8A 3S8YA 1W35A 5ES4B 3UJNA 4H4EA 2QMUA 1E0KA 1LSSA 4WK6A 2QJFA 4H7JA 1JIVA 1SKQA 1AGPA 1MABB 4G65A 3Q72A 3ZWDA 1QH1A 1O94D 1DUSA 2R5NA 4KQ1A 4O2RA 2C0CA 5F52A 1G6KA 2DT8A 3ZCUA 3OCVA 4XJTA 2V97A 2ZRMA 4N03A 1TKBA 2YJ6A 3MK31 4OXNA 1JN0A 1N2CA 3HZHA 1P7YA 4U2GA 4RKEA 2PZBA 1I6KA 4Q21A 1FX0A 1CPYA 1P17A 5HA5A 3B7PA 3GLHE 2D5IA 5E6RB 1M2FA 3HA3A 3Q11A 3N07A 3OZFA 1F2DA 3REQA 1FFYA 2DY1A 1LV7A 2IZ0A 1US8A 3C1UA 1RPNA 2QG9A 1XTTA 2FPXA 3K16A 3EMBA 1PZFA 4Q66C 4YLEA 3F3KA 5JASA 4BQNA 1QRUA 3V7YA 5CJJA 5M6DA 1GP2A 3KWLA 4YRTA 2FEPA 4KRGA 3DLCA 4FD3A 4DRXA 2O4CA 4GM0A 4C0HA 1B0PA 1ISPA 2DOKA 1VJ0A 1WDMA 1JH8A 3ESZA 4BOYA 2CNDA 1J2EA 2GCGA 2WYIA 3D6NB 3E1SA 2X0EA 4D56A 4GH5A 4MYRA 4OX9Y 1R12A 4PIMA 1YRQA 1ISSA 4P93A 5IMBA 5AVKA 3IS3A 2Q3HA 4TTVA 4TXLA 3HYSA 2FPIA 3BIFA 5EWJA 2IPNA 5IUKC 4WXRA 2EC5A 1N6KA 1B6SA 3N3AC 2DFTA 3PE3A 3TKAA 5ALYA 1QKJA 3TINA 3SIXA 1A97A 4D42A 3TF5A 1Q0LA 1BAPA 3TNFA 3MJVA 1U8UA 3O90A 4U6SA 2VTEA 4HGPA 2IH5A 3ORFA 3VOAA 2O0HA 2PBZA 4A8JB 3GEEA 1POWA 1W36B 3LWNA 1BDHA 3VJKA 4KPGA 1P2UA 1THGA 3ZX5A 2J07A 4MMXB 3UTCA 4MJLA 3NTRA 5DDIP 2ZE8A 2Z2KA 3JQPA 1R2QA 1DOHA 3FFXA 3QKSB 4JC5A 3RIMA 1JJAA 3LOQA 1L3CA 3KAPA 2GOYA 3JATB 1A9ZA 1ZVKA 4QFMA 2CXUA 2XE8A 1TA4A 3VGJA 4LHYA 2P4SA 5FBWB 2QL7A 4BMPB 2K2QB 4WGFA 5GY7A 3RIEA 3RRXA 1IM5A 1FJHA 1TW2A 4KR0A 1AE1A 3C1OA 1KU6A 2VZLA 4MQFB 5AK5A 4AMUA 5H5JA 1H3FA 4M89A 4ZIRB 3KQVA 1Y6GA 1U0HC 4ZQEA 1E79A 5B2ZA 1N0HA 3BMCB 3SVLA 4ALIA 1LLUA 1BVRA 2BR5A 2EZ4A 1T2NA 4KBGA 1AS2A 1OROA 4WLEA 3T1VA 4IXMA 3THWB 3GT0A 3ZWPA 1P5JA 3NGMA 3Q7SA 2XWJI 2E6UX 3IE0A 4IHJB 4W7SA 4K87A 4M3NA 3QU9A 1M2GA 3PKJA 3CCFA 3ZUGA 5JOQA 3OFND 2OHXA 3C98A 3Q6IA 4UPDA 1OLXA 3V8QA 2H0AA 3M5CA 1KOFA 4LRWA 3K1YA 3TIIA 4B3GA 3EZ6A 2XNKA 3KKKA 1JTFA 2ZR8A 2QZSA 5ENZA 5EGNA 2P79A 2QN6A 4PE5B 1M33A 4M1ZA 3D2CA 5EWMB 2VT2A 3CINA 1HTWA 1X87A 3ZU2A 5CP8A 4UZEA 1E7QA 1E1KA 4C5CA 1XD9A 3DOJA 4RANA 5B3LA 2VVTA 1UUFA 2R6HA 1U02A 3HFSA 3L0PA 2HU2A 2WIFA 3WADA 2VQEB 1E1QA 3T3IA 1J8QA 1XU7A 1BMFA 1I3NA 4X3OA 1C3OA 1D07A 2HPHA 3M6LA 3SK0A 1RYZA 1KK0A 1MEJA 1K63A 1QAQA 2AJCA 2XNDA 3QVMA 4YALA 1MAAA 3V7FA 4HXFB 3ESYA 4BLTA 1NVBA 3NT5A 4EHDA 1G8HA 4EYEA 5B1HA 2I29A 4MB2A 4S0ZA 3UJ6A 2GB4A 1E2FA 1Z88A 2Q28A 1UYJA 1VLJA 1YIOA 2G3YA 2I80A 1QAMA 2CLHB 3PTZA 4EHKA 3EFBA 1CKEA 4AD8A 1QDEA 4FCCA 1O94A 2AJTA 1FQJA 4MCHA 2GZ2A 5LP6F 1PUXA 2ZU6A 4QLAA 2OGUA 2P4QA 4D4HA 3PUXA 3EVDA 1YI1A 2EQ5A 3R9IA 3RHFA 2FUKA 2M9MA 4O2AB 4JJGA 1X8KA 1R6DA 3SHOA 5HMLA 3WIEA 3G59A 4AUMA 2GERA 5LQNA 1W36D 2YV1A 2W4QA 3S5UA 4R2MA 4DTIA 2R44A 3QITA 2QE7A 1COWD 1F1JA 2YWFA 3NV9A 3IDOA 3T5TA 4KITB 1OT5A 1C30B 2JIZA 1YQ9A 4BQEA 1QK5A 1SKYE 2RH4A 4X93A 1XT6A 1D4OA 1WSDA 1F4LA 1GAQA 3NWEA 3FCCA 1P61B 4IIEA 4LV5B 5LQMA 4TLDA 3DL0A 1YKSA 2H4FA 1SXIA 4MI6A 3D02A 4TS4A 2IX9A 4QICA 1PEAA 3IMGA 3R7LA 4GYWA 1XC7A 3IAAA 3N2KA 1AC5A 2R3SA 3BZWA 3NALA 4BMZA 2YRWA 1Y8QA 3P9XA 4HGNA 3SS8A 1M8FA 1UIMA 3LW8A 3NEJA 1IZ8A 4NE2A 2PPLA 1XTZA 5L45A 3JQ8A 3JQ6A 5DHRA 3C4QA 1ZNYA 1SNYA 4WINA 1XLWA 5MFPA 2ZZMA 4KREA 2CUNA 1X8LA 1P8JA 1BTOA 1BOOA 3G68A 3P0IA 4B2LA 4KH0A 1OWOA 3W5DA 2G88A 4R1NA 3T12A 5FPTA 5CM9C 3U5ZB 3EC1A 5BUZA 1P0FA 1QR6A 3B7GA 4U3JB 5L4SA 3FGPA 3ZQUA 1P9LA 1FZQA 3CONA 3PNSA 4RH3A 5EZYF 1D8AA 1MGOA 4NECA 1R0CA 1WA5A 3O47A 3WSTA 1BN6A 1ACMA 1NBME 3I9MA 3PHIA 4EYQA 1KY2A 4F91B 1I4DD 1YQTA 1TEHA 4ILKA 2R25B 3QLJA 3DCJA 2ILVA 1EUZA 3ONDA 3U3ZA 3CX6A 1AO0A 1G42A 5L8VA 2PMBA 4WZBA 1BRMA 5J1TB 3DLAA 5MGNA 4RVHA 4RDCA 1RWXA 4HH3C 3TRFA 2IWRA 4WOPA 3ZYCA 1NF2A 4MR9B 1AGRA 3ZE9A 1TIBA 5IUNC 1WXDA 2WE7A 4J0QA 4P5DA 5JR3A 2HCJB 5PNTA 3RNOA 2QU8A 4TUYB 2A0WA 3SLGA 2X6TA 4RHFA 4Z4EA 1SXJC 4P8RA 1A5BB 2FEKA 4O1HA 1IEWA 4HQFA 4Q7LA 3S7ZA 2GNPA 4YPVA 2GEKA 5L6LB 4Y6SA 4UM5A 2A0KA 2G67A 1XMQB 4OK5A 2G5CA 1YB5A 5DMXA 2YDXA 2DP4E 3ADPA 4J7UA 1GWNA 5FA5A 1CUBA 3O5AA 2BTEA 1MABA 2DYKA 1H85A 3TQIA 1U5AA 5AVQA 3PGKA 1PK9A 4J16C 4EYKA 4LECA 3OFNA 2LUOA 4X85A 4RKRA 2WJVA 4AQYB 4M55A 1TF7A 1U7ZA 4S0XA 3EFHA 4IIDA 2X8WA 1UM9B 2HJVA 3WLMA 3LSTA 4XZ3A 2NP7A 1Y42X 2LBPA 1YD7A 4GR5A 1O96B 1SKBA 2RI0A 4N76A 5E6RA 4ARCA 2Z2ZA 1ZGZA 3NXSA 3CYFA 4ZHQF 1UJ4A 4DJTA 3T9FA 4IDCA 3VR1A 3COSA 4C0BA 4Z9XA 3LDGA 4MYTA 1E7RA 4NENA 3SMVA 3OZ7A 3SF8A 1WF3A 4DXAA 4LHEA 4RZXA 4OSOA 4KXYA 1EZZA 3P0JA 2R6GA 1ZH0A 4TV8B 3RDPA 1LEHA 1DJLA 2ZRLA 5B7GA 5CLIA 2XNSA 3FY4A 1L9KA 4CMIA 1U3UA 4ZYYA 2TMDA 1KQFA 1LSJA 1L1RA 2F4NA 2JI7A 3P2YA 4QJ5A 4ENQA 2V9PA 3H3FA 4ZCPA 2I87A 4TYYA 2FFAA 2L19A 3A58B 3QVWA 1B00A 2BFBB 4N12A 1M6WA 3EIFA 1T4GA 2FWMX 3WWYA 1U0TA 3KQYA 4V3CA 4F4DA 3PQEA 1KJ8A 1AZWA 1K8YB 1U3WA 2DU8A 3GJXC 3VOTA 1ISRA 1EVQA 1O5TA 1LTHR 3G2MA 4GOND 5I4CA 2H5IA 5I7UA 2DHQA 4DV4B 1ATIA 1Q7CA 1PFGA 3E35A 5EXTA 3TL2A 4FVTA 3CKYA 3W9SA 5A3RA 5B7NA 3LUKA 3V4RA 1L7DA 3VH4A 2ZUFA 1OU4A 1MTOA 3C14C 1RZUA 2A2ZA 2NZYA 2QL5A 2YWHA 3FTQA 4QU5A 1J20A 4IF4A 5H80A 4BTVA 4CYMA 1PS8A 3F5MA 4BN0A 4Z6KA 2GD1O 2BSXA 3GLFB 4YMLA 1BDMA 2FN7A 3DYIA 3CLUD 3QA9A 2OAGA 4P5PA 1W47A 3LCMA 1G8PA 4A8JA 1HYHA 2C0QA 3ZDRA 3RAGA 2JJMA 2FUCA 2WJGA 3P8ZA 1COWA 1P73A 4UTXA 4BTLA 7MHTA 4FGLA 3I9OA 4ENWA 2H85A 2NSYA 2PV7A 3LDFA 1D0IA 2AG0A 1JEYB 3QKSA 1AKVA 2QTAA 4J49A 4CKYA 3DKPA 1FU8A 1ZRSA 3GGSA 4WJZA 2QRZA 3ABOB 2GHTA 3JATA 1CERA 4EK9A 2J3LA 3PEYA 3AI2A 3DMGA 3K4QA 2DUWA 4MQFA 3OX2A 5JUWA 2VFAA 4JI7B 4JBWA 1U9YA 4KFSA 2FWNA 5EC8A 4M0EA 5A6SB 4ZIRA 3IUQA 4DCCA 4DDHA 3FFWA 5T5QA 3QJYA 3HCDA 5IDYA 1A8SA 1KOGA 2X0RA 3BMCA 2CJXA 3TW4A 2FSIA 3LHFA 3WQBA 1SQ0A 3CXRA 2ZYVX 3UKDA 2WHXA 1AMOA 1MOPA 1WF6A 3M4XA 3THWA 3WNCA 3RWMB 2ID7A 4HFNA 4IHJA 2HPZA 4KX3A 3PU6A 4IP0A 1W8IA 1ESDA 1DTEA 3ASYA 1SPBS 1YCDA 3QSGA 2UZ1B 2HBQA 4OFBA 2C61A 5FOQA 1GCOA 1PJLA 1VHWA 3EDMA 3MRTA 1HE8B 1PLJA 1W44A 4OIMA 2FR1A 4YCAA 4LZWA 1AGYA 4PCUA 4L0DA 4AXXA 4DKJA 4IKEA 4GGOA 1WBJB 3O91A 1NYLA 3EASA 5L3RA 2XMCA 5EFZA 3W9YA 2GKSA 3IQDB 1ODIA 3ZE1B 1K1EA 5EWMA 2FQYA 4ZOLF 3BSSA 3PGLA 4IDAA 5I01A 3ZGXA 3IELA 4MI3A 4RTRA 5K3BA 3G7SA 4D43A 1QF6A 1TK3A 3UXHA 1PNVA 3VJLA 1L4MA 1OILA 3GWZA 3LO5A 4FN5A 3RFXA 3JQ7B 4JROA 4NMXB 3UQZA 1XCOA 2F3UA 4W5OA 3TLEA 4TTIA 4ZCRA 3KBOA 4IVPA 1CF2O 5FUBA 1CUEA 3FVQA 1HEIA 5KPDA 2BE7A 1UEJA 1S8FA 2C8LA 1CY8A 1LK0A 2QJWA 3M1IA 4R81A 4D79A 2AG1A 4PZZA 4OQQA 1ZW6A 1LLFA 5IG2A 1KAGA 1MRZA 4ZTBA 5IHPA 1SZPA 1L5QA 4PHFA 4U7DA 3IUEA 1D1PA 1KOJA 1RC1A 3UAVA 1G5TA 3GDGA 3RRMA 4EF4A 2GASA 4L4UA 4S24A 3WLSA 2WVHA 1IBLB 4F56A 4CM5A 5KQMA 1LBIA 4ZT6A 4RVGA 1W581 1X9GA 3A11A 4D6YA 3OTQA 3ZKWA 4DCJA 4MKXA 3ILHA 1G7RA 4FFMA 4HGQA 3W8RA 2P3SA 5IVKA 4I4TF 2ENWA 2LKDA 2CWWA 1OW3B 2W2XA 5EYPA 4A92A 4PRYA 5JXWA 4BBAA 1YL7A 3PR2B 4US1R 4O2AA 2R5FA 2YQZA 3ZWBA 4EY3A 4JU9A 4Q9LA 1WXFA 2X1HA 3TB4A 5JIBA 1HTBA 1ZIYA 2ODTX 3PFCA 4RELA 5JY1A 3MG9A 1C30A 3CUVA 2WWRA 1DT5A 2B2NA 2IUYA 1PO7A 2Q21A 2WU1A 3GMIA 3HDJA 4QFBA 4MB6A 1NYQA 2X2OA 4BASA 4CG2A 3U7HB 2QTVB 4DC1A 4FE7A 4DQVA 1NJGA 4BNTA 3Q8MA 1VC2A 1G41A 1N8NA 4NNJA 5ALIA 4KLZA 1Q83A 1SELA 3I92A 1K3TA 3N8IA 4S1PA 1HX7A 2BISA 1GSIA 2A5FA 2HSZA 2PRSA 5KWEA 1TMYA 1U3DA 1J0EA 1HY3A 3WMXA 4NYIQ 1PR1A 4E5KA 4HGYA 2D2IA 3HGQA 2P7HA 1GADO 1XK7A 3B9QA 5JDIA 4ND5A 3SLKA 1ORTA 3I6ZA 5HR5A 3DMDA 3PD7A 4CT5A 3QOXA 3WZ2A 1SCAA 3HKBB 1R0SA 3ZLUA 2DR2A 1GFIA 2ZR9A 4MINA 1JL3A 4OD0A 4YAJA 1HI9A 1WV1A 1GGFA 1WXHA 2P62A 3BSWA 1KEEB 3K3PA 4XVQA 5EN4A 3TSYA 2X8AA 3B6KA 2XUPA 2VHWA 1NR1A 1GY8A 3F46A 3ND9A 4U3JA 2YWBA 4Q9NA 3WYDA 5AVWA 3I04A 2ALJA 4P4NA 2FZLA 2JVIA 2Y0PA 5I5GA 4YREA 2OK7A 4IICA 5B6JA 3QVTA 3ZCXA 2ORWA 1MRNA 3LT4A 2MINB 3IR6A 1PLLA 2IYXA 3DPUA 2XYVA 5COBA 3UBTA 2NAFA 4GLLA 3UK0A 1T5LA 1OJ7A 2WP8J 3DAOA 3SQDA 1TEVA 3V8PA 3CSDA 3UHJA 4UUMA 2PWAA 2HIHA 3ESCA 2OB1A 3IQGX 2HEIA 4PTZA 2OO5A 3OBBA 4G0PA 3UMFA 4CM1A 1E3DA 5SYMA 4MR9A 4TVBA 2NLOA 2XEDA 3H0WB 3MOIA 3MELA 3PXUA 2YW9A 2HDWA 3NM4A 1BKYA 3TTXA 3A1VA 3KSAC 3VHQA 1W0JA 3AR7A 1Q95A 1ZHHA 2PV0A 4TUYA 3K9QO 1QAOA 4OY3A 3COZA 3ITNA 5TR9A 2SBTA 1H5NA 1Z2NX 3GLIE 2XYRA 1Y5RA 1DBWA 2PMCA 4DSZA 4BJ1A 1RP7A 4HLNA 1L4FA 3I0NA 4NVRA 5COAA 3BXZA 5AUQA 5FAXA 3PSHA 3OIGA 1GTJ1 3NHRA 4FHZA 3IMKA 3WMGA 4KR6A 5ICSA 2HUPA 2P9TA 3A26A 3FTPA 4NZ9A 5A9SB 2EL7A 1E66A 1V5IA 1ZP6A 1UXHA 3CA8A 3C3AA 3DLTA 3PA8A 3ZHUA 4NBLA 4EMBA 5J2TB 4EH1A 2WEKA 4R8KA 3EZYA 2F2TA 5CH3A 1PZXA 4YRCA 4KMMA 5FTJA 5BWMA 1LS6A 2VXCA 3HXOA 3D5QA 1FNMA 3Q2IA 3TUIC 1UM9A 1N2BA 2HK6A 5FI1B 3DTTA 4NARA 4IJ6A 4DVJA 1BQ4A 4IRMA 4PTLA 2JH8A 3QWHA 1O96A 4H7PA 4HDOB 4WZAB 1KDVA 3SSMA 3HXMA 2IE8A 1CIVA 3V00A 4K2AA 4LZJA 1TU0A 4E7PA 2JFNA 2EBFX 5I9SA 2J3MA 3ZY6A 3BHJA 3EE6A 3R3XA 4GM1A 1G63A 2RJ3A 1JS1X 1KDTA 5DHUA 5C8XA 5HF5A 3P4XA 4JOQA 1P1JA 3QPDA 1LBEA 4GU5A 1PSDA 3PFIA 2WW8A 4LDRA 4TV8A 2BYTA 3AY0A 1ZKMA 3HCBA 3K2QA 2WUFA 2JA1A 4W63A 4LC9A 1ML3A 3BREA 3N28A 4ZYVA 5AW3A 4G5RA 4Q82A 2QX6A 3T1TA 3FE2A 2FDCA 3I6MA 3DR3A 1D1TA 2BFBA 3H2HA 3C7DB 4HGRA 2QF7A 5K0FA 1XKTA 2Z57A 4BS9A 4DILA 5EJ8A 1L5RA 1GN8A 3WGYA 2GA9A 3P9CA 3GFRA 4HXEB 1S0UA 3D4BA 3OLYA 4JCOA 3TECE 1DIOB 4ZCSA 4YS6A 3TQSA 1T9ZA 4I7EA 1XF9A 3F7NA 2NUTB 4P35A 2RONA 2P2NA 2UYOA 4ZDIA 3E84A 1J2TA 4DUZB 4BCBA 1BN7A 2R96A 5EJ6A 3B70A 3PGA1 3L1IA 3COWA 4RSRA 4ENSA 5CVTA 5KYYB 3EQZA 1XZ8A 1Z28A 4LG1A 2EF1A 2QP3A 5EJMA 3GLFA 4EY6A 1JT9A 1D6SA 1STOA 2UU9B 3RVBA 3G0BA 3O8QB 2P6NA 2Q45A 5M3BA 5AJXA 3QQPA 1Z16A 4GOKA 1Y1TA 2WM9B 4IH1A 1U4OA 2IYQA 4ZOCA 3UPTA 4AKSA 3SOPA 3R7SA 3Q3GE 2C9MA 2F55A 1JEYA 3UJDA 5SY6A 1M2JA 3ND6A 4NTZA 3F9IA 4HNSA 5EA2A 4B3FX 2Z1MA 2H4HA 2HQOA 3GYBA 2KHZA 3H1BA 1HE1C 3G2HA 1ABBA 4CCWA 1JUDA 4M37A 2I6TA 3RSOA 2V7VA 2OFFA 3P32A 3NV7A 1PV4A 5JJLA 2FWPA 4BGIA 3FLMA 4HK4A 1X70A 5CT9A 1U2DA 2AE2A 3MXOA 4BNKA 3NHJA 2CD9A 4HJXA 3OQPA 5JNVA 4DIFA 4XVUA 4BVFA 1KZ1A 3AR6A 2L0XA 5E8RA 3OMWA 2DRIA 1DXOA 2Q22A 1YAJA 1HMPA 1MDBA 4G2NA 1E20A 1T13A 2Q0QA 2Q5CA 1C8LA 2Y1DA 3FOWA 3UMGA 5DRYA 2J6BA 4CMBA 2D2EA 1N5MA 4LRSB 3V7WA 3NUGA 3Q5GA 2OMEA 2J3EA 2UZ1A 4IIUA 3T9AA 4RFLA 1DIBA 1LXCA 1HDXA 3FRJA 1LKZA 4L57A 5HILA 3EVGA 2RHHA 1JFVA 1PTJC 1PV1A 4H6PA 2ZETA 4XSHA 1YKFA 3I45A 1P4RA 5BT9A 1DEAA 2FG7C 2EV9A 1UBGA 1A04A 1V0JA 2FMUA 1PEYA 5H7XA 3H17A 4YLGA 2FWBA 3PFKA 3OY2A 5H68A 4D3XA 1M1YE 3GLTA 5IWCA 3TGLA 1OKKD 4PHHA 2VJCA 2DHRA 1QMHA 1AZTA 5BT8A 4N9QA 4UBIA 3SX0A 3JQ7A 4X6XA 2GK3A 1E3SA 2EX0A 3JAKB 5CEFA 4IO1A 4UNQA 3VPSA 1YR2A 3MNFA 4FUQA 1YIAA 2FFQA 4GI1A 1PT5A 4QQFA 5LBTA 4WOJA 3C5VA 1Y3BE 1IZYA 2XUIA 1R0YA 2IF2A 3L40A 4MITA 1U0JA 1TXGA 4NK5A 4V39A 4WLUA 5F64A 1T1EA 5F4ZA 5JALA 4P3YA 3EEBA 4I5EA 5BNTA 2DWOA 1NF8A 2KW5A 4R8SA 4L0MA 2O8CB 4A4DA 1QTRA 1NC1A 5KSOA 5KYNA 3AL0C 2XVZA 4E5PA 4C22A 1UXGA 3KTFA 2BRUC 4GDFA 4KIWA 3RBVA 3M1YA 5T7BA 3K94A 4ARUA 3BD6A 2PN1A 2RK6A 5A9TA 1L7OA 4JLVA 4DNQA 3CG4A 1KQ3A 4IDFA 4LFBB 2IA5A 3TQOA 4Y9DA 3LFHA 4UU1A 2OLEA 3T7KA 1R9GA 1RW4A 3AGPA 2H1LA 4DMLA 1CDDA 2VPPA 1I7CB 3DPIA 1NOIA 5EINA 3FZNA 4RETA 4CTOA 4Z86A 4HN9A 4C30A 3TFWA 1RE1A 2HQ1A 1EVIA 3CRVA 3OLXA 3TNDA 4YQZA 1UKBA 3STYA 4ME6A 1NAHA 4BO2A 3LPMA 3CNEA 2QTVA 3DZ6B 3TZLA 2BGJA 1O95D 2DWCA 4EMSA 1I32A 1GCIA 1R6VA 3QKTA 2EFCB 4WZ6A 1CY1A 1OREA 1X14A 3AR8A 3I5UA 2AG8A 4MQLA 4ZAYA 2VIIA 2ZI3A 1YRBA 3LAWA 4BY9E 3EISA 3PEUA 1EFLA 4XWYA 4UFNA 3T8YA 4IHJF 1RXUA 2W2NA 3TE7A 2IYAA 1SBQA 2XNJA 2JJYA 1TAGA 4G67A 4I50A 3EZFA 3FMOB 2WFAA 3AEYA 1GGKA 1XQYA 2A5LA 2GSDA 1ZXBA 2R5WA 3INRA 2R6AA 4ZO7A 3ZG6A 4WXMA 2H29A 3ZWNA 2O5EA 2WF5A 1CQWA 5D5HA 4AICA 1GAJA 2O2GA 5M34A 1ESCA 5IH3A 2Z1DA 2FG5A 1EXNA 2C2XA 2AR0A 2QSJA 3VNRA 3HKBA 1Z35A 4FSHA 1GGEA 1C7JA 1M1ZA 1L8AA 2W11A 4JOSA 1ZESA 1JGTA 1UH5A 3JYQA 3EXHC 4X8HA 5H16A 5DN9A 3V3TA 4C6TB 3CIFA 4FLMA 2YYSA 1KEEA 1P4HA 4M9RA 4AWBA 1QK3A 5BRJA 2AYYA 1N0IA 1AQUA 1I0LA 3DZ7B 1TX4B 4YYEA 2JI9A 2VHZA 4JR2A 3JRWA 1M6NA 1W88B 3BDAA 4GZ6A 1V5GA 4B6JA 4CCYB 5C8YB 2EOAA 5CHEA 2JARA 2MINA 4IOKA 2XOKA 3EUAA 3EGCA 3JQBC 2VNIA 3PNPA 5DSXA 3Q4GA 3KR9A 2B7LA 2XOEA 2BMFA 2ZSAA 4UOQA 2H5LA 1W5AA 1P2GA 1Y6RA 1J39A 2HC9A 2PU5A 3C43A 4OP1A 3BK1A 4DLSA 1PG0A 5T4HA 1IXKA 1CDOA 2HSGA 2I1LA 1DCFA 2G1AA 2GWHA 5ERYA 3WLRA 4D0RA 2HHHB 1UC8A 4XEHA 1IDN1 3ZGVA 4QU0A 2YR0A 4ZO9A 4WADA 3UYKA 1HG1A 3RAEC 1IVSA 1QHYA 3VAYA 5LYJB 3WRXC 4JSYA 2DQZA 1U2EA 4XARA 2ID4A 2XQGA 4Y7DA 3RK1A 1RC0A 4ZZIA 5JMWA 1EYZA 2YWRA 2QPOA 3OIWA 2DCUA 5I9NA 4R9UC 3OIVA 3FMGA 3WTCA 3AHCA 1SY7A 2G6TA 4IQ8A 2V3VA 4R2HA 4ZO4A 1LJ8A 5F77A 1Y1QA 1JLMA 4BMCA 5CLFA 2F1JA 1XTVA 1W5SA 4RCYA 4AC9A 4O2AF 3IFSA 5A9SA 2AFRA 2G6BA 4WAUA 4YT4A 2BF7A 4KXFB 3AETB 3O3NB 3FHOA 4G8JA 1T2UA 5J2TA 2FGJA 3DC2A 3ZH2A 3FYDA 2AOXA 4KGVA 4OKSA 4AMZA 5AKYA 1VQ1A 1YRLA 2ZRKA 5BSVA 1P3JA 1X8XA 3LIPA 1Q0HA 4B1FA 4H4CA 2R86A 2RI6A 3Q5EA 3R3VA 1VE3A 4FOLA 5M04A 1HFKA 4JXJA 3PRHA 5HBGA 5HKLA 1NP3A 5FV7A 2COKA 5A05A 4LCBA 1ZDMA 2NZUG 4TMZA 2ISCA 3I01M 3M3HA 4QPPA 4WZAA 2EP5A 1OU0A 1AT1A 2JFHA 2MYPA 3E5NA 4FIZA 1JKXA 5AM5A 1PT7A 5ICEA 2GRUA 1A1SA 1L8OA 2DFDA 2FX5A 1RLMA 5GZ1A 1U5BB 2DHCA 2BSQA 1CJBA 1KIFA 1OKKA 4YRNA 1JFSA 1FS5A 3V32A 4LXTA 3AI3A 3WIBA 3UW3A 4TKVA 1CU1A 4ISCA 1ZIPA 1NZFA 4NIMA 5AVVA 2WF7A 1I36A 3MMZA 1C50A 5BQ5A 3E1KA 1FTWA 2IOYA 2P6RA 1DKMA 3TNLA 2ZBUA 2B3TA 2PGNA 2UVDA 4U8HA 3GBSA 4JD5A 1YONA 3MCAA 4FDAA 1TCUA 4YGXB 5E7JA 1U7OA 5FJJA 1ZVVA 4IJUA 1Q7GA 1UT8A 3HLTA 4J6EA 4GX0A 4D45A 3JQFC 5H81A 5GADl 2FN3A 4MLCA 4FS8A 1R1DA 3EG5A 1UBMS 1KSGA 5CEJA 3IOMA 4TTPA 5DTEA 3CB4A 1G3MA 4KODA 4GFDA 1MW9X 4XWWA 1QRDA 2IVFA 5DM2A 2NUTA 2FQXA 2QW1A 3AKEA 4XD2A 1LVGA 2GD0A 1WSAA 3A25A 2A5JA 2HV9A 3GAFA 3T4XA 4Q0MA 1HYGA 2FWJA 3U4CA 5B57C 3ZVMA 1RWOA 1RHKA 3HJNA 3HRKA 3OC0A 4LXHA 4OQZA 4PXSA 1OPXA 4CE6A 4FFWA 1CUGA 2IC5A 2AW3A 2B8TA 2QUJA 3AUFA 3WNBA 4BFVA 1QM5A 1T1IA 5K0NA 5K4HA 3IMEA 2HM7A 1SK9A 1RJ9B 3ZBTA 4HAZA 2YV5A 1C9DB 5LZ8A 3KCQA 4NAHA 3O8QA 1COZA 3I3OA 1DCTA 1G66A 4JVNA 2FY8A 2XUOA 3AHEA 5EIOA 3NBMA 1A9QA 2XWSA 3LGAA 4DMHA 3LUJA 3TLCA 5LMCA 2CF6A 1RQPA 3PX7A 4D4GA 2BAGA 4P9NA 1BKSB 1O95A 3VPFA 4JOBA 1TMOA 3DV2A 4PO3X 1U7UA 1EX9A 1H42A 4BRUA 2D1SA 4XM2A 3L8MA 3ZCVA 1T8UA 2WUWE 3MJCA 1PNOA 1V25A 2NTEA 3MLAA 4MW1A 3NBYC 1NM5C 4EARA 1C8BA 3VFDA 1G5FA 1LDBA 3E03A 3UHPA 4D1YA 1B8NA 5C51B 5FBKA 5G0VA 1NQ5A 2BFNA 4ISBA 4YRRA 3VR0A 4YHHB 3L06A 1GOTA 3ENWA 4MGIR 1AKTA 1J8YF 3WJ2A 4V0NA 1ODSA 2DTEA 2PD6A 3ZHBA 2AH5A 1WUKS 3M4YA 3TTSA 2WKPA 2HZBA 4R2KA 3TL3A 3D3KA 1UZLA 5C1DA 5DNEA 1CF4A 3Q41A 4HX9A 4I5FA 3QEBZ 3TD2A 1GG8A 1V6AA 2FMXA 1XDWA 1YE3A 3AV3A 3JX9A 4CM3A 1K6EA 4BKUA 5JCZA 5JROA 3E48A 1NV9A 1EFAA 4NZMA 4KAAA 2CJPA 4OG2A 4LFAB 4QOSA 1ISHA 4C4TA 3JTEA 3U7QB 3CEPB 1CJVC 3LYAA 4ZVPA 4TV8F 1ZIDA 3PHBE 4UVHA 3TZ6A 1RFGE 2XUGA 3UXYA 4L6IA 5T4EA 3GDHA 3R7WB 1Y1RA 4KQ6A 2Z9CA