3ECFA

Crystal structure of an ntf2-like protein (ava_4193) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
ATEKYHEILKKYFLSFETGDFSQVQFSCNLEFLSPISGNTLKGTEEVIPFLKGVTTRVAEVNIMSTTVEYPRASGVWQMRTTKGTLYTLHNFFRLDEEGIVYVWPMFDPKAVMENPDALIQWLTGKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like Protein
publication title Crystal structure of NTF2-like Protein (YP_324687.1) from ANABAENA VARIABILIS ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Unknown function
total genus 38
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16247 DUF4904 Domain of unknown function (DUF4904)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ecfA00
5BVBA 3F8HA 1ULJB 1Z1SA 2QGUA 2GXFA 5IG5A 3NHXA 5CLKA 3OX9A 2JQ5A 2PZVA 4WP5A 2QIYA 5IEPA 3NM2A 3G0KA 1TP6A 3GWRA 2YFLB 3JUPA 3HZPA 4OVMA 5AIFA 3G8ZA 2GEXA 2F99A 1O7PB 1OH0A 1ZO2A 3NBRA 3K0ZA 2RFRA 4R1KA 1ISKA 4RZMA 3WMDA 4HM7B 4HVNA 1K41A 3EQQB 3CNMA 3CU3A 5CF2A 3B8LA 3FLJA 2R4IA 4KVHA 1BUQA 3FF2A 2F98A 2XRXB 4MJDA 1E3VA 3MSOA 4STDA 5D81A 3T8UA 5DRVA 1OF5A 5G2GA 1GS3A 1WQLB 1JKGB 3H3HA 3FH1A 2HMKB 3CNXA 1O7MB 3B4PA 5JPPA 3FGYA 3JUNA 1W02A 5IF6A 2B1XB 4CDLA 2I9WA 5AI1A 2A15A 3EBYA 3DM8A 3UNLA 1Q40A 3M8CA 3JUOA 2CKFB 3I0YA 4XBTA 2GBXB 3KKGA 3F9SA 3MKIA 4FCMA 2GBWB 1ULIB 4X2HA 3G16A 3ECFA 1QMAA 2HMLB 3F40A 4ORLA 3EJVA 1JB5A 2Z77A 1EA2A 3RGRA 1JKGA 1AR0A 4U13A 3DZLA 3JUQA 4XB5A 1JB2A 2BNGA 2IMJA 3OWUA 4XDWA 1W00A 4WWUC 1OHPA 5D83A 1OF5B 3GZYB 3CPOA 2CHCA 3FKAA 5IERA 3MG1A 4K1UA 1DMMA 3MG3A 3EN8A 5HGRA 2YFIB 2RGQA 2Z7AA 2STDA 3GRDA 1Q40B 5JPUA 2HMNB 2HMMB 3H51A 3F8XA 3SOYA 3HK4A 1TUHA 3BLZA 3UJMA 4K1VA 1OUNA 3KE7A 1UUVB 4R9LA 3MG2A 3OXAA 4L8OA 2HMOB 4XDVA 3NV0B 3ER7A 1GY7A 5IENA 2UX0A 5IEOA 5KP1A 1E3RA 3F14A 2Z76A 4R9KA 5KP4A 2GEYA 2XSOB 3ROBA 1O7GB 3GZRA 4L8PA 4HKVB 3K7CA 5CK6A 3MYTA 7STDA 2F86B 1S5AA 1ASKA 1SJWA 1O7HB 3LYGA 2INXA 3DUKA 1VZZA 5KP3A 1A2KA 4HJLB 5BXQA 1HKXA 5IG4A 4FCJA 5AEUB 3VGNA 3NV0A 5CF1A 4PEJA 5EVHA 8CHOA 1CQSA 4J8TA 3SEDA 4WYKA 4IIAA 2YFJB 3OV4A 4HM4B 3F7XA 3RGAA 3OWYA 3EX9A 1EG9B 1OHSA 2B24B 4I4KA 1OGXA 6STDA 5IG3A 3STDA 3NXJA 3LZAA 3DXOA 3GZBA 4H3UA 4GB5A 1ZX2A 5AIHA 4OUQA 2RCDA 3FZWA 3Q90A 4LMIA 2XSHB 3EBTA 1W6YA 2BMRB 4HM5B 4HM3B 3EN1B 1JN5B 2OWPA 4N3VA 1NWWA 2BMOB 3S5CA 1O7NB 1U5OA 3NUVA 1JB4A 5AIIA 3SOAA 1OPYA 3FSDA 4XM4A 4X2OA 2XR8B 3KSPA 5IG0A 4WYKB 1C7HA 4Q53A 3B4OA 3VSYA 1O7WB 1GYBA 3EC9A 1NDOB 3KZTA 3OWSA 1NU3A 5STDA 3EF8A 1IDPA 1OGZA 3BB9A 4XBYA 1GY5A 5D82A 5AIGA 4HM6B 4XBXA 4HZ9B 3HX8A 5FW5A 2BMQB 4L7KA 1W01A 1UUWB 1OCVA 3MHEA 3EHCA 1OHOA 1JN5A 1Q42A 5DREA 1STDA 5CXOA 3DMCA 1DMNA 4HM2B 3D9RA 5TGNA 3JUMA 3GZXB 3FF0A 4HZBB 4HM0B 1DMQA 3E99A 3A76A 2K54A 5AEWB 4J9AA 4LGQA 1QJGA 4LEHA 2HMJB 4HM1B 1GY6A 3T8NA 4HM8B 1E97A 3F7SA 2W2CA 3B7CA 3IPTA
chains in the Genus database with same CATH superfamily
1VQ63 1I2GA 4K90B 1RDSA 3U1WA 5BVBA 2HOHA 3F8HA 1S723 1ULJB 1MWSA 1Z1SA 2QGUA 4BTXA 3PZWA 1B2XA 1BRSA 1UI8A 4TX4A 2GXFA 5IG5A 3NHXA 5CLKA 3OX9A 2JQ5A 2PZVA 3BIRA 4WP5A 2QIYA 5IEPA 3NM2A 3G0KA 1TP6A 3D5GA 5AYRB 3FCSB 5G1LA 1FGMA 3X42A 3GWRA 1IT7A 4RNZA 2YFLB 1TFKA 3JUPA 3RDEA 3CCM3 1RGCA 3HZPA 4OVMA 1RGFA 2E2UA 5AIFA 1V57A 1X1XA 2GU1A 1N5HA 2BHMA 2GEXA 3G8ZA 3IJEB 3DGLA 1UCKA 1IQ8A 2F99A 1O7PB 1OH0A 2W9PA 1RGKA 2XEPA 1ZO2A 4NPBA 3NBRA 1AV4A 1B2UA 3BNEA 3K0ZA 2OTL3 3CXC2 3UB1A 2RFRA 1UDII 4R1KA 1K28A 1ISKA 2SARA 4RZMA 3WMDA 4HM7B 4MMZB 5RNTA 4HVNA 3SVAA 2BT3A 3PCRA 1K41A 3CCS3 3EQQB 1VQ83 2XF3A 1IVXA 3HIIA 2L1SA 3G6E3 3CCJ3 3CNMA 1ROAA 1Q7HA 1I2EA 1NNVA 3CU3A 5CF2A 4NHFA 3B8LA 1J2BA 2FXTA 4J5KA 2CG1A 3FLJA 4CPKA 1EQKA 1MWUA 3A5EA 1N9JA 2R4IA 3CCE3 3PXMA 1GSPA 4KVHA 3D5IA 1BUQA 1UUGB 3K5TA 3QK9A 2KAAA 2OQEC 2F98A 3FF2A 3AHWA 2XRXB 1VQ73 5LC7A 1U8CB 1A90A 3GSPA 4N6LA 4MJDA 1VQ53 2C11A 1E3VA 4JRFA 2P0MA 3MSOA 4STDA 5D81A 1QAFA 3T8UA 5DRVA 4BIRA 1AQZA 1BNRA 1OF5A 2OOVC 4KFFA 5G2GA 3TDGA 2P0XA 4R4KA 1GS3A 1IVUA 1Q814 3IPTA 1WQLB 4KT3B 1JKGB 3H3HA 3PCSA 5FGOA 3FH1A 2HMKB 1TIJA 4IPBA 3CNXA 3WHOA 4EBGA 1LNHA 1O7MB 3B4PA 5JPPA 3FGYA 1K734 2W56B 1GOUA 3JUNA 3CPW2 1X1YA 1W02A 2CFKA 3UL5A 2CG0A 5IF6A 1UI7A 2B1XB 2WO0A 3ZG5A 1GD3A 1MWRA 3LTAA 4CDLA 1WTHA 1KWIA 1D6YA 4EW5A 2I9WA 5AI1A 2A15A 2H0IA 2OTJ3 1W2B2 1VQM3 2KCDA 3CCV3 2BIRA 1RN1A 3EBYA 1KSIA 3DM8A 1L5GB 3UNLA 4MEIA 4MMXB 1IV9A 3FG1A 1SIIA 3WOEB 1N9EA 1I0XA 1Q40A 3M8CA 1CYUA 1G96A 3K9MC 3JUOA 3Q3FA 4EYCA 1QALA 1GOYA 3EB8A 1VQL3 2CKFB 1QVF2 1GMQA 3I0YA 3JVCA 4XBTA 2GBXB 4RNYA 2F4YA 5LC6A 3V92A 2KF4A 3KKGA 3F9SA 3T0UA 1FGTA 3MKIA 4BU4A 1B20A 1BSEA 1LOXA 4FCMA 2GBWB 1M9GA 2W03A 3LOYA 1ULIB 3SLUA 4X2HA 3ECFA 3G16A 1QMAA 4K61A 1DVCA 2RNTA 4WFOA 5M18A 2HMLB 1M1K4 2XFSA 1VQO3 1RCKA 3F40A 4ORLA 1N8R4 1RMSA 3EJVA 2KXGA 3D79A 3DGOA 3I553 1JB5A 1B21A 1N5PA 2D42A 1GOVA 2Z77A 1BRJA 1EA2A 1NB3I 1JKGA 1AR0A 4U13A 3DZLA 3RGRA 3JUQA 4XB5A 1JB2A 2CWVA 1AVLA 1DE3A 1B2ZA 2BNGA 2IMJA 2W56A 3OWUA 2CX1A 7GSPA 2AADA 1EEJA 2FGTA 4XDWA 3CC73 3ZFZA 1W00A 2Z6BA 4KZ1A 1VQ43 4WWUC 1I3IA 3LT9A 3X40A 2CW9A 1YVSA 1YGEA 3LH4A 1GD4A 1ZS7A 1YJ93 1X1UA 2CIUA 1GMRA 1OHPA 1BSAA 1EUIC 2ZDJA 3IMAB 1OF5B 2CK3H 2CWUA 5D83A 1I0VA 3GZYB 5BIRA 1BNIA 3CPOA 2CHCA 3S29A 1JJ22 3CC43 4N6OB 1IVVA 2W6JH 3FKAA 1LOYA 3QRDA 2CFWA 2RBIA 2IYJA 3X3YA 5IERA 1BANA 3MG1A 2W04A 2L4VA 3WA2X 4K1UA 1DMMA 1CH0A 3CCL3 1YI23 3BNDA 2W9QA 2H0GA 3MG3A 3EN8A 3WDGB 1Q9EA 5HGRA 2YFIB 1YHQ3 2RGQA 3SXXA 1IT8A 4O8SA 2Z7AA 4O02B 4AKZA 3WODG 1UCLA 3O8YA 2QA43 2STDA 4GHOA 3X3ZA 5ELJA 5I97A 3GRDA 3J7Yd 3WOFB 4BL3A 1Q40B 1UGHI 1R4CA 1RTUA 2O3OA 1YJW3 5JPUA 4GSPA 2HMNB 4HOHA 2HMMB 3X3XA 3H51A 3LTDA 3HIGA 4HAAA 4N6MA 2OQEA 5JBSA 2FNQA 3F8XA 3SOYA 1T5YA 3HK4A 1TUHA 3BLZA 3UJMA 4K1VA 1KQS2 1B3SA 1CEWI 1MGRA 1OUNA 2QEX3 1PY3A 2UGIA 3KE7A 1UUVB 1ROVA 1VQK3 4R9LA 3MG2A 1K8A4 3K63A 1Q864 1B2SA 2AAEA 3OXAA 5BU4A 1RKYA 1VQP3 1KC84 4RNTA 4L8OA 2HMOB 1FGQA 1BSBA 2D1WA 4LZIA 4XDVA 3NQYA 3S27A 1RCLA 1US1A 2KF3A 2ZL8A 1FZUA 3BU4A 2BO9B 3ER7A 3NV0B 4IT7A 4QWTA 5G1KA 1GY7A 5IENA 3CCR3 1BSDA 2UX0A 3CCQ3 5IEOA 5KP1A 1K9M4 6RNTA 1TRQA 1E3RA 2BU4A 3F14A 1BNJA 1LOVA 2Z76A 1GMPA 4R9KA 1M1XB 3BNCA 3Q1CA 5KP4A 5ELUA 2GSPA 3DGNA 2GEYA 2PNCA 1BIRA 4EXRA 2J8XB 3URPA 1B27A 1I3FA 2KF6A 2XSOB 1EKMA 3ROBA 1O7GB 3GZRA 4BTWA 1RGHA 8RNTA 3G4S3 4L8PA 1JZOA 1Q7Y4 3DGYA 4ILFA 4HKVB 3K7CA 5CK6A 3G713 1IK3A 1NB5I 3MYTA 7STDA 3LTBA 1STFI 1LOWA 4N6UA 2IY2A 1JV2B 3D3LA 1YGWA 1NJI4 2KRTA 2WGOA 2F86B 1S5AA 1BGSA 1ASKA 1BVIA 4ZM8A 5M19A 2CFGA 3CCU3 4BTYA 1SJWA 1O7HB 1SQWA 2F5WA 3LYGA 4FR9A 1UCIA 2INXA 1VQN3 1G0TA 1RGEA 3DUKA 1M904 1BOXA 1Q824 1VZZA 3N8BA 5KP3A 1OACA 5EEOA 1A2KA 4H61A 3S67A 3S28A 4HJLB 2Y74A 3U97A 5BXQA 1HKXA 4DKIA 2RSXA 5IG4A 1A2VA 1RGLA 1RN4A 4FCJA 4GL6A 1FUSA 3V99A 1LQMB 5AYSC 5AEUB 3VGNA 1W7CA 3NV0A 3PS8A 5CF1A 4PEJA 3GAXA 5EVHA 3I563 1BSCA 2CFDA 4AEQA 1RNBA 1T2IA 1W6CA 3DGMA 4CJNA 8CHOA 3EE1A 1CQSA 3MPHA 2IA7A 1HZ1A 1KD14 3NBJA 4J8TA 1PFPA 1W5ZA 3SEDA 1UGIA 2F5MA 4WYKA 1MOLA 1RRHA 2K0MA 2XH9A 2YFJB 2P38A 3OV4A 4HM4B 3F7XA 4IIAA 3RGAA 1BNEA 1QVG2 3OWYA 1IU7A 4EV5A 4KFDA 1YVBI 9RNTA 3AHSA 1JBTA 3EX9A 1EG9B 2MC8A 3FG3A 5GSPA 3N9HA 3CD63 1BAOA 3L0RA 1A67A 1AY7A 3AGNA 2P09A 2ML6A 2ZA4A 1W2ZA 3HI7A 1RN7A 1RSNA 1OHSA 4O3VA 2B24B 2XGLA 1N8QA 1BNSA 2LQVA 3KFQC 1R4YA 1V74A 1ZGXA 1YIJ3 4I4KA 1OGXA 4N6NB 6STDA 3FG4A 1RGGA 5HOHA 1LXEA 4MMYB 3BNBA 1NO3A 1Y4KA 1IVWA 5IG3A 3STDA 3KN4A 3NXJA 4FMDA 3LZAA 3DXOA 3GZBA 3OW22 4H3UA 4GB5A 5IW9A 1X1WA 1ZX2A 3DY5A 5AIHA 3KSED 4OUQA 2RCDA 3KIIA 3KCHA 3FZWA 3Q90A 1WNHA 3WR2A 4LMIA 1A2PA 2XSHB 3EBTA 3X41A 2CWTA 1W6YA 3HOHA 4JF8A 1B2MA 2BMRB 4HM5B 3LXUX 2GU3A 1TU5A 1FW7A 1D6ZA 4HM3B 4WHAA 1IQXA 7RNTA 3CME3 3EN1B 4EC6A 4CCVA 2XFTA 1JN5B 2OWPA 2JDIH 4N3VA 3NQZA 2OCTA 4G1MB 1C54A 1WMOA 4FCZA 5M1AA 2V1LA 3CMA3 1TJDA 1MWTA 2E2TA 2CFLA 1NWWA 1RLSA 2OOVA 2BMOB 3NX0A 3S5CA 1BUJA 5A0OB 1FA3A 4LSOA 3AMOA 3Q2PA 1O7NB 1U5OA 3ALAA 2Q07A 3MWZA 3NUVA 1JNQA 1IV7A 1T3BA 1JB4A 5AIIA 4NREA 3SOAA 1OPYA 1RJOA 3FSDA 4XM4A 2Y73A 1I2FA 4I5QA 1PU4A 1FYSA 1MNLA 2MF7A 4X2OA 1RRLA 1QAKA 2XR8B 3D4AA 3KSPA 5IG0A 4WYKB 1C7HA 4Q53A 3B4OA 3VSYA 1O7WB 1GYBA 1LNIA 3EC9A 3V98A 1YIT3 1NDOB 4R80A 3KZTA 1SARA 4AKYA 1SIHA 1BRGA 3NM7A 1PYLA 3OWSA 4BL2A 1NU3A 3AGOA 5STDA 1BU4A 3EF8A 1FUWA 1IDPA 1TFOA 1FUTA 1BNGA 1OGZA 1W6GA 3BB9A 4XBYA 2W0QA 1GY5A 5D82A 3DH2A 1HYFA 2SBLA 5AIGA 1TRPA 1I70A 1IQYA 4HM6B 1HU9A 4LYLB 4XBXA 4HZ9B 2O9UX 3HX8A 5FW5A 2R41A 1LQGC 2BMQB 3LMLA 4L7KA 1W01A 1BRNL 1DYUA 3NBBA 1UUWB 1JBRA 1OCVA 3MHEA 1D6UA 1SPUA 1FGOA 3EHCA 1OHOA 3LTCA 1UCJA 1JN5A 1Q42A 2P05A 1V58A 2WOFA 5DREA 3UL6A 2UUGC 2WGQA 1TTOA 2ZHXB 1BRKA 1RGAA 6GSPA 3CC23 4EV2A 1STDA 1DETA 2WOHA 2IUKA 1W4NA 3DMCA 4FMCA 5CXOA 1DMNA 4HM2B 3D9RA 4FMBA 5TGNA 1WMNA 1I8VA 3JUMA 1LVNA 4N6TA 3GZXB 1JBSA 1JRQA 2C4BA 1RNTA 5EQLA 3PYJA 3LT8A 2CH9A 2IUJA 3FF0A 4HZBB 4HM0B 4KFEA 1DMQA 2E2VA 1FGRA 2F56A 3E99A 4OK0A 1UW1A 2C10A 1T2HA 3RNTA 3SX1A 3A76A 4FMAA 2K54A 5AEWB 1F8NA 4RBNA 1MGWA 4J9AA 4LGQA 1YJN3 1QJGA 4HYZA 4LEHA 1JZDA 1BNFA 2M7OA 2HMJB 2CC3A 4HM1B 3AMOB 1GY6A 3PGBA 1G02A 1CYVA 2CX0A 1VQ93 1YNVX 1LRAA 2LYXA 2XGNA 2YX9A 2K3DA 2KF5A 3T8NA 3SYUA 1DVDA 4HM8B 1AVKA 1E97A 1WMPA 3F7SA 1IYYA 1BRHA 2W2CA 3WA3A 2H0HA 3VF1A 1BRIA 2ML5A 3N54B 3B7CA 4HBRA 1VQQA 4O2HA 4J5GA 4N6V0 3ZG0A 1RHLA
chains in the Genus database with same CATH topology
1VQ63 4K90B 3U1WA 5BVBA 3F8HA 1S723 1ULJB 1Z1SA 2QGUA 4BTXA 3PZWA 1UI8A 4TX4A 2GXFA 5IG5A 3NHXA 5CLKA 3OX9A 2JQ5A 2PZVA 4WP5A 2QIYA 5IEPA 3NM2A 3G0KA 1TP6A 5AYRB 3FCSB 1FGMA 3X42A 3GWRA 1IT7A 4RNZA 2YFLB 1TFKA 3JUPA 3RDEA 3CCM3 3HZPA 4OVMA 2E2UA 5AIFA 2GU1A 3G8ZA 3IJEB 1N5HA 2BHMA 2GEXA 4FMCA 3DGLA 1IQ8A 2F99A 1O7PB 1OH0A 2W9PA 2XEPA 1ZO2A 3NBRA 1AV4A 3BNEA 3K0ZA 2OTL3 3CXC2 3UB1A 2RFRA 4R1KA 1K28A 1ISKA 4RZMA 3WMDA 4HM7B 4MMZB 4HVNA 3SVAA 2BT3A 3PCRA 1K41A 3CCS3 3EQQB 1VQ83 2XF3A 1IVXA 3HIIA 3G6E3 3CCJ3 3CNMA 1ROAA 3CU3A 5CF2A 1J2BA 4NHFA 3B8LA 2FXTA 2CG1A 3FLJA 1EQKA 1N9JA 2R4IA 3CCE3 3PXMA 4KVHA 1BUQA 3K5TA 3QK9A 2OQEC 3FF2A 2F98A 2XRXB 1VQ73 5LC7A 1U8CB 1A90A 4N6LA 4MJDA 1VQ53 2C11A 1E3VA 4JRFA 2P0MA 3MSOA 4STDA 5D81A 1QAFA 3T8UA 5DRVA 1OF5A 2OOVC 4KFFA 5G2GA 3TDGA 2P0XA 4R4KA 1GS3A 1IVUA 1Q814 1WQLB 1JKGB 3H3HA 3PCSA 5FGOA 3FH1A 2HMKB 1TIJA 4IPBA 3CNXA 4EBGA 1LNHA 1O7MB 3B4PA 5JPPA 3FGYA 1K734 2W56B 3CPW2 3JUNA 1W02A 2CFKA 3UL5A 2CG0A 5IF6A 1UI7A 2B1XB 2WO0A 1GD3A 3LTAA 4CDLA 1WTHA 1KWIA 1D6YA 2I9WA 5AI1A 2A15A 2OTJ3 1W2B2 1VQM3 2KCDA 3CCV3 3EBYA 1KSIA 3DM8A 1L5GB 3UNLA 4MEIA 4MMXB 1IV9A 3FG1A 1SIIA 3WOEB 1N9EA 1Q40A 3M8CA 1CYUA 1G96A 3K9MC 3JUOA 4EYCA 1QALA 1VQL3 3EB8A 2CKFB 1QVF2 3I0YA 3JVCA 4XBTA 2GBXB 4RNYA 5LC6A 3V92A 3KKGA 3T0UA 3F9SA 1FGTA 3MKIA 4FCMA 1LOXA 2GBWB 1M9GA 2W03A 3LOYA 1ULIB 3SLUA 4X2HA 3ECFA 3G16A 1QMAA 4K61A 1DVCA 4WFOA 2HMLB 1M1K4 2XFSA 1VQO3 3F40A 4ORLA 1N8R4 3EJVA 2KXGA 3DGOA 3I553 1JB5A 1N5PA 2D42A 2Z77A 1EA2A 1NB3I 1JKGA 1AR0A 4U13A 3DZLA 3RGRA 3JUQA 4XB5A 1JB2A 2CWVA 1AVLA 2BNGA 2IMJA 2W56A 3OWUA 2FGTA 4XDWA 3CC73 2Z6BA 1W00A 4KZ1A 1VQ43 4WWUC 3LT9A 3X40A 2CW9A 1YGEA 3LH4A 1GD4A 1YJ93 2CIUA 1OHPA 5D83A 2ZDJA 3IMAB 1OF5B 2CK3H 2CWUA 3GZYB 3CC43 3CPOA 3S29A 2CHCA 1JJ22 4N6OB 1IVVA 2W6JH 3FKAA 3QRDA 2CFWA 3X3YA 5IERA 3MG1A 2W04A 2L4VA 3WA2X 4K1UA 1DMMA 3CCL3 1YI23 3BNDA 2W9QA 3MG3A 3EN8A 3WDGB 5HGRA 1YHQ3 2YFIB 2RGQA 3SXXA 1IT8A 4O8SA 2Z7AA 4O02B 4AKZA 3WODG 3O8YA 2QA43 2STDA 5I97A 3X3ZA 5ELJA 3GRDA 3J7Yd 3WOFB 1Q40B 1R4CA 1YJW3 2O3OA 5JPUA 2HMNB 2HMMB 3X3XA 3H51A 3LTDA 3HIGA 4N6MA 2OQEA 5JBSA 2FNQA 3F8XA 3SOYA 1T5YA 3HK4A 1TUHA 3BLZA 3UJMA 4K1VA 1KQS2 1CEWI 1OUNA 2QEX3 3KE7A 1UUVB 1ROVA 1VQK3 4R9LA 3MG2A 1K8A4 3K63A 1Q864 1RKYA 1VQP3 3OXAA 1KC84 4L8OA 2HMOB 1FGQA 4LZIA 2D1WA 4XDVA 3NQYA 3S27A 2ZL8A 1US1A 4IT7A 3NV0B 2BO9B 3ER7A 4QWTA 3CCR3 1GY7A 5IENA 2UX0A 3CCQ3 5IEOA 5KP1A 1K9M4 1E3RA 3F14A 2Z76A 4R9KA 1M1XB 3BNCA 3Q1CA 5KP4A 5ELUA 3DGNA 2GEYA 2PNCA 4EXRA 2XSOB 3G4S3 1EKMA 3ROBA 1O7GB 3GZRA 4BTWA 4L8PA 1Q7Y4 4HKVB 3K7CA 5CK6A 3G713 1IK3A 1NB5I 3MYTA 7STDA 3LTBA 1STFI 4N6UA 1JV2B 3D3LA 1NJI4 2KRTA 2WGOA 2F86B 1S5AA 1ASKA 4ZM8A 2CFGA 3CCU3 4BTYA 1SJWA 1O7HB 1SQWA 3LYGA 4FR9A 2INXA 1VQN3 3DUKA 1M904 1Q824 1VZZA 3N8BA 5KP3A 1OACA 5EEOA 1A2KA 4H61A 3S67A 3S28A 4HJLB 2Y74A 3U97A 5BXQA 1HKXA 2RSXA 5IG4A 1A2VA 4FCJA 4GL6A 3V99A 5AYSC 5AEUB 3VGNA 1W7CA 3NV0A 3PS8A 5CF1A 4PEJA 3GAXA 5EVHA 3I563 2CFDA 4AEQA 1W6CA 3DGMA 8CHOA 3EE1A 1CQSA 3MPHA 2IA7A 1KD14 3NBJA 4J8TA 1PFPA 1W5ZA 3SEDA 4WYKA 1MOLA 1RRHA 2K0MA 2XH9A 2YFJB 2P38A 3OV4A 4HM4B 3F7XA 4IIAA 3RGAA 1QVG2 3OWYA 1IU7A 4EV5A 4KFDA 1YVBI 3EX9A 1EG9B 2MC8A 3FG3A 3N9HA 3CD63 3L0RA 1A67A 2P09A 2ML6A 3HI7A 1W2ZA 1RN7A 1OHSA 4O3VA 2B24B 2XGLA 1N8QA 2LQVA 3KFQC 1V74A 1YIJ3 4I4KA 1OGXA 4N6NB 6STDA 3FG4A 1LXEA 4MMYB 3BNBA 1NO3A 1Y4KA 1IVWA 5IG3A 3STDA 3KN4A 3NXJA 4FMDA 3LZAA 3DXOA 3GZBA 3OW22 4H3UA 4GB5A 5IW9A 1ZX2A 3DY5A 5AIHA 3KSED 4OUQA 2RCDA 3KIIA 3FZWA 3Q90A 1WNHA 4LMIA 2XSHB 3EBTA 3X41A 2CWTA 1W6YA 4JF8A 2BMRB 4HM5B 3LXUX 2GU3A 1TU5A 1D6ZA 4HM3B 4WHAA 1IQXA 3CME3 3EN1B 4EC6A 4CCVA 2XFTA 1JN5B 2OWPA 2JDIH 4N3VA 3NQZA 2OCTA 4G1MB 1WMOA 4FCZA 2V1LA 3CMA3 2E2TA 2CFLA 1NWWA 2OOVA 2BMOB 3NX0A 3S5CA 5A0OB 1FA3A 4LSOA 3AMOA 3Q2PA 1O7NB 1U5OA 3ALAA 2Q07A 3MWZA 3NUVA 1JNQA 1IV7A 1JB4A 5AIIA 4NREA 3SOAA 1OPYA 1RJOA 3FSDA 4XM4A 2Y73A 1PU4A 1MNLA 2MF7A 4X2OA 1RRLA 1QAKA 2XR8B 3KSPA 5IG0A 4WYKB 1C7HA 4Q53A 3B4OA 3VSYA 1O7WB 1GYBA 3EC9A 3V98A 1YIT3 1NDOB 4R80A 3KZTA 4AKYA 1SIHA 3NM7A 3OWSA 1NU3A 5STDA 3EF8A 1FUWA 1IDPA 1TFOA 1OGZA 3BB9A 4XBYA 1W6GA 2W0QA 1GY5A 5D82A 2SBLA 5AIGA 1IQYA 4HM6B 1HU9A 4XBXA 4HZ9B 2O9UX 3HX8A 5FW5A 2BMQB 3LMLA 4L7KA 1W01A 1DYUA 3NBBA 1UUWB 1OCVA 3MHEA 1D6UA 1SPUA 1FGOA 3EHCA 1OHOA 3LTCA 2P05A 1JN5A 1Q42A 2WOFA 5DREA 3UL6A 2WGQA 3CC23 4EV2A 1STDA 2WOHA 2IUKA 1W4NA 3DMCA 5CXOA 1DMNA 4HM2B 3D9RA 4FMBA 5TGNA 1WMNA 3JUMA 1LVNA 4N6TA 3GZXB 1JRQA 5EQLA 3PYJA 3LT8A 2CH9A 2IUJA 3FF0A 4HZBB 4HM0B 4KFEA 1DMQA 2E2VA 1FGRA 3E99A 4OK0A 1UW1A 2C10A 3SX1A 3A76A 4FMAA 2K54A 5AEWB 1F8NA 4RBNA 4J9AA 4LGQA 1YJN3 1QJGA 4HYZA 4LEHA 2M7OA 2HMJB 2CC3A 4HM1B 3AMOB 1GY6A 3PGBA 1CYVA 1VQ93 2LYXA 2XGNA 2YX9A 3T8NA 1DVDA 4HM8B 1AVKA 1E97A 1WMPA 3F7SA 2W2CA 3WA3A 3VF1A 2ML5A 3N54B 3B7CA 4HBRA 4O2HA 4N6V0 3IPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVB A;  3F8H A;  1ULJ B;  1Z1S A;  2QGU A;  2GXF A;  5IG5 A;  3NHX A;  5CLK A;  3OX9 A;  2JQ5 A;  2PZV A;  4WP5 A;  2QIY A;  5IEP A;  3NM2 A;  3G0K A;  1TP6 A;  3GWR A;  2YFL B;  3JUP A;  3HZP A;  4OVM A;  5AIF A;  3G8Z A;  2GEX A;  2F99 A;  1O7P B;  1OH0 A;  1ZO2 A;  3NBR A;  3K0Z A;  2RFR A;  4R1K A;  1ISK A;  4RZM A;  3WMD A;  4HM7 B;  4HVN A;  1K41 A;  3EQQ B;  3CNM A;  3CU3 A;  5CF2 A;  3B8L A;  3FLJ A;  2R4I A;  4KVH A;  1BUQ A;  3FF2 A;  2F98 A;  2XRX B;  4MJD A;  1E3V A;  3MSO A;  4STD A;  5D81 A;  3T8U A;  5DRV A;  1OF5 A;  5G2G A;  1GS3 A;  1WQL B;  1JKG B;  3H3H A;  3FH1 A;  2HMK B;  3CNX A;  1O7M B;  3B4P A;  5JPP A;  3FGY A;  3JUN A;  1W02 A;  5IF6 A;  2B1X B;  4CDL A;  2I9W A;  5AI1 A;  2A15 A;  3EBY A;  3DM8 A;  3UNL A;  1Q40 A;  3M8C A;  3JUO A;  2CKF B;  3I0Y A;  4XBT A;  2GBX B;  3KKG A;  3F9S A;  3MKI A;  4FCM A;  2GBW B;  1ULI B;  4X2H A;  3G16 A;  3ECF A;  1QMA A;  2HML B;  3F40 A;  4ORL A;  3EJV A;  1JB5 A;  2Z77 A;  1EA2 A;  3RGR A;  1JKG A;  1AR0 A;  4U13 A;  3DZL A;  3JUQ A;  4XB5 A;  1JB2 A;  2BNG A;  2IMJ A;  3OWU A;  4XDW A;  1W00 A;  4WWU C;  1OHP A;  5D83 A;  1OF5 B;  3GZY B;  3CPO A;  2CHC A;  3FKA A;  5IER A;  3MG1 A;  4K1U A;  1DMM A;  3MG3 A;  3EN8 A;  5HGR A;  2YFI B;  2RGQ A;  2Z7A A;  2STD A;  3GRD A;  1Q40 B;  5JPU A;  2HMN B;  2HMM B;  3H51 A;  3F8X A;  3SOY A;  3HK4 A;  1TUH A;  3BLZ A;  3UJM A;  4K1V A;  1OUN A;  3KE7 A;  1UUV B;  4R9L A;  3MG2 A;  3OXA A;  4L8O A;  2HMO B;  4XDV A;  3NV0 B;  3ER7 A;  1GY7 A;  5IEN A;  2UX0 A;  5IEO A;  5KP1 A;  1E3R A;  3F14 A;  2Z76 A;  4R9K A;  5KP4 A;  2GEY A;  2XSO B;  3ROB A;  1O7G B;  3GZR A;  4L8P A;  4HKV B;  3K7C A;  5CK6 A;  3MYT A;  7STD A;  2F86 B;  1S5A A;  1ASK A;  1SJW A;  1O7H B;  3LYG A;  2INX A;  3DUK A;  1VZZ A;  5KP3 A;  1A2K A;  4HJL B;  5BXQ A;  1HKX A;  5IG4 A;  4FCJ A;  5AEU B;  3VGN A;  3NV0 A;  5CF1 A;  4PEJ A;  5EVH A;  8CHO A;  1CQS A;  4J8T A;  3SED A;  4WYK A;  4IIA A;  2YFJ B;  3OV4 A;  4HM4 B;  3F7X A;  3RGA A;  3OWY A;  3EX9 A;  1EG9 B;  1OHS A;  2B24 B;  4I4K A;  1OGX A;  6STD A;  5IG3 A;  3STD A;  3NXJ A;  3LZA A;  3DXO A;  3GZB A;  4H3U A;  4GB5 A;  1ZX2 A;  5AIH A;  4OUQ A;  2RCD A;  3FZW A;  3Q90 A;  4LMI A;  2XSH B;  3EBT A;  1W6Y A;  2BMR B;  4HM5 B;  4HM3 B;  3EN1 B;  1JN5 B;  2OWP A;  4N3V A;  1NWW A;  2BMO B;  3S5C A;  1O7N B;  1U5O A;  3NUV A;  1JB4 A;  5AII A;  3SOA A;  1OPY A;  3FSD A;  4XM4 A;  4X2O A;  2XR8 B;  3KSP A;  5IG0 A;  4WYK B;  1C7H A;  4Q53 A;  3B4O A;  3VSY A;  1O7W B;  1GYB A;  3EC9 A;  1NDO B;  3KZT A;  3OWS A;  1NU3 A;  5STD A;  3EF8 A;  1IDP A;  1OGZ A;  3BB9 A;  4XBY A;  1GY5 A;  5D82 A;  5AIG A;  4HM6 B;  4XBX A;  4HZ9 B;  3HX8 A;  5FW5 A;  2BMQ B;  4L7K A;  1W01 A;  1UUW B;  1OCV A;  3MHE A;  3EHC A;  1OHO A;  1JN5 A;  1Q42 A;  5DRE A;  1STD A;  5CXO A;  3DMC A;  1DMN A;  4HM2 B;  3D9R A;  5TGN A;  3JUM A;  3GZX B;  3FF0 A;  4HZB B;  4HM0 B;  1DMQ A;  3E99 A;  3A76 A;  2K54 A;  5AEW B;  4J9A A;  4LGQ A;  1QJG A;  4LEH A;  2HMJ B;  4HM1 B;  1GY6 A;  3T8N A;  4HM8 B;  1E97 A;  3F7S A;  2W2C A;  3B7C A;  3IPT A; 
#chains in the Genus database with same CATH topology
 1VQ6 3;  1I2G A;  4K90 B;  1RDS A;  3U1W A;  5BVB A;  2HOH A;  3F8H A;  1S72 3;  1ULJ B;  1MWS A;  1Z1S A;  2QGU A;  4BTX A;  3PZW A;  1B2X A;  1BRS A;  1UI8 A;  4TX4 A;  2GXF A;  5IG5 A;  3NHX A;  5CLK A;  3OX9 A;  2JQ5 A;  2PZV A;  3BIR A;  4WP5 A;  2QIY A;  5IEP A;  3NM2 A;  3G0K A;  1TP6 A;  3D5G A;  5AYR B;  3FCS B;  5G1L A;  1FGM A;  3X42 A;  3GWR A;  1IT7 A;  4RNZ A;  2YFL B;  1TFK A;  3JUP A;  3RDE A;  3CCM 3;  1RGC A;  3HZP A;  4OVM A;  1RGF A;  2E2U A;  5AIF A;  1V57 A;  1X1X A;  2GU1 A;  1N5H A;  2BHM A;  2GEX A;  3G8Z A;  3IJE B;  3DGL A;  1UCK A;  1IQ8 A;  2F99 A;  1O7P B;  1OH0 A;  2W9P A;  1RGK A;  2XEP A;  1ZO2 A;  4NPB A;  3NBR A;  1AV4 A;  1B2U A;  3BNE A;  3K0Z A;  2OTL 3;  3CXC 2;  3UB1 A;  2RFR A;  1UDI I;  4R1K A;  1K28 A;  1ISK A;  2SAR A;  4RZM A;  3WMD A;  4HM7 B;  4MMZ B;  5RNT A;  4HVN A;  3SVA A;  2BT3 A;  3PCR A;  1K41 A;  3CCS 3;  3EQQ B;  1VQ8 3;  2XF3 A;  1IVX A;  3HII A;  2L1S A;  3G6E 3;  3CCJ 3;  3CNM A;  1ROA A;  1Q7H A;  1I2E A;  1NNV A;  3CU3 A;  5CF2 A;  4NHF A;  3B8L A;  1J2B A;  2FXT A;  4J5K A;  2CG1 A;  3FLJ A;  4CPK A;  1EQK A;  1MWU A;  3A5E A;  1N9J A;  2R4I A;  3CCE 3;  3PXM A;  1GSP A;  4KVH A;  3D5I A;  1BUQ A;  1UUG B;  3K5T A;  3QK9 A;  2KAA A;  2OQE C;  2F98 A;  3FF2 A;  3AHW A;  2XRX B;  1VQ7 3;  5LC7 A;  1U8C B;  1A90 A;  3GSP A;  4N6L A;  4MJD A;  1VQ5 3;  2C11 A;  1E3V A;  4JRF A;  2P0M A;  3MSO A;  4STD A;  5D81 A;  1QAF A;  3T8U A;  5DRV A;  4BIR A;  1AQZ A;  1BNR A;  1OF5 A;  2OOV C;  4KFF A;  5G2G A;  3TDG A;  2P0X A;  4R4K A;  1GS3 A;  1IVU A;  1Q81 4;  3IPT A;  1WQL B;  4KT3 B;  1JKG B;  3H3H A;  3PCS A;  5FGO A;  3FH1 A;  2HMK B;  1TIJ A;  4IPB A;  3CNX A;  3WHO A;  4EBG A;  1LNH A;  1O7M B;  3B4P A;  5JPP A;  3FGY A;  1K73 4;  2W56 B;  1GOU A;  3JUN A;  3CPW 2;  1X1Y A;  1W02 A;  2CFK A;  3UL5 A;  2CG0 A;  5IF6 A;  1UI7 A;  2B1X B;  2WO0 A;  3ZG5 A;  1GD3 A;  1MWR A;  3LTA A;  4CDL A;  1WTH A;  1KWI A;  1D6Y A;  4EW5 A;  2I9W A;  5AI1 A;  2A15 A;  2H0I A;  2OTJ 3;  1W2B 2;  1VQM 3;  2KCD A;  3CCV 3;  2BIR A;  1RN1 A;  3EBY A;  1KSI A;  3DM8 A;  1L5G B;  3UNL A;  4MEI A;  4MMX B;  1IV9 A;  3FG1 A;  1SII A;  3WOE B;  1N9E A;  1I0X A;  1Q40 A;  3M8C A;  1CYU A;  1G96 A;  3K9M C;  3JUO A;  3Q3F A;  4EYC A;  1QAL A;  1GOY A;  3EB8 A;  1VQL 3;  2CKF B;  1QVF 2;  1GMQ A;  3I0Y A;  3JVC A;  4XBT A;  2GBX B;  4RNY A;  2F4Y A;  5LC6 A;  3V92 A;  2KF4 A;  3KKG A;  3F9S A;  3T0U A;  1FGT A;  3MKI A;  4BU4 A;  1B20 A;  1BSE A;  1LOX A;  4FCM A;  2GBW B;  1M9G A;  2W03 A;  3LOY A;  1ULI B;  3SLU A;  4X2H A;  3ECF A;  3G16 A;  1QMA A;  4K61 A;  1DVC A;  2RNT A;  4WFO A;  5M18 A;  2HML B;  1M1K 4;  2XFS A;  1VQO 3;  1RCK A;  3F40 A;  4ORL A;  1N8R 4;  1RMS A;  3EJV A;  2KXG A;  3D79 A;  3DGO A;  3I55 3;  1JB5 A;  1B21 A;  1N5P A;  2D42 A;  1GOV A;  2Z77 A;  1BRJ A;  1EA2 A;  1NB3 I;  1JKG A;  1AR0 A;  4U13 A;  3DZL A;  3RGR A;  3JUQ A;  4XB5 A;  1JB2 A;  2CWV A;  1AVL A;  1DE3 A;  1B2Z A;  2BNG A;  2IMJ A;  2W56 A;  3OWU A;  2CX1 A;  7GSP A;  2AAD A;  1EEJ A;  2FGT A;  4XDW A;  3CC7 3;  3ZFZ A;  1W00 A;  2Z6B A;  4KZ1 A;  1VQ4 3;  4WWU C;  1I3I A;  3LT9 A;  3X40 A;  2CW9 A;  1YVS A;  1YGE A;  3LH4 A;  1GD4 A;  1ZS7 A;  1YJ9 3;  1X1U A;  2CIU A;  1GMR A;  1OHP A;  1BSA A;  1EUI C;  2ZDJ A;  3IMA B;  1OF5 B;  2CK3 H;  2CWU A;  5D83 A;  1I0V A;  3GZY B;  5BIR A;  1BNI A;  3CPO A;  2CHC A;  3S29 A;  1JJ2 2;  3CC4 3;  4N6O B;  1IVV A;  2W6J H;  3FKA A;  1LOY A;  3QRD A;  2CFW A;  2RBI A;  2IYJ A;  3X3Y A;  5IER A;  1BAN A;  3MG1 A;  2W04 A;  2L4V A;  3WA2 X;  4K1U A;  1DMM A;  1CH0 A;  3CCL 3;  1YI2 3;  3BND A;  2W9Q A;  2H0G A;  3MG3 A;  3EN8 A;  3WDG B;  1Q9E A;  5HGR A;  2YFI B;  1YHQ 3;  2RGQ A;  3SXX A;  1IT8 A;  4O8S A;  2Z7A A;  4O02 B;  4AKZ A;  3WOD G;  1UCL A;  3O8Y A;  2QA4 3;  2STD A;  4GHO A;  3X3Z A;  5ELJ A;  5I97 A;  3GRD A;  3J7Y d;  3WOF B;  4BL3 A;  1Q40 B;  1UGH I;  1R4C A;  1RTU A;  2O3O A;  1YJW 3;  5JPU A;  4GSP A;  2HMN B;  4HOH A;  2HMM B;  3X3X A;  3H51 A;  3LTD A;  3HIG A;  4HAA A;  4N6M A;  2OQE A;  5JBS A;  2FNQ A;  3F8X A;  3SOY A;  1T5Y A;  3HK4 A;  1TUH A;  3BLZ A;  3UJM A;  4K1V A;  1KQS 2;  1B3S A;  1CEW I;  1MGR A;  1OUN A;  2QEX 3;  1PY3 A;  2UGI A;  3KE7 A;  1UUV B;  1ROV A;  1VQK 3;  4R9L A;  3MG2 A;  1K8A 4;  3K63 A;  1Q86 4;  1B2S A;  2AAE A;  3OXA A;  5BU4 A;  1RKY A;  1VQP 3;  1KC8 4;  4RNT A;  4L8O A;  2HMO B;  1FGQ A;  1BSB A;  2D1W A;  4LZI A;  4XDV A;  3NQY A;  3S27 A;  1RCL A;  1US1 A;  2KF3 A;  2ZL8 A;  1FZU A;  3BU4 A;  2BO9 B;  3ER7 A;  3NV0 B;  4IT7 A;  4QWT A;  5G1K A;  1GY7 A;  5IEN A;  3CCR 3;  1BSD A;  2UX0 A;  3CCQ 3;  5IEO A;  5KP1 A;  1K9M 4;  6RNT A;  1TRQ A;  1E3R A;  2BU4 A;  3F14 A;  1BNJ A;  1LOV A;  2Z76 A;  1GMP A;  4R9K A;  1M1X B;  3BNC A;  3Q1C A;  5KP4 A;  5ELU A;  2GSP A;  3DGN A;  2GEY A;  2PNC A;  1BIR A;  4EXR A;  2J8X B;  3URP A;  1B27 A;  1I3F A;  2KF6 A;  2XSO B;  1EKM A;  3ROB A;  1O7G B;  3GZR A;  4BTW A;  1RGH A;  8RNT A;  3G4S 3;  4L8P A;  1JZO A;  1Q7Y 4;  3DGY A;  4ILF A;  4HKV B;  3K7C A;  5CK6 A;  3G71 3;  1IK3 A;  1NB5 I;  3MYT A;  7STD A;  3LTB A;  1STF I;  1LOW A;  4N6U A;  2IY2 A;  1JV2 B;  3D3L A;  1YGW A;  1NJI 4;  2KRT A;  2WGO A;  2F86 B;  1S5A A;  1BGS A;  1ASK A;  1BVI A;  4ZM8 A;  5M19 A;  2CFG A;  3CCU 3;  4BTY A;  1SJW A;  1O7H B;  1SQW A;  2F5W A;  3LYG A;  4FR9 A;  1UCI A;  2INX A;  1VQN 3;  1G0T A;  1RGE A;  3DUK A;  1M90 4;  1BOX A;  1Q82 4;  1VZZ A;  3N8B A;  5KP3 A;  1OAC A;  5EEO A;  1A2K A;  4H61 A;  3S67 A;  3S28 A;  4HJL B;  2Y74 A;  3U97 A;  5BXQ A;  1HKX A;  4DKI A;  2RSX A;  5IG4 A;  1A2V A;  1RGL A;  1RN4 A;  4FCJ A;  4GL6 A;  1FUS A;  3V99 A;  1LQM B;  5AYS C;  5AEU B;  3VGN A;  1W7C A;  3NV0 A;  3PS8 A;  5CF1 A;  4PEJ A;  3GAX A;  5EVH A;  3I56 3;  1BSC A;  2CFD A;  4AEQ A;  1RNB A;  1T2I A;  1W6C A;  3DGM A;  4CJN A;  8CHO A;  3EE1 A;  1CQS A;  3MPH A;  2IA7 A;  1HZ1 A;  1KD1 4;  3NBJ A;  4J8T A;  1PFP A;  1W5Z A;  3SED A;  1UGI A;  2F5M A;  4WYK A;  1MOL A;  1RRH A;  2K0M A;  2XH9 A;  2YFJ B;  2P38 A;  3OV4 A;  4HM4 B;  3F7X A;  4IIA A;  3RGA A;  1BNE A;  1QVG 2;  3OWY A;  1IU7 A;  4EV5 A;  4KFD A;  1YVB I;  9RNT A;  3AHS A;  1JBT A;  3EX9 A;  1EG9 B;  2MC8 A;  3FG3 A;  5GSP A;  3N9H A;  3CD6 3;  1BAO A;  3L0R A;  1A67 A;  1AY7 A;  3AGN A;  2P09 A;  2ML6 A;  2ZA4 A;  1W2Z A;  3HI7 A;  1RN7 A;  1RSN A;  1OHS A;  4O3V A;  2B24 B;  2XGL A;  1N8Q A;  1BNS A;  2LQV A;  3KFQ C;  1R4Y A;  1V74 A;  1ZGX A;  1YIJ 3;  4I4K A;  1OGX A;  4N6N B;  6STD A;  3FG4 A;  1RGG A;  5HOH A;  1LXE A;  4MMY B;  3BNB A;  1NO3 A;  1Y4K A;  1IVW A;  5IG3 A;  3STD A;  3KN4 A;  3NXJ A;  4FMD A;  3LZA A;  3DXO A;  3GZB A;  3OW2 2;  4H3U A;  4GB5 A;  5IW9 A;  1X1W A;  1ZX2 A;  3DY5 A;  5AIH A;  3KSE D;  4OUQ A;  2RCD A;  3KII A;  3KCH A;  3FZW A;  3Q90 A;  1WNH A;  3WR2 A;  4LMI A;  1A2P A;  2XSH B;  3EBT A;  3X41 A;  2CWT A;  1W6Y A;  3HOH A;  4JF8 A;  1B2M A;  2BMR B;  4HM5 B;  3LXU X;  2GU3 A;  1TU5 A;  1FW7 A;  1D6Z A;  4HM3 B;  4WHA A;  1IQX A;  7RNT A;  3CME 3;  3EN1 B;  4EC6 A;  4CCV A;  2XFT A;  1JN5 B;  2OWP A;  2JDI H;  4N3V A;  3NQZ A;  2OCT A;  4G1M B;  1C54 A;  1WMO A;  4FCZ A;  5M1A A;  2V1L A;  3CMA 3;  1TJD A;  1MWT A;  2E2T A;  2CFL A;  1NWW A;  1RLS A;  2OOV A;  2BMO B;  3NX0 A;  3S5C A;  1BUJ A;  5A0O B;  1FA3 A;  4LSO A;  3AMO A;  3Q2P A;  1O7N B;  1U5O A;  3ALA A;  2Q07 A;  3MWZ A;  3NUV A;  1JNQ A;  1IV7 A;  1T3B A;  1JB4 A;  5AII A;  4NRE A;  3SOA A;  1OPY A;  1RJO A;  3FSD A;  4XM4 A;  2Y73 A;  1I2F A;  4I5Q A;  1PU4 A;  1FYS A;  1MNL A;  2MF7 A;  4X2O A;  1RRL A;  1QAK A;  2XR8 B;  3D4A A;  3KSP A;  5IG0 A;  4WYK B;  1C7H A;  4Q53 A;  3B4O A;  3VSY A;  1O7W B;  1GYB A;  1LNI A;  3EC9 A;  3V98 A;  1YIT 3;  1NDO B;  4R80 A;  3KZT A;  1SAR A;  4AKY A;  1SIH A;  1BRG A;  3NM7 A;  1PYL A;  3OWS A;  4BL2 A;  1NU3 A;  3AGO A;  5STD A;  1BU4 A;  3EF8 A;  1FUW A;  1IDP A;  1TFO A;  1FUT A;  1BNG A;  1OGZ A;  1W6G A;  3BB9 A;  4XBY A;  2W0Q A;  1GY5 A;  5D82 A;  3DH2 A;  1HYF A;  2SBL A;  5AIG A;  1TRP A;  1I70 A;  1IQY A;  4HM6 B;  1HU9 A;  4LYL B;  4XBX A;  4HZ9 B;  2O9U X;  3HX8 A;  5FW5 A;  2R41 A;  1LQG C;  2BMQ B;  3LML A;  4L7K A;  1W01 A;  1BRN L;  1DYU A;  3NBB A;  1UUW B;  1JBR A;  1OCV A;  3MHE A;  1D6U A;  1SPU A;  1FGO A;  3EHC A;  1OHO A;  3LTC A;  1UCJ A;  1JN5 A;  1Q42 A;  2P05 A;  1V58 A;  2WOF A;  5DRE A;  3UL6 A;  2UUG C;  2WGQ A;  1TTO A;  2ZHX B;  1BRK A;  1RGA A;  6GSP A;  3CC2 3;  4EV2 A;  1STD A;  1DET A;  2WOH A;  2IUK A;  1W4N A;  3DMC A;  4FMC A;  5CXO A;  1DMN A;  4HM2 B;  3D9R A;  4FMB A;  5TGN A;  1WMN A;  1I8V A;  3JUM A;  1LVN A;  4N6T A;  3GZX B;  1JBS A;  1JRQ A;  2C4B A;  1RNT A;  5EQL A;  3PYJ A;  3LT8 A;  2CH9 A;  2IUJ A;  3FF0 A;  4HZB B;  4HM0 B;  4KFE A;  1DMQ A;  2E2V A;  1FGR A;  2F56 A;  3E99 A;  4OK0 A;  1UW1 A;  2C10 A;  1T2H A;  3RNT A;  3SX1 A;  3A76 A;  4FMA A;  2K54 A;  5AEW B;  1F8N A;  4RBN A;  1MGW A;  4J9A A;  4LGQ A;  1YJN 3;  1QJG A;  4HYZ A;  4LEH A;  1JZD A;  1BNF A;  2M7O A;  2HMJ B;  2CC3 A;  4HM1 B;  3AMO B;  1GY6 A;  3PGB A;  1G02 A;  1CYV A;  2CX0 A;  1VQ9 3;  1YNV X;  1LRA A;  2LYX A;  2XGN A;  2YX9 A;  2K3D A;  2KF5 A;  3T8N A;  3SYU A;  1DVD A;  4HM8 B;  1AVK A;  1E97 A;  1WMP A;  3F7S A;  1IYY A;  1BRH A;  2W2C A;  3WA3 A;  2H0H A;  3VF1 A;  1BRI A;  2ML5 A;  3N54 B;  3B7C A;  4HBR A;  1VQQ A;  4O2H A;  4J5G A;  4N6V 0;  3ZG0 A;  1RHL A; 
#chains in the Genus database with same CATH homology
 1VQ6 3;  4K90 B;  3U1W A;  5BVB A;  3F8H A;  1S72 3;  1ULJ B;  1Z1S A;  2QGU A;  4BTX A;  3PZW A;  1UI8 A;  4TX4 A;  2GXF A;  5IG5 A;  3NHX A;  5CLK A;  3OX9 A;  2JQ5 A;  2PZV A;  4WP5 A;  2QIY A;  5IEP A;  3NM2 A;  3G0K A;  1TP6 A;  5AYR B;  3FCS B;  1FGM A;  3X42 A;  3GWR A;  1IT7 A;  4RNZ A;  2YFL B;  1TFK A;  3JUP A;  3RDE A;  3CCM 3;  3HZP A;  4OVM A;  2E2U A;  5AIF A;  2GU1 A;  3G8Z A;  3IJE B;  1N5H A;  2BHM A;  2GEX A;  4FMC A;  3DGL A;  1IQ8 A;  2F99 A;  1O7P B;  1OH0 A;  2W9P A;  2XEP A;  1ZO2 A;  3NBR A;  1AV4 A;  3BNE A;  3K0Z A;  2OTL 3;  3CXC 2;  3UB1 A;  2RFR A;  4R1K A;  1K28 A;  1ISK A;  4RZM A;  3WMD A;  4HM7 B;  4MMZ B;  4HVN A;  3SVA A;  2BT3 A;  3PCR A;  1K41 A;  3CCS 3;  3EQQ B;  1VQ8 3;  2XF3 A;  1IVX A;  3HII A;  3G6E 3;  3CCJ 3;  3CNM A;  1ROA A;  3CU3 A;  5CF2 A;  1J2B A;  4NHF A;  3B8L A;  2FXT A;  2CG1 A;  3FLJ A;  1EQK A;  1N9J A;  2R4I A;  3CCE 3;  3PXM A;  4KVH A;  1BUQ A;  3K5T A;  3QK9 A;  2OQE C;  3FF2 A;  2F98 A;  2XRX B;  1VQ7 3;  5LC7 A;  1U8C B;  1A90 A;  4N6L A;  4MJD A;  1VQ5 3;  2C11 A;  1E3V A;  4JRF A;  2P0M A;  3MSO A;  4STD A;  5D81 A;  1QAF A;  3T8U A;  5DRV A;  1OF5 A;  2OOV C;  4KFF A;  5G2G A;  3TDG A;  2P0X A;  4R4K A;  1GS3 A;  1IVU A;  1Q81 4;  1WQL B;  1JKG B;  3H3H A;  3PCS A;  5FGO A;  3FH1 A;  2HMK B;  1TIJ A;  4IPB A;  3CNX A;  4EBG A;  1LNH A;  1O7M B;  3B4P A;  5JPP A;  3FGY A;  1K73 4;  2W56 B;  3CPW 2;  3JUN A;  1W02 A;  2CFK A;  3UL5 A;  2CG0 A;  5IF6 A;  1UI7 A;  2B1X B;  2WO0 A;  1GD3 A;  3LTA A;  4CDL A;  1WTH A;  1KWI A;  1D6Y A;  2I9W A;  5AI1 A;  2A15 A;  2OTJ 3;  1W2B 2;  1VQM 3;  2KCD A;  3CCV 3;  3EBY A;  1KSI A;  3DM8 A;  1L5G B;  3UNL A;  4MEI A;  4MMX B;  1IV9 A;  3FG1 A;  1SII A;  3WOE B;  1N9E A;  1Q40 A;  3M8C A;  1CYU A;  1G96 A;  3K9M C;  3JUO A;  4EYC A;  1QAL A;  1VQL 3;  3EB8 A;  2CKF B;  1QVF 2;  3I0Y A;  3JVC A;  4XBT A;  2GBX B;  4RNY A;  5LC6 A;  3V92 A;  3KKG A;  3T0U A;  3F9S A;  1FGT A;  3MKI A;  4FCM A;  1LOX A;  2GBW B;  1M9G A;  2W03 A;  3LOY A;  1ULI B;  3SLU A;  4X2H A;  3ECF A;  3G16 A;  1QMA A;  4K61 A;  1DVC A;  4WFO A;  2HML B;  1M1K 4;  2XFS A;  1VQO 3;  3F40 A;  4ORL A;  1N8R 4;  3EJV A;  2KXG A;  3DGO A;  3I55 3;  1JB5 A;  1N5P A;  2D42 A;  2Z77 A;  1EA2 A;  1NB3 I;  1JKG A;  1AR0 A;  4U13 A;  3DZL A;  3RGR A;  3JUQ A;  4XB5 A;  1JB2 A;  2CWV A;  1AVL A;  2BNG A;  2IMJ A;  2W56 A;  3OWU A;  2FGT A;  4XDW A;  3CC7 3;  2Z6B A;  1W00 A;  4KZ1 A;  1VQ4 3;  4WWU C;  3LT9 A;  3X40 A;  2CW9 A;  1YGE A;  3LH4 A;  1GD4 A;  1YJ9 3;  2CIU A;  1OHP A;  5D83 A;  2ZDJ A;  3IMA B;  1OF5 B;  2CK3 H;  2CWU A;  3GZY B;  3CC4 3;  3CPO A;  3S29 A;  2CHC A;  1JJ2 2;  4N6O B;  1IVV A;  2W6J H;  3FKA A;  3QRD A;  2CFW A;  3X3Y A;  5IER A;  3MG1 A;  2W04 A;  2L4V A;  3WA2 X;  4K1U A;  1DMM A;  3CCL 3;  1YI2 3;  3BND A;  2W9Q A;  3MG3 A;  3EN8 A;  3WDG B;  5HGR A;  1YHQ 3;  2YFI B;  2RGQ A;  3SXX A;  1IT8 A;  4O8S A;  2Z7A A;  4O02 B;  4AKZ A;  3WOD G;  3O8Y A;  2QA4 3;  2STD A;  5I97 A;  3X3Z A;  5ELJ A;  3GRD A;  3J7Y d;  3WOF B;  1Q40 B;  1R4C A;  1YJW 3;  2O3O A;  5JPU A;  2HMN B;  2HMM B;  3X3X A;  3H51 A;  3LTD A;  3HIG A;  4N6M A;  2OQE A;  5JBS A;  2FNQ A;  3F8X A;  3SOY A;  1T5Y A;  3HK4 A;  1TUH A;  3BLZ A;  3UJM A;  4K1V A;  1KQS 2;  1CEW I;  1OUN A;  2QEX 3;  3KE7 A;  1UUV B;  1ROV A;  1VQK 3;  4R9L A;  3MG2 A;  1K8A 4;  3K63 A;  1Q86 4;  1RKY A;  1VQP 3;  3OXA A;  1KC8 4;  4L8O A;  2HMO B;  1FGQ A;  4LZI A;  2D1W A;  4XDV A;  3NQY A;  3S27 A;  2ZL8 A;  1US1 A;  4IT7 A;  3NV0 B;  2BO9 B;  3ER7 A;  4QWT A;  3CCR 3;  1GY7 A;  5IEN A;  2UX0 A;  3CCQ 3;  5IEO A;  5KP1 A;  1K9M 4;  1E3R A;  3F14 A;  2Z76 A;  4R9K A;  1M1X B;  3BNC A;  3Q1C A;  5KP4 A;  5ELU A;  3DGN A;  2GEY A;  2PNC A;  4EXR A;  2XSO B;  3G4S 3;  1EKM A;  3ROB A;  1O7G B;  3GZR A;  4BTW A;  4L8P A;  1Q7Y 4;  4HKV B;  3K7C A;  5CK6 A;  3G71 3;  1IK3 A;  1NB5 I;  3MYT A;  7STD A;  3LTB A;  1STF I;  4N6U A;  1JV2 B;  3D3L A;  1NJI 4;  2KRT A;  2WGO A;  2F86 B;  1S5A A;  1ASK A;  4ZM8 A;  2CFG A;  3CCU 3;  4BTY A;  1SJW A;  1O7H B;  1SQW A;  3LYG A;  4FR9 A;  2INX A;  1VQN 3;  3DUK A;  1M90 4;  1Q82 4;  1VZZ A;  3N8B A;  5KP3 A;  1OAC A;  5EEO A;  1A2K A;  4H61 A;  3S67 A;  3S28 A;  4HJL B;  2Y74 A;  3U97 A;  5BXQ A;  1HKX A;  2RSX A;  5IG4 A;  1A2V A;  4FCJ A;  4GL6 A;  3V99 A;  5AYS C;  5AEU B;  3VGN A;  1W7C A;  3NV0 A;  3PS8 A;  5CF1 A;  4PEJ A;  3GAX A;  5EVH A;  3I56 3;  2CFD A;  4AEQ A;  1W6C A;  3DGM A;  8CHO A;  3EE1 A;  1CQS A;  3MPH A;  2IA7 A;  1KD1 4;  3NBJ A;  4J8T A;  1PFP A;  1W5Z A;  3SED A;  4WYK A;  1MOL A;  1RRH A;  2K0M A;  2XH9 A;  2YFJ B;  2P38 A;  3OV4 A;  4HM4 B;  3F7X A;  4IIA A;  3RGA A;  1QVG 2;  3OWY A;  1IU7 A;  4EV5 A;  4KFD A;  1YVB I;  3EX9 A;  1EG9 B;  2MC8 A;  3FG3 A;  3N9H A;  3CD6 3;  3L0R A;  1A67 A;  2P09 A;  2ML6 A;  3HI7 A;  1W2Z A;  1RN7 A;  1OHS A;  4O3V A;  2B24 B;  2XGL A;  1N8Q A;  2LQV A;  3KFQ C;  1V74 A;  1YIJ 3;  4I4K A;  1OGX A;  4N6N B;  6STD A;  3FG4 A;  1LXE A;  4MMY B;  3BNB A;  1NO3 A;  1Y4K A;  1IVW A;  5IG3 A;  3STD A;  3KN4 A;  3NXJ A;  4FMD A;  3LZA A;  3DXO A;  3GZB A;  3OW2 2;  4H3U A;  4GB5 A;  5IW9 A;  1ZX2 A;  3DY5 A;  5AIH A;  3KSE D;  4OUQ A;  2RCD A;  3KII A;  3FZW A;  3Q90 A;  1WNH A;  4LMI A;  2XSH B;  3EBT A;  3X41 A;  2CWT A;  1W6Y A;  4JF8 A;  2BMR B;  4HM5 B;  3LXU X;  2GU3 A;  1TU5 A;  1D6Z A;  4HM3 B;  4WHA A;  1IQX A;  3CME 3;  3EN1 B;  4EC6 A;  4CCV A;  2XFT A;  1JN5 B;  2OWP A;  2JDI H;  4N3V A;  3NQZ A;  2OCT A;  4G1M B;  1WMO A;  4FCZ A;  2V1L A;  3CMA 3;  2E2T A;  2CFL A;  1NWW A;  2OOV A;  2BMO B;  3NX0 A;  3S5C A;  5A0O B;  1FA3 A;  4LSO A;  3AMO A;  3Q2P A;  1O7N B;  1U5O A;  3ALA A;  2Q07 A;  3MWZ A;  3NUV A;  1JNQ A;  1IV7 A;  1JB4 A;  5AII A;  4NRE A;  3SOA A;  1OPY A;  1RJO A;  3FSD A;  4XM4 A;  2Y73 A;  1PU4 A;  1MNL A;  2MF7 A;  4X2O A;  1RRL A;  1QAK A;  2XR8 B;  3KSP A;  5IG0 A;  4WYK B;  1C7H A;  4Q53 A;  3B4O A;  3VSY A;  1O7W B;  1GYB A;  3EC9 A;  3V98 A;  1YIT 3;  1NDO B;  4R80 A;  3KZT A;  4AKY A;  1SIH A;  3NM7 A;  3OWS A;  1NU3 A;  5STD A;  3EF8 A;  1FUW A;  1IDP A;  1TFO A;  1OGZ A;  3BB9 A;  4XBY A;  1W6G A;  2W0Q A;  1GY5 A;  5D82 A;  2SBL A;  5AIG A;  1IQY A;  4HM6 B;  1HU9 A;  4XBX A;  4HZ9 B;  2O9U X;  3HX8 A;  5FW5 A;  2BMQ B;  3LML A;  4L7K A;  1W01 A;  1DYU A;  3NBB A;  1UUW B;  1OCV A;  3MHE A;  1D6U A;  1SPU A;  1FGO A;  3EHC A;  1OHO A;  3LTC A;  2P05 A;  1JN5 A;  1Q42 A;  2WOF A;  5DRE A;  3UL6 A;  2WGQ A;  3CC2 3;  4EV2 A;  1STD A;  2WOH A;  2IUK A;  1W4N A;  3DMC A;  5CXO A;  1DMN A;  4HM2 B;  3D9R A;  4FMB A;  5TGN A;  1WMN A;  3JUM A;  1LVN A;  4N6T A;  3GZX B;  1JRQ A;  5EQL A;  3PYJ A;  3LT8 A;  2CH9 A;  2IUJ A;  3FF0 A;  4HZB B;  4HM0 B;  4KFE A;  1DMQ A;  2E2V A;  1FGR A;  3E99 A;  4OK0 A;  1UW1 A;  2C10 A;  3SX1 A;  3A76 A;  4FMA A;  2K54 A;  5AEW B;  1F8N A;  4RBN A;  4J9A A;  4LGQ A;  1YJN 3;  1QJG A;  4HYZ A;  4LEH A;  2M7O A;  2HMJ B;  2CC3 A;  4HM1 B;  3AMO B;  1GY6 A;  3PGB A;  1CYV A;  1VQ9 3;  2LYX A;  2XGN A;  2YX9 A;  3T8N A;  1DVD A;  4HM8 B;  1AVK A;  1E97 A;  1WMP A;  3F7S A;  2W2C A;  3WA3 A;  3VF1 A;  2ML5 A;  3N54 B;  3B7C A;  4HBR A;  4O2H A;  4N6V 0;  3IPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...