3ECFA

Crystal structure of an ntf2-like protein (ava_4193) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'ATEKYHEILKKYFLSFETGDFSQVQFSCNLEFLSPISGNTLKGTEEVIPFLKGVTTRVAEVNIMSTTVEYPRASGVWQMRTTKGTLYTLHNFFRLDEEGIVYVWPMFDPKAVMENPDALIQWLTGKDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like Protein
publication title Crystal structure of NTF2-like Protein (YP_324687.1) from ANABAENA VARIABILIS ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Unknown function
total genus 38
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16247 DUF4904 Domain of unknown function (DUF4904)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ecfA00
3BLZA 3GZXB 5AIFA 2HMKB 4J8TA 4U13A 1EA2A 1O7MB 2HMOB 3OXAA 5D83A 2QGUA 1NDOB 1E3RA 1JKGB 3EQQB 1STDA 2BMRB 3MG3A 2YFLB 3STDA 4HKVB 2XRXB 3G8ZA 2A15A 5STDA 1SJWA 3UNLA 3OWYA 2GEXA 4HZBB 2QIYA 2Z77A 4HM3B 3CPOA 3GZBA 2HMJB 3CNXA 1TUHA 2BMQB 1EG9B 1ZX2A 1Q40A 5DREA 3OX9A 1C7HA 2XSOB 5KP4A 1OHOA 3H3HA 3FF0A 1UUWB 4WP5A 5TGNA 1K41A 1S5AA 1GS3A 3DXOA 4GB5A 3WMDA 4XBTA 2INXA 1UUVB 3NXJA 4HM6B 1VZZA 3GZYB 1E3VA 5JPPA 3F7SA 3JUQA 4HM8B 5AIGA 4IIAA 4RZMA 3HX8A 2GBXB 1O7WB 4HM0B 4WWUC 1JN5A 3T8NA 1U5OA 3MG1A 3MYTA 3F14A 3G0KA 1OGZA 5IG3A 3FZWA 4HM4B 3JUNA 4R9KA 3FSDA 5AIHA 1QJGA 1ZO2A 1JKGA 3KE7A 4HJLB 5IERA 3CU3A 3KKGA 3MHEA 3SOYA 3KSPA 3M8CA 2HMLB 3CNMA 3DMCA 5KP1A 4STDA 3IPTA 5G2GA 4L8PA 5HGRA 4LEHA 4LMIA 1OF5B 2RCDA 4XB5A 4FCMA 3SOAA 1W6YA 3EBYA 3Q90A 1GY7A 1O7PB 3EN1B 5FW5A 4XBXA 1ISKA 4KVHA 3FLJA 3LYGA 5IG0A 6STDA 1O7GB 5CLKA 5AIIA 3KZTA 3JUPA 5IG4A 5CK6A 1O7HB 3JUOA 3HZPA 4PEJA 5CF1A 4L7KA 5IEOA 4LGQA 3F8HA 5IG5A 1OGXA 1TP6A 1AR0A 2XSHB 2BMOB 4MJDA 4K1UA 4J9AA 1NWWA 4FCJA 5AI1A 1W02A 3VGNA 4H3UA 3SEDA 3EC9A 3MKIA 3EF8A 2YFJB 4WYKB 2R4IA 2XR8B 4X2OA 1CQSA 1GY5A 3A76A 3JUMA 5KP3A 3NM2A 5DRVA 1O7NB 2B1XB 3ECFA 1OHSA 3EX9A 1DMMA 3EHCA 2K54A 2Z7AA 1GY6A 1HKXA 4X2HA 1BUQA 2PZVA 1A2KA 1JB5A 3MSOA 4L8OA 5D81A 1OF5A 1DMNA 4OVMA 2CKFB 3F7XA 4OUQA 2W2CA 2OWPA 3F8XA 3B4PA 4N3VA 3GZRA 3D9RA 2HMMB 2JQ5A 4XM4A 2STDA 3NHXA 1WQLB 3NV0B 3BB9A 3EJVA 2Z76A 3VSYA 3H51A 3OWSA 3F9SA 2GEYA 2RFRA 8CHOA 2CHCA 1OH0A 2GXFA 3GRDA 4XDWA 4HVNA 1ULJB 4HM2B 1JB2A 1ASKA 3G16A 2YFIB 1DMQA 4XDVA 3K7CA 3I0YA 3NUVA 5AEUB 1E97A 4WYKA 5D82A 5JPUA 3FKAA 1GYBA 3K0ZA 3GWRA 3UJMA 3ROBA 3OWUA 3E99A 3S5CA 3OV4A 3EBTA 4ORLA 3DZLA 4R1KA 4K1VA 1Z1SA 2F86B 1QMAA 3ER7A 2UX0A 3HK4A 2F99A 3DUKA 3B7CA 1Q40B 4CDLA 5IF6A 1W00A 1IDPA 2GBWB 4XBYA 4HZ9B 1OCVA 2I9WA 1OHPA 1NU3A 1W01A 3FH1A 3LZAA 4HM5B 5EVHA 3DM8A 3T8UA 4R9LA 3FF2A 3MG2A 5IENA 2F98A 4HM1B 4I4KA 2BNGA 7STDA 4Q53A 5CXOA 2RGQA 1Q42A 3B8LA 4HM7B 5IEPA 3NV0A 2HMNB 3FGYA 5CF2A 3RGAA 5AEWB 3EN8A 3B4OA 1JB4A 1OPYA 3NBRA 1OUNA 2IMJA 3F40A 5BXQA 1JN5B 1ULIB 2B24B 5BVBA 3RGRA
chains in the Genus database with same CATH superfamily
2D42A 4QWTA 5M19A 3BLZA 2UUGC 4N6V0 3GZXB 3CCU3 1BRNL 2J8XB 5AIFA 2PNCA 2HMKB 2XF3A 4J8TA 4U13A 1EA2A 1SIIA 3NX0A 3ZG0A 1O7MB 2HMOB 1RLSA 3OXAA 1GMPA 3LOYA 5D83A 1RGFA 2QGUA 4K61A 1NDOB 4KT3B 1UGIA 1E3RA 1VQ43 4HOHA 1AVKA 1RN1A 1IQYA 1BRSA 1VQO3 1JKGB 4HAAA 1DVDA 3EQQB 1I0VA 1MWSA 1SARA 3AGOA 1STDA 3X3ZA 2BMRB 1STFI 4WHAA 1TIJA 3MG3A 1AY7A 1BRHA 2CFWA 1WMOA 2YFLB 3I563 3IJEB 1BGSA 3STDA 2XH9A 1LQGC 3CCQ3 1QVG2 1BSCA 4HKVB 2XRXB 3G8ZA 1LOYA 1V58A 2W0QA 3AMOA 2C11A 4O2HA 3S29A 2A15A 1T3BA 3CC73 2CG0A 5STDA 1BANA 3RDEA 4BTYA 1YJ93 1FW7A 1C54A 2RNTA 3LT9A 4MMYB 1SJWA 3UNLA 1RGCA 1T2HA 1W2ZA 3OWYA 3AGNA 1MWTA 4EV2A 2GEXA 2XEPA 4HZBB 2W9PA 1B21A 3DGYA 3AHSA 4BU4A 3X41A 2WOFA 2QIYA 2Z77A 4HM3B 5ELJA 3X40A 3CPOA 3GZBA 5BIRA 1GD3A 3RNTA 2HMJB 2KF6A 3CNXA 3SLUA 3DY5A 2OOVC 1WNHA 1TUHA 2BMQB 1EG9B 1Q40A 1ZX2A 1D6ZA 1LOVA 5DREA 2IUJA 5EEOA 3OX9A 1C7HA 2XSOB 5KP4A 1M1K4 1BNGA 1GSPA 2CIUA 3BNDA 2LYXA 1UW1A 3DGOA 4CPKA 4ZM8A 1QALA 1OHOA 3IMAB 4FMAA 3H3HA 4BL3A 2L4VA 3FF0A 4FR9A 6GSPA 1UUWB 4WP5A 2W56A 2YX9A 5TGNA 1BRKA 1K41A 1S5AA 3UL6A 1PYLA 1GS3A 3DXOA 3L0RA 1BSEA 4LSOA 4GB5A 3WMDA 3CCV3 3MWZA 1NNVA 1PU4A 4XBTA 4G1MB 2INXA 3PS8A 3X3XA 1I3IA 2IUKA 5BU4A 1F8NA 1UUVB 3NXJA 1FGQA 1TRQA 2Y74A 4HM6B 3WA3A 1Q814 3D5GA 1A2PA 1T2IA 3ZG5A 1VZZA 1WMNA 2OQEC 3D3LA 1IYYA 2KAAA 1Y4KA 5A0OB 1Q864 2CC3A 4KFDA 1MWRA 3GZYB 1E3VA 2SARA 3ZFZA 1Q7HA 2OCTA 3NBBA 1MOLA 4N6UA 5JPPA 3F7SA 1KD14 3JUQA 1B20A 4EV5A 1JJ22 1X1UA 4HM8B 1LXEA 5AIGA 1A90A 1RCKA 2ML6A 1N9JA 4IIAA 3CD63 4RZMA 3FG4A 2C10A 2CWVA 3BNCA 1GMRA 1Q9EA 1KQS2 1RDSA 3D5IA 3HX8A 1HYFA 2GBXB 2AADA 4WFOA 2IA7A 3SVAA 1CYVA 1O7WB 4HM0B 1JBRA 1VQ53 3S27A 1QAKA 1A2VA 4WWUC 1JN5A 2D1WA 2F5MA 4GHOA 3T8NA 3U1WA 4K90B 2H0HA 3VF1A 3CXC2 1KC84 1U5OA 3S67A 4IPBA 2OOVA 1T5YA 3MG1A 3MYTA 3F14A 7GSPA 3G0KA 1OGZA 2F5WA 5IG3A 3MPHA 1N8R4 1ROVA 3FZWA 1VQP3 1JZDA 2FNQA 4TX4A 4HM4B 2P09A 1I2GA 3JUNA 4R9KA 4J5KA 1FUWA 1IVVA 3FSDA 2IYJA 5AIHA 1KSIA 1QAFA 2KF5A 5AYSC 1QJGA 1L5GB 1VQN3 1UCJA 4JF8A 3Q2PA 2GU3A 1ZO2A 1VQ63 1JKGA 3G4S3 4JRFA 4MEIA 3KE7A 4HJLB 3X3YA 5BVBA 1GOYA 5IERA 3CU3A 3KKGA 4N6OB 3MHEA 3SOYA 1M9GA 3KSPA 2K0MA 3M8CA 1YVBI 2HMLB 2OQEA 1YI23 3CNMA 1YNVX 3DMCA 4RNTA 4BL2A 5KP1A 3UB1A 1KWIA 5M1AA 4STDA 3IPTA 1TTOA 5G2GA 4L8PA 5HGRA 1EEJA 2LQVA 5RNTA 4LEHA 4LMIA 2BIRA 1WTHA 1BNRA 3A5EA 3LT8A 1OF5B 2RCDA 4XB5A 1N8QA 4FCMA 1X1WA 3SOAA 3TDGA 1W6YA 1IVUA 1VQ73 1K8A4 4R4KA 3AHWA 3EBYA 3Q90A 3HI7A 1GY7A 3G713 1O7PB 2KXGA 1VQL3 4O3VA 3N54B 1B2SA 3EN1B 4N6NB 5FW5A 4XBXA 1ISKA 4LZIA 4KVHA 2MC8A 3FLJA 2WGOA 2W03A 3LYGA 5IG0A 1RGEA 2WO0A 1IU7A 1DYUA 4DKIA 2IY2A 3N9HA 1VQK3 6STDA 1RHLA 1O7GB 1VQM3 3J7Yd 3FG1A 5CLKA 2L1SA 2CFDA 5AIIA 2WGQA 1RKYA 1IT7A 1RGGA 3QRDA 2FXTA 2SBLA 3KZTA 3JUPA 4AKZA 5LC6A 1G0TA 1V74A 3T0UA 5IG4A 1IVXA 4N6TA 5CK6A 1UUGB 1O7HB 1BSAA 2CFKA 3JUOA 2CFGA 2E2UA 4HBRA 3HZPA 3WODG 4PEJA 4CCVA 1CH0A 5CF1A 4L7KA 1X1YA 5LC7A 5IEOA 1D6YA 3BU4A 4LGQA 1G96A 3F8HA 5G1KA 5IG5A 3K63A 1RGLA 1JV2B 1OGXA 1TP6A 1AR0A 2E2VA 3KN4A 2Y73A 1AQZA 1MGWA 2GSPA 3LTBA 2XSHB 2CWUA 5M18A 2BMOB 3Q3FA 4MJDA 1YJN3 1B2MA 4K1UA 2KRTA 3BIRA 4J9AA 1NWWA 4FCJA 3OW22 2CX1A 5AI1A 1BNJA 1I3FA 3Q1CA 4IT7A 1W02A 3NM7A 1BRGA 1SQWA 2QEX3 3VGNA 2XGNA 1Q824 4BTWA 1IV7A 1JZOA 3DH2A 4H3UA 3SEDA 3CC43 1I70A 1RSNA 1NB3I 1BRJA 1JBTA 1R4CA 1D6UA 2W6JH 1PFPA 3EC9A 1UCIA 1V57A 3MKIA 3EF8A 2YFJB 1CEWI 1RGAA 1EQKA 1B2XA 4WYKB 1UI8A 4RBNA 2R4IA 2XR8B 2OTL3 4X2OA 1K734 3EB8A 1IK3A 2QA43 5GSPA 3CCJ3 3V98A 1GOVA 1RNBA 1CQSA 1GY5A 1I8VA 1RNTA 3A76A 3JUMA 2P0MA 4KFFA 5KP3A 4MMXB 1SIHA 3LMLA 2Q07A 1RGHA 3WOEB 3NM2A 5DRVA 1O7NB 3CCE3 2B1XB 3ECFA 3KSED 4AKYA 3I553 3PGBA 2RSXA 4KZ1A 1OHSA 1W4NA 3KCHA 1AVLA 3EX9A 2RBIA 1S723 1DMMA 1DETA 3EHCA 2K54A 2Z7AA 3LTAA 1GY6A 1TJDA 1RMSA 1HKXA 1YVSA 3LH4A 8RNTA 2P38A 2BO9B 1YHQ3 4N6MA 4X2HA 1BUQA 1YIT3 2PZVA 1A2KA 1QVF2 1JB5A 3MSOA 4L8OA 3U97A 3O8YA 3CCR3 2JDIH 1FGRA 1OF5A 1JRQA 1TFKA 5D81A 3CME3 1LRAA 1RRHA 1DMNA 4O02B 1GD4A 6RNTA 4OVMA 2CKFB 3F7XA 2XFSA 1BNEA 1RN4A 1LNIA 4OUQA 2KF4A 1US1A 2W2CA 2W9QA 1LVNA 2H0GA 2OWPA 3F8XA 4EXRA 3B4PA 4N3VA 3PCRA 4GL6A 3CC23 3GZRA 1W2B2 1M904 3QK9A 4ILFA 1WMPA 1GOUA 3HIGA 3WDGB 1DVCA 1RTUA 2CX0A 3GAXA 3WHOA 1FA3A 1FGMA 2CFLA 3D9RA 3UL5A 2HMMB 4NHFA 3K9MC 2JQ5A 4XM4A 1FGTA 1MGRA 3PCSA 2STDA 4CJNA 1EKMA 3NHXA 2CW9A 9RNTA 1WQLB 1W6GA 3DGNA 4NREA 3NV0B 1W5ZA 4EC6A 2KF3A 2CG1A 1OACA 1VQ83 3BB9A 3EJVA 3DGMA 2AAEA 2Z76A 4EBGA 1UCKA 3VSYA 3H51A 1GMQA 2R41A 3OWSA 4H61A 1SPUA 3F9SA 5HOHA 2GU1A 2BHMA 3KFQC 2O9UX 1BVIA 3WR2A 3URPA 2F56A 2GEYA 2RFRA 3NQYA 8CHOA 2CHCA 4FMBA 1IQ8A 1OH0A 3NBJA 4J5GA 4R80A 1NJI4 2GXFA 4GSPA 3GRDA 2BU4A 2ML5A 4XDWA 4HVNA 2C4BA 4BTXA 3PZWA 1B3SA 3CCM3 1W6CA 1W7CA 3HIIA 1ULJB 3ALAA 4HM2B 1JB2A 4RNYA 3S28A 1CYUA 1I2EA 1RN7A 1ASKA 3JVCA 3G16A 3CMA3 2K3DA 1BU4A 1DMQA 1HU9A 2YFIB 3SX1A 5FGOA 5I97A 4XDVA 3D79A 3K7CA 3I0YA 1YJW3 3NUVA 1LNHA 2CWTA 1M1XB 1I2FA 1HZ1A 1FUTA 2KCDA 2Z6BA 1BNSA 1MWUA 2UGIA 3G6E3 1RJOA 2ZDJA 5AEUB 3DGLA 1E97A 1FZUA 4I5QA 3K5TA 1BSBA 4WYKA 1BAOA 3PXMA 5D82A 2M7OA 1YIJ3 1A67A 5JPUA 3FKAA 1GYBA 3FG3A 3K0ZA 3GWRA 3UJMA 3ROBA 1N9EA 2O3OA 3D4AA 1RGKA 1U8CB 1AV4A 3AMOB 3KIIA 3NQZA 3OWUA 4LYLB 1JBSA 1BUJA 3E99A 3S5CA 1TRPA 1BOXA 2H0IA 1B2UA 3BNEA 3LXUX 5AYRB 1VQQA 3OV4A 1IQXA 1BNIA 3V99A 3EBTA 4ORLA 3DZLA 4HYZA 4R1KA 4FMCA 4K1VA 1B2ZA 1IV9A 1N5PA 1IT8A 1YGWA 4BIRA 1Z1SA 2F86B 1QMAA 3ER7A 7RNTA 5ELUA 1FUSA 1ROAA 2P05A 1K28A 3PYJA 1JNQA 3HOHA 1TFOA 2UX0A 2OTJ3 3SXXA 3HK4A 1ZGXA 2F99A 2P0XA 1FGOA 3B7CA 1Q40B 3DUKA 1RRLA 4CDLA 3CCL3 3LTDA 3WOFB 1DE3A 5IF6A 2XGLA 4KFEA 1B27A 1PY3A 1W00A 3SYUA 1IDPA 2GBWB 2WOHA 4XBYA 4HZ9B 4O8SA 1OCVA 2I9WA 1OHPA 1J2BA 3X42A 2W56B 2W04A 5EQLA 2ZHXB 4FCZA 1NU3A 3BNBA 4MMZB 1IVWA 1W01A 2FGTA 3FH1A 1EUIC 3DM8A 3LZAA 4HM5B 5EVHA 5JBSA 4RNZA 1ZS7A 1YGEA 3GSPA 4R9LA 3T8UA 4AEQA 3FF2A 3FCSB 2CH9A 3MG2A 5IENA 2F98A 2BT3A 3V92A 1K9M4 1TU5A 5IW9A 4HM1B 2XFTA 1BNFA 1FYSA 4I4KA 1UDII 2BNGA 4EW5A 1UGHI 7STDA 1BIRA 2MF7A 4Q53A 4NPBA 3EE1A 5CXOA 2RGQA 1Q42A 2F4YA 3B8LA 1G02A 4HM7B 5IEPA 3N8BA 3NV0A 2HMNB 1LOXA 3FGYA 5CF2A 1LQMB 3RGAA 1LOWA 1Q7Y4 4OK0A 1UI7A 5AEWB 3EN8A 3B4OA 1JB4A 3LTCA 1OPYA 1BSDA 3NBRA 1MNLA 2CK3H 3CPW2 1VQ93 1OUNA 1X1XA 2IMJA 3WA2X 3F40A 5G1LA 5BXQA 1JN5B 1UCLA 2ZA4A 1NB5I 2V1LA 1ULIB 4EYCA 2B24B 1R4YA 1BRIA 2ZL8A 4FMDA 3CCS3 1RCLA 2E2TA 1N5HA 2HOHA 1NO3A 4N6LA 1I0XA 3RGRA
chains in the Genus database with same CATH topology
2D42A 4QWTA 3BLZA 4N6V0 3GZXB 3CCU3 5AIFA 2PNCA 2HMKB 2XF3A 4J8TA 4U13A 1EA2A 1SIIA 3NX0A 1O7MB 2HMOB 3OXAA 5D83A 3LOYA 4K61A 2QGUA 1NDOB 1VQ43 1E3RA 1AVKA 1IQYA 1VQO3 1JKGB 1DVDA 3EQQB 1STDA 3X3ZA 2BMRB 1STFI 4WHAA 1TIJA 3MG3A 2CFWA 1WMOA 2YFLB 3I563 3IJEB 3STDA 2XH9A 3CCQ3 1QVG2 4HKVB 2XRXB 3G8ZA 2W0QA 3AMOA 4O2HA 2C11A 3S29A 2A15A 3CC73 2CG0A 5STDA 3RDEA 4BTYA 1YJ93 3LT9A 4MMYB 1SJWA 3UNLA 1W2ZA 3OWYA 4EV2A 2GEXA 2XEPA 4HZBB 2W9PA 3X41A 2WOFA 2QIYA 2Z77A 4HM3B 5ELJA 3X40A 3CPOA 3GZBA 1GD3A 2HMJB 3CNXA 3SLUA 3DY5A 2OOVC 1WNHA 1TUHA 2BMQB 1EG9B 1Q40A 1ZX2A 1D6ZA 5DREA 2IUJA 5EEOA 3OX9A 1C7HA 2XSOB 5KP4A 1M1K4 3BNDA 2CIUA 2LYXA 1UW1A 3DGOA 4ZM8A 1QALA 1OHOA 3IMAB 4FMAA 3H3HA 2L4VA 3FF0A 4FR9A 1UUWB 4WP5A 2W56A 2YX9A 5TGNA 1K41A 3UL6A 1S5AA 1GS3A 3DXOA 3L0RA 4LSOA 4GB5A 3WMDA 3CCV3 3MWZA 1PU4A 4XBTA 4G1MB 2INXA 3PS8A 2IUKA 1F8NA 1UUVB 3NXJA 1FGQA 2Y74A 4HM6B 3WA3A 1Q814 1VZZA 1WMNA 2OQEC 3D3LA 5A0OB 1Y4KA 1Q864 2CC3A 4KFDA 3GZYB 1E3VA 2OCTA 3NBBA 1MOLA 4N6UA 5JPPA 3F7SA 1KD14 3JUQA 4EV5A 1JJ22 4HM8B 1LXEA 5AIGA 1A90A 4IIAA 2ML6A 1N9JA 3CD63 4RZMA 3FG4A 2C10A 2CWVA 3BNCA 1KQS2 3HX8A 3SVAA 2GBXB 4WFOA 2IA7A 1CYVA 1O7WB 4HM0B 1VQ53 3S27A 1QAKA 1A2VA 4WWUC 1JN5A 2D1WA 3T8NA 3U1WA 4K90B 3VF1A 3CXC2 1KC84 1U5OA 3S67A 4IPBA 2OOVA 1T5YA 3MG1A 3MYTA 3F14A 3G0KA 1OGZA 5IG3A 1N8R4 3MPHA 1ROVA 3FZWA 1VQP3 2FNQA 4TX4A 4HM4B 2P09A 3JUNA 4R9KA 1FUWA 1IVVA 3FSDA 5AIHA 1KSIA 1QAFA 5AYSC 1QJGA 1L5GB 1VQN3 4JF8A 3Q2PA 2GU3A 1ZO2A 1VQ63 1JKGA 3G4S3 4JRFA 4MEIA 3KE7A 4HJLB 3X3YA 5BVBA 5IERA 3CU3A 3KKGA 4N6OB 3MHEA 3SOYA 1M9GA 3KSPA 2K0MA 3M8CA 1YVBI 2HMLB 2OQEA 1YI23 3CNMA 3DMCA 5KP1A 3UB1A 1KWIA 4STDA 3IPTA 5G2GA 4L8PA 5HGRA 2LQVA 4LEHA 4LMIA 1WTHA 3LT8A 1OF5B 2RCDA 4XB5A 1N8QA 4FCMA 3SOAA 3TDGA 1W6YA 1IVUA 1VQ73 1K8A4 4R4KA 3EBYA 3Q90A 3HI7A 1GY7A 3G713 1O7PB 2KXGA 1VQL3 4O3VA 3N54B 3EN1B 4N6NB 5FW5A 4XBXA 1ISKA 4LZIA 4KVHA 2MC8A 3FLJA 2WGOA 2W03A 3LYGA 5IG0A 2WO0A 1IU7A 1DYUA 3N9HA 1VQK3 6STDA 1O7GB 1VQM3 3J7Yd 3FG1A 5CLKA 2CFDA 5AIIA 2WGQA 1RKYA 1IT7A 3QRDA 2FXTA 2SBLA 3KZTA 3JUPA 4AKZA 5LC6A 1V74A 3T0UA 5IG4A 1IVXA 4N6TA 5CK6A 2CFKA 1O7HB 3JUOA 4HBRA 3WODG 2CFGA 2E2UA 4CCVA 3HZPA 4PEJA 5CF1A 4L7KA 5LC7A 5IEOA 1D6YA 4LGQA 1G96A 3F8HA 5IG5A 3K63A 1JV2B 1OGXA 1TP6A 1AR0A 2E2VA 3KN4A 2Y73A 3LTBA 2XSHB 2CWUA 2BMOB 4MJDA 1YJN3 4K1UA 2KRTA 4J9AA 1NWWA 4FCJA 3OW22 5AI1A 3Q1CA 4IT7A 1W02A 3NM7A 1SQWA 2QEX3 3VGNA 2XGNA 1Q824 4BTWA 1IV7A 4H3UA 3CC43 3SEDA 1NB3I 1R4CA 1D6UA 2W6JH 1PFPA 3EC9A 3MKIA 3EF8A 2YFJB 1CEWI 1EQKA 4WYKB 1UI8A 4RBNA 2R4IA 2XR8B 2OTL3 4X2OA 1K734 3EB8A 1IK3A 2QA43 3CCJ3 3V98A 1CQSA 1GY5A 3A76A 3JUMA 2P0MA 4KFFA 5KP3A 4MMXB 1SIHA 3LMLA 2Q07A 3WOEB 3NM2A 5DRVA 1O7NB 3CCE3 2B1XB 3ECFA 3KSED 4AKYA 3I553 3PGBA 2RSXA 4KZ1A 1OHSA 1W4NA 1AVLA 3EX9A 1S723 1DMMA 3EHCA 2K54A 2Z7AA 3LTAA 1GY6A 1HKXA 3LH4A 2P38A 2BO9B 1YHQ3 4N6MA 4X2HA 1BUQA 1YIT3 2PZVA 1A2KA 1QVF2 1JB5A 3MSOA 4L8OA 3U97A 3O8YA 3CCR3 2JDIH 1FGRA 1OF5A 1JRQA 1TFKA 5D81A 3CME3 1RRHA 1DMNA 4O02B 1GD4A 4OVMA 2CKFB 3F7XA 2XFSA 4OUQA 1US1A 2W2CA 2W9QA 1LVNA 2OWPA 3F8XA 4EXRA 3B4PA 4N3VA 3PCRA 4GL6A 3CC23 3GZRA 1W2B2 1M904 3QK9A 1WMPA 3HIGA 3WDGB 1DVCA 3GAXA 1FA3A 1FGMA 2CFLA 3D9RA 3UL5A 2HMMB 4NHFA 3K9MC 2JQ5A 4XM4A 1FGTA 3PCSA 2STDA 1EKMA 3NHXA 2CW9A 1WQLB 1W6GA 3DGNA 4NREA 3NV0B 1W5ZA 4EC6A 2CG1A 1OACA 1VQ83 3BB9A 3EJVA 3DGMA 2Z76A 4EBGA 3VSYA 3H51A 3OWSA 4H61A 1SPUA 3F9SA 2GU1A 2BHMA 3KFQC 2O9UX 2GEYA 2RFRA 3NQYA 8CHOA 2CHCA 4FMBA 1IQ8A 1OH0A 3NBJA 4R80A 1NJI4 2GXFA 3GRDA 2ML5A 4XDWA 4HVNA 4BTXA 3PZWA 3CCM3 1W6CA 1W7CA 3HIIA 1ULJB 3ALAA 4HM2B 1JB2A 4RNYA 3S28A 1CYUA 1RN7A 3CMA3 1ASKA 3JVCA 3G16A 2YFIB 1DMQA 1HU9A 3SX1A 5I97A 5FGOA 4XDVA 3K7CA 3I0YA 1YJW3 3NUVA 1LNHA 2CWTA 1M1XB 2KCDA 2Z6BA 3G6E3 1RJOA 2ZDJA 5AEUB 3DGLA 1E97A 3K5TA 4WYKA 3PXMA 5D82A 2M7OA 1YIJ3 1A67A 5JPUA 3FKAA 1GYBA 3FG3A 3K0ZA 3GWRA 3UJMA 3ROBA 1N9EA 2O3OA 3OWUA 1U8CB 1AV4A 3AMOB 3KIIA 3NQZA 3E99A 3S5CA 3BNEA 3LXUX 5AYRB 3OV4A 1IQXA 3V99A 3EBTA 4ORLA 3DZLA 4HYZA 4R1KA 4FMCA 4K1VA 1IV9A 1N5PA 1IT8A 1Z1SA 2F86B 1QMAA 3ER7A 5ELUA 1ROAA 2P05A 3PYJA 1K28A 1JNQA 1TFOA 2UX0A 2OTJ3 3SXXA 3HK4A 2F99A 2P0XA 1FGOA 3B7CA 1Q40B 3DUKA 1RRLA 4CDLA 3CCL3 3LTDA 3WOFB 5IF6A 2XGLA 4KFEA 1W00A 1IDPA 2GBWB 2WOHA 4XBYA 4HZ9B 4O8SA 1OCVA 2I9WA 1OHPA 1J2BA 3X42A 2W56B 2W04A 5EQLA 3X3XA 4FCZA 1NU3A 3BNBA 4MMZB 1IVWA 1W01A 2FGTA 3FH1A 3LZAA 3DM8A 4HM5B 5EVHA 5JBSA 4RNZA 1YGEA 3T8UA 4AEQA 4R9LA 3FF2A 3FCSB 2CH9A 3MG2A 5IENA 2F98A 2BT3A 3V92A 1K9M4 1TU5A 5IW9A 4HM1B 2XFTA 4I4KA 2BNGA 7STDA 2MF7A 4Q53A 3EE1A 5CXOA 2RGQA 1Q42A 3B8LA 4HM7B 5IEPA 3N8BA 3NV0A 2HMNB 1LOXA 3FGYA 5CF2A 3RGAA 1Q7Y4 4OK0A 1UI7A 5AEWB 3EN8A 3B4OA 1JB4A 3LTCA 1OPYA 3NBRA 1MNLA 2CK3H 3CPW2 1VQ93 1OUNA 2IMJA 3WA2X 3F40A 5BXQA 1JN5B 1NB5I 2V1LA 1ULIB 4EYCA 2B24B 2ZL8A 4FMDA 3CCS3 2E2TA 1N5HA 1NO3A 4N6LA 3RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLZ A;  3GZX B;  5AIF A;  2HMK B;  4J8T A;  4U13 A;  1EA2 A;  1O7M B;  2HMO B;  3OXA A;  5D83 A;  2QGU A;  1NDO B;  1E3R A;  1JKG B;  3EQQ B;  1STD A;  2BMR B;  3MG3 A;  2YFL B;  3STD A;  4HKV B;  2XRX B;  3G8Z A;  2A15 A;  5STD A;  1SJW A;  3UNL A;  3OWY A;  2GEX A;  4HZB B;  2QIY A;  2Z77 A;  4HM3 B;  3CPO A;  3GZB A;  2HMJ B;  3CNX A;  1TUH A;  2BMQ B;  1EG9 B;  1ZX2 A;  1Q40 A;  5DRE A;  3OX9 A;  1C7H A;  2XSO B;  5KP4 A;  1OHO A;  3H3H A;  3FF0 A;  1UUW B;  4WP5 A;  5TGN A;  1K41 A;  1S5A A;  1GS3 A;  3DXO A;  4GB5 A;  3WMD A;  4XBT A;  2INX A;  1UUV B;  3NXJ A;  4HM6 B;  1VZZ A;  3GZY B;  1E3V A;  5JPP A;  3F7S A;  3JUQ A;  4HM8 B;  5AIG A;  4IIA A;  4RZM A;  3HX8 A;  2GBX B;  1O7W B;  4HM0 B;  4WWU C;  1JN5 A;  3T8N A;  1U5O A;  3MG1 A;  3MYT A;  3F14 A;  3G0K A;  1OGZ A;  5IG3 A;  3FZW A;  4HM4 B;  3JUN A;  4R9K A;  3FSD A;  5AIH A;  1QJG A;  1ZO2 A;  1JKG A;  3KE7 A;  4HJL B;  5IER A;  3CU3 A;  3KKG A;  3MHE A;  3SOY A;  3KSP A;  3M8C A;  2HML B;  3CNM A;  3DMC A;  5KP1 A;  4STD A;  3IPT A;  5G2G A;  4L8P A;  5HGR A;  4LEH A;  4LMI A;  1OF5 B;  2RCD A;  4XB5 A;  4FCM A;  3SOA A;  1W6Y A;  3EBY A;  3Q90 A;  1GY7 A;  1O7P B;  3EN1 B;  5FW5 A;  4XBX A;  1ISK A;  4KVH A;  3FLJ A;  3LYG A;  5IG0 A;  6STD A;  1O7G B;  5CLK A;  5AII A;  3KZT A;  3JUP A;  5IG4 A;  5CK6 A;  1O7H B;  3JUO A;  3HZP A;  4PEJ A;  5CF1 A;  4L7K A;  5IEO A;  4LGQ A;  3F8H A;  5IG5 A;  1OGX A;  1TP6 A;  1AR0 A;  2XSH B;  2BMO B;  4MJD A;  4K1U A;  4J9A A;  1NWW A;  4FCJ A;  5AI1 A;  1W02 A;  3VGN A;  4H3U A;  3SED A;  3EC9 A;  3MKI A;  3EF8 A;  2YFJ B;  4WYK B;  2R4I A;  2XR8 B;  4X2O A;  1CQS A;  1GY5 A;  3A76 A;  3JUM A;  5KP3 A;  3NM2 A;  5DRV A;  1O7N B;  2B1X B;  3ECF A;  1OHS A;  3EX9 A;  1DMM A;  3EHC A;  2K54 A;  2Z7A A;  1GY6 A;  1HKX A;  4X2H A;  1BUQ A;  2PZV A;  1A2K A;  1JB5 A;  3MSO A;  4L8O A;  5D81 A;  1OF5 A;  1DMN A;  4OVM A;  2CKF B;  3F7X A;  4OUQ A;  2W2C A;  2OWP A;  3F8X A;  3B4P A;  4N3V A;  3GZR A;  3D9R A;  2HMM B;  2JQ5 A;  4XM4 A;  2STD A;  3NHX A;  1WQL B;  3NV0 B;  3BB9 A;  3EJV A;  2Z76 A;  3VSY A;  3H51 A;  3OWS A;  3F9S A;  2GEY A;  2RFR A;  8CHO A;  2CHC A;  1OH0 A;  2GXF A;  3GRD A;  4XDW A;  4HVN A;  1ULJ B;  4HM2 B;  1JB2 A;  1ASK A;  3G16 A;  2YFI B;  1DMQ A;  4XDV A;  3K7C A;  3I0Y A;  3NUV A;  5AEU B;  1E97 A;  4WYK A;  5D82 A;  5JPU A;  3FKA A;  1GYB A;  3K0Z A;  3GWR A;  3UJM A;  3ROB A;  3OWU A;  3E99 A;  3S5C A;  3OV4 A;  3EBT A;  4ORL A;  3DZL A;  4R1K A;  4K1V A;  1Z1S A;  2F86 B;  1QMA A;  3ER7 A;  2UX0 A;  3HK4 A;  2F99 A;  3DUK A;  3B7C A;  1Q40 B;  4CDL A;  5IF6 A;  1W00 A;  1IDP A;  2GBW B;  4XBY A;  4HZ9 B;  1OCV A;  2I9W A;  1OHP A;  1NU3 A;  1W01 A;  3FH1 A;  3LZA A;  4HM5 B;  5EVH A;  3DM8 A;  3T8U A;  4R9L A;  3FF2 A;  3MG2 A;  5IEN A;  2F98 A;  4HM1 B;  4I4K A;  2BNG A;  7STD A;  4Q53 A;  5CXO A;  2RGQ A;  1Q42 A;  3B8L A;  4HM7 B;  5IEP A;  3NV0 A;  2HMN B;  3FGY A;  5CF2 A;  3RGA A;  5AEW B;  3EN8 A;  3B4O A;  1JB4 A;  1OPY A;  3NBR A;  1OUN A;  2IMJ A;  3F40 A;  5BXQ A;  1JN5 B;  1ULI B;  2B24 B;  5BVB A;  3RGR A; 
#chains in the Genus database with same CATH topology
 2D42 A;  4QWT A;  5M19 A;  3BLZ A;  2UUG C;  4N6V 0;  3GZX B;  3CCU 3;  1BRN L;  2J8X B;  5AIF A;  2PNC A;  2HMK B;  2XF3 A;  4J8T A;  4U13 A;  1EA2 A;  1SII A;  3NX0 A;  3ZG0 A;  1O7M B;  2HMO B;  1RLS A;  3OXA A;  1GMP A;  3LOY A;  5D83 A;  1RGF A;  2QGU A;  4K61 A;  1NDO B;  4KT3 B;  1UGI A;  1E3R A;  1VQ4 3;  4HOH A;  1AVK A;  1RN1 A;  1IQY A;  1BRS A;  1VQO 3;  1JKG B;  4HAA A;  1DVD A;  3EQQ B;  1I0V A;  1MWS A;  1SAR A;  3AGO A;  1STD A;  3X3Z A;  2BMR B;  1STF I;  4WHA A;  1TIJ A;  3MG3 A;  1AY7 A;  1BRH A;  2CFW A;  1WMO A;  2YFL B;  3I56 3;  3IJE B;  1BGS A;  3STD A;  2XH9 A;  1LQG C;  3CCQ 3;  1QVG 2;  1BSC A;  4HKV B;  2XRX B;  3G8Z A;  1LOY A;  1V58 A;  2W0Q A;  3AMO A;  2C11 A;  4O2H A;  3S29 A;  2A15 A;  1T3B A;  3CC7 3;  2CG0 A;  5STD A;  1BAN A;  3RDE A;  4BTY A;  1YJ9 3;  1FW7 A;  1C54 A;  2RNT A;  3LT9 A;  4MMY B;  1SJW A;  3UNL A;  1RGC A;  1T2H A;  1W2Z A;  3OWY A;  3AGN A;  1MWT A;  4EV2 A;  2GEX A;  2XEP A;  4HZB B;  2W9P A;  1B21 A;  3DGY A;  3AHS A;  4BU4 A;  3X41 A;  2WOF A;  2QIY A;  2Z77 A;  4HM3 B;  5ELJ A;  3X40 A;  3CPO A;  3GZB A;  5BIR A;  1GD3 A;  3RNT A;  2HMJ B;  2KF6 A;  3CNX A;  3SLU A;  3DY5 A;  2OOV C;  1WNH A;  1TUH A;  2BMQ B;  1EG9 B;  1Q40 A;  1ZX2 A;  1D6Z A;  1LOV A;  5DRE A;  2IUJ A;  5EEO A;  3OX9 A;  1C7H A;  2XSO B;  5KP4 A;  1M1K 4;  1BNG A;  1GSP A;  2CIU A;  3BND A;  2LYX A;  1UW1 A;  3DGO A;  4CPK A;  4ZM8 A;  1QAL A;  1OHO A;  3IMA B;  4FMA A;  3H3H A;  4BL3 A;  2L4V A;  3FF0 A;  4FR9 A;  6GSP A;  1UUW B;  4WP5 A;  2W56 A;  2YX9 A;  5TGN A;  1BRK A;  1K41 A;  1S5A A;  3UL6 A;  1PYL A;  1GS3 A;  3DXO A;  3L0R A;  1BSE A;  4LSO A;  4GB5 A;  3WMD A;  3CCV 3;  3MWZ A;  1NNV A;  1PU4 A;  4XBT A;  4G1M B;  2INX A;  3PS8 A;  3X3X A;  1I3I A;  2IUK A;  5BU4 A;  1F8N A;  1UUV B;  3NXJ A;  1FGQ A;  1TRQ A;  2Y74 A;  4HM6 B;  3WA3 A;  1Q81 4;  3D5G A;  1A2P A;  1T2I A;  3ZG5 A;  1VZZ A;  1WMN A;  2OQE C;  3D3L A;  1IYY A;  2KAA A;  1Y4K A;  5A0O B;  1Q86 4;  2CC3 A;  4KFD A;  1MWR A;  3GZY B;  1E3V A;  2SAR A;  3ZFZ A;  1Q7H A;  2OCT A;  3NBB A;  1MOL A;  4N6U A;  5JPP A;  3F7S A;  1KD1 4;  3JUQ A;  1B20 A;  4EV5 A;  1JJ2 2;  1X1U A;  4HM8 B;  1LXE A;  5AIG A;  1A90 A;  1RCK A;  2ML6 A;  1N9J A;  4IIA A;  3CD6 3;  4RZM A;  3FG4 A;  2C10 A;  2CWV A;  3BNC A;  1GMR A;  1Q9E A;  1KQS 2;  1RDS A;  3D5I A;  3HX8 A;  1HYF A;  2GBX B;  2AAD A;  4WFO A;  2IA7 A;  3SVA A;  1CYV A;  1O7W B;  4HM0 B;  1JBR A;  1VQ5 3;  3S27 A;  1QAK A;  1A2V A;  4WWU C;  1JN5 A;  2D1W A;  2F5M A;  4GHO A;  3T8N A;  3U1W A;  4K90 B;  2H0H A;  3VF1 A;  3CXC 2;  1KC8 4;  1U5O A;  3S67 A;  4IPB A;  2OOV A;  1T5Y A;  3MG1 A;  3MYT A;  3F14 A;  7GSP A;  3G0K A;  1OGZ A;  2F5W A;  5IG3 A;  3MPH A;  1N8R 4;  1ROV A;  3FZW A;  1VQP 3;  1JZD A;  2FNQ A;  4TX4 A;  4HM4 B;  2P09 A;  1I2G A;  3JUN A;  4R9K A;  4J5K A;  1FUW A;  1IVV A;  3FSD A;  2IYJ A;  5AIH A;  1KSI A;  1QAF A;  2KF5 A;  5AYS C;  1QJG A;  1L5G B;  1VQN 3;  1UCJ A;  4JF8 A;  3Q2P A;  2GU3 A;  1ZO2 A;  1VQ6 3;  1JKG A;  3G4S 3;  4JRF A;  4MEI A;  3KE7 A;  4HJL B;  3X3Y A;  5BVB A;  1GOY A;  5IER A;  3CU3 A;  3KKG A;  4N6O B;  3MHE A;  3SOY A;  1M9G A;  3KSP A;  2K0M A;  3M8C A;  1YVB I;  2HML B;  2OQE A;  1YI2 3;  3CNM A;  1YNV X;  3DMC A;  4RNT A;  4BL2 A;  5KP1 A;  3UB1 A;  1KWI A;  5M1A A;  4STD A;  3IPT A;  1TTO A;  5G2G A;  4L8P A;  5HGR A;  1EEJ A;  2LQV A;  5RNT A;  4LEH A;  4LMI A;  2BIR A;  1WTH A;  1BNR A;  3A5E A;  3LT8 A;  1OF5 B;  2RCD A;  4XB5 A;  1N8Q A;  4FCM A;  1X1W A;  3SOA A;  3TDG A;  1W6Y A;  1IVU A;  1VQ7 3;  1K8A 4;  4R4K A;  3AHW A;  3EBY A;  3Q90 A;  3HI7 A;  1GY7 A;  3G71 3;  1O7P B;  2KXG A;  1VQL 3;  4O3V A;  3N54 B;  1B2S A;  3EN1 B;  4N6N B;  5FW5 A;  4XBX A;  1ISK A;  4LZI A;  4KVH A;  2MC8 A;  3FLJ A;  2WGO A;  2W03 A;  3LYG A;  5IG0 A;  1RGE A;  2WO0 A;  1IU7 A;  1DYU A;  4DKI A;  2IY2 A;  3N9H A;  1VQK 3;  6STD A;  1RHL A;  1O7G B;  1VQM 3;  3J7Y d;  3FG1 A;  5CLK A;  2L1S A;  2CFD A;  5AII A;  2WGQ A;  1RKY A;  1IT7 A;  1RGG A;  3QRD A;  2FXT A;  2SBL A;  3KZT A;  3JUP A;  4AKZ A;  5LC6 A;  1G0T A;  1V74 A;  3T0U A;  5IG4 A;  1IVX A;  4N6T A;  5CK6 A;  1UUG B;  1O7H B;  1BSA A;  2CFK A;  3JUO A;  2CFG A;  2E2U A;  4HBR A;  3HZP A;  3WOD G;  4PEJ A;  4CCV A;  1CH0 A;  5CF1 A;  4L7K A;  1X1Y A;  5LC7 A;  5IEO A;  1D6Y A;  3BU4 A;  4LGQ A;  1G96 A;  3F8H A;  5G1K A;  5IG5 A;  3K63 A;  1RGL A;  1JV2 B;  1OGX A;  1TP6 A;  1AR0 A;  2E2V A;  3KN4 A;  2Y73 A;  1AQZ A;  1MGW A;  2GSP A;  3LTB A;  2XSH B;  2CWU A;  5M18 A;  2BMO B;  3Q3F A;  4MJD A;  1YJN 3;  1B2M A;  4K1U A;  2KRT A;  3BIR A;  4J9A A;  1NWW A;  4FCJ A;  3OW2 2;  2CX1 A;  5AI1 A;  1BNJ A;  1I3F A;  3Q1C A;  4IT7 A;  1W02 A;  3NM7 A;  1BRG A;  1SQW A;  2QEX 3;  3VGN A;  2XGN A;  1Q82 4;  4BTW A;  1IV7 A;  1JZO A;  3DH2 A;  4H3U A;  3SED A;  3CC4 3;  1I70 A;  1RSN A;  1NB3 I;  1BRJ A;  1JBT A;  1R4C A;  1D6U A;  2W6J H;  1PFP A;  3EC9 A;  1UCI A;  1V57 A;  3MKI A;  3EF8 A;  2YFJ B;  1CEW I;  1RGA A;  1EQK A;  1B2X A;  4WYK B;  1UI8 A;  4RBN A;  2R4I A;  2XR8 B;  2OTL 3;  4X2O A;  1K73 4;  3EB8 A;  1IK3 A;  2QA4 3;  5GSP A;  3CCJ 3;  3V98 A;  1GOV A;  1RNB A;  1CQS A;  1GY5 A;  1I8V A;  1RNT A;  3A76 A;  3JUM A;  2P0M A;  4KFF A;  5KP3 A;  4MMX B;  1SIH A;  3LML A;  2Q07 A;  1RGH A;  3WOE B;  3NM2 A;  5DRV A;  1O7N B;  3CCE 3;  2B1X B;  3ECF A;  3KSE D;  4AKY A;  3I55 3;  3PGB A;  2RSX A;  4KZ1 A;  1OHS A;  1W4N A;  3KCH A;  1AVL A;  3EX9 A;  2RBI A;  1S72 3;  1DMM A;  1DET A;  3EHC A;  2K54 A;  2Z7A A;  3LTA A;  1GY6 A;  1TJD A;  1RMS A;  1HKX A;  1YVS A;  3LH4 A;  8RNT A;  2P38 A;  2BO9 B;  1YHQ 3;  4N6M A;  4X2H A;  1BUQ A;  1YIT 3;  2PZV A;  1A2K A;  1QVF 2;  1JB5 A;  3MSO A;  4L8O A;  3U97 A;  3O8Y A;  3CCR 3;  2JDI H;  1FGR A;  1OF5 A;  1JRQ A;  1TFK A;  5D81 A;  3CME 3;  1LRA A;  1RRH A;  1DMN A;  4O02 B;  1GD4 A;  6RNT A;  4OVM A;  2CKF B;  3F7X A;  2XFS A;  1BNE A;  1RN4 A;  1LNI A;  4OUQ A;  2KF4 A;  1US1 A;  2W2C A;  2W9Q A;  1LVN A;  2H0G A;  2OWP A;  3F8X A;  4EXR A;  3B4P A;  4N3V A;  3PCR A;  4GL6 A;  3CC2 3;  3GZR A;  1W2B 2;  1M90 4;  3QK9 A;  4ILF A;  1WMP A;  1GOU A;  3HIG A;  3WDG B;  1DVC A;  1RTU A;  2CX0 A;  3GAX A;  3WHO A;  1FA3 A;  1FGM A;  2CFL A;  3D9R A;  3UL5 A;  2HMM B;  4NHF A;  3K9M C;  2JQ5 A;  4XM4 A;  1FGT A;  1MGR A;  3PCS A;  2STD A;  4CJN A;  1EKM A;  3NHX A;  2CW9 A;  9RNT A;  1WQL B;  1W6G A;  3DGN A;  4NRE A;  3NV0 B;  1W5Z A;  4EC6 A;  2KF3 A;  2CG1 A;  1OAC A;  1VQ8 3;  3BB9 A;  3EJV A;  3DGM A;  2AAE A;  2Z76 A;  4EBG A;  1UCK A;  3VSY A;  3H51 A;  1GMQ A;  2R41 A;  3OWS A;  4H61 A;  1SPU A;  3F9S A;  5HOH A;  2GU1 A;  2BHM A;  3KFQ C;  2O9U X;  1BVI A;  3WR2 A;  3URP A;  2F56 A;  2GEY A;  2RFR A;  3NQY A;  8CHO A;  2CHC A;  4FMB A;  1IQ8 A;  1OH0 A;  3NBJ A;  4J5G A;  4R80 A;  1NJI 4;  2GXF A;  4GSP A;  3GRD A;  2BU4 A;  2ML5 A;  4XDW A;  4HVN A;  2C4B A;  4BTX A;  3PZW A;  1B3S A;  3CCM 3;  1W6C A;  1W7C A;  3HII A;  1ULJ B;  3ALA A;  4HM2 B;  1JB2 A;  4RNY A;  3S28 A;  1CYU A;  1I2E A;  1RN7 A;  1ASK A;  3JVC A;  3G16 A;  3CMA 3;  2K3D A;  1BU4 A;  1DMQ A;  1HU9 A;  2YFI B;  3SX1 A;  5FGO A;  5I97 A;  4XDV A;  3D79 A;  3K7C A;  3I0Y A;  1YJW 3;  3NUV A;  1LNH A;  2CWT A;  1M1X B;  1I2F A;  1HZ1 A;  1FUT A;  2KCD A;  2Z6B A;  1BNS A;  1MWU A;  2UGI A;  3G6E 3;  1RJO A;  2ZDJ A;  5AEU B;  3DGL A;  1E97 A;  1FZU A;  4I5Q A;  3K5T A;  1BSB A;  4WYK A;  1BAO A;  3PXM A;  5D82 A;  2M7O A;  1YIJ 3;  1A67 A;  5JPU A;  3FKA A;  1GYB A;  3FG3 A;  3K0Z A;  3GWR A;  3UJM A;  3ROB A;  1N9E A;  2O3O A;  3D4A A;  1RGK A;  1U8C B;  1AV4 A;  3AMO B;  3KII A;  3NQZ A;  3OWU A;  4LYL B;  1JBS A;  1BUJ A;  3E99 A;  3S5C A;  1TRP A;  1BOX A;  2H0I A;  1B2U A;  3BNE A;  3LXU X;  5AYR B;  1VQQ A;  3OV4 A;  1IQX A;  1BNI A;  3V99 A;  3EBT A;  4ORL A;  3DZL A;  4HYZ A;  4R1K A;  4FMC A;  4K1V A;  1B2Z A;  1IV9 A;  1N5P A;  1IT8 A;  1YGW A;  4BIR A;  1Z1S A;  2F86 B;  1QMA A;  3ER7 A;  7RNT A;  5ELU A;  1FUS A;  1ROA A;  2P05 A;  1K28 A;  3PYJ A;  1JNQ A;  3HOH A;  1TFO A;  2UX0 A;  2OTJ 3;  3SXX A;  3HK4 A;  1ZGX A;  2F99 A;  2P0X A;  1FGO A;  3B7C A;  1Q40 B;  3DUK A;  1RRL A;  4CDL A;  3CCL 3;  3LTD A;  3WOF B;  1DE3 A;  5IF6 A;  2XGL A;  4KFE A;  1B27 A;  1PY3 A;  1W00 A;  3SYU A;  1IDP A;  2GBW B;  2WOH A;  4XBY A;  4HZ9 B;  4O8S A;  1OCV A;  2I9W A;  1OHP A;  1J2B A;  3X42 A;  2W56 B;  2W04 A;  5EQL A;  2ZHX B;  4FCZ A;  1NU3 A;  3BNB A;  4MMZ B;  1IVW A;  1W01 A;  2FGT A;  3FH1 A;  1EUI C;  3DM8 A;  3LZA A;  4HM5 B;  5EVH A;  5JBS A;  4RNZ A;  1ZS7 A;  1YGE A;  3GSP A;  4R9L A;  3T8U A;  4AEQ A;  3FF2 A;  3FCS B;  2CH9 A;  3MG2 A;  5IEN A;  2F98 A;  2BT3 A;  3V92 A;  1K9M 4;  1TU5 A;  5IW9 A;  4HM1 B;  2XFT A;  1BNF A;  1FYS A;  4I4K A;  1UDI I;  2BNG A;  4EW5 A;  1UGH I;  7STD A;  1BIR A;  2MF7 A;  4Q53 A;  4NPB A;  3EE1 A;  5CXO A;  2RGQ A;  1Q42 A;  2F4Y A;  3B8L A;  1G02 A;  4HM7 B;  5IEP A;  3N8B A;  3NV0 A;  2HMN B;  1LOX A;  3FGY A;  5CF2 A;  1LQM B;  3RGA A;  1LOW A;  1Q7Y 4;  4OK0 A;  1UI7 A;  5AEW B;  3EN8 A;  3B4O A;  1JB4 A;  3LTC A;  1OPY A;  1BSD A;  3NBR A;  1MNL A;  2CK3 H;  3CPW 2;  1VQ9 3;  1OUN A;  1X1X A;  2IMJ A;  3WA2 X;  3F40 A;  5G1L A;  5BXQ A;  1JN5 B;  1UCL A;  2ZA4 A;  1NB5 I;  2V1L A;  1ULI B;  4EYC A;  2B24 B;  1R4Y A;  1BRI A;  2ZL8 A;  4FMD A;  3CCS 3;  1RCL A;  2E2T A;  1N5H A;  2HOH A;  1NO3 A;  4N6L A;  1I0X A;  3RGR A; 
#chains in the Genus database with same CATH homology
 2D42 A;  4QWT A;  3BLZ A;  4N6V 0;  3GZX B;  3CCU 3;  5AIF A;  2PNC A;  2HMK B;  2XF3 A;  4J8T A;  4U13 A;  1EA2 A;  1SII A;  3NX0 A;  1O7M B;  2HMO B;  3OXA A;  5D83 A;  3LOY A;  4K61 A;  2QGU A;  1NDO B;  1VQ4 3;  1E3R A;  1AVK A;  1IQY A;  1VQO 3;  1JKG B;  1DVD A;  3EQQ B;  1STD A;  3X3Z A;  2BMR B;  1STF I;  4WHA A;  1TIJ A;  3MG3 A;  2CFW A;  1WMO A;  2YFL B;  3I56 3;  3IJE B;  3STD A;  2XH9 A;  3CCQ 3;  1QVG 2;  4HKV B;  2XRX B;  3G8Z A;  2W0Q A;  3AMO A;  4O2H A;  2C11 A;  3S29 A;  2A15 A;  3CC7 3;  2CG0 A;  5STD A;  3RDE A;  4BTY A;  1YJ9 3;  3LT9 A;  4MMY B;  1SJW A;  3UNL A;  1W2Z A;  3OWY A;  4EV2 A;  2GEX A;  2XEP A;  4HZB B;  2W9P A;  3X41 A;  2WOF A;  2QIY A;  2Z77 A;  4HM3 B;  5ELJ A;  3X40 A;  3CPO A;  3GZB A;  1GD3 A;  2HMJ B;  3CNX A;  3SLU A;  3DY5 A;  2OOV C;  1WNH A;  1TUH A;  2BMQ B;  1EG9 B;  1Q40 A;  1ZX2 A;  1D6Z A;  5DRE A;  2IUJ A;  5EEO A;  3OX9 A;  1C7H A;  2XSO B;  5KP4 A;  1M1K 4;  3BND A;  2CIU A;  2LYX A;  1UW1 A;  3DGO A;  4ZM8 A;  1QAL A;  1OHO A;  3IMA B;  4FMA A;  3H3H A;  2L4V A;  3FF0 A;  4FR9 A;  1UUW B;  4WP5 A;  2W56 A;  2YX9 A;  5TGN A;  1K41 A;  3UL6 A;  1S5A A;  1GS3 A;  3DXO A;  3L0R A;  4LSO A;  4GB5 A;  3WMD A;  3CCV 3;  3MWZ A;  1PU4 A;  4XBT A;  4G1M B;  2INX A;  3PS8 A;  2IUK A;  1F8N A;  1UUV B;  3NXJ A;  1FGQ A;  2Y74 A;  4HM6 B;  3WA3 A;  1Q81 4;  1VZZ A;  1WMN A;  2OQE C;  3D3L A;  5A0O B;  1Y4K A;  1Q86 4;  2CC3 A;  4KFD A;  3GZY B;  1E3V A;  2OCT A;  3NBB A;  1MOL A;  4N6U A;  5JPP A;  3F7S A;  1KD1 4;  3JUQ A;  4EV5 A;  1JJ2 2;  4HM8 B;  1LXE A;  5AIG A;  1A90 A;  4IIA A;  2ML6 A;  1N9J A;  3CD6 3;  4RZM A;  3FG4 A;  2C10 A;  2CWV A;  3BNC A;  1KQS 2;  3HX8 A;  3SVA A;  2GBX B;  4WFO A;  2IA7 A;  1CYV A;  1O7W B;  4HM0 B;  1VQ5 3;  3S27 A;  1QAK A;  1A2V A;  4WWU C;  1JN5 A;  2D1W A;  3T8N A;  3U1W A;  4K90 B;  3VF1 A;  3CXC 2;  1KC8 4;  1U5O A;  3S67 A;  4IPB A;  2OOV A;  1T5Y A;  3MG1 A;  3MYT A;  3F14 A;  3G0K A;  1OGZ A;  5IG3 A;  1N8R 4;  3MPH A;  1ROV A;  3FZW A;  1VQP 3;  2FNQ A;  4TX4 A;  4HM4 B;  2P09 A;  3JUN A;  4R9K A;  1FUW A;  1IVV A;  3FSD A;  5AIH A;  1KSI A;  1QAF A;  5AYS C;  1QJG A;  1L5G B;  1VQN 3;  4JF8 A;  3Q2P A;  2GU3 A;  1ZO2 A;  1VQ6 3;  1JKG A;  3G4S 3;  4JRF A;  4MEI A;  3KE7 A;  4HJL B;  3X3Y A;  5BVB A;  5IER A;  3CU3 A;  3KKG A;  4N6O B;  3MHE A;  3SOY A;  1M9G A;  3KSP A;  2K0M A;  3M8C A;  1YVB I;  2HML B;  2OQE A;  1YI2 3;  3CNM A;  3DMC A;  5KP1 A;  3UB1 A;  1KWI A;  4STD A;  3IPT A;  5G2G A;  4L8P A;  5HGR A;  2LQV A;  4LEH A;  4LMI A;  1WTH A;  3LT8 A;  1OF5 B;  2RCD A;  4XB5 A;  1N8Q A;  4FCM A;  3SOA A;  3TDG A;  1W6Y A;  1IVU A;  1VQ7 3;  1K8A 4;  4R4K A;  3EBY A;  3Q90 A;  3HI7 A;  1GY7 A;  3G71 3;  1O7P B;  2KXG A;  1VQL 3;  4O3V A;  3N54 B;  3EN1 B;  4N6N B;  5FW5 A;  4XBX A;  1ISK A;  4LZI A;  4KVH A;  2MC8 A;  3FLJ A;  2WGO A;  2W03 A;  3LYG A;  5IG0 A;  2WO0 A;  1IU7 A;  1DYU A;  3N9H A;  1VQK 3;  6STD A;  1O7G B;  1VQM 3;  3J7Y d;  3FG1 A;  5CLK A;  2CFD A;  5AII A;  2WGQ A;  1RKY A;  1IT7 A;  3QRD A;  2FXT A;  2SBL A;  3KZT A;  3JUP A;  4AKZ A;  5LC6 A;  1V74 A;  3T0U A;  5IG4 A;  1IVX A;  4N6T A;  5CK6 A;  2CFK A;  1O7H B;  3JUO A;  4HBR A;  3WOD G;  2CFG A;  2E2U A;  4CCV A;  3HZP A;  4PEJ A;  5CF1 A;  4L7K A;  5LC7 A;  5IEO A;  1D6Y A;  4LGQ A;  1G96 A;  3F8H A;  5IG5 A;  3K63 A;  1JV2 B;  1OGX A;  1TP6 A;  1AR0 A;  2E2V A;  3KN4 A;  2Y73 A;  3LTB A;  2XSH B;  2CWU A;  2BMO B;  4MJD A;  1YJN 3;  4K1U A;  2KRT A;  4J9A A;  1NWW A;  4FCJ A;  3OW2 2;  5AI1 A;  3Q1C A;  4IT7 A;  1W02 A;  3NM7 A;  1SQW A;  2QEX 3;  3VGN A;  2XGN A;  1Q82 4;  4BTW A;  1IV7 A;  4H3U A;  3CC4 3;  3SED A;  1NB3 I;  1R4C A;  1D6U A;  2W6J H;  1PFP A;  3EC9 A;  3MKI A;  3EF8 A;  2YFJ B;  1CEW I;  1EQK A;  4WYK B;  1UI8 A;  4RBN A;  2R4I A;  2XR8 B;  2OTL 3;  4X2O A;  1K73 4;  3EB8 A;  1IK3 A;  2QA4 3;  3CCJ 3;  3V98 A;  1CQS A;  1GY5 A;  3A76 A;  3JUM A;  2P0M A;  4KFF A;  5KP3 A;  4MMX B;  1SIH A;  3LML A;  2Q07 A;  3WOE B;  3NM2 A;  5DRV A;  1O7N B;  3CCE 3;  2B1X B;  3ECF A;  3KSE D;  4AKY A;  3I55 3;  3PGB A;  2RSX A;  4KZ1 A;  1OHS A;  1W4N A;  1AVL A;  3EX9 A;  1S72 3;  1DMM A;  3EHC A;  2K54 A;  2Z7A A;  3LTA A;  1GY6 A;  1HKX A;  3LH4 A;  2P38 A;  2BO9 B;  1YHQ 3;  4N6M A;  4X2H A;  1BUQ A;  1YIT 3;  2PZV A;  1A2K A;  1QVF 2;  1JB5 A;  3MSO A;  4L8O A;  3U97 A;  3O8Y A;  3CCR 3;  2JDI H;  1FGR A;  1OF5 A;  1JRQ A;  1TFK A;  5D81 A;  3CME 3;  1RRH A;  1DMN A;  4O02 B;  1GD4 A;  4OVM A;  2CKF B;  3F7X A;  2XFS A;  4OUQ A;  1US1 A;  2W2C A;  2W9Q A;  1LVN A;  2OWP A;  3F8X A;  4EXR A;  3B4P A;  4N3V A;  3PCR A;  4GL6 A;  3CC2 3;  3GZR A;  1W2B 2;  1M90 4;  3QK9 A;  1WMP A;  3HIG A;  3WDG B;  1DVC A;  3GAX A;  1FA3 A;  1FGM A;  2CFL A;  3D9R A;  3UL5 A;  2HMM B;  4NHF A;  3K9M C;  2JQ5 A;  4XM4 A;  1FGT A;  3PCS A;  2STD A;  1EKM A;  3NHX A;  2CW9 A;  1WQL B;  1W6G A;  3DGN A;  4NRE A;  3NV0 B;  1W5Z A;  4EC6 A;  2CG1 A;  1OAC A;  1VQ8 3;  3BB9 A;  3EJV A;  3DGM A;  2Z76 A;  4EBG A;  3VSY A;  3H51 A;  3OWS A;  4H61 A;  1SPU A;  3F9S A;  2GU1 A;  2BHM A;  3KFQ C;  2O9U X;  2GEY A;  2RFR A;  3NQY A;  8CHO A;  2CHC A;  4FMB A;  1IQ8 A;  1OH0 A;  3NBJ A;  4R80 A;  1NJI 4;  2GXF A;  3GRD A;  2ML5 A;  4XDW A;  4HVN A;  4BTX A;  3PZW A;  3CCM 3;  1W6C A;  1W7C A;  3HII A;  1ULJ B;  3ALA A;  4HM2 B;  1JB2 A;  4RNY A;  3S28 A;  1CYU A;  1RN7 A;  3CMA 3;  1ASK A;  3JVC A;  3G16 A;  2YFI B;  1DMQ A;  1HU9 A;  3SX1 A;  5I97 A;  5FGO A;  4XDV A;  3K7C A;  3I0Y A;  1YJW 3;  3NUV A;  1LNH A;  2CWT A;  1M1X B;  2KCD A;  2Z6B A;  3G6E 3;  1RJO A;  2ZDJ A;  5AEU B;  3DGL A;  1E97 A;  3K5T A;  4WYK A;  3PXM A;  5D82 A;  2M7O A;  1YIJ 3;  1A67 A;  5JPU A;  3FKA A;  1GYB A;  3FG3 A;  3K0Z A;  3GWR A;  3UJM A;  3ROB A;  1N9E A;  2O3O A;  3OWU A;  1U8C B;  1AV4 A;  3AMO B;  3KII A;  3NQZ A;  3E99 A;  3S5C A;  3BNE A;  3LXU X;  5AYR B;  3OV4 A;  1IQX A;  3V99 A;  3EBT A;  4ORL A;  3DZL A;  4HYZ A;  4R1K A;  4FMC A;  4K1V A;  1IV9 A;  1N5P A;  1IT8 A;  1Z1S A;  2F86 B;  1QMA A;  3ER7 A;  5ELU A;  1ROA A;  2P05 A;  3PYJ A;  1K28 A;  1JNQ A;  1TFO A;  2UX0 A;  2OTJ 3;  3SXX A;  3HK4 A;  2F99 A;  2P0X A;  1FGO A;  3B7C A;  1Q40 B;  3DUK A;  1RRL A;  4CDL A;  3CCL 3;  3LTD A;  3WOF B;  5IF6 A;  2XGL A;  4KFE A;  1W00 A;  1IDP A;  2GBW B;  2WOH A;  4XBY A;  4HZ9 B;  4O8S A;  1OCV A;  2I9W A;  1OHP A;  1J2B A;  3X42 A;  2W56 B;  2W04 A;  5EQL A;  3X3X A;  4FCZ A;  1NU3 A;  3BNB A;  4MMZ B;  1IVW A;  1W01 A;  2FGT A;  3FH1 A;  3LZA A;  3DM8 A;  4HM5 B;  5EVH A;  5JBS A;  4RNZ A;  1YGE A;  3T8U A;  4AEQ A;  4R9L A;  3FF2 A;  3FCS B;  2CH9 A;  3MG2 A;  5IEN A;  2F98 A;  2BT3 A;  3V92 A;  1K9M 4;  1TU5 A;  5IW9 A;  4HM1 B;  2XFT A;  4I4K A;  2BNG A;  7STD A;  2MF7 A;  4Q53 A;  3EE1 A;  5CXO A;  2RGQ A;  1Q42 A;  3B8L A;  4HM7 B;  5IEP A;  3N8B A;  3NV0 A;  2HMN B;  1LOX A;  3FGY A;  5CF2 A;  3RGA A;  1Q7Y 4;  4OK0 A;  1UI7 A;  5AEW B;  3EN8 A;  3B4O A;  1JB4 A;  3LTC A;  1OPY A;  3NBR A;  1MNL A;  2CK3 H;  3CPW 2;  1VQ9 3;  1OUN A;  2IMJ A;  3WA2 X;  3F40 A;  5BXQ A;  1JN5 B;  1NB5 I;  2V1L A;  1ULI B;  4EYC A;  2B24 B;  2ZL8 A;  4FMD A;  3CCS 3;  2E2T A;  1N5H A;  1NO3 A;  4N6L A;  3RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...