3ECFA

Crystal structure of an ntf2-like protein (ava_4193) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'ATEKYHEILKKYFLSFETGDFSQVQFSCNLEFLSPISGNTLKGTEEVIPFLKGVTTRVAEVNIMSTTVEYPRASGVWQMRTTKGTLYTLHNFFRLDEEGIVYVWPMFDPKAVMENPDALIQWLTGKDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like Protein
publication title Crystal structure of NTF2-like Protein (YP_324687.1) from ANABAENA VARIABILIS ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Unknown function
total genus 38
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16247 DUF4904 Domain of unknown function (DUF4904)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ecfA00
1GY6A 1ISKA 4K1UA 1GY7A 5IEOA 4HM1B 4R9LA 4GB5A 4L8PA 4H3UA 4FCMA 4XBYA 1E97A 4HM4B 5G2GA 4Q53A 2XR8B 3FLJA 1OPYA 3JUPA 1E3VA 1OGZA 3FF2A 4N3VA 2F98A 4MJDA 3FH1A 1U5OA 2GEXA 2XSOB 2RFRA 1W6YA 4L7KA 3F14A 4HKVB 3MHEA 5CF2A 5EVHA 1OGXA 3BLZA 1OH0A 5CXOA 5D82A 3CU3A 4HM5B 3KZTA 1K41A 1OHSA 2HMNB 3KSPA 3NBRA 5KP4A 3Q90A 3IPTA 3MSOA 3FF0A 3LZAA 1Q40B 2CHCA 3CNXA 2OWPA 3JUNA 4R1KA 1OF5B 1Q40A 5HGRA 1OUNA 6STDA 3E99A 1OF5A 1QMAA 1OHOA 1ULIB 4OUQA 4XB5A 3RGRA 1DMQA 2GXFA 5CF1A 3ROBA 3FKAA 2K54A 4K1VA 3MG3A 8CHOA 5IEPA 3NV0B 2IMJA 4J9AA 2XRXB 3FGYA 2B24B 3JUOA 1O7PB 3NV0A 5BXQA 3EBYA 1NDOB 3G16A 1C7HA 3F7XA 1ZX2A 7STDA 3GRDA 5JPPA 3OX9A 1O7HB 4HM7B 2BMOB 3UJMA 5AIFA 1Z1SA 3EC9A 3H3HA 3EX9A 3RGAA 3B4OA 3NUVA 3DXOA 3OV4A 5IG4A 2Z7AA 4XBTA 1CQSA 1VZZA 3K7CA 1ULJB 4HZBB 5FW5A 5DREA 2HMMB 4J8TA 3NXJA 3DZLA 4X2OA 3UNLA 2CKFB 3GZRA 3MYTA 5D81A 5IERA 2HMLB 4XM4A 3I0YA 3SOYA 1JN5B 4PEJA 1EG9B 2HMJB 3OWYA 4XBXA 4IIAA 1JN5A 5IENA 1AR0A 5CLKA 3GWRA 5AI1A 2RGQA 1HKXA 5TGNA 5KP1A 1GS3A 3DMCA 1JB5A 5IG0A 2PZVA 3B7CA 3SEDA 4OVMA 2Z76A 2HMOB 3HK4A 3VGNA 2Z77A 4STDA 5D83A 1DMNA 3JUQA 2BMQB 3MG1A 1OHPA 5AEWB 3F7SA 5DRVA 5CK6A 2QIYA 2B1XB 3G0KA 5IG5A 2HMKB 4XDVA 3MKIA 1ASKA 3WMDA 3EF8A 1WQLB 4WYKB 1Q42A 3CPOA 2F86B 3LYGA 3A76A 2R4IA 4I4KA 4X2HA 1NU3A 1UUVB 3KKGA 1O7WB 4LEHA 1JB4A 1O7NB 4WYKA 2RCDA 3EN1B 3F40A 3GZXB 5KP3A 2XSHB 1GYBA 2W2CA 3DUKA 3OXAA 3B8LA 3OWSA 5IG3A 1TUHA 2UX0A 1ZO2A 2GBWB 2I9WA 5AIHA 5JPUA 3ECFA 1QJGA 4LGQA 3F8HA 1E3RA 2YFIB 1A2KA 3ER7A 3DM8A 1UUWB 3M8CA 4HM0B 4HZ9B 4ORLA 3NM2A 4HM3B 3B4PA 1TP6A 2JQ5A 3EN8A 5AEUB 4U13A 1IDPA 1GY5A 1S5AA 3H51A 1O7MB 3EJVA 4HJLB 4LMIA 4HVNA 3S5CA 4HM2B 2STDA 2BNGA 1NWWA 1JB2A 3MG2A 3STDA 1OCVA 3SOAA 3JUMA 2GBXB 5AIIA 3T8NA 2YFJB 1JKGB 4RZMA 3VSYA 4XDWA 4R9KA 4FCJA 1BUQA 1EA2A 1O7GB 3EHCA 1W00A 3T8UA 3HZPA 1JKGA 4KVHA 2YFLB 4CDLA 1SJWA 2GEYA 3K0ZA 3F8XA 3G8ZA 2INXA 4WP5A 3GZYB 3GZBA 3NHXA 3EQQB 3KE7A 2QGUA 5AIGA 5BVBA 4HM6B 2F99A 4HM8B 4WWUC 3OWUA 4L8OA 2A15A 2BMRB 3HX8A 5STDA 1DMMA 3F9SA 3FZWA 1W02A 1STDA 3CNMA 3FSDA 3EBTA 3D9RA 1W01A 3BB9A 5IF6A
chains in the Genus database with same CATH superfamily
3CXC2 1GY6A 1ISKA 3WA2X 1DVDA 3I563 2K3DA 4K1UA 3RNTA 1GY7A 1X1WA 5IEOA 4HM1B 4R9LA 4GB5A 4FMBA 4L8PA 1UI7A 3LTBA 2CFKA 3ALAA 4H3UA 4N6LA 4FCMA 4XBYA 4MMZB 1E97A 1RTUA 3UB1A 4BTWA 2JDIH 5GSPA 4BL2A 3FG4A 1GOYA 4HM4B 5G2GA 3S29A 1AV4A 2L1SA 1VQ93 1BRGA 2C4BA 5JBSA 3SX1A 4Q53A 1BAOA 2XR8B 3FLJA 4HBRA 3CD63 1RGLA 1FYSA 1EEJA 1OPYA 3JUPA 2WOHA 1N8QA 1X1XA 2KF6A 4O3VA 1E3VA 1B2ZA 1BRJA 1PU4A 1T5YA 4CCVA 1OGZA 3FF2A 1I3IA 2P38A 3GAXA 4N3VA 2F98A 4MJDA 7GSPA 3FH1A 1KC84 3WR2A 1U5OA 1HU9A 2OOVC 1YIJ3 1Q7HA 2IUKA 3U97A 2GEXA 2XSOB 3D3LA 3LTAA 2RFRA 1W6YA 3D79A 3SYUA 1DE3A 2P0MA 1VQ73 1QAKA 4L7KA 2OOVA 3F14A 4HKVB 3KSED 3BNEA 1BRKA 1VQP3 3MHEA 1LOYA 1T2HA 1LVNA 3PGBA 2WGOA 1MWUA 2ZA4A 2CFDA 5EQLA 4EBGA 5CF2A 5EVHA 1OGXA 3PCSA 1GD3A 3BLZA 1OH0A 5CXOA 5D82A 1V58A 3CU3A 3N54B 4HM5B 4MEIA 2GU1A 2XGNA 1RN7A 4AKYA 3BIRA 1JRQA 4R80A 2ML5A 2CW9A 3KZTA 3Q2PA 1K41A 1OHSA 1GMQA 1L5GB 2HMNB 1T2IA 2XFSA 3KSPA 4AEQA 4EC6A 2FXTA 3NBRA 1BSDA 6GSPA 5KP4A 3Q90A 3IPTA 3MSOA 1GOVA 2KXGA 1M1XB 3FF0A 2QA43 1YJW3 4N6V0 4ILFA 1MOLA 1C54A 1IQXA 1FGOA 1TFKA 3LZAA 3ZG0A 2AADA 2XFTA 1G02A 1Q40B 2L4VA 2SBLA 3PS8A 2CHCA 3TDGA 4N6OB 3CNXA 3PCRA 2OWPA 3JUNA 2BHMA 4R1KA 1WMNA 1OF5B 4IT7A 1QVG2 4QWTA 1Q40A 1I2GA 3QRDA 1DETA 4K61A 1GD4A 5HGRA 2V1LA 1JBTA 1OUNA 2H0GA 2MF7A 3L0RA 2BIRA 1X1YA 1JBSA 1IV7A 6STDA 3X40A 1Q7Y4 1AVLA 1NNVA 1QALA 1GSPA 3E99A 4GL6A 1OF5A 3CCR3 3I553 5M18A 2ML6A 3NBBA 1U8CB 1QMAA 1OHOA 1YGEA 1JZDA 1VQ43 2E2VA 3S67A 2IYJA 1FA3A 4KFEA 2RBIA 2O3OA 1ULIB 2CFGA 3KIIA 3RDEA 3CCS3 1BNEA 4OUQA 2XEPA 1BGSA 4XB5A 1TIJA 4ZM8A 4FCZA 1Q864 1UW1A 5AYRB 1IYYA 3D5GA 1FUWA 3RGRA 1EKMA 1DMQA 2GXFA 5ELJA 4RBNA 5CF1A 3ROBA 1RRHA 1IT8A 2C11A 4N6MA 3FKAA 2K54A 3LXUX 2UGIA 3DGNA 5IW9A 4K1VA 3MG3A 2OCTA 8CHOA 3FCSB 5IEPA 1TRPA 2CWTA 2IMJA 3NV0B 3WODG 4J9AA 2XH9A 3SVAA 1IVVA 1GOUA 3AMOB 4BTYA 1AQZA 1JZOA 2XRXB 3FGYA 4O02B 2C10A 2SARA 3CC73 1K28A 1RHLA 2B24B 3JUOA 2CX1A 2Y74A 4JRFA 1O7PB 1YGWA 1RKYA 3NV0A 2E2UA 1RCKA 3FG1A 4BIRA 2CFLA 3VF1A 4BU4A 5BXQA 3AMOA 3EBYA 1UCLA 1FZUA 1NDOB 3G16A 1C7HA 3F7XA 1VQ53 1TFOA 3X42A 2FNQA 1UGIA 1ZX2A 7STDA 1Q9EA 3G713 4NHFA 3GRDA 5ELUA 5JPPA 4J5KA 3OX9A 1O7HB 1SIHA 1Y4KA 4HM7B 1JBRA 2BMOB 3CCU3 3OW22 1I0VA 2P05A 1NB5I 2KAAA 5BIRA 1RN1A 3UJMA 5AIFA 1Z1SA 3EC9A 3CPW2 3K5TA 1A90A 2W56B 3H3HA 1LRAA 1N9EA 3EX9A 3LTCA 2H0IA 4MMYB 3RGAA 1VQM3 2W9PA 1VQK3 3CMA3 3B4OA 5M19A 3NUVA 1BOXA 2WGQA 3DXOA 2ZL8A 4KFDA 3U1WA 1FUSA 2W56A 3OV4A 3G6E3 3D4AA 5IG4A 4FMCA 4RNTA 3DH2A 2Z7AA 5G1KA 5AYSC 4OK0A 1I2EA 4G1MB 4XBTA 1CQSA 1I70A 1VZZA 3BNBA 1D6YA 2P09A 3V92A 3DGLA 3K7CA 1ULJB 1MWRA 1YIT3 2CWUA 1MWTA 1RRLA 2H0HA 3LMLA 4HZBB 1KWIA 1SIIA 1BNIA 3Q1CA 5FW5A 5DREA 3D5IA 1MGRA 2QEX3 3V98A 1FGQA 3EE1A 2HMMB 1R4CA 2P0XA 1BNJA 4GHOA 4J8TA 2CX0A 3NXJA 1YI23 2LYXA 1RSNA 1T3BA 2O9UX 1IVUA 3DZLA 3N8BA 3QK9A 1TJDA 4X2OA 3UNLA 1RGAA 1QVF2 1IT7A 4GSPA 2CKFB 3GZRA 3S28A 3MYTA 4HAAA 5D81A 5HOHA 2HMLB 2GSPA 1LQMB 5IERA 4XM4A 3I0YA 2LQVA 3SOYA 1BRSA 1JN5B 1GMRA 1QAFA 1N9JA 3PXMA 4PEJA 1EG9B 4AKZA 1YJ93 4FMAA 4H61A 1RNBA 1RGKA 1UI8A 2HMJB 3OWYA 1AVKA 4XBXA 1LXEA 2F56A 1D6UA 1JN5A 4IIAA 4HOHA 5IENA 3WA3A 1FGTA 3DY5A 3CCV3 5I97A 1AR0A 2BT3A 5CLKA 3GWRA 5AI1A 1V74A 1PY3A 2J8XB 2D42A 2RGQA 2D1WA 1N5HA 1HKXA 1LOVA 3KFQC 3Q3FA 4FR9A 1K8A4 5TGNA 1WMPA 1BVIA 5KP1A 1UCKA 3SLUA 2AAEA 2MC8A 1JNQA 1IVXA 1BNFA 3WOEB 1IQ8A 1MGWA 3HI7A 1GS3A 1LNHA 2Y73A 4JF8A 3DMCA 1JB5A 2XGLA 2ZHXB 3NQYA 4N6NB 3ZG5A 3WOFB 1RGEA 1BANA 5IG0A 1BUJA 1HZ1A 3CCJ3 1FW7A 1W7CA 1JV2B 2PZVA 3B7CA 3SEDA 4OVMA 5FGOA 3CCE3 1YVBI 3X3ZA 2Z76A 1FGMA 2Q07A 2HMOB 9RNTA 1DVCA 3HK4A 1NJI4 3VGNA 1X1UA 2KF5A 1SQWA 2IY2A 3AGNA 3DGOA 1W2B2 2Z77A 4STDA 5D83A 1PFPA 1DMNA 3JUQA 1I8VA 1WMOA 1J2BA 2BMQB 1B2UA 4DKIA 2W03A 3MG1A 4N6UA 1OHPA 5AEWB 3F7SA 1N5PA 5DRVA 5CK6A 2QIYA 3LH4A 2B1XB 2W04A 3CCQ3 3G0KA 5IG5A 4I5QA 2HMKB 4XDVA 3MKIA 1ASKA 3WMDA 3EF8A 3URPA 3DGMA 2WO0A 3X41A 2R41A 1WQLB 2WOFA 4WYKB 2BU4A 1Q42A 2CFWA 3CPOA 2F86B 3LYGA 1W6GA 3CCL3 3A76A 2R4IA 4I4KA 5BU4A 2OTJ3 3CC43 1BRHA 2CG0A 4X2HA 1EQKA 1NU3A 1UUVB 1BU4A 3LT8A 2GU3A 1O7WB 3KKGA 1W5ZA 1IK3A 2OTL3 4BL3A 2CK3H 4LEHA 1JB4A 1O7NB 4WYKA 3LTDA 4EV5A 2RCDA 8RNTA 1I3FA 1NB3I 1RGHA 3EN1B 1JJ22 3F40A 1RGGA 2PNCA 1RNTA 3GZXB 1N8R4 1BSEA 4NPBA 3K9MC 5KP3A 2XSHB 1KQS2 1GYBA 3FG3A 2CH9A 5LC6A 1IV9A 1IVWA 1UDII 1CEWI 1WTHA 2F4YA 1LQGC 3G4S3 1VQ63 4EW5A 2W2CA 3DUKA 1M1K4 1YVSA 3OXAA 4KFFA 1FGRA 1Q814 1BSCA 3AHWA 3B8LA 3OWSA 5IG3A 1B2MA 4K90B 1DYUA 1PYLA 5A0OB 1G96A 1TUHA 1BRNL 1K734 4BTXA 3JVCA 2UX0A 1F8NA 4RNYA 1ZO2A 2KF3A 4WFOA 2GBWB 2I9WA 2Z6BA 1I0XA 2CIUA 5AIHA 5JPUA 3ECFA 1FUTA 2BO9B 1QJGA 1STFI 1UCJA 4LGQA 5M1AA 3F8HA 4FMDA 1E3RA 3ZFZA 2YFIB 1A2KA 4LSOA 4KZ1A 5RNTA 3KCHA 3WHOA 3ER7A 3DM8A 1UUWB 2HOHA 2W9QA 3KN4A 3M8CA 4HM0B 4HZ9B 4ORLA 3BU4A 7RNTA 3X3XA 4MMXB 1RJOA 4O2HA 1M904 1CYUA 3NM2A 1LOWA 1R4YA 4HM3B 3B4PA 2F5WA 1W2ZA 1TP6A 3AHSA 2JQ5A 3EN8A 3HOHA 1EUIC 6RNTA 5AEUB 1VQL3 3DGYA 2IA7A 1V57A 4U13A 1IDPA 1GY5A 1B3SA 3NQZA 1RGCA 3WDGB 4LZIA 1MWSA 1ROAA 1S5AA 1RLSA 3H51A 1US1A 1O7MB 1I2FA 3HIGA 3EJVA 4HJLB 1KSIA 4LMIA 4HVNA 3UL5A 4WHAA 3S5CA 4HM2B 1TU5A 1UUGB 1GMPA 1YNVX 2BNGA 2STDA 1BSBA 1RCLA 1NWWA 4EV2A 1JB2A 3MG2A 3STDA 2FGTA 1OCVA 3A5EA 3SOAA 4CJNA 3JUMA 2GBXB 5AIIA 1UGHI 3T8NA 2YFJB 1CH0A 3O8YA 1SPUA 3K63A 1A67A 3NX0A 1RDSA 3BNCA 1JKGB 3PZWA 2YX9A 3NM7A 1D6ZA 4RZMA 3VSYA 2OQEC 4XDWA 1YHQ3 1LNIA 4R9KA 4FCJA 3GSPA 2KF4A 1BUQA 2KRTA 1EA2A 3LOYA 1O7GB 1LOXA 1W00A 3EHCA 4HYZA 2OQEA 1BRIA 5G1LA 3AGOA 3T8UA 2W6JH 3HZPA 2RNTA 1JKGA 4KVHA 2XF3A 2YFLB 1B20A 1YJN3 2CG1A 1B2XA 2CC3A 4KT3B 3MWZA 1A2PA 2UUGC 4CDLA 1SJWA 2GEYA 1BNGA 1WNHA 1ZGXA 3K0ZA 3IMAB 3IJEB 1B2SA 4CPKA 1VQN3 1S723 3F8XA 3PYJA 2CWVA 2W0QA 3X3YA 1VQQA 1OACA 3G8ZA 3CCM3 3BNDA 4LYLB 1TTOA 1NO3A 2INXA 4WP5A 1W4NA 1VQO3 3LT9A 5EEOA 1HYFA 2M7OA 3GZBA 3GZYB 1ZS7A 2K0MA 3NBJA 3EB8A 3NHXA 4O8SA 4EYCA 3EQQB 3HIIA 1RMSA 1M9GA 3KE7A 1B27A 3N9HA 2QGUA 3J7Yd 5AIGA 2RSXA 1BIRA 4EXRA 1VQ83 5BVBA 4HM6B 1TRQA 2F99A 3S27A 4HM8B 4WWUC 1RGFA 1ROVA 3MPHA 1AY7A 2ZDJA 3OWUA 4L8OA 1A2VA 2A15A 2BMRB 1SARA 3UL6A 3HX8A 1BNSA 5STDA 1DMMA 4N6TA 2F5MA 4TX4A 1RN4A 3SXXA 1G0TA 2E2TA 4RNZA 1KD14 1BNRA 1K9M4 3CME3 1CYVA 4J5GA 2KCDA 1B21A 1BSAA 3F9SA 3CC23 1Q824 3FZWA 3V99A 1W02A 2IUJA 1STDA 1MNLA 3CNMA 3FSDA 4IPBA 1W6CA 1IU7A 3T0UA 3EBTA 5LC7A 1IQYA 3D9RA 4R4KA 1W01A 4NREA 1UCIA 3BB9A 5IF6A
chains in the Genus database with same CATH topology
3CXC2 1GY6A 1ISKA 3WA2X 1DVDA 3I563 4K1UA 1GY7A 5IEOA 4HM1B 4R9LA 4GB5A 4FMBA 4L8PA 1UI7A 3LTBA 2CFKA 3ALAA 4H3UA 4N6LA 4FCMA 4XBYA 4MMZB 1E97A 3UB1A 4BTWA 2JDIH 3FG4A 4HM4B 5G2GA 3S29A 1AV4A 1VQ93 5JBSA 3SX1A 4Q53A 2XR8B 3FLJA 4HBRA 3CD63 1OPYA 3JUPA 2WOHA 1N8QA 1PU4A 4O3VA 1E3VA 1T5YA 4CCVA 1OGZA 3FF2A 2P38A 3GAXA 4N3VA 2F98A 4MJDA 1KC84 3FH1A 1U5OA 1HU9A 2OOVC 1YIJ3 3U97A 2IUKA 2GEXA 2XSOB 3D3LA 3LTAA 2RFRA 1W6YA 2P0MA 1VQ73 1QAKA 4L7KA 2OOVA 3F14A 4HKVB 3KSED 3BNEA 1VQP3 3MHEA 1LVNA 3PGBA 2WGOA 2CFDA 5EQLA 4EBGA 5CF2A 5EVHA 1OGXA 3PCSA 1GD3A 3BLZA 1OH0A 5CXOA 5D82A 3CU3A 3N54B 4HM5B 4MEIA 2GU1A 2XGNA 1RN7A 4AKYA 1JRQA 4R80A 2ML5A 2CW9A 3KZTA 3Q2PA 1K41A 1OHSA 1L5GB 2HMNB 4EC6A 2XFSA 3KSPA 4AEQA 2FXTA 3NBRA 5KP4A 3Q90A 3IPTA 3MSOA 2QA43 2KXGA 1M1XB 3FF0A 1YJW3 4N6V0 1MOLA 1IQXA 1FGOA 1TFKA 3LZAA 2XFTA 1Q40B 2L4VA 2SBLA 3PS8A 2CHCA 3TDGA 4N6OB 3CNXA 3PCRA 2OWPA 3JUNA 2BHMA 4R1KA 1WMNA 1OF5B 4IT7A 1QVG2 4QWTA 1Q40A 4K61A 3QRDA 1GD4A 5HGRA 2V1LA 1OUNA 3L0RA 2MF7A 1IV7A 6STDA 3X40A 1Q7Y4 1AVLA 1QALA 3E99A 4GL6A 1OF5A 3CCR3 3I553 2ML6A 3NBBA 1U8CB 1QMAA 1OHOA 1YGEA 1VQ43 2E2VA 3S67A 1FA3A 4KFEA 2O3OA 1ULIB 2CFGA 3KIIA 3RDEA 3CCS3 4OUQA 2XEPA 4XB5A 4ZM8A 1TIJA 1Q864 4FCZA 1UW1A 5AYRB 1FUWA 3RGRA 1EKMA 1DMQA 2GXFA 5ELJA 4RBNA 5CF1A 3ROBA 1RRHA 1IT8A 2C11A 4N6MA 3FKAA 2K54A 3LXUX 3DGNA 5IW9A 4K1VA 3MG3A 2OCTA 8CHOA 3FCSB 5IEPA 3NV0B 2CWTA 2IMJA 3WODG 4J9AA 2XH9A 3SVAA 1IVVA 3AMOB 4BTYA 2XRXB 3FGYA 4O02B 2C10A 3CC73 1K28A 2B24B 3JUOA 2Y74A 4JRFA 1O7PB 1RKYA 3NV0A 2E2UA 3FG1A 2CFLA 3VF1A 5BXQA 3AMOA 3EBYA 1NDOB 3G16A 1C7HA 3F7XA 1VQ53 1TFOA 3X42A 2FNQA 1ZX2A 7STDA 3G713 4NHFA 3GRDA 5ELUA 5JPPA 3OX9A 1O7HB 1SIHA 1Y4KA 4HM7B 2BMOB 3CCU3 3OW22 2P05A 1NB5I 3UJMA 5AIFA 1Z1SA 3EC9A 3CPW2 3K5TA 1A90A 2W56B 3H3HA 1N9EA 4MMYB 3EX9A 3LTCA 3RGAA 1VQM3 2W9PA 1VQK3 3CMA3 3B4OA 3NUVA 2WGQA 3DXOA 2ZL8A 4KFDA 3U1WA 2W56A 3OV4A 3G6E3 5IG4A 4FMCA 2Z7AA 5AYSC 4OK0A 4G1MB 4XBTA 1CQSA 1VZZA 3BNBA 1D6YA 2P09A 3V92A 3DGLA 3K7CA 1ULJB 1YIT3 2CWUA 1RRLA 3LMLA 4HZBB 1KWIA 1SIIA 3Q1CA 5FW5A 5DREA 2QEX3 3V98A 1FGQA 3EE1A 2HMMB 1R4CA 2P0XA 4J8TA 3NXJA 1YI23 2LYXA 2O9UX 1IVUA 3DZLA 3N8BA 3QK9A 4X2OA 3UNLA 1QVF2 1IT7A 2CKFB 3GZRA 3S28A 3MYTA 5D81A 5IERA 2HMLB 4XM4A 3I0YA 2LQVA 3SOYA 1JN5B 1QAFA 3PXMA 1N9JA 4PEJA 1EG9B 4AKZA 1YJ93 4FMAA 4H61A 1UI8A 2HMJB 3OWYA 1AVKA 4XBXA 1LXEA 1D6UA 1JN5A 4IIAA 5IENA 3WA3A 1FGTA 3DY5A 3CCV3 5I97A 1AR0A 2BT3A 5CLKA 3GWRA 5AI1A 1V74A 2D42A 2RGQA 2D1WA 1N5HA 1HKXA 3KFQC 4FR9A 1K8A4 5TGNA 1WMPA 5KP1A 3SLUA 2MC8A 1JNQA 1IVXA 3WOEB 1IQ8A 3HI7A 1GS3A 1LNHA 2Y73A 4JF8A 3DMCA 1JB5A 2XGLA 3NQYA 4N6NB 3WOFB 5IG0A 3CCJ3 1W7CA 1JV2B 2PZVA 3B7CA 3SEDA 4OVMA 5FGOA 3CCE3 1YVBI 3X3ZA 2Z76A 1FGMA 2Q07A 2HMOB 1DVCA 3HK4A 1NJI4 3VGNA 1SQWA 3DGOA 1W2B2 2Z77A 4STDA 5D83A 1PFPA 1DMNA 3JUQA 1WMOA 1J2BA 2BMQB 2W03A 3MG1A 4N6UA 1OHPA 5AEWB 3F7SA 1N5PA 5DRVA 5CK6A 2QIYA 3LH4A 2B1XB 2W04A 3CCQ3 3G0KA 5IG5A 2HMKB 4XDVA 3MKIA 1ASKA 3WMDA 3EF8A 3DGMA 2WO0A 3X41A 1WQLB 2WOFA 4WYKB 1Q42A 2CFWA 3CPOA 2F86B 3LYGA 1W6GA 3CCL3 3A76A 2R4IA 4I4KA 2OTJ3 3CC43 2CG0A 4X2HA 1EQKA 1NU3A 1UUVB 3LT8A 2GU3A 1O7WB 3KKGA 1W5ZA 1IK3A 2OTL3 2CK3H 4LEHA 1JB4A 1O7NB 4WYKA 3LTDA 4EV5A 2RCDA 1NB3I 3EN1B 1JJ22 3F40A 2PNCA 3GZXB 1N8R4 3K9MC 5KP3A 2XSHB 1KQS2 1GYBA 3FG3A 2CH9A 5LC6A 1IV9A 1IVWA 3G4S3 1CEWI 1WTHA 1VQ63 2W2CA 3DUKA 1M1K4 3OXAA 4KFFA 1FGRA 1Q814 3B8LA 3OWSA 5IG3A 4K90B 1DYUA 5A0OB 1G96A 1TUHA 1K734 4BTXA 3JVCA 2UX0A 1F8NA 4RNYA 1ZO2A 4WFOA 2GBWB 2I9WA 2Z6BA 2CIUA 5AIHA 5JPUA 3ECFA 2BO9B 1QJGA 1STFI 4LGQA 3F8HA 4FMDA 1E3RA 2YFIB 1A2KA 4LSOA 4KZ1A 3ER7A 3DM8A 1UUWB 2W9QA 3KN4A 3M8CA 4HM0B 4HZ9B 4ORLA 3X3XA 4MMXB 1RJOA 4O2HA 1M904 1CYUA 3NM2A 4HM3B 3B4PA 1W2ZA 1TP6A 2JQ5A 3EN8A 5AEUB 1VQL3 2IA7A 4U13A 1IDPA 1GY5A 3NQZA 3WDGB 4LZIA 1ROAA 1S5AA 3H51A 1US1A 1O7MB 3HIGA 3EJVA 4HJLB 1KSIA 4LMIA 4HVNA 3UL5A 4WHAA 3S5CA 4HM2B 1TU5A 2STDA 2BNGA 1NWWA 4EV2A 1JB2A 3MG2A 3STDA 2FGTA 1OCVA 3SOAA 3JUMA 2GBXB 5AIIA 3T8NA 2YFJB 3O8YA 1SPUA 3K63A 1A67A 3NX0A 3BNCA 1JKGB 3PZWA 2YX9A 3NM7A 1D6ZA 4RZMA 3VSYA 2OQEC 4XDWA 1YHQ3 4R9KA 4FCJA 1BUQA 2KRTA 1EA2A 3LOYA 1O7GB 1LOXA 1W00A 3EHCA 4HYZA 2OQEA 3T8UA 2W6JH 3HZPA 1JKGA 4KVHA 2XF3A 2YFLB 1YJN3 2CG1A 2CC3A 3MWZA 4CDLA 1SJWA 2GEYA 1WNHA 3K0ZA 3IMAB 3IJEB 1VQN3 1S723 3F8XA 3PYJA 2CWVA 2W0QA 3X3YA 1OACA 3G8ZA 3CCM3 3BNDA 1NO3A 2INXA 4WP5A 1W4NA 1VQO3 3LT9A 5EEOA 2M7OA 3GZBA 3GZYB 3NBJA 2K0MA 3NHXA 3EB8A 4O8SA 4EYCA 3EQQB 3HIIA 1M9GA 3KE7A 3N9HA 2QGUA 3J7Yd 5AIGA 2RSXA 4EXRA 1VQ83 5BVBA 4HM6B 2F99A 3S27A 4HM8B 4WWUC 1ROVA 3MPHA 2ZDJA 3OWUA 4L8OA 1A2VA 2A15A 2BMRB 3UL6A 3HX8A 5STDA 1DMMA 4N6TA 4TX4A 3SXXA 2E2TA 4RNZA 1KD14 1K9M4 3CME3 1CYVA 2KCDA 3F9SA 1Q824 3CC23 3FZWA 3V99A 1W02A 2IUJA 1STDA 1MNLA 3CNMA 3FSDA 4IPBA 1W6CA 1IU7A 3T0UA 3EBTA 5LC7A 1IQYA 3D9RA 4R4KA 1W01A 4NREA 3BB9A 5IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY6 A;  1ISK A;  4K1U A;  1GY7 A;  5IEO A;  4HM1 B;  4R9L A;  4GB5 A;  4L8P A;  4H3U A;  4FCM A;  4XBY A;  1E97 A;  4HM4 B;  5G2G A;  4Q53 A;  2XR8 B;  3FLJ A;  1OPY A;  3JUP A;  1E3V A;  1OGZ A;  3FF2 A;  4N3V A;  2F98 A;  4MJD A;  3FH1 A;  1U5O A;  2GEX A;  2XSO B;  2RFR A;  1W6Y A;  4L7K A;  3F14 A;  4HKV B;  3MHE A;  5CF2 A;  5EVH A;  1OGX A;  3BLZ A;  1OH0 A;  5CXO A;  5D82 A;  3CU3 A;  4HM5 B;  3KZT A;  1K41 A;  1OHS A;  2HMN B;  3KSP A;  3NBR A;  5KP4 A;  3Q90 A;  3IPT A;  3MSO A;  3FF0 A;  3LZA A;  1Q40 B;  2CHC A;  3CNX A;  2OWP A;  3JUN A;  4R1K A;  1OF5 B;  1Q40 A;  5HGR A;  1OUN A;  6STD A;  3E99 A;  1OF5 A;  1QMA A;  1OHO A;  1ULI B;  4OUQ A;  4XB5 A;  3RGR A;  1DMQ A;  2GXF A;  5CF1 A;  3ROB A;  3FKA A;  2K54 A;  4K1V A;  3MG3 A;  8CHO A;  5IEP A;  3NV0 B;  2IMJ A;  4J9A A;  2XRX B;  3FGY A;  2B24 B;  3JUO A;  1O7P B;  3NV0 A;  5BXQ A;  3EBY A;  1NDO B;  3G16 A;  1C7H A;  3F7X A;  1ZX2 A;  7STD A;  3GRD A;  5JPP A;  3OX9 A;  1O7H B;  4HM7 B;  2BMO B;  3UJM A;  5AIF A;  1Z1S A;  3EC9 A;  3H3H A;  3EX9 A;  3RGA A;  3B4O A;  3NUV A;  3DXO A;  3OV4 A;  5IG4 A;  2Z7A A;  4XBT A;  1CQS A;  1VZZ A;  3K7C A;  1ULJ B;  4HZB B;  5FW5 A;  5DRE A;  2HMM B;  4J8T A;  3NXJ A;  3DZL A;  4X2O A;  3UNL A;  2CKF B;  3GZR A;  3MYT A;  5D81 A;  5IER A;  2HML B;  4XM4 A;  3I0Y A;  3SOY A;  1JN5 B;  4PEJ A;  1EG9 B;  2HMJ B;  3OWY A;  4XBX A;  4IIA A;  1JN5 A;  5IEN A;  1AR0 A;  5CLK A;  3GWR A;  5AI1 A;  2RGQ A;  1HKX A;  5TGN A;  5KP1 A;  1GS3 A;  3DMC A;  1JB5 A;  5IG0 A;  2PZV A;  3B7C A;  3SED A;  4OVM A;  2Z76 A;  2HMO B;  3HK4 A;  3VGN A;  2Z77 A;  4STD A;  5D83 A;  1DMN A;  3JUQ A;  2BMQ B;  3MG1 A;  1OHP A;  5AEW B;  3F7S A;  5DRV A;  5CK6 A;  2QIY A;  2B1X B;  3G0K A;  5IG5 A;  2HMK B;  4XDV A;  3MKI A;  1ASK A;  3WMD A;  3EF8 A;  1WQL B;  4WYK B;  1Q42 A;  3CPO A;  2F86 B;  3LYG A;  3A76 A;  2R4I A;  4I4K A;  4X2H A;  1NU3 A;  1UUV B;  3KKG A;  1O7W B;  4LEH A;  1JB4 A;  1O7N B;  4WYK A;  2RCD A;  3EN1 B;  3F40 A;  3GZX B;  5KP3 A;  2XSH B;  1GYB A;  2W2C A;  3DUK A;  3OXA A;  3B8L A;  3OWS A;  5IG3 A;  1TUH A;  2UX0 A;  1ZO2 A;  2GBW B;  2I9W A;  5AIH A;  5JPU A;  3ECF A;  1QJG A;  4LGQ A;  3F8H A;  1E3R A;  2YFI B;  1A2K A;  3ER7 A;  3DM8 A;  1UUW B;  3M8C A;  4HM0 B;  4HZ9 B;  4ORL A;  3NM2 A;  4HM3 B;  3B4P A;  1TP6 A;  2JQ5 A;  3EN8 A;  5AEU B;  4U13 A;  1IDP A;  1GY5 A;  1S5A A;  3H51 A;  1O7M B;  3EJV A;  4HJL B;  4LMI A;  4HVN A;  3S5C A;  4HM2 B;  2STD A;  2BNG A;  1NWW A;  1JB2 A;  3MG2 A;  3STD A;  1OCV A;  3SOA A;  3JUM A;  2GBX B;  5AII A;  3T8N A;  2YFJ B;  1JKG B;  4RZM A;  3VSY A;  4XDW A;  4R9K A;  4FCJ A;  1BUQ A;  1EA2 A;  1O7G B;  3EHC A;  1W00 A;  3T8U A;  3HZP A;  1JKG A;  4KVH A;  2YFL B;  4CDL A;  1SJW A;  2GEY A;  3K0Z A;  3F8X A;  3G8Z A;  2INX A;  4WP5 A;  3GZY B;  3GZB A;  3NHX A;  3EQQ B;  3KE7 A;  2QGU A;  5AIG A;  5BVB A;  4HM6 B;  2F99 A;  4HM8 B;  4WWU C;  3OWU A;  4L8O A;  2A15 A;  2BMR B;  3HX8 A;  5STD A;  1DMM A;  3F9S A;  3FZW A;  1W02 A;  1STD A;  3CNM A;  3FSD A;  3EBT A;  3D9R A;  1W01 A;  3BB9 A;  5IF6 A; 
#chains in the Genus database with same CATH topology
 3CXC 2;  1GY6 A;  1ISK A;  3WA2 X;  1DVD A;  3I56 3;  2K3D A;  4K1U A;  3RNT A;  1GY7 A;  1X1W A;  5IEO A;  4HM1 B;  4R9L A;  4GB5 A;  4FMB A;  4L8P A;  1UI7 A;  3LTB A;  2CFK A;  3ALA A;  4H3U A;  4N6L A;  4FCM A;  4XBY A;  4MMZ B;  1E97 A;  1RTU A;  3UB1 A;  4BTW A;  2JDI H;  5GSP A;  4BL2 A;  3FG4 A;  1GOY A;  4HM4 B;  5G2G A;  3S29 A;  1AV4 A;  2L1S A;  1VQ9 3;  1BRG A;  2C4B A;  5JBS A;  3SX1 A;  4Q53 A;  1BAO A;  2XR8 B;  3FLJ A;  4HBR A;  3CD6 3;  1RGL A;  1FYS A;  1EEJ A;  1OPY A;  3JUP A;  2WOH A;  1N8Q A;  1X1X A;  2KF6 A;  4O3V A;  1E3V A;  1B2Z A;  1BRJ A;  1PU4 A;  1T5Y A;  4CCV A;  1OGZ A;  3FF2 A;  1I3I A;  2P38 A;  3GAX A;  4N3V A;  2F98 A;  4MJD A;  7GSP A;  3FH1 A;  1KC8 4;  3WR2 A;  1U5O A;  1HU9 A;  2OOV C;  1YIJ 3;  1Q7H A;  2IUK A;  3U97 A;  2GEX A;  2XSO B;  3D3L A;  3LTA A;  2RFR A;  1W6Y A;  3D79 A;  3SYU A;  1DE3 A;  2P0M A;  1VQ7 3;  1QAK A;  4L7K A;  2OOV A;  3F14 A;  4HKV B;  3KSE D;  3BNE A;  1BRK A;  1VQP 3;  3MHE A;  1LOY A;  1T2H A;  1LVN A;  3PGB A;  2WGO A;  1MWU A;  2ZA4 A;  2CFD A;  5EQL A;  4EBG A;  5CF2 A;  5EVH A;  1OGX A;  3PCS A;  1GD3 A;  3BLZ A;  1OH0 A;  5CXO A;  5D82 A;  1V58 A;  3CU3 A;  3N54 B;  4HM5 B;  4MEI A;  2GU1 A;  2XGN A;  1RN7 A;  4AKY A;  3BIR A;  1JRQ A;  4R80 A;  2ML5 A;  2CW9 A;  3KZT A;  3Q2P A;  1K41 A;  1OHS A;  1GMQ A;  1L5G B;  2HMN B;  1T2I A;  2XFS A;  3KSP A;  4AEQ A;  4EC6 A;  2FXT A;  3NBR A;  1BSD A;  6GSP A;  5KP4 A;  3Q90 A;  3IPT A;  3MSO A;  1GOV A;  2KXG A;  1M1X B;  3FF0 A;  2QA4 3;  1YJW 3;  4N6V 0;  4ILF A;  1MOL A;  1C54 A;  1IQX A;  1FGO A;  1TFK A;  3LZA A;  3ZG0 A;  2AAD A;  2XFT A;  1G02 A;  1Q40 B;  2L4V A;  2SBL A;  3PS8 A;  2CHC A;  3TDG A;  4N6O B;  3CNX A;  3PCR A;  2OWP A;  3JUN A;  2BHM A;  4R1K A;  1WMN A;  1OF5 B;  4IT7 A;  1QVG 2;  4QWT A;  1Q40 A;  1I2G A;  3QRD A;  1DET A;  4K61 A;  1GD4 A;  5HGR A;  2V1L A;  1JBT A;  1OUN A;  2H0G A;  2MF7 A;  3L0R A;  2BIR A;  1X1Y A;  1JBS A;  1IV7 A;  6STD A;  3X40 A;  1Q7Y 4;  1AVL A;  1NNV A;  1QAL A;  1GSP A;  3E99 A;  4GL6 A;  1OF5 A;  3CCR 3;  3I55 3;  5M18 A;  2ML6 A;  3NBB A;  1U8C B;  1QMA A;  1OHO A;  1YGE A;  1JZD A;  1VQ4 3;  2E2V A;  3S67 A;  2IYJ A;  1FA3 A;  4KFE A;  2RBI A;  2O3O A;  1ULI B;  2CFG A;  3KII A;  3RDE A;  3CCS 3;  1BNE A;  4OUQ A;  2XEP A;  1BGS A;  4XB5 A;  1TIJ A;  4ZM8 A;  4FCZ A;  1Q86 4;  1UW1 A;  5AYR B;  1IYY A;  3D5G A;  1FUW A;  3RGR A;  1EKM A;  1DMQ A;  2GXF A;  5ELJ A;  4RBN A;  5CF1 A;  3ROB A;  1RRH A;  1IT8 A;  2C11 A;  4N6M A;  3FKA A;  2K54 A;  3LXU X;  2UGI A;  3DGN A;  5IW9 A;  4K1V A;  3MG3 A;  2OCT A;  8CHO A;  3FCS B;  5IEP A;  1TRP A;  2CWT A;  2IMJ A;  3NV0 B;  3WOD G;  4J9A A;  2XH9 A;  3SVA A;  1IVV A;  1GOU A;  3AMO B;  4BTY A;  1AQZ A;  1JZO A;  2XRX B;  3FGY A;  4O02 B;  2C10 A;  2SAR A;  3CC7 3;  1K28 A;  1RHL A;  2B24 B;  3JUO A;  2CX1 A;  2Y74 A;  4JRF A;  1O7P B;  1YGW A;  1RKY A;  3NV0 A;  2E2U A;  1RCK A;  3FG1 A;  4BIR A;  2CFL A;  3VF1 A;  4BU4 A;  5BXQ A;  3AMO A;  3EBY A;  1UCL A;  1FZU A;  1NDO B;  3G16 A;  1C7H A;  3F7X A;  1VQ5 3;  1TFO A;  3X42 A;  2FNQ A;  1UGI A;  1ZX2 A;  7STD A;  1Q9E A;  3G71 3;  4NHF A;  3GRD A;  5ELU A;  5JPP A;  4J5K A;  3OX9 A;  1O7H B;  1SIH A;  1Y4K A;  4HM7 B;  1JBR A;  2BMO B;  3CCU 3;  3OW2 2;  1I0V A;  2P05 A;  1NB5 I;  2KAA A;  5BIR A;  1RN1 A;  3UJM A;  5AIF A;  1Z1S A;  3EC9 A;  3CPW 2;  3K5T A;  1A90 A;  2W56 B;  3H3H A;  1LRA A;  1N9E A;  3EX9 A;  3LTC A;  2H0I A;  4MMY B;  3RGA A;  1VQM 3;  2W9P A;  1VQK 3;  3CMA 3;  3B4O A;  5M19 A;  3NUV A;  1BOX A;  2WGQ A;  3DXO A;  2ZL8 A;  4KFD A;  3U1W A;  1FUS A;  2W56 A;  3OV4 A;  3G6E 3;  3D4A A;  5IG4 A;  4FMC A;  4RNT A;  3DH2 A;  2Z7A A;  5G1K A;  5AYS C;  4OK0 A;  1I2E A;  4G1M B;  4XBT A;  1CQS A;  1I70 A;  1VZZ A;  3BNB A;  1D6Y A;  2P09 A;  3V92 A;  3DGL A;  3K7C A;  1ULJ B;  1MWR A;  1YIT 3;  2CWU A;  1MWT A;  1RRL A;  2H0H A;  3LML A;  4HZB B;  1KWI A;  1SII A;  1BNI A;  3Q1C A;  5FW5 A;  5DRE A;  3D5I A;  1MGR A;  2QEX 3;  3V98 A;  1FGQ A;  3EE1 A;  2HMM B;  1R4C A;  2P0X A;  1BNJ A;  4GHO A;  4J8T A;  2CX0 A;  3NXJ A;  1YI2 3;  2LYX A;  1RSN A;  1T3B A;  2O9U X;  1IVU A;  3DZL A;  3N8B A;  3QK9 A;  1TJD A;  4X2O A;  3UNL A;  1RGA A;  1QVF 2;  1IT7 A;  4GSP A;  2CKF B;  3GZR A;  3S28 A;  3MYT A;  4HAA A;  5D81 A;  5HOH A;  2HML B;  2GSP A;  1LQM B;  5IER A;  4XM4 A;  3I0Y A;  2LQV A;  3SOY A;  1BRS A;  1JN5 B;  1GMR A;  1QAF A;  1N9J A;  3PXM A;  4PEJ A;  1EG9 B;  4AKZ A;  1YJ9 3;  4FMA A;  4H61 A;  1RNB A;  1RGK A;  1UI8 A;  2HMJ B;  3OWY A;  1AVK A;  4XBX A;  1LXE A;  2F56 A;  1D6U A;  1JN5 A;  4IIA A;  4HOH A;  5IEN A;  3WA3 A;  1FGT A;  3DY5 A;  3CCV 3;  5I97 A;  1AR0 A;  2BT3 A;  5CLK A;  3GWR A;  5AI1 A;  1V74 A;  1PY3 A;  2J8X B;  2D42 A;  2RGQ A;  2D1W A;  1N5H A;  1HKX A;  1LOV A;  3KFQ C;  3Q3F A;  4FR9 A;  1K8A 4;  5TGN A;  1WMP A;  1BVI A;  5KP1 A;  1UCK A;  3SLU A;  2AAE A;  2MC8 A;  1JNQ A;  1IVX A;  1BNF A;  3WOE B;  1IQ8 A;  1MGW A;  3HI7 A;  1GS3 A;  1LNH A;  2Y73 A;  4JF8 A;  3DMC A;  1JB5 A;  2XGL A;  2ZHX B;  3NQY A;  4N6N B;  3ZG5 A;  3WOF B;  1RGE A;  1BAN A;  5IG0 A;  1BUJ A;  1HZ1 A;  3CCJ 3;  1FW7 A;  1W7C A;  1JV2 B;  2PZV A;  3B7C A;  3SED A;  4OVM A;  5FGO A;  3CCE 3;  1YVB I;  3X3Z A;  2Z76 A;  1FGM A;  2Q07 A;  2HMO B;  9RNT A;  1DVC A;  3HK4 A;  1NJI 4;  3VGN A;  1X1U A;  2KF5 A;  1SQW A;  2IY2 A;  3AGN A;  3DGO A;  1W2B 2;  2Z77 A;  4STD A;  5D83 A;  1PFP A;  1DMN A;  3JUQ A;  1I8V A;  1WMO A;  1J2B A;  2BMQ B;  1B2U A;  4DKI A;  2W03 A;  3MG1 A;  4N6U A;  1OHP A;  5AEW B;  3F7S A;  1N5P A;  5DRV A;  5CK6 A;  2QIY A;  3LH4 A;  2B1X B;  2W04 A;  3CCQ 3;  3G0K A;  5IG5 A;  4I5Q A;  2HMK B;  4XDV A;  3MKI A;  1ASK A;  3WMD A;  3EF8 A;  3URP A;  3DGM A;  2WO0 A;  3X41 A;  2R41 A;  1WQL B;  2WOF A;  4WYK B;  2BU4 A;  1Q42 A;  2CFW A;  3CPO A;  2F86 B;  3LYG A;  1W6G A;  3CCL 3;  3A76 A;  2R4I A;  4I4K A;  5BU4 A;  2OTJ 3;  3CC4 3;  1BRH A;  2CG0 A;  4X2H A;  1EQK A;  1NU3 A;  1UUV B;  1BU4 A;  3LT8 A;  2GU3 A;  1O7W B;  3KKG A;  1W5Z A;  1IK3 A;  2OTL 3;  4BL3 A;  2CK3 H;  4LEH A;  1JB4 A;  1O7N B;  4WYK A;  3LTD A;  4EV5 A;  2RCD A;  8RNT A;  1I3F A;  1NB3 I;  1RGH A;  3EN1 B;  1JJ2 2;  3F40 A;  1RGG A;  2PNC A;  1RNT A;  3GZX B;  1N8R 4;  1BSE A;  4NPB A;  3K9M C;  5KP3 A;  2XSH B;  1KQS 2;  1GYB A;  3FG3 A;  2CH9 A;  5LC6 A;  1IV9 A;  1IVW A;  1UDI I;  1CEW I;  1WTH A;  2F4Y A;  1LQG C;  3G4S 3;  1VQ6 3;  4EW5 A;  2W2C A;  3DUK A;  1M1K 4;  1YVS A;  3OXA A;  4KFF A;  1FGR A;  1Q81 4;  1BSC A;  3AHW A;  3B8L A;  3OWS A;  5IG3 A;  1B2M A;  4K90 B;  1DYU A;  1PYL A;  5A0O B;  1G96 A;  1TUH A;  1BRN L;  1K73 4;  4BTX A;  3JVC A;  2UX0 A;  1F8N A;  4RNY A;  1ZO2 A;  2KF3 A;  4WFO A;  2GBW B;  2I9W A;  2Z6B A;  1I0X A;  2CIU A;  5AIH A;  5JPU A;  3ECF A;  1FUT A;  2BO9 B;  1QJG A;  1STF I;  1UCJ A;  4LGQ A;  5M1A A;  3F8H A;  4FMD A;  1E3R A;  3ZFZ A;  2YFI B;  1A2K A;  4LSO A;  4KZ1 A;  5RNT A;  3KCH A;  3WHO A;  3ER7 A;  3DM8 A;  1UUW B;  2HOH A;  2W9Q A;  3KN4 A;  3M8C A;  4HM0 B;  4HZ9 B;  4ORL A;  3BU4 A;  7RNT A;  3X3X A;  4MMX B;  1RJO A;  4O2H A;  1M90 4;  1CYU A;  3NM2 A;  1LOW A;  1R4Y A;  4HM3 B;  3B4P A;  2F5W A;  1W2Z A;  1TP6 A;  3AHS A;  2JQ5 A;  3EN8 A;  3HOH A;  1EUI C;  6RNT A;  5AEU B;  1VQL 3;  3DGY A;  2IA7 A;  1V57 A;  4U13 A;  1IDP A;  1GY5 A;  1B3S A;  3NQZ A;  1RGC A;  3WDG B;  4LZI A;  1MWS A;  1ROA A;  1S5A A;  1RLS A;  3H51 A;  1US1 A;  1O7M B;  1I2F A;  3HIG A;  3EJV A;  4HJL B;  1KSI A;  4LMI A;  4HVN A;  3UL5 A;  4WHA A;  3S5C A;  4HM2 B;  1TU5 A;  1UUG B;  1GMP A;  1YNV X;  2BNG A;  2STD A;  1BSB A;  1RCL A;  1NWW A;  4EV2 A;  1JB2 A;  3MG2 A;  3STD A;  2FGT A;  1OCV A;  3A5E A;  3SOA A;  4CJN A;  3JUM A;  2GBX B;  5AII A;  1UGH I;  3T8N A;  2YFJ B;  1CH0 A;  3O8Y A;  1SPU A;  3K63 A;  1A67 A;  3NX0 A;  1RDS A;  3BNC A;  1JKG B;  3PZW A;  2YX9 A;  3NM7 A;  1D6Z A;  4RZM A;  3VSY A;  2OQE C;  4XDW A;  1YHQ 3;  1LNI A;  4R9K A;  4FCJ A;  3GSP A;  2KF4 A;  1BUQ A;  2KRT A;  1EA2 A;  3LOY A;  1O7G B;  1LOX A;  1W00 A;  3EHC A;  4HYZ A;  2OQE A;  1BRI A;  5G1L A;  3AGO A;  3T8U A;  2W6J H;  3HZP A;  2RNT A;  1JKG A;  4KVH A;  2XF3 A;  2YFL B;  1B20 A;  1YJN 3;  2CG1 A;  1B2X A;  2CC3 A;  4KT3 B;  3MWZ A;  1A2P A;  2UUG C;  4CDL A;  1SJW A;  2GEY A;  1BNG A;  1WNH A;  1ZGX A;  3K0Z A;  3IMA B;  3IJE B;  1B2S A;  4CPK A;  1VQN 3;  1S72 3;  3F8X A;  3PYJ A;  2CWV A;  2W0Q A;  3X3Y A;  1VQQ A;  1OAC A;  3G8Z A;  3CCM 3;  3BND A;  4LYL B;  1TTO A;  1NO3 A;  2INX A;  4WP5 A;  1W4N A;  1VQO 3;  3LT9 A;  5EEO A;  1HYF A;  2M7O A;  3GZB A;  3GZY B;  1ZS7 A;  2K0M A;  3NBJ A;  3EB8 A;  3NHX A;  4O8S A;  4EYC A;  3EQQ B;  3HII A;  1RMS A;  1M9G A;  3KE7 A;  1B27 A;  3N9H A;  2QGU A;  3J7Y d;  5AIG A;  2RSX A;  1BIR A;  4EXR A;  1VQ8 3;  5BVB A;  4HM6 B;  1TRQ A;  2F99 A;  3S27 A;  4HM8 B;  4WWU C;  1RGF A;  1ROV A;  3MPH A;  1AY7 A;  2ZDJ A;  3OWU A;  4L8O A;  1A2V A;  2A15 A;  2BMR B;  1SAR A;  3UL6 A;  3HX8 A;  1BNS A;  5STD A;  1DMM A;  4N6T A;  2F5M A;  4TX4 A;  1RN4 A;  3SXX A;  1G0T A;  2E2T A;  4RNZ A;  1KD1 4;  1BNR A;  1K9M 4;  3CME 3;  1CYV A;  4J5G A;  2KCD A;  1B21 A;  1BSA A;  3F9S A;  3CC2 3;  1Q82 4;  3FZW A;  3V99 A;  1W02 A;  2IUJ A;  1STD A;  1MNL A;  3CNM A;  3FSD A;  4IPB A;  1W6C A;  1IU7 A;  3T0U A;  3EBT A;  5LC7 A;  1IQY A;  3D9R A;  4R4K A;  1W01 A;  4NRE A;  1UCI A;  3BB9 A;  5IF6 A; 
#chains in the Genus database with same CATH homology
 3CXC 2;  1GY6 A;  1ISK A;  3WA2 X;  1DVD A;  3I56 3;  4K1U A;  1GY7 A;  5IEO A;  4HM1 B;  4R9L A;  4GB5 A;  4FMB A;  4L8P A;  1UI7 A;  3LTB A;  2CFK A;  3ALA A;  4H3U A;  4N6L A;  4FCM A;  4XBY A;  4MMZ B;  1E97 A;  3UB1 A;  4BTW A;  2JDI H;  3FG4 A;  4HM4 B;  5G2G A;  3S29 A;  1AV4 A;  1VQ9 3;  5JBS A;  3SX1 A;  4Q53 A;  2XR8 B;  3FLJ A;  4HBR A;  3CD6 3;  1OPY A;  3JUP A;  2WOH A;  1N8Q A;  1PU4 A;  4O3V A;  1E3V A;  1T5Y A;  4CCV A;  1OGZ A;  3FF2 A;  2P38 A;  3GAX A;  4N3V A;  2F98 A;  4MJD A;  1KC8 4;  3FH1 A;  1U5O A;  1HU9 A;  2OOV C;  1YIJ 3;  3U97 A;  2IUK A;  2GEX A;  2XSO B;  3D3L A;  3LTA A;  2RFR A;  1W6Y A;  2P0M A;  1VQ7 3;  1QAK A;  4L7K A;  2OOV A;  3F14 A;  4HKV B;  3KSE D;  3BNE A;  1VQP 3;  3MHE A;  1LVN A;  3PGB A;  2WGO A;  2CFD A;  5EQL A;  4EBG A;  5CF2 A;  5EVH A;  1OGX A;  3PCS A;  1GD3 A;  3BLZ A;  1OH0 A;  5CXO A;  5D82 A;  3CU3 A;  3N54 B;  4HM5 B;  4MEI A;  2GU1 A;  2XGN A;  1RN7 A;  4AKY A;  1JRQ A;  4R80 A;  2ML5 A;  2CW9 A;  3KZT A;  3Q2P A;  1K41 A;  1OHS A;  1L5G B;  2HMN B;  4EC6 A;  2XFS A;  3KSP A;  4AEQ A;  2FXT A;  3NBR A;  5KP4 A;  3Q90 A;  3IPT A;  3MSO A;  2QA4 3;  2KXG A;  1M1X B;  3FF0 A;  1YJW 3;  4N6V 0;  1MOL A;  1IQX A;  1FGO A;  1TFK A;  3LZA A;  2XFT A;  1Q40 B;  2L4V A;  2SBL A;  3PS8 A;  2CHC A;  3TDG A;  4N6O B;  3CNX A;  3PCR A;  2OWP A;  3JUN A;  2BHM A;  4R1K A;  1WMN A;  1OF5 B;  4IT7 A;  1QVG 2;  4QWT A;  1Q40 A;  4K61 A;  3QRD A;  1GD4 A;  5HGR A;  2V1L A;  1OUN A;  3L0R A;  2MF7 A;  1IV7 A;  6STD A;  3X40 A;  1Q7Y 4;  1AVL A;  1QAL A;  3E99 A;  4GL6 A;  1OF5 A;  3CCR 3;  3I55 3;  2ML6 A;  3NBB A;  1U8C B;  1QMA A;  1OHO A;  1YGE A;  1VQ4 3;  2E2V A;  3S67 A;  1FA3 A;  4KFE A;  2O3O A;  1ULI B;  2CFG A;  3KII A;  3RDE A;  3CCS 3;  4OUQ A;  2XEP A;  4XB5 A;  4ZM8 A;  1TIJ A;  1Q86 4;  4FCZ A;  1UW1 A;  5AYR B;  1FUW A;  3RGR A;  1EKM A;  1DMQ A;  2GXF A;  5ELJ A;  4RBN A;  5CF1 A;  3ROB A;  1RRH A;  1IT8 A;  2C11 A;  4N6M A;  3FKA A;  2K54 A;  3LXU X;  3DGN A;  5IW9 A;  4K1V A;  3MG3 A;  2OCT A;  8CHO A;  3FCS B;  5IEP A;  3NV0 B;  2CWT A;  2IMJ A;  3WOD G;  4J9A A;  2XH9 A;  3SVA A;  1IVV A;  3AMO B;  4BTY A;  2XRX B;  3FGY A;  4O02 B;  2C10 A;  3CC7 3;  1K28 A;  2B24 B;  3JUO A;  2Y74 A;  4JRF A;  1O7P B;  1RKY A;  3NV0 A;  2E2U A;  3FG1 A;  2CFL A;  3VF1 A;  5BXQ A;  3AMO A;  3EBY A;  1NDO B;  3G16 A;  1C7H A;  3F7X A;  1VQ5 3;  1TFO A;  3X42 A;  2FNQ A;  1ZX2 A;  7STD A;  3G71 3;  4NHF A;  3GRD A;  5ELU A;  5JPP A;  3OX9 A;  1O7H B;  1SIH A;  1Y4K A;  4HM7 B;  2BMO B;  3CCU 3;  3OW2 2;  2P05 A;  1NB5 I;  3UJM A;  5AIF A;  1Z1S A;  3EC9 A;  3CPW 2;  3K5T A;  1A90 A;  2W56 B;  3H3H A;  1N9E A;  4MMY B;  3EX9 A;  3LTC A;  3RGA A;  1VQM 3;  2W9P A;  1VQK 3;  3CMA 3;  3B4O A;  3NUV A;  2WGQ A;  3DXO A;  2ZL8 A;  4KFD A;  3U1W A;  2W56 A;  3OV4 A;  3G6E 3;  5IG4 A;  4FMC A;  2Z7A A;  5AYS C;  4OK0 A;  4G1M B;  4XBT A;  1CQS A;  1VZZ A;  3BNB A;  1D6Y A;  2P09 A;  3V92 A;  3DGL A;  3K7C A;  1ULJ B;  1YIT 3;  2CWU A;  1RRL A;  3LML A;  4HZB B;  1KWI A;  1SII A;  3Q1C A;  5FW5 A;  5DRE A;  2QEX 3;  3V98 A;  1FGQ A;  3EE1 A;  2HMM B;  1R4C A;  2P0X A;  4J8T A;  3NXJ A;  1YI2 3;  2LYX A;  2O9U X;  1IVU A;  3DZL A;  3N8B A;  3QK9 A;  4X2O A;  3UNL A;  1QVF 2;  1IT7 A;  2CKF B;  3GZR A;  3S28 A;  3MYT A;  5D81 A;  5IER A;  2HML B;  4XM4 A;  3I0Y A;  2LQV A;  3SOY A;  1JN5 B;  1QAF A;  3PXM A;  1N9J A;  4PEJ A;  1EG9 B;  4AKZ A;  1YJ9 3;  4FMA A;  4H61 A;  1UI8 A;  2HMJ B;  3OWY A;  1AVK A;  4XBX A;  1LXE A;  1D6U A;  1JN5 A;  4IIA A;  5IEN A;  3WA3 A;  1FGT A;  3DY5 A;  3CCV 3;  5I97 A;  1AR0 A;  2BT3 A;  5CLK A;  3GWR A;  5AI1 A;  1V74 A;  2D42 A;  2RGQ A;  2D1W A;  1N5H A;  1HKX A;  3KFQ C;  4FR9 A;  1K8A 4;  5TGN A;  1WMP A;  5KP1 A;  3SLU A;  2MC8 A;  1JNQ A;  1IVX A;  3WOE B;  1IQ8 A;  3HI7 A;  1GS3 A;  1LNH A;  2Y73 A;  4JF8 A;  3DMC A;  1JB5 A;  2XGL A;  3NQY A;  4N6N B;  3WOF B;  5IG0 A;  3CCJ 3;  1W7C A;  1JV2 B;  2PZV A;  3B7C A;  3SED A;  4OVM A;  5FGO A;  3CCE 3;  1YVB I;  3X3Z A;  2Z76 A;  1FGM A;  2Q07 A;  2HMO B;  1DVC A;  3HK4 A;  1NJI 4;  3VGN A;  1SQW A;  3DGO A;  1W2B 2;  2Z77 A;  4STD A;  5D83 A;  1PFP A;  1DMN A;  3JUQ A;  1WMO A;  1J2B A;  2BMQ B;  2W03 A;  3MG1 A;  4N6U A;  1OHP A;  5AEW B;  3F7S A;  1N5P A;  5DRV A;  5CK6 A;  2QIY A;  3LH4 A;  2B1X B;  2W04 A;  3CCQ 3;  3G0K A;  5IG5 A;  2HMK B;  4XDV A;  3MKI A;  1ASK A;  3WMD A;  3EF8 A;  3DGM A;  2WO0 A;  3X41 A;  1WQL B;  2WOF A;  4WYK B;  1Q42 A;  2CFW A;  3CPO A;  2F86 B;  3LYG A;  1W6G A;  3CCL 3;  3A76 A;  2R4I A;  4I4K A;  2OTJ 3;  3CC4 3;  2CG0 A;  4X2H A;  1EQK A;  1NU3 A;  1UUV B;  3LT8 A;  2GU3 A;  1O7W B;  3KKG A;  1W5Z A;  1IK3 A;  2OTL 3;  2CK3 H;  4LEH A;  1JB4 A;  1O7N B;  4WYK A;  3LTD A;  4EV5 A;  2RCD A;  1NB3 I;  3EN1 B;  1JJ2 2;  3F40 A;  2PNC A;  3GZX B;  1N8R 4;  3K9M C;  5KP3 A;  2XSH B;  1KQS 2;  1GYB A;  3FG3 A;  2CH9 A;  5LC6 A;  1IV9 A;  1IVW A;  3G4S 3;  1CEW I;  1WTH A;  1VQ6 3;  2W2C A;  3DUK A;  1M1K 4;  3OXA A;  4KFF A;  1FGR A;  1Q81 4;  3B8L A;  3OWS A;  5IG3 A;  4K90 B;  1DYU A;  5A0O B;  1G96 A;  1TUH A;  1K73 4;  4BTX A;  3JVC A;  2UX0 A;  1F8N A;  4RNY A;  1ZO2 A;  4WFO A;  2GBW B;  2I9W A;  2Z6B A;  2CIU A;  5AIH A;  5JPU A;  3ECF A;  2BO9 B;  1QJG A;  1STF I;  4LGQ A;  3F8H A;  4FMD A;  1E3R A;  2YFI B;  1A2K A;  4LSO A;  4KZ1 A;  3ER7 A;  3DM8 A;  1UUW B;  2W9Q A;  3KN4 A;  3M8C A;  4HM0 B;  4HZ9 B;  4ORL A;  3X3X A;  4MMX B;  1RJO A;  4O2H A;  1M90 4;  1CYU A;  3NM2 A;  4HM3 B;  3B4P A;  1W2Z A;  1TP6 A;  2JQ5 A;  3EN8 A;  5AEU B;  1VQL 3;  2IA7 A;  4U13 A;  1IDP A;  1GY5 A;  3NQZ A;  3WDG B;  4LZI A;  1ROA A;  1S5A A;  3H51 A;  1US1 A;  1O7M B;  3HIG A;  3EJV A;  4HJL B;  1KSI A;  4LMI A;  4HVN A;  3UL5 A;  4WHA A;  3S5C A;  4HM2 B;  1TU5 A;  2STD A;  2BNG A;  1NWW A;  4EV2 A;  1JB2 A;  3MG2 A;  3STD A;  2FGT A;  1OCV A;  3SOA A;  3JUM A;  2GBX B;  5AII A;  3T8N A;  2YFJ B;  3O8Y A;  1SPU A;  3K63 A;  1A67 A;  3NX0 A;  3BNC A;  1JKG B;  3PZW A;  2YX9 A;  3NM7 A;  1D6Z A;  4RZM A;  3VSY A;  2OQE C;  4XDW A;  1YHQ 3;  4R9K A;  4FCJ A;  1BUQ A;  2KRT A;  1EA2 A;  3LOY A;  1O7G B;  1LOX A;  1W00 A;  3EHC A;  4HYZ A;  2OQE A;  3T8U A;  2W6J H;  3HZP A;  1JKG A;  4KVH A;  2XF3 A;  2YFL B;  1YJN 3;  2CG1 A;  2CC3 A;  3MWZ A;  4CDL A;  1SJW A;  2GEY A;  1WNH A;  3K0Z A;  3IMA B;  3IJE B;  1VQN 3;  1S72 3;  3F8X A;  3PYJ A;  2CWV A;  2W0Q A;  3X3Y A;  1OAC A;  3G8Z A;  3CCM 3;  3BND A;  1NO3 A;  2INX A;  4WP5 A;  1W4N A;  1VQO 3;  3LT9 A;  5EEO A;  2M7O A;  3GZB A;  3GZY B;  3NBJ A;  2K0M A;  3NHX A;  3EB8 A;  4O8S A;  4EYC A;  3EQQ B;  3HII A;  1M9G A;  3KE7 A;  3N9H A;  2QGU A;  3J7Y d;  5AIG A;  2RSX A;  4EXR A;  1VQ8 3;  5BVB A;  4HM6 B;  2F99 A;  3S27 A;  4HM8 B;  4WWU C;  1ROV A;  3MPH A;  2ZDJ A;  3OWU A;  4L8O A;  1A2V A;  2A15 A;  2BMR B;  3UL6 A;  3HX8 A;  5STD A;  1DMM A;  4N6T A;  4TX4 A;  3SXX A;  2E2T A;  4RNZ A;  1KD1 4;  1K9M 4;  3CME 3;  1CYV A;  2KCD A;  3F9S A;  1Q82 4;  3CC2 3;  3FZW A;  3V99 A;  1W02 A;  2IUJ A;  1STD A;  1MNL A;  3CNM A;  3FSD A;  4IPB A;  1W6C A;  1IU7 A;  3T0U A;  3EBT A;  5LC7 A;  1IQY A;  3D9R A;  4R4K A;  1W01 A;  4NRE A;  3BB9 A;  5IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...