3ECHA

The marr-family repressor mexr in complex with its antirepressor armr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
142
structure length
129
Chain Sequence
MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCALITRKIRELEGRNLVRRQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
publication title The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription, transcription regulation
total genus 49
structure length 129
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3echA01
3K9TA 4UNOA 4U0YA 3R61A 1JE8A 3GUDA 4S05A 1H9GA 5DCMA 1ZG5A 5D5VB 5J6XA 5LHGA 3HSEA 5J8CA 1MD0A 1W7PB 2KJBA 3NRVA 4ESBA 2FE3A 1A04A 1HKQA 1XGOA 2DFIA 4BHPA 1TQPA 4P9UA 3KP2A 2EK5A 3GFLA 2IA2A 1KU7A 1BBYA 2WV0A 5D4RA 4CGZA 1XGSA 2HOEA 2QQ9A 2DW4A 3CUQC 4WX9A 4L0YB 4BQAA 3J81K 2A5YB 1HW5A 1OR7A 4HF1A 3KZYA 4LFUA 1D5VA 2UXNA 2HGCA 1BI2A 3FMRA 4YG2F 4Z2YA 3SXYA 1D3YA 3R60A 1S3JA 5JFRA 4GGGA 2L4MA 1R1TA 3LSTA 1C0WA 2BYVE 4R79A 2HKOA 2BV6A 3F8CA 5CLSA 4XBFA 1NHAA 2A61A 3F72A 1QNTA 4IRGA 5JR3A 4ENMA 1K78A 5ERIA 5J8FA 4AIJA 3GYHX 4G6QA 1I6XA 1KGSA 2ISZA 1OYWA 5ILVA 2CG4A 4FHTA 2VE8A 3ZMSA 2GAUA 5TRDA 2VOOA 2K86A 2F5DA 4CDGA 1T2KA 3G3ZA 3P7NA 3T5XA 4K2EA 2WTEA 3FXRA 3C18A 5BPIA 5BOXA 2DQRA 3WTYC 3LA3A 4IVNA 3E6BA 2HFHA 1JXSA 2ZJ2A 3ULQB 4HQEA 3HRMA 4N9HA 4I01A 1FC3A 1RUNA 4CXFA 2PFBA 2A3SA 3SZTA 4BHCA 2NS0A 3FXUA 4ZYEA 5K5QA 3OV8A 2E1CA 3F6VA 3FX3A 3OOPA 5ILUA 1R5GA 1Z9CA 1EH8A 4G7OF 4GYIA 5HVQC 4RS8A 5DD4A 4FT8A 2EFOA 4E70A 4EJUA 2M30A 2XUBA 3FZVA 2RC4A 1RIOH 1PUEE 2QYOA 4CHUA 4A12A 4GYGA 2M8EA 1MJAA 2VBXA 3BPVA 4EJOA 4L18B 4OMZA 1SD4A 5D5XB 3J81Z 5ICGA 5D6FA 4RAYA 4BYYA 4ZYGA 3GVAA 5F64A 3RPQA 1DPRA 1BC7C 2HKXA 3IKTA 1YW8A 2VC0A 4AIKA 2PG4A 1QZYA 2JRTA 2CFXA 2BBYA 4NHJA 2QUFA 3BROA 2CW0F 4HOBA 4KIBA 3Q9VA 2YPRA 2M5WA 1LNWA 2DAOA 1FYMA 4OIQF 1P4XA 3VEPA 4L9NA 2EV0A 3ZMDA 5DV5A 3VFZA 4LJZF 3MFKA 2CSOA 1PP7U 2D1HA 2P6TA 3K1MA 3V8LA 1RNLA 2GZWA 4MHGA 4OOIA 1YW7A 2JPBA 1O3QA 1LDDA 4OINF 3ZMTA 3EYYA 3HYIA 2RDPA 1RZ4A 2B0LA 3O2PE 3CTAA 3L09A 1FBSA 2ZBKA 4NB5A 1ULYA 1UCRA 1ZYRF 3E6DA 2HQNA 5FB2A 5LBQA 1FSEA 3GXOA 4M74A 1J7KA 3C1DA 1G3YA 3L7WA 2COMA 4EJVA 3ELKA 1JGSA 3HTSB 4CYDA 1Q1HA 1SD5A 1XCBA 2QBYB 1LEBA 1T98A 1G3TA 4MTEA 2XAJA 2K4JA 2LNBA 1H0MA 2IT0A 2IJLA 3R0AA 4YFNF 1QO0D 5L3EA 1U3EM 1HSJA 2DT5A 4O3MA 1IXRC 1V4RA 3KE2A 4XSZF 5E1WA 2QM3A 5LRSA 1R00A 2VONA 2IVMA 4UHTA 2VT3A 1YS6A 2H6CA 2L4AA 1GXPA 1GVJA 1YFHA 1HKSA 1S29A 4BHBA 1IAWA 1OYYA 4WF2A 3DXJF 4A5NA 1TQIA 5IT9K 1LDKB 4Y15A 3SHFA 1CF7A 5HDNA 3KFWX 3TKYA 1E2XA 3IL2A 1IUYA 4HF2A 2K7LA 1ZLJA 2Z3YA 5HDKA 1Z7UA 3GZ6A 1P4AA 2OQGA 3Q5FA 3JTHA 5DEQA 2PQ8A 3V4GA 3LAJA 3IKVA 4PGHA 5DYMA 1BC8C 3LQRA 1U2WA 4UXNA 5BQTA 2L3DA 1RI7A 1UHWA 2CQKA 1YG2A 3I59B 2GQQA 2K02A 1SD6A 1KQ9A 4L9VA 3FHZA 2OU2A 1B1BA 3EYIA 1FP1D 5HDGA 1UB9A 3J7AO 4UV9A 1JHFA 1FWZA 1GHCA 3ABTA 2A07F 5A2QK 4IHSA 1T39A 2EV6A 1X3UA 4P96A 5D8LB 3ZPLA 4EGZA 1WI9A 2ISYA 4O5VA 1JHHA 3RYPA 4WXCA 1EH6A 4IRIA 5FLXK 1ZRFA 3GWZA 3TDUC 2ELHA 3RYRA 4YFKF 2UXXA 2IA1A 3WG9A 2YU3A 4U88A 3FMSA 2F5FA 1TW3A 1HBXG 3DEUA 3GFJA 2ZKZA 1USSA 1J9IA 1L3LA 2FEZA 2IA0A 1U5TC 3DP7A 2ZNZA 1ZGJA 2MA3A 1P6RA 2PI0A 3HRTA 1IF1A 3E6MA 3C3WA 2XVCA 3D0SA 1J0RA 4CZZA 1H9TA 1Z1DA 1XN7A 1FY7A 3W6JB 2ZFWA 1XGNA 5CVVA 3WGGA 5LLQA 5BPDA 1ONVA 5LEKA 1J5YA 1D8JA 1WRJA 3CO7C 4HBLA 4EMSA 4A2UA 1IW7F 5IT9Z 3GFMA 2J5OA 4G94A 1PP8F 2HDCA 2M1BA 1W7PA 3WTTC 3F8BA 2EJRA 2OBPA 3WTUC 3AAFA 2H6BA 3TO6A 4KT5C 4M73A 3F8FA 2EFPA 4XSXF 4ENKA 5DCMB 3FMQA 1QBJA 4UVBA 5D8KB 4MEYF 1ZREA 3KEOA 2STTA 1R22A 3WODF 2IPQX 4I02A 3KP7A 3DF8A 3E5UA 5LGNA 5CYVA 2M87A 2RKHA 2P6SA 5HS8A 3ZMZA 1IN6A 1XDSA 1U5TA 2E1NA 1Y0UA 5A2QZ 1O3TA 3HRUA 2ZMEA 4KA4A 4ZZDA 1SAXA 2CO5A 3VB2A 1ON1A 3BP8A 2AXLA 2XHKA 4G6DA 4I09A 3FXQA 4N9IA 3IC7A 5FLXZ 2UWMA 3CLOA 2R3SA 3IRRA 2MLKA 4G7HF 1WSUA 4LK0F 2H27A 2HS5A 3BPXA 3E6CC 3SFZA 3G73A 2EFNA 3TGNA 4R8HA 2QWWA 4RGRA 2WC2A 2A6EF 4RB3C 1ZG1A 2IW5A 2J5PA 1ZN2A 2ZNYA 3F21A 5ICEA 3KP5A 2QENA 3SZPA 4P9FA 1K78B 3R4KA 5L3BA 4AD9A 4AVPA 4HW0A 4KNYA 4WCGA 2DK5A 2Q8KA 3E3VA 3MCZA 4KYWA 3QPHA 3ZP5A 4YFXF 2NNYA 4IPAA 3CUQA 1U8RA 3WU0A 1U78A 1K6OA 2W24A 3F8MA 5DDGA 2DI3A 4P5OA 2ZCWA 4HA8A 3O3KA 4FX0A 1FZPB 2ADUA 1O57A 3IRQA 1KYZA 2VBZA 3LA2A 4EGYA 3BDDA 1FX7A 3VODA 1XSDA 4UUVA 1J59A 3I4PA 1IN5A 2D1VA 4EQQA 1TNTA 3RDIA 4L9TA 1XSXA 1SFEA 4L0ZB 2DLLA 4ASNA 1O7FA 4U0WA 2STWA 1R23A 5HS7A 1FP2A 1FNNA 1MJBA 2GA2A 4AIHA 2DU9A 2C6YA 2H94A 2HTSA 2HR3A 2FF4A 2FMYA 2KJCA 4YIIA 4A0YA 1FYKA 1R1UA 3F23A 4Y13A 2Z33A 4FX4A 3H3UA 4JQFA 5ICFA 5LEJA 2MH9A 2VT2A 4B8XA 3GW2A 2O61A 2RQPA 4ZYHA 3HTUA 2YX7A 1S7AA 2PLYA 2DBBA 3N97A 2KRFA 3P9CA 3TO7A 2FA5A 2MBFA 2LSOA 4IXAA 4WK8F 3GFIA 2HWVA 1B6AA 4BXUA 3KEQA 2XRNA 2XAQA 4EM2A 3KLOA 4KICA 3CO6C 2MD5A 3HSFA 2YX4A 4EJWA 2QQAA 2W85A 1R7JA 4IRHA 2JTVA 1FOKA 1DDNA 5L3CA 1IRFA 1HXDA 5HLGA 2FNAA 1USTA 5JI6A 5FO5A 4KMUX 4RGUA 4H0EA 2RVCA 3PFIA 5FD6A 2EV5A 3T0YA 3WE3A 2DQLA 4OIRF 5E8GA 2P7VB 3R0JA 4HDUA 3BJAA 2HQRA 5LGTA 1HKTA 2K27A 2XAGA 3K69A 3KP6A 1KA8A 4RB2C 3HUGA 3V7RA 4D0PA 3QP5A 3F3XA 3L9FA 2XAFA 1XGMA 4YIFA 1BN5A 5K1YA 1U6GA 2QLZA 2P5LC 4AWXB 2BEOA 4IJAA 1KU9A 4KMFA 1SMTA 3C7JA 4ENJA 4I7HA 5CVJA 5ILSA 5L3FA 2NNNA 2QBYA 3DFGA 3RJPA 1TTYA 1FYLA 4A5MA 5HS9A 2G9WA 5H6QA 3ZQ7A 3QU6A 2UZKA 4ENNA 5K5OA 4WWCA 2G7HA 1D8KA 5E8IA 1EV7A 3CDHA 3WU1B 2OAZA 1TQMA 1BIBA 5AIPA 5E1ZB 1L0OC 4MQVA 3EQLF 5ED4A 3I58A 4M71A 1SMYF 1I5ZA 4HLXA 3JTGA 3V7SA 2VC1A 2EFWA 1BM9A 4M9SA 1K7AA 3F22A 2O03A 2OA4A 1R1VA 1TLHB 3M8EA 3REOA 1ODDA 2NAZA 4I98B 2DPUA 2XIGA 2Y75A 2GXBA 3RKWA 2FMLA 3LFKA 1LVAA 4QWQA 5JVTA 2PJPA 3I0TA 1P92A 3DKWA 1S8NA 4UVCA 5L3DA 1EH7A 3ZMVA 1BI3A 2LDUA 1ZAOA 4ZH4F 2KIMA 1CF7B 1IXSB 2L54A 3KP3A 2JSCA 1ZRCA 1FSHA 3I59A 4RAZA 1LQ1A 5H6RA 3WGHA 4RB0A 1B4AA 3ISPA 2GA1A 4ON0A 3K1PA 4ESFA 2RV8A 4A0ZA 4HQMA 5D5WB 2P8TA 5E1XA 3B02A 2Y48A 4KIGA 3ML6A 3NQOA 5D6EA 1UHMA 2CGPA 1LEAA 3FM3A 3WTWC 2XGXA 4I0AA 2ETHA 2GXGA 3BOQA 4M6XA 1F4KA 3FF5A 3JW4A 1MDMA 1ZLKA 1HW2A 4LG0A 3TDZC 2MC3A 3GZ5A 4IHTA 2DK8A 4LLGF 3TOBA 1QGPA 4HX8A 5HLHA 2P5VA 2L01A 3E5XA 1G4DA 1TNSA 2O3FA 5EEGA 1YYVA 5CVRA 3O6BB 1I1SA 3WTSC 2VE9A 1LJ9A 4HZFA 2W57A 1DP7P 2FU4A 3U2RA 4HF0A 4GCVA 1R58A 4PCQA 3T1BA 3DQVC 1WWXA 3QU3A 1QPMA 1XCVA 1REPC 2F2EA 1YW9A 1Z6RA 3BWGA 1P2FA 4LGWA 4A6EA 1YTYA 2FSWA 1GXQA 1B9MA 3HSRA 1O7LA 2LF7A 2QQBA 1STZA 2JZYA 1B9NA 5DCFA 4HLYA 2D2WA 3BZ6A 4LB6B 1XDUA 2W25A 1BI1A 4Y17A 1T0FA 5HLIA 1YQAA 1KU3A 2GIVA 3GO5A 1W7PD 4I0BA 4ZZLA 5HOOA 1G6NA 2A6HF 3BY6A 1MKMA 4Q47A 5FFXA 1BI0A 3QP6A 2XROA 2LF8A 5L3GA 2A69F 2V1DA 1I27A 3K2ZA 2IP2A 1YO5C 2LKPA 3WTVC 3GLXA 4M9XA 3I5UA 4P55A 3LAPA 4Q48A 2DO7A 2F5EA 1TBXA 3JAMK 2F5CA 2XAHA 3FM5A 3R6SA 4DNCA 3L2CA 2G7UA 3RTRA 5KK1A 1J2XA 5AONA 3E97A 2KIFA 2CYYA 3PQJA 4S04A 3T8RA 4M9ZA 4NQWA 1VTNC 4RGXA 3MEXA 1QZZA 1W4MA 5FGMA 3J80K 2XV4S 2XKPA 3CUOA 1LDJA 1AWCA 2Z9OA 2VN2A 3ROUA 2FRHA 4PZJA 4CO8A 3HRSA 1U5TB 2ZXJA 4KFCA 2ZMEB 2V9VA 4UVAA 3TOAA 1FBUA 3BJ6A 2PEXA 2NYXA 1J75A 5E20A 2O0YA 4KIFA 4ETSA 1O3SA 3U1DA 2VBYA 4PDKA 3E5QA 4MNUA 1WQ2A 3RI4A 5LRRA 1LB2A 2ESHA 3ECHA 4MGRA 3V7CA 2PBIA 2X4HA 1OYIA 4GXOA 2PMUA 2TDXA 4ZYDA 3DPTA 1P4WA 2BGCA 2BE5F 2ACJA 4CICA 4L5IA 4LD5A 2JPCA 3I64A 4HX7A 4OIOF 2JT1A 1FBQA 2HZTA 3DPLC 4GO1A 4LB5A 3W6KB 2DPDA 2RGVA 1KQ0A 3ABUA 4WXHA 1KYWA 3LQQA 2PN6A 2IRFG 2X0LA 5KVRA 5F1RA 1MGTA 1ZRDA 5LHIA 3CUQB 2VXZA 4B09A 3KZZA 2Z5UA 3CJNA 4A6DA 3TQNA 2V1UA 5BMZA 3P9IA 3K1NA 5DUIA 5CJ9A 5E17F 3GEZA 2OD5A 1R36A 4MQ9F 4Q5SF 1XB4A 4HDVA 3N4MA 1SFXA 4DQ2A 1R5HA 5D5UB 4KDPA 1G3SA 3GF2A 4LMYA 2O8XA 3JAMZ 3COAC 1FPQA 2V1XA 3Q9SA 3F8NA 1XMAA 3LA7A 4L9JA 3ECOA 1DPUA 1ZARA 2Q0OA 4HV6A 2EFQA 1W5SA 3J80Z 2FBKA 4KN7X 2HEOA 4HV5A 3IHUA 2W84A 2D45A 3V8JA 2ZO4A 1OKRA 4OU0A 3JSOA 2E7WA 1Z6TA 3M8FA 3VOEA 3GX4X 2KKOA 3RKXA 2P4WA 5IT3A 3KLNA 4I2OA 4QLCU 1ON2A 3WTZA 4U7DA 1OPCA 3M7GA 1F9NA 2EA4A 2FBHA 4WXDA 1IRGA 2FQ3A 3L00A 4OIPF 3RIRA 2QVOA 1IZ1A 2E7XA 1OMIA 1W5TA 4JBAA 5DD8A 4A0XA 2V79A 3T8TA 2RNJA 3RPUA 1IN7A 3IWFA 1ZH5A 1HSTA 3H3ZA 1BJAA 3QOPA 5CVUA 4F7ZA 2RN7A 3F6OA 3MZYA 2O6GE 2CWEA 1SFUA 2P7CB 3FWEA 2K4BA 2PMHA 1ZHFA 1E17A 4JK1X 4U0VA 1XD7A 5JHUA 2DTRA 3HIFA 3RKYA 3I71A 2VOPA 2VODA 3WGIA 3HOSA 2NRAC 3M9AA 2Z99A 5LGUA 2XKOA 4MEXF 1XSVA 3ZN1A 3MQ0A 2MLGA 4EM0B 4HAMA 4UV8A 2R7DA 4M72A 3S2WA 2VBWA 3QPTA 4L5JA 4XLPF 2XASA 3BJOA 2A68F 1HQCA 4Q4ZF 4LK1F 1XMKA 4M6YA 4EM1A 2OZ6A 3JSPA 1PDNC 1AOYA 2FNPA 3PQKA 1O3RA 2V6CA 1I1GA 1B59A 1S6LA 2YSRA 6PAXA 1BIAA 3TO9A 1G3WA 1Z91A 5CVIA 2Y0MA 2AS5F 1YIOA 3QAHA 1Z05A 2KIUA 3V8KA 1RUOA 2HYGD 5BS6A 5AIQA 3HOTA 2HTJA 3ZMUA 4EJTA 3QRFF 3EDPA 2GWRA 5EEHA 1S7OA 1DUXC 5TJJA 2Q2EA 1HW1A 4BAYA 1T6SA 1IXCA 1ZG3A 4EVIA 5K5RA 4N0BA 3U9GA 1YS7A 4BNCA 2QZ8A 3LWFA 3WE2A 4G8XA 3MZHA 3IWZA 4O6JA 5LHHA 3HHGA 2YR2A 4OMYA 5H20A 2EB7A 3KETA 2EA2A 3ERED 1TW2A 1FT9A 3DV8A 4EV0A 3P9KA 1UFMA 4PGGA 4MTDA 4BH9A 3I53A 1MZBA 1MJ9A 4HYEA 3D5LA 2FOKA 3B73A 1WKMA 3MAJA 3KP4A 4KN4X 5E18F 4TV7A 1F5TA 5FFZA 3MWMA 2HYFA 3SQNA 4LLNA 2L02A 5ICCA 5DUKA 4R1HA 4RGSA 3EETA 4XRFA 1K79A 3ZN0A 1IN4A 3EUHA 1MDMB 2OQRA 1ZGAA 4G7ZF 1FLIA 2P5KA 4G9YA 4LG0B 1YLFA 3I54A 3K0LA 5FD5A 2H09A 1QQIA 1CGPA 2R7FA 1KU2A 4KUMA 4ESJA 3KCCA 3HHHA 1V3FA 1F1ZA 2FXAA 1IN8A 2WWYA 4XLNF 1SD7A 4U7BA 5D4SA 4LLLA 2OZUA 3H92A 4IF4A 4RB1A 1BOAA 2FBIA 1KQ8A 4HX4A 3NEUA 2EWNA 2MH2A 3WTXC 3M1EA 1T38A 2M45A 2ESNA 5F6FA
chains in the Genus database with same CATH superfamily
3K9TA 4UNOA 1WJFA 4U0YA 3R61A 2KPMA 4IO9F 1JE8A 2DCEA 2BVMA 3GUDA 1H9GA 4S05A 5DCMA 1ZG5A 5D5VB 1JKRC 5J6XA 5LHGA 3HSEA 5J8CA 1MD0A 2Z2SB 1W7PB 3PSIA 2KJBA 3W2AA 5HNFA 4NNJA 3NRVA 3L1PA 4ESBA 2R93J 2FE3A 1A04A 1HKQA 1W5CC 1XGOA 2X48A 2DFIA 4BHPA 1TQPA 4P9UA 3KP2A 2EK5A 1ZQ3P 9ANTA 3GFLA 2IA2A 4BXXJ 4MFEA 2CMPA 1T56A 2HPMA 1KU7A 3JRHA 1BBYA 2WV0A 4DYQA 5D4RA 4CGZA 1JUSA 1XGSA 4DZJA 2BW3B 2HOEA 2QQ9A 3ABKH 2DW4A 3CUQC 4WX9A 4RDUA 4L0YB 4BQAA 5EEAA 3J81K 2M7BA 1X1AA 2A5YB 1HW5A 5KNLA 1OR7A 1WI3A 1UG0A 3OIQA 4HF1A 5B1BH 3KZYA 4LFUA 1FTTA 1D5VA 1JTYA 2UXNA 4BKXA 2K40A 2K85A 1B72B 2HGCA 2JVHA 1Y8RB 1BI2A 3RQIA 2JMWA 3FMRA 1HA8A 4D1QA 4YG2F 4Z2YA 3DBHB 3SXYA 3FK6A 1D3YA 4Y52J 3R60A 1S3JA 4RBOA 3IAM2 5JFRA 2HVRA 4GGGA 1U9OA 2L4MA 1R1TA 3LSTA 1C0WA 2BYVE 2KDZA 2DOEA 4R79A 2HKOA 3Q0UA 4E7IA 2BV6A 3F8CA 4NQWB 5CLSA 2QF7A 1FJLA 3HGGA 3VSLA 4XBFA 2L7MP 4CYCB 3EUAA 5TISC 1AKHA 1NHAA 3HG9A 2VKVA 2A61A 4BJ5C 2ZSIB 3F72A 1JGGA 1QNTA 4XR6A 1D1AA 4IRGA 5JR3A 4ENMA 1B8IB 1K78A 5ERIA 5J8FA 2R7ZJ 4IHVA 5JLXA 4AIJA 3GYHX 4E7SA 4G6QA 1I6XA 1KGSA 2ISZA 5B66C 1OYWA 5ILVA 2CG4A 5KHDA 2WBMA 3MKWB 4FHTA 3NWSA 5EZHA 3G71I 2VE8A 1UELB 3ZMSA 2GAUA 5TRDA 4YELA 2VOOA 2K86A 1MSFC 2F5DA 4FETA 4CDGA 4ZDLA 1OCPA 1ETVA 2VJ5A 4M3FA 3G3ZA 1T2KA 3P7NA 2NVYJ 3T5XA 1ERDA 1RETA 4K2EA 2WTEA 3S15J 3FXRA 3C18A 4RAFA 5BPIA 5BOXA 3K7AJ 2DQRA 3TMOA 3WTYC 5C3EJ 1S7EA 2YS9A 3LA3A 4HPQA 2E2IJ 4IVNA 3E6BA 3HOYJ 3EPZA 3CCUI 1ZR2A 2HFHA 3OY9A 1JKOC 1HDDC 1JXSA 2ZJ2A 3ULQB 4HQEA 1A36A 2V26A 3HRMA 4N9HA 4I01A 1FC3A 1RUNA 2E5ZA 4CXFA 4B1RA 3PJRA 2PFBA 4D7NA 3HKZN 2A3SA 4RM2A 3SZTA 4BHCA 2NS0A 3FXUA 4ZYEA 2CV1A 2E1MB 5DM7F 1RR7A 5K5QA 3OV8A 2ZJRF 2E1CA 3F6VA 1PUFA 1MNDA 3M8JA 4W97A 1UMQA 1RRJA 3FX3A 4UY8I 1X2NA 3OOPA 5ILUA 5J40A 1R5GA 1R9TJ 1OJLA 1Z9CA 1EH8A 4G7OF 5GPAA 4UUSB 2ICWG 4GYIA 3JRDA 2TRTA 5HVQC 2XF5A 4FTHA 2WY8Q 4RS8A 4C3JJ 5DD4A 4FT8A 4YIRX 2EFOA 4E70A 1JJ8C 3F0CA 2L9RA 1ACIA 4EJUA 1JUMA 3K4CA 2WAEA 2DMNA 2M30A 2XUBA 3FZVA 2RC4A 2KLOA 2LLKA 1RIOH 1VQ5I 2OPTA 2Y2ZA 1PUEE 2ID6A 2JA5J 1BJZA 1WH5A 2QYOA 1NTCA 4CHUA 3OIPA 4A12A 4GYGA 2XPWA 1T33A 2M8EA 1VQ9I 1MJAA 2ECBA 2LKSA 2VBXA 3QWLA 3GTLJ 3BPVA 5C4XJ 1W0UA 1I50J 1MH4A 1WJDA 2GOMA 4OMZA 4EJOA 2DXIA 4L18B 1SD4A 5D5XB 3J81Z 2DMQA 4E6KG 5ICGA 1X3WB 5D6FA 4HSTA 4RAYA 2YU9J 4BYYA 3CC2I 2E60A 4ZYGA 3GVAA 2HI3A 2NVXJ 5F64A 3RPQA 1DPRA 3AG4H 3G4SI 3CQZJ 5FROA 1BC7C 2HKXA 3IKTA 1XG1A 1YW8A 2F48A 2VC0A 4AIKA 4ZC3A 1TP4A 1G8XA 1TZLA 2EZKA 4H4KC 3LSJA 2PG4A 2JJ7A 4QSHA 1QZYA 2JRTA 1SC7A 2CFXA 3CC4I 2BBYA 1Z0XA 2QUFA 1MMDA 5IY5H 3RKQA 3BROA 4EEFG 2CW0F 4NHJA 2XB0X 4HOBA 1WVRA 4KIBA 1YX3A 1WJBA 3Q9VA 2YPRA 5K7HA 2M5WA 2R92J 1LNWA 4Y7NJ 1LE8B 2DAOA 4PJNA 1FYMA 3PUFA 4OIQF 1P4XA 3SJMA 3VEPA 4L9NA 1OCOH 2EV0A 3ZMDA 3HJEA 5DV5A 3VFZA 4DYRA 3OR2C 4LJZF 2ZFUA 2HVQA 3SDGA 3MFKA 2CSOA 2Y9YA 1PP7U 2XGEA 4D5CA 2D1HA 4DW6A 2P6TA 2Z16A 3K1MA 3GTOJ 3V8LA 2DDAA 2E71A 2E34A 4FCYA 1RNLA 2GZWA 4MHGA 4OOIA 3BR5A 4IZZA 1QA6A 1YW7A 4A3JJ 2JPBA 3LSGA 1ZR4A 1O3QA 1LDDA 1D0ZA 2CJJA 4OINF 3JRCA 3ZMTA 2PX9A 3SYTA 2LG4A 2WA0A 3EYYA 3HYIA 2AQFA 4IHYA 1BOBA 2MABA 1NG7A 3HBLA 4ZTJA 4W1UA 2DA6A 2RDPA 1T8IA 2ELJA 1RZ4A 2B0LA 2F6CA 1YHQI 3O2PE 3CTAA 4MIMA 3L09A 1TT0A 1OLTA 2M8GX 3GTJJ 1FBSA 3HDDA 1WPKA 4D7MA 3H9GA 1TWAJ 2ZBKA 2DA1A 1E0EA 4NB5A 1ULYA 1YI2I 1UCRA 1ZYRF 3O8GA 2HU9A 3KPHA 3E6DA 2HQNA 2JA8J 3CP2A 3PFYA 5LBQA 5FB2A 4IHXA 1G59A 1EA3A 1FSEA 3GXOA 2CQXA 4M74A 1J7KA 3M3YJ 2KDOA 1XPXA 2DMTA 3C1DA 1Y1WJ 2W48A 3OYJA 1OISA 3H0GJ 1G3YA 3L7WA 4II3A 3DU5A 4F3QA 3S2HJ 4D9JA 1UHSA 2IEKA 2QGUA 4LOCA 2COMA 2ME6A 4EJVA 3RPUD 3AFHA 3ELKA 1JGSA 3A0HC 3HTSB 2VIXA 1YRNA 3OYBA 1QVUA 4DBQA 4QPQA 4CYDA 1VZ0A 1Q1HA 1SD5A 3ESWB 1XCBA 5IYCJ 3LSPA 2QBYB 1LEBA 1RKTA 1T98A 1G3TA 4MTEA 1FIPA 2R5ZA 2XAJA 3A02A 2K4JA 2LNBA 1H0MA 2IT0A 3KZIC 3BZKA 1XS9A 2IJLA 2KZGA 3R0AA 2DOAA 4YFNF 1M1EB 1QO0D 5L3EA 1U3EM 2CQNA 1HSJA 2PMZN 4DOZA 2HOTA 2DT5A 4O3MA 1IXRC 1V4RA 3BG5A 2L0KA 4EATA 3KE2A 3DTKA 3W3CA 2NVUB 4CSWA 1GLNA 4A3CJ 3CCLI 4XSZF 5E1WA 2QM3A 5LRSA 3A01B 1VQLI 1OQYA 3CCVI 1R00A 2QEXI 2VONA 2GLOA 2IVMA 4JX6A 2MW8A 4RM3A 3GTQJ 4A3BJ 4UHTA 1FEXA 2RNGA 2VT3A 4XORA 3OYHA 1YS6A 3WHCA 2CUFA 2M7AA 2H6CA 4AC0A 2EZIA 3IH4A 4FE4A 2L4AA 3W6VA 1WJEA 1GXPA 1GVJA 3IUOA 3VYRB 5EGOA 1YFHA 3S2DJ 3DWLE 1HKSA 1S29A 4BHBA 1RR8C 2R7OA 1IAWA 2EQRA 2Y69H 1OYYA 1Y8QB 2LKXA 1GV2A 2H1LA 1FOWA 3H9JA 3DXJF 4WF2A 2FX0A 5E3OA 4A5NA 4N4NB 2RQQA 1TQIA 5IT9K 1LDKB 1WJCA 4Y15A 2CFOA 3SHFA 4F92B 4CCNA 1FOXA 1CF7A 2E36A 2YUSA 5HDNA 1VQNI 5IOYA 1VNDA 3KFWX 1R4MB 1K4TA 3TKYA 1E2XA 3IL2A 3IH3A 4AVZA 1X4OA 1MMNA 2VASA 3HKZA 3MN2A 4NC6A 4OAZA 1IUYA 1Z3YA 2ELKA 4HF2A 2K7LA 1LKXA 5FKKA 1ZLJA 2Z3YA 3MKZA 5HDKA 1XMXA 1Z7UA 3DEWA 3RCOA 1P4AA 3GZ6A 2OQGA 3LNQA 4YRVA 3Q5FA 3JTHA 4J01A 2EH3A 5DEQA 2PQ8A 2ZXIA 1N77A 3V4GA 3Q0VA 4XLFA 5EDNA 3LAJA 4JOMA 3IKVA 3DPUA 4PGHA 2HVSA 4C2UA 5DYMA 1D1BA 3K6GA 1BC8C 4XNFA 5KCMA 3OYIA 5GAEJ 3LQRA 1IUFA 1U2WA 1HCRA 5EG0A 4UXNA 5BQTA 2L3DA 4NBQA 1RI7A 1UHWA 3BCBA 2CQKA 2Q2EB 1YG2A 4C9YA 2LD5A 3I59B 2GQQA 2IBDA 2K02A 3HM5A 3GTPJ 3G2BA 1XTAA 1SD6A 4HNTA 1KQ9A 4L9VA 3FHZA 2QQ8A 1LPQA 2OU2A 1B1BA 3ZQLA 1FP1D 3EYIA 4A3LJ 5HDGA 1IO2A 2ZJQF 1F36A 5KAFC 1UB9A 3J7AO 2H8RA 4ZDOA 5M3FJ 4UV9A 1JHFA 1FWZA 1GHCA 3ABTA 2A07F 3DTIA 1P9QC 5A2QK 2A6TA 4IHSA 4AU7A 1GT0C 4I99C 2M0CA 2IS1A 4ITVA 1T39A 2EV6A 2R7VA 4AYBN 5C4JJ 3WU2C 1X3UA 4P96A 5D8LB 3ZPLA 3G1OA 3ZXSA 4EGZA 2R7SA 1U9NA 1WI9A 2E19A 1S9HA 3Q3SA 1I39A 3ZGKA 2ISYA 2Z1DA 4O5VA 2LBFB 1JHHA 3RYPA 4WXCA 1EH6A 1WGXA 4IRIA 5FLXK 2P81A 1ZRFA 3GWZA 3TDUC 2ELHA 3RYRA 1XC5A 4YFKF 2DA4A 2IA1A 2UXXA 4M3EA 3WG9A 2X6YA 3AL0B 2QKLB 3NARA 2CUJA 2YU3A 3B6CA 2LY2A 4U88A 3FMSA 4CCJA 2F5FA 4BXFA 1TW3A 1HBXG 3OYMA 3DEUA 3GFJA 2ZKZA 4UB8C 1USSA 1AU7A 4C30A 1J9IA 1DP3A 3CCMI 1L3LA 2FEZA 2IA0A 1U5TC 2WB1A 3DP7A 2ZNZA 1OCRH 1ETXA 4X1EA 1ZGJA 2MA3A 3BR1A 2QCOA 2ZMEC 1P6RA 4RLQA 2PI0A 3K4MA 3A1YA 3HRTA 1W36D 1IF1A 2HDWA 3C3WA 3E6MA 1SANA 2XVCA 3D0SA 3JRGA 2K3FA 1SFOJ 1J0RA 2Y30A 3RQ4A 2K9QA 3CJQB 3OOUA 4CZZA 1H9TA 1Z1DA 4XLAA 1XN7A 3SEZA 1FY7A 3W6JB 2ZFWA 2PJRA 2XRLA 1XGNA 5CVVA 3WGGA 5LLQA 5BPDA 3QPSA 3OSFA 4HEA2 3AG2H 3ONQA 4XK4A 1TC3C 2W7NA 1ONVA 3BR2A 5LEKA 1J5YA 1HLVA 1D8JA 1VQKI 1WRJA 3OR1C 3CO7C 1IRXA 4HBLA 2BY2A 4EMSA 4A2UA 1IW7F 2V4JC 2TCTA 5IT9Z 3GFMA 2J5OA 5IOZA 4G94A 1PP8F 1D1CA 3ZRGA 3S1RJ 2HDCA 2M1BA 2KIQA 1U0JA 1W7PA 3KIOA 3WTTC 2L7FP 3F8BA 3OYKA 2EJRA 2OBPA 3WTUC 3AAFA 3NWTA 2KRCA 4E7KA 2H6BA 3TO6A 3OYAA 3PNVA 1U8BA 3D5SC 4KT5C 2K9LA 4M73A 3L2VA 3MKLA 3F8FA 2EFPA 1JTXA 4XSXF 4A3EJ 4BGDA 2Y9ZA 2LMDA 4ENKA 5DCMB 1GDTA 3FMQA 3CF5F 1QBJA 4UVBA 5D8KB 4MEYF 4PJMA 3UNGC 1ZREA 3BTJA 3KEOA 3L2RA 4JYKA 2VKEA 2STTA 5CQGA 1R22A 5F1JA 3WODF 2FD5A 2IPQX 2EILH 4I02A 1FTZA 3KP7A 1EF4A 2KHMA 3DF8A 1MBEA 3BG9A 3E5UA 3FXLA 2HQAA 5GPCA 5LGNA 5CYVA 3FHNA 3DKYA 1FMVA 2PMZA 3CJTB 2M87A 2RKHA 3FBNB 3DLLF 2P6SA 1Y39A 5HS8A 5GAGJ 3ZMZA 4BACA 1W0TA 1IN6A 3K2AA 3C2GA 4Y4RA 1XDSA 1E3HA 2K9SA 1U5TA 2E1NA 2V6EA 1PVEA 1Y0UA 5A2QZ 3FXMA 4KITB 3HRUA 1O3TA 2ZMEA 1X3ZB 4KA4A 3A03A 4ZZDA 1SAXA 2CV0A 2IS2A 4IOCF 3BTIA 2VLAA 2CO5A 1XX5A 1MBGA 1WHUA 1A5JA 3VB2A 1VQMI 1QPIA 1ON1A 3BP8A 2AXLA 2XHKA 2BHYA 4G6DA 4I09A 4A3GJ 3FXQA 3G1MA 3CMAI 1X1CA 4JX4A 4N9IA 3K10A 3IC7A 3CDIA 5FLXZ 1YOVB 3I3LA 3CCYA 3L2QA 3S1MJ 2UWMA 3CLOA 2R3SA 3IRRA 4BY1J 2MLKA 2W82A 4B3AA 2VXDA 4G7HF 4LK0F 3VDXA 3FDYA 2HS5A 3BPXA 3E6CC 3SFZA 1Y1VJ 3G73A 1K61A 3UR3C 2K5CA 2EFNA 3TGNA 4R8HA 1LFBA 1NH3A 2QWWA 4RGRA 2WC2A 2A6EF 3CF2A 1WFXA 4RB3C 3TW7A 2NXNB 1ZG1A 2LOOA 2IW5A 4XKCA 2J5PA 1X2MA 5GTIC 1ZN2A 3SFIA 1A35A 2ZNYA 3F21A 1AKHB 2MYSA 1N25A 5ICEA 3JRBA 3BT9A 4PFPA 4I6ZA 2JA6J 3KP5A 2QENA 1KZHA 3SZPA 3VYSB 1P7JA 4DIQA 3VWBA 3K4NA 4P9FA 1K78B 3H3VK 3R4KA 5L3BA 4AD9A 2X1CA 4HW0A 4AVPA 1P7IA 4KNYA 1H89C 4WCGA 1JUPA 2LREA 4G12A 3BCAA 2DK5A 2DJNA 2Q8KA 4OAYA 3E3VA 4BEHA 4F93B 3HOWJ 3BZCA 3MCZA 3VYTB 2KP6A 4KYWA 4A93J 3MD2A 3A2KA 2F4OB 3QPHA 3CESA 2KFDA 3ZP5A 4YFXF 2NNYA 2OF7A 1WZ2A 4IPAA 3CUQA 5F0FA 4A3MJ 2DDBA 1U8RA 3WU0A 1U78A 1K6OA 2JA2A 2W24A 2COBA 3CMEI 2JK3A 3F8MA 1MNMC 3DBLB 3LFUA 2O9LA 5DDGA 2WAQA 2DI3A 4P5OA 3TL4X 2GM4A 1QHHD 2BY3A 2ZCWA 4HA8A 4E7LA 3O3KA 4FX0A 1MBJA 1TT5B 3ERMA 1D5YA 3PO3J 2EBIA 1FZPB 2ADUA 3S1QJ 4M3BA 4AM3A 3LSRA 1O57A 3IRQA 1KYZA 2HYJA 2VBZA 3LA2A 4EGYA 1PUFB 3BDDA 5FLVA 2IGMA 4AYBA 5M5XJ 1FX7A 3VODA 1XSDA 4UUVA 1J59A 3ABMH 2IS4A 3ZQHA 3I4PA 3PIPF 4Z6YA 4XL9A 2I10A 1IN5A 2KZVA 2D1VA 4EQQA 1Y56A 4KJZA 1TNTA 3RDIA 4L9TA 1XSXA 3QYEA 1SFEA 4L0ZB 5J1YA 2DLLA 1QU3A 4ASNA 1O7FA 4U0WA 2STWA 2LC2A 1R23A 2R7QA 5HS7A 1FP2A 1FNNA 1MJBA 2GA2A 2OC6A 4AIHA 2DU9A 2C6YA 1Z77A 3ASNH 2H94A 2HTSA 2HR3A 1X1BA 2FF4A 2FMYA 2KJCA 4YIIA 4A0YA 1FYKA 1R1UA 3F23A 4Y13A 4QPOA 2DMPA 2XF6A 2Z33A 4V2GA 1RPWA 4FX4A 3H3UA 3ZQGA 1KONA 4JQFA 5ICFA 3QPLA 3WG7H 1V5GA 5LEJA 4E7ZA 2MH9A 2VT2A 4B8XA 3GW2A 3BR6A 2O61A 2RQPA 4ZYHA 2X1EA 3HTUA 2JUCA 2CUZA 2YX7A 2Q1ZB 2XPUA 3FISA 4C3HJ 3CDLA 1S7AA 2PLYA 2DBBA 4MFDA 3N97A 2KRFA 4LG3A 3P9CA 3TO7A 1R71A 2FA5A 2MBFA 5FJ8J 4XIDA 1VI0A 2LSOA 2DYRH 1V55H 4B43A 4IXAA 4BUPA 4WK8F 3C2BA 2HWVA 1B6AA 1OCCH 3HXLA 3LSIA 5K7FA 5C44J 3IV5A 2D5VA 3RZOJ 4BXUA 3KEQA 2XRNA 2XAQA 4EM2A 3KLOA 4KICA 3CO6C 2DTZA 2MD5A 3ZOBA 4CZCA 3HSFA 2CH0A 2YX4A 3BQYA 5J4YA 4EJWA 3O8HA 2QQAA 2W85A 5FKMA 3QYBA 1R7JA 4IRHA 1NK3P 2ZSHB 2JTVA 1MBHA 2A5WA 1DDNA 1FOKA 5L3CA 2V9KA 4D5FA 1WJ5A 2NS8A 1IRFA 2VQLA 1HXDA 5HLGA 4XRMA 2FNAA 3HPGA 1USTA 5M5YJ 5JI6A 3WHBA 5FO5A 4KMUX 4RGUA 4H0EA 2RVCA 1H8AC 3PFIA 4CH7A 5FD6A 1AA7A 2EV5A 1GVDA 5M3MJ 3TW6A 3OYFA 3T0YA 3WE3A 3FXKA 2DQLA 4OIRF 5E8GA 2P7VB 2L9NA 1T08B 3R0JA 2LFBA 5J4VA 4HDUA 3BJAA 2HQRA 5LGTA 4C3IJ 1HKTA 1BW6A 2K27A 4N4OB 2XAGA 1Z3XA 3HOUJ 5J1UA 1BW5A 3K69A 3KP6A 1WCMJ 1KA8A 3H1CA 4RB2C 4IEJA 1J09A 3HUGA 1QVTA 1X4PA 3F9KA 3OWTA 3V7RA 3OL4A 4D0PA 3QP5A 3F3XA 2O8KA 3L9FA 1A31A 5E3MA 3HEFA 2M0MA 2O7OA 2XAFA 2HNHA 1XGMA 4YIFA 5J47A 1BN5A 4XM3A 1Y0NA 3SDBA 5K1YA 3ZQCA 4F91B 1U6GA 2QLZA 1ZELA 2P5LC 5FKLA 2BEOA 4AWXB 2VJJA 2UV1A 4IJAA 1KU9A 1BR4A 2ME0A 4KMFA 1SMTA 3C7JA 4ENJA 4I7HA 3TP0A 1E3OC 1BR2A 5CVJA 5ILSA 5L3FA 3TP3A 2NNNA 4ZYAA 3DFGA 3RJPA 2QBYA 4BDYA 3LL7A 1TTYA 2KRHA 1FYLA 4A5MA 3JR9A 5HS9A 2EIJH 3KYDB 5DM6F 1HDPA 3MMYB 2G9WA 3I56I 1K4SA 4XLCA 5H6QA 3ZQ7A 3QU6A 5IP9J 2W00A 2UZKA 4ENNA 4DYCA 1WH7A 2LYCA 3FXJA 3S3OA 5K5OA 4WWCA 2F4MB 2G7HA 1D8KA 2JUGA 3BTCA 5E8IA 2JSPA 1YRNB 1EV7A 3CDHA 3WU1B 3MZ8A 2OAZA 2CW8A 2OJED 1TQMA 3DEEA 1BIBA 3E7LA 5AIPA 5E1ZB 4KT6A 3A01A 3HC7A 1L0OC 2GIZA 1VF9A 4MQVA 2CQQA 3JRFA 3EQLF 5ED4A 2R5ZB 4ABZA 1T95A 2HZDA 4LITA 3CP8A 4AUXA 3I58A 4M71A 4FISA 3ZCOA 3GTMJ 1FIAA 1SMYF 2VKHA 1I5ZA 4XLEA 4J19A 4HLXA 3EUKL 3X2QH 4MO7A 3JTGA 1AHDP 3V7SA 2VC1A 4UUTA 5BNGA 2LP0A 3W2WA 3D1NI 2EFWA 1BM9A 4M9SA 1K7AA 3K70C 4YEJA 3FBIB 5EZGA 1TWHJ 3F22A 4A3DJ 2O03A 2OA4A 3KEYA 1R1VA 1K6YA 2QSGX 1TLHB 3JCUC 3M8EA 2KMUA 3S1NJ 3REOA 4IQJA 3BC8A 1YITI 1ODDA 3PM1A 2NAZA 1IRZA 4G6TB 2LR8A 4I98B 2DPUA 2FQ4A 2XIGA 2XC7A 2Y75A 2GXBA 1PYVA 3RKWA 5EGOB 2FMLA 2VJ4A 4HRIA 3BG6A 3LFKA 1LVAA 2WADA 4JP0A 4QWQA 5JVTA 2PJPA 4A3KJ 3I0TA 1P92A 3DKWA 4HNVA 1S8NA 1PJRA 4MLOA 4UVCA 5L3DA 1EH7A 3ZMVA 2HXOA 3L2UA 1BI3A 3VYUB 2LDUA 1ZAOA 4ZH4F 2KIMA 1CF7B 2FOWA 3OYLA 4C2TA 1IXSB 2L54A 3KP3A 2OCCH 3KYLA 2F5VA 2JSCA 1ZRCA 1FSHA 1UZCA 3I59A 1BR1A 4RAZA 2EZHA 1MMAA 1LQ1A 3OSGA 3K4JA 5H6RA 4XKVA 2H8WA 3GZNB 3WGHA 4XN3A 3C2HA 2VPRA 2L7ZA 2MGQA 4RB0A 2ZC2A 1B4AA 3ISPA 4F55A 5IP6A 2GA1A 4ON0A 2N8GA 2VQHA 1ETQA 3K1PA 4ESFA 1ZKGA 2RV8A 4A0ZA 4HQMA 5D5WB 3H5NA 1X1DA 2QKMB 2P8TA 3IP4B 5E1XA 2HXIA 4XRSA 1VQOI 5EG0B 5M5WJ 3B02A 2XAUA 2QSHX 2Y48A 4KIGA 4ZDPA 3ML6A 3NQOA 1T0FC 2I5UA 5D6EA 1UHMA 2CGPA 1LEAA 3FM3A 5E79C 3WTWC 2LK2A 4DJAA 3S32A 2XGXA 4I0AA 2ETHA 3H5AA 2IGOA 2GXGA 3BOQA 2HPIA 4XLHA 4M6XA 4BE0A 1R49A 2RAEA 2LTPA 1F4KA 3PO2J 3H9QA 3S14J 4GRIA 5IP7J 3FF5A 1IG7A 3J7ZI 4CCMA 3JW4A 1MDMA 1ZLKA 2A05A 1HW2A 1MH3A 3DLAA 2DMUA 4LG0A 3TDZC 2MC3A 3GZ5A 4IHTA 1EJ9A 2DK8A 2LRDA 4LLGF 3TOBA 1QGPA 4HX8A 5HLHA 2P5VA 2H1KA 2R5YA 3OS2A 2L01A 2BZTA 3E5XA 1G4DA 1TNSA 4CCKA 1TWFJ 2O3FA 2NVTJ 4NDLA 5EEGA 1LFUP 4B47A 1YYVA 2BXYA 5CVRA 2DJIA 3O6BB 1I1SA 2AQEA 3WTSC 2VE9A 1LJ9A 4HZFA 5IYBJ 2AXTC 2W57A 4HG2A 1DP7P 2FU4A 3U2RA 4HF0A 4GCVA 1MMGA 1D0XA 2QSFX 1R58A 3E0JB 4PCQA 2FUG2 3T1BA 3DQVC 3A4CA 3OYDA 2P0WA 4L5EA 1WWXA 3QU3A 1QPMA 2IGKA 1XCVA 2MG4A 1REPC 2F2EA 2DA7A 1YW9A 4ANJA 2L5QA 3L2WA 1Z6RA 1IDZA 2BXZA 3U21A 5LD2C 4A69C 4IOAF 4IX7A 3S17J 3M1CA 3BWGA 1P2FA 1QRYA 4BE1A 3CJRB 4LGWA 4A6EA 1YTYA 1I3QJ 3LOCA 5F27A 2FSWA 1GXQA 1MBKA 1B9MA 1YIJI 3H35A 3HSRA 2XSJC 4B44A 1O7LA 2X85A 2LF7A 2V1NA 3PSFA 1V5EA 2QQBA 2E2HJ 1STZA 2DODA 3HGYA 2JZYA 1MNEA 1B9NA 2WV1A 5DCFA 2DOFA 4HLYA 2R7UA 2D2WA 3BZ6A 4LB6B 1XDUA 2W25A 1BI1A 2V9PA 2GBYA 4Y17A 3DTEA 1T0FA 5HLIA 2B63J 1YQAA 3Q0WA 1KU3A 2GIVA 3GO5A 1IC8A 1W7PD 4I0BA 1JJ6C 2X6WA 2BW3A 4XQFA 4V19K 2ECCA 4ZZLA 5HOOA 1G6NA 2A6HF 4NC8A 4XKBA 3J7YJ 3I4NJ 3BY6A 1X1PA 2E1MC 3CMYA 4PUSA 3GLLA 2CV2A 1MKMA 4Q47A 5FFXA 1BI0A 3QP6A 2XROA 3DKXA 2LF8A 4V2FA 2V7FA 2A69F 3CMMA 5L3GA 3JRAA 2V1DA 1ITYA 1I27A 5CKTA 3BQZA 3K2ZA 2IP2A 1YO5C 1B72A 4A3IJ 2LKPA 2OCEA 3WTVC 3GLXA 3AKZA 4M9XA 1Z21A 3I5UA 4P55A 5TGTA 4Q48A 3LAPA 1VQ4I 2H27A 2DO7A 2F5EA 1TBXA 4AIDA 3JAMK 2F5CA 4IHWA 3I4MJ 1HC8A 2XAHA 3FM5A 3R6SA 4DNCA 2UUZA 3L2CA 2K9NA 2G7UA 3RTRA 4X6AJ 5KK1A 1J2XA 2B7EA 3PNTA 5AONA 3E97A 5B3SH 2KIFA 2JRMA 1QHGA 2VUMJ 2W1OA 2CYYA 2L9VA 3PQJA 4BQOA 4S04A 1HF0A 3T8RA 4M9ZA 4NQWA 1VTNC 4RGXA 3MEXA 3SZGA 5EYRA 1QZZA 2JA7J 4CYCA 1W4MA 5FGMA 2X6XA 3J80K 2XV4S 4F52A 3BLYA 2XKPA 3CUOA 4PJ0C 4CCOA 3PIOF 1MIJA 1LDJA 1AWCA 2Z9OA 2VN2A 3ROUA 3GTGJ 2FRHA 4PZJA 4CO8A 1QZEA 5IPAA 1B8IA 3HRSA 2LVSA 1U5TB 2ZXJA 1EKEA 2R0QC 2ZMEB 4KFCA 2BHZA 1A6IA 4ZJZA 2V9VA 4OWRB 4DZPA 5FLMJ 4UVAA 1S5LC 3JREA 2VPLA 2MSYA 3H0DA 2EZLA 5IYDJ 3TOAA 1YE9A 1FBUA 3BJ6A 2PEXA 4XMYA 1YX5A 3S93A 2R7RA 3K4KA 1G2HA 2NYXA 2BY0A 2CQ7A 5HNHA 2DA3A 3HPHA 3LSKA 1J75A 1V54H 5E20A 2I8DA 2JN6A 2O0YA 4KIFA 4ETSA 3AG3H 1O3SA 2DT7B 2KQRA 3U1DA 3G6EI 2VBYA 4PDKA 3OS0A 4NUBA 1R5ID 3E5QA 4MNUA 4PSXA 1WQ2A 3U1KA 1WJAA 3S16J 3RI4A 5LRRA 1LB2A 1BL0A 2ESHA 1R6RA 2E2JJ 4E7JA 2VQGA 3ECHA 4MGRA 3V7CA 2PBIA 2WY7Q 3A0BC 1N78A 2X4HA 2XDVA 2JVGA 1ZTRA 1OYIA 1FMWA 1Q1VA 3BR3A 4GXOA 2CS3A 2PMUA 2TDXA 4RA2A 5FKNA 3DPTA 4ZYDA 1ZK8A 1P4WA 3FKJA 4XOTA 2KL4A 2BGCA 2BE5F 1DGRM 2ACJA 4CICA 4L5IA 1NK2P 4LD5A 2JPCA 3I64A 4HX7A 1RKWA 4OIOF 2JT1A 1FBQA 2HZTA 3DPLC 3QYFA 4UUSA 4GO1A 4BEHB 4LB5A 2DT6A 4UB6C 3W6KB 1OFCX 2DFHA 2DPDA 2RGVA 4XICA 1SVOA 1KQ0A 3ABUA 4LIVA 4WXHA 1KYWA 3LQQA 2PN6A 2IRFG 4E4HA 2X0LA 5KVRA 5F1RA 2DA2A 1MGTA 1ZRDA 5LHIA 3CUQB 5B5EC 4PJLA 2VXZA 2X1DA 4B09A 2JQ7A 3KZZA 2Z5UA 3CJNA 2NOGA 2DN0A 4XN0A 3BR0A 1TL8A 4A6DA 3TQNA 2V1UA 2WAFA 3M07A 5BMZA 1CQTA 3P9IA 2B9SA 3K1NA 3MVPA 5DUIA 5CJ9A 5E17F 3GEZA 2OD5A 1R36A 4MQ9F 4Q5SF 2RREA 3CCRI 1XB4A 4KISA 4HDVA 3N4MA 1VFCA 2MC4A 1SFXA 2E1OA 4DQ2A 3HB9A 3PNYA 3CCQI 1APLC 3PUBA 3OL3A 3BTLA 1R5HA 1JT0A 5D5UB 4KDPA 1G3SA 3GF2A 2IS6A 1SAUA 4LMYA 2O8XA 5GADJ 3JAMZ 3COAC 4BE2A 1FPQA 4J00A 2L2OA 2V1XA 3SEQA 1MBFA 3Q9SA 2R7WA 3F8NA 2VKDA 1XMAA 3LA7A 4L9JA 2VL8A 4LIUA 3ECOA 2VQCA 1MSEC 2X9DA 1VQPI 2G0EA 1DPUA 1ZARA 2Q0OA 1LE8A 4II2A 2F4IA 4HV6A 1ETYA 2EFQA 1DQUA 1W5SA 3S8PA 2FBKA 3J80Z 1VQ8I 5HODA 4KN7X 1VQ6I 2K9MA 3HZJA 5F04A 2HEOA 2X51A 4HV5A 4BBRJ 4B3XA 2KISA 2JWTA 1UAAA 3IHUA 2W84A 1S72I 2D45A 3V8JA 5F08A 3N05A 2ZO4A 1OKRA 4OU0A 3FK7A 5GTHC 3HOXJ 4Y33A 1D0YA 3JSOA 3OMYA 2E7WA 1Z6TA 3M8FA 3VOEA 3GX4X 2KKOA 1Y6IA 3RKXA 2P4WA 5IT3A 3KLNA 4I2OA 2Y0SN 4QLCU 1ON2A 3WTZA 2WB1N 4BS9A 3GFIA 3CCSI 5JVGF 2XB5A 4U7DA 1IV8A 1OPCA 1ETOA 4M3DA 4Y3OA 3W2VA 3M7GA 3QODA 4X0GA 1VQ7I 2ID3A 2XF7A 2DYSH 3CC7I 1F9NA 2EA4A 3GBGA 3GCMA 2FBHA 4WXDA 1YJWI 2L9SA 3S3NA 1IRGA 2FQ3A 3I9V2 3LSHA 3L00A 4OIPF 2M9HA 3P5JA 3RIRA 2VI6A 3FXOA 1TWCJ 1BA5A 4HNUA 2CU7A 2QVOA 3HOVJ 1IZ1A 1LUJB 3LMMA 2E7XA 1NG6A 2GOXB 3OIOA 2VB6A 1OMIA 2ZXHA 3PL8A 1W5TA 3TBIA 2MD0A 4JBAA 1W1WE 5DD8A 4PJJA 2DFFA 4A0XA 2V79A 4QTRA 3T8TA 2RNJA 1DU0A 3RPUA 1IDYA 1IN7A 1IGNA 4XOPA 3IWFA 1ZH5A 3HUGB 3CLQA 1V5FA 1HSTA 3H3ZA 2M2EA 1BJAA 3QOPA 5CVUA 2OTLI 5DS9A 3E1SA 3HOZJ 4F7ZA 2RN7A 4IQ4A 3M4OJ 2M4KA 2LH9A 3F6OA 3MZYA 2O6GE 1FOYA 1LVKA 2CWEA 4IL6C 1SFUA 5J3LA 4PFOA 2EPFA 3BG3A 4XKWA 3HL2A 2P7CB 3FWEA 3NAUA 1LFPA 2IAIA 2K4BA 2PMHA 2GXAA 1MMSA 1ZHFA 1E17A 4JK1X 4U0VA 1XD7A 3ZQFA 4DBRA 5JHUA 2DTRA 1TWGJ 3HIFA 3RKYA 3I71A 2VOPA 2EIKH 3DBRB 2VODA 4RLFA 4S0HB 3OYEA 3WGIA 4RMNA 2MFZA 3HOSA 2HDDA 2NRAC 3VPRA 3RZDJ 5FRMA 3M9AA 2Z99A 1DU6A 3CCJI 5H2FC 5LGUA 2XKOA 3CCEI 1XSVA 4MEXF 4IKFA 3ZN1A 4BJTA 2M34A 3MQ0A 1ORKA 2MLGA 1ZGWA 4EM0B 2X6OA 1WSUA 4HAMA 4UV8A 2R7DA 1R4NB 4I76A 4M72A 4BQQA 3S2WA 2VBWA 1JT6A 3QPTA 4L5JA 4XLPF 2BY1A 2XASA 3BJOA 3AL0C 2A68F 1HQCA 4BL0B 4Q4ZF 4LK1F 1JKQC 4BDZA 1XMKA 4M6YA 4EM1A 2OZ6A 3G1LA 3JSPA 1H88C 4FE7A 3KYCB 1PDNC 3FKIJ 2E5NA 1SFKA 1AOYA 3ZQQA 2FNPA 3PQKA 1O3RA 2QA4I 2V6CA 1UG2A 2CUEA 1I1GA 1YJNI 1B59A 1S6LA 2CW7A 2YSRA 6PAXA 2DFEA 4CCLA 1HOMA 3OYGA 3EUHC 1W36C 1BIAA 2KT0A 1Z7LA 2M4GA 1DGWY 1ETKA 3TO9A 2NVQJ 1G3WA 4XONA 3QQAA 1Z91A 2R4GA 5E3LA 5CVIA 5J1RA 2Y0MA 1UJ8A 2AS5F 1E3PA 5EJCA 1YIOA 3QAHA 4BBSJ 4NC7A 2M3AA 1Z05A 2KIUA 3V8KA 1SEUA 2XGCA 2HYGD 2L7KA 5BS6A 2HOAA 1RUOA 5AIQA 3HOTA 3DU6A 4JX5A 2HTJA 3ZMUA 3OYNA 4EJTA 1A6QA 3QRFF 5DTDA 3EDPA 2OUMA 2GWRA 1ENHA 4XRSG 5EEHA 1S7OA 1DUXC 5TJJA 2Q2EA 5KAIC 1F43A 1HW1A 2OV7A 1T6SA 4BAYA 1IXCA 1ZG3A 4EVIA 5K5RA 1SVMA 2ZB9A 2R7TA 3LSMA 4N0BA 3U9GA 1YS7A 5GAHJ 4BNCA 2QZ8A 1JI8A 3LWFA 3ASOH 4BY7J 3ZQIA 4PSWA 3WE2A 4G8XA 3TEDA 2EINH 3MZHA 2NS7A 3IWZA 5E3NA 2AO9A 4O6JA 4A3FJ 5LHHA 4GDFA 2R7XA 2OTJI 4RAGA 3HHGA 3ZR8X 2YR2A 4M3GA 3RSNA 3UKGA 5JHFA 5EF6A 1YJ9I 4OMYA 5FKOA 5H20A 1N75A 2EB7A 1OCTC 3DCFA 4BU2A 3KETA 2EA2A 3ERED 2K3PA 1TW2A 4CUGA 1OCZH 3H36A 1FT9A 3DV8A 4EV0A 3P9KA 1UFMA 2WAQN 3D5RC 4PGGA 5F0CA 4MTDA 2W4SA 2HQ5A 4BH9A 2FJ1A 4QIWN 2LBFA 5F0HA 2XGDA 3I53A 1MZBA 1MJ9A 4HYEA 2ZXWH 2LY1A 4M6VA 1POGA 3IAS2 3D5LA 2FOKA 3K4LA 3B73A 4PK4A 2E35A 5FRNA 1WKMA 4FASD 3FIWA 3MAJA 3KP4A 3J7AY 3GMEA 4KN4X 5E18F 3K4BA 1Z67A 4TV7A 1O4XA 3H5RA 3QOEA 2BVLA 4FQGA 1F5TA 5FFZA 1GUUA 3ABLH 3MWMA 4E7HA 2HYFA 3SQNA 4LLNA 2L02A 4ZTFA 1RC9A 3BG7A 4BQNA 5ICCA 5DUKA 4R1HA 5JLWA 4RGSA 1OR7C 2XSDC 5CPRB 3EETA 3VSKA 3I55I 2NOJB 4XRFA 2BOLA 5CQEA 3MKYB 1K79A 3ZN0A 3IH2A 1IN4A 3K70D 3EUHA 2DA5A 1MDMB 2OQRA 1ETWA 5HLTA 1ZGAA 4G7ZF 1FLIA 3B6AA 2P5KA 4C2MJ 5K7ZA 1I6HJ 2AHQA 4G9YA 4HSRA 4B4CA 1RESA 2LY9A 3CD6I 4LG0B 1MW7A 2XPVA 1YLFA 3I54A 3K0LA 3OYCA 1I3AA 2Y0SA 5FD5A 4GFBA 5GP9A 2EIMH 4U87A 2H09A 1SVLA 1QQIA 2Y31A 3S3MA 1CGPA 4P1WA 2R5YB 2R7FA 4BJ6C 1KU2A 4KUMA 1K83J 4ESJA 3KCCA 2CRGA 3V42A 3HHHA 1V3FA 1F1ZA 2FXAA 1IN8A 2IXSA 2WWYA 4CA0A 3CZ6A 4XLNF 3KX2A 3JRIA 1GV5A 2HOSA 3GTKJ 1SD7A 2IGNA 4U7BA 1JKPC 2ZJPF 5D4SA 4LLLA 1IJWC 2OZUA 3H92A 4IF4A 4RB1A 4DGWB 1BOAA 2FBIA 1X19A 2VJIA 4B48A 1KQ8A 2PJRB 3OS1A 4HX4A 1X58A 2O5RA 5LFAA 3NEUA 2EWNA 2MH2A 3WTXC 3M1EA 1T38A 1IV6A 2M45A 2ESNA 5B1AH 5F6FA 3AG1H
chains in the Genus database with same CATH topology
3K9TA 4UNOA 4U0YA 3R61A 1JE8A 3GUDA 4S05A 1H9GA 5DCMA 1ZG5A 5D5VB 5J6XA 5LHGA 3HSEA 5J8CA 1MD0A 1W7PB 2KJBA 3NRVA 4ESBA 2FE3A 1A04A 1HKQA 1XGOA 2DFIA 4BHPA 1TQPA 4P9UA 3KP2A 2EK5A 3GFLA 2IA2A 1KU7A 1BBYA 2WV0A 5D4RA 4CGZA 1XGSA 2HOEA 2QQ9A 2DW4A 3CUQC 4WX9A 4L0YB 4BQAA 3J81K 2A5YB 1HW5A 1OR7A 4HF1A 3KZYA 4LFUA 1D5VA 2UXNA 2HGCA 1BI2A 3FMRA 4YG2F 4Z2YA 3SXYA 1D3YA 3R60A 1S3JA 5JFRA 4GGGA 2L4MA 1R1TA 3LSTA 1C0WA 2BYVE 4R79A 2HKOA 2BV6A 3F8CA 5CLSA 4XBFA 1NHAA 2A61A 3F72A 1QNTA 4IRGA 5JR3A 4ENMA 1K78A 5ERIA 5J8FA 4AIJA 3GYHX 4G6QA 1I6XA 1KGSA 2ISZA 1OYWA 5ILVA 2CG4A 4FHTA 2VE8A 3ZMSA 2GAUA 5TRDA 2VOOA 2K86A 2F5DA 4CDGA 1T2KA 3G3ZA 3P7NA 3T5XA 4K2EA 2WTEA 3FXRA 3C18A 5BPIA 5BOXA 2DQRA 3WTYC 3LA3A 4IVNA 3E6BA 2HFHA 1JXSA 2ZJ2A 3ULQB 4HQEA 3HRMA 4N9HA 4I01A 1FC3A 1RUNA 4CXFA 2PFBA 2A3SA 3SZTA 4BHCA 2NS0A 3FXUA 4ZYEA 5K5QA 3OV8A 2E1CA 3F6VA 3FX3A 3OOPA 5ILUA 1R5GA 1Z9CA 1EH8A 4G7OF 4GYIA 5HVQC 4RS8A 5DD4A 4FT8A 2EFOA 4E70A 4EJUA 2M30A 2XUBA 3FZVA 2RC4A 1RIOH 1PUEE 2QYOA 4CHUA 4A12A 4GYGA 2M8EA 1MJAA 2VBXA 3BPVA 4EJOA 4L18B 4OMZA 1SD4A 5D5XB 3J81Z 5ICGA 5D6FA 4RAYA 4BYYA 4ZYGA 3GVAA 5F64A 3RPQA 1DPRA 1BC7C 2HKXA 3IKTA 1YW8A 2VC0A 4AIKA 2PG4A 1QZYA 2JRTA 2CFXA 2BBYA 4NHJA 2QUFA 3BROA 2CW0F 4HOBA 4KIBA 3Q9VA 2YPRA 2M5WA 1LNWA 2DAOA 1FYMA 4OIQF 1P4XA 3VEPA 4L9NA 2EV0A 3ZMDA 5DV5A 3VFZA 4LJZF 3MFKA 2CSOA 1PP7U 2D1HA 2P6TA 3K1MA 3V8LA 1RNLA 2GZWA 4MHGA 4OOIA 1YW7A 2JPBA 1O3QA 1LDDA 4OINF 3ZMTA 3EYYA 3HYIA 2RDPA 1RZ4A 2B0LA 3O2PE 3CTAA 3L09A 1FBSA 2ZBKA 4NB5A 1ULYA 1UCRA 1ZYRF 3E6DA 2HQNA 5FB2A 5LBQA 1FSEA 3GXOA 4M74A 1J7KA 3C1DA 1G3YA 3L7WA 2COMA 4EJVA 3ELKA 1JGSA 3HTSB 4CYDA 1Q1HA 1SD5A 1XCBA 2QBYB 1LEBA 1T98A 1G3TA 4MTEA 2XAJA 2K4JA 2LNBA 1H0MA 2IT0A 2IJLA 3R0AA 4YFNF 1QO0D 5L3EA 1U3EM 1HSJA 2DT5A 4O3MA 1IXRC 1V4RA 3KE2A 4XSZF 5E1WA 2QM3A 5LRSA 1R00A 2VONA 2IVMA 4UHTA 2VT3A 1YS6A 2H6CA 2L4AA 1GXPA 1GVJA 1YFHA 1HKSA 1S29A 4BHBA 1IAWA 1OYYA 4WF2A 3DXJF 4A5NA 1TQIA 5IT9K 1LDKB 4Y15A 3SHFA 1CF7A 5HDNA 3KFWX 3TKYA 1E2XA 3IL2A 1IUYA 4HF2A 2K7LA 1ZLJA 2Z3YA 5HDKA 1Z7UA 3GZ6A 1P4AA 2OQGA 3Q5FA 3JTHA 5DEQA 2PQ8A 3V4GA 3LAJA 3IKVA 4PGHA 5DYMA 1BC8C 3LQRA 1U2WA 4UXNA 5BQTA 2L3DA 1RI7A 1UHWA 2CQKA 1YG2A 3I59B 2GQQA 2K02A 1SD6A 1KQ9A 4L9VA 3FHZA 2OU2A 1B1BA 3EYIA 1FP1D 5HDGA 1UB9A 3J7AO 4UV9A 1JHFA 1FWZA 1GHCA 3ABTA 2A07F 5A2QK 4IHSA 1T39A 2EV6A 1X3UA 4P96A 5D8LB 3ZPLA 4EGZA 1WI9A 2ISYA 4O5VA 1JHHA 3RYPA 4WXCA 1EH6A 4IRIA 5FLXK 1ZRFA 3GWZA 3TDUC 2ELHA 3RYRA 4YFKF 2UXXA 2IA1A 3WG9A 2YU3A 4U88A 3FMSA 2F5FA 1TW3A 1HBXG 3DEUA 3GFJA 2ZKZA 1USSA 1J9IA 1L3LA 2FEZA 2IA0A 1U5TC 3DP7A 2ZNZA 1ZGJA 2MA3A 1P6RA 2PI0A 3HRTA 1IF1A 3E6MA 3C3WA 2XVCA 3D0SA 1J0RA 4CZZA 1H9TA 1Z1DA 1XN7A 1FY7A 3W6JB 2ZFWA 1XGNA 5CVVA 3WGGA 5LLQA 5BPDA 1ONVA 5LEKA 1J5YA 1D8JA 1WRJA 3CO7C 4HBLA 4EMSA 4A2UA 1IW7F 5IT9Z 3GFMA 2J5OA 4G94A 1PP8F 2HDCA 2M1BA 1W7PA 3WTTC 3F8BA 2EJRA 2OBPA 3WTUC 3AAFA 2H6BA 3TO6A 4KT5C 4M73A 3F8FA 2EFPA 4XSXF 4ENKA 5DCMB 3FMQA 1QBJA 4UVBA 5D8KB 4MEYF 1ZREA 3KEOA 2STTA 1R22A 3WODF 2IPQX 4I02A 3KP7A 3DF8A 3E5UA 5LGNA 5CYVA 2M87A 2RKHA 2P6SA 5HS8A 3ZMZA 1IN6A 1XDSA 1U5TA 2E1NA 1Y0UA 5A2QZ 1O3TA 3HRUA 2ZMEA 4KA4A 4ZZDA 1SAXA 2CO5A 3VB2A 1ON1A 3BP8A 2AXLA 2XHKA 4G6DA 4I09A 3FXQA 4N9IA 3IC7A 5FLXZ 2UWMA 3CLOA 2R3SA 3IRRA 2MLKA 4G7HF 1WSUA 4LK0F 2H27A 2HS5A 3BPXA 3E6CC 3SFZA 3G73A 2EFNA 3TGNA 4R8HA 2QWWA 4RGRA 2WC2A 2A6EF 4RB3C 1ZG1A 2IW5A 2J5PA 1ZN2A 2ZNYA 3F21A 5ICEA 3KP5A 2QENA 3SZPA 4P9FA 1K78B 3R4KA 5L3BA 4AD9A 4AVPA 4HW0A 4KNYA 4WCGA 2DK5A 2Q8KA 3E3VA 3MCZA 4KYWA 3QPHA 3ZP5A 4YFXF 2NNYA 4IPAA 3CUQA 1U8RA 3WU0A 1U78A 1K6OA 2W24A 3F8MA 5DDGA 2DI3A 4P5OA 2ZCWA 4HA8A 3O3KA 4FX0A 1FZPB 2ADUA 1O57A 3IRQA 1KYZA 2VBZA 3LA2A 4EGYA 3BDDA 1FX7A 3VODA 1XSDA 4UUVA 1J59A 3I4PA 1IN5A 2D1VA 4EQQA 1TNTA 3RDIA 4L9TA 1XSXA 1SFEA 4L0ZB 2DLLA 4ASNA 1O7FA 4U0WA 2STWA 1R23A 5HS7A 1FP2A 1FNNA 1MJBA 2GA2A 4AIHA 2DU9A 2C6YA 2H94A 2HTSA 2HR3A 2FF4A 2FMYA 2KJCA 4YIIA 4A0YA 1FYKA 1R1UA 3F23A 4Y13A 2Z33A 4FX4A 3H3UA 4JQFA 5ICFA 5LEJA 2MH9A 2VT2A 4B8XA 3GW2A 2O61A 2RQPA 4ZYHA 3HTUA 2YX7A 1S7AA 2PLYA 2DBBA 3N97A 2KRFA 3P9CA 3TO7A 2FA5A 2MBFA 2LSOA 4IXAA 4WK8F 3GFIA 2HWVA 1B6AA 4BXUA 3KEQA 2XRNA 2XAQA 4EM2A 3KLOA 4KICA 3CO6C 2MD5A 3HSFA 2YX4A 4EJWA 2QQAA 2W85A 1R7JA 4IRHA 2JTVA 1FOKA 1DDNA 5L3CA 1IRFA 1HXDA 5HLGA 2FNAA 1USTA 5JI6A 5FO5A 4KMUX 4RGUA 4H0EA 2RVCA 3PFIA 5FD6A 2EV5A 3T0YA 3WE3A 2DQLA 4OIRF 5E8GA 2P7VB 3R0JA 4HDUA 3BJAA 2HQRA 5LGTA 1HKTA 2K27A 2XAGA 3K69A 3KP6A 1KA8A 4RB2C 3HUGA 3V7RA 4D0PA 3QP5A 3F3XA 3L9FA 2XAFA 1XGMA 4YIFA 1BN5A 5K1YA 1U6GA 2QLZA 2P5LC 4AWXB 2BEOA 4IJAA 1KU9A 4KMFA 1SMTA 3C7JA 4ENJA 4I7HA 5CVJA 5ILSA 5L3FA 2NNNA 2QBYA 3DFGA 3RJPA 1TTYA 1FYLA 4A5MA 5HS9A 2G9WA 5H6QA 3ZQ7A 3QU6A 2UZKA 4ENNA 5K5OA 4WWCA 2G7HA 1D8KA 5E8IA 1EV7A 3CDHA 3WU1B 2OAZA 1TQMA 1BIBA 5AIPA 5E1ZB 1L0OC 4MQVA 3EQLF 5ED4A 3I58A 4M71A 1SMYF 1I5ZA 4HLXA 3JTGA 3V7SA 2VC1A 2EFWA 1BM9A 4M9SA 1K7AA 3F22A 2O03A 2OA4A 1R1VA 1TLHB 3M8EA 3REOA 1ODDA 2NAZA 4I98B 2DPUA 2XIGA 2Y75A 2GXBA 3RKWA 2FMLA 3LFKA 1LVAA 4QWQA 5JVTA 2PJPA 3I0TA 1P92A 3DKWA 1S8NA 4UVCA 5L3DA 1EH7A 3ZMVA 1BI3A 2LDUA 1ZAOA 4ZH4F 2KIMA 1CF7B 1IXSB 2L54A 3KP3A 2JSCA 1ZRCA 1FSHA 3I59A 4RAZA 1LQ1A 5H6RA 3WGHA 4RB0A 1B4AA 3ISPA 2GA1A 4ON0A 3K1PA 4ESFA 2RV8A 4A0ZA 4HQMA 5D5WB 2P8TA 5E1XA 3B02A 2Y48A 4KIGA 3ML6A 3NQOA 5D6EA 1UHMA 2CGPA 1LEAA 3FM3A 3WTWC 2XGXA 4I0AA 2ETHA 2GXGA 3BOQA 4M6XA 1F4KA 3FF5A 3JW4A 1MDMA 1ZLKA 1HW2A 4LG0A 3TDZC 2MC3A 3GZ5A 4IHTA 2DK8A 4LLGF 3TOBA 1QGPA 4HX8A 5HLHA 2P5VA 2L01A 3E5XA 1G4DA 1TNSA 2O3FA 5EEGA 1YYVA 5CVRA 3O6BB 1I1SA 3WTSC 2VE9A 1LJ9A 4HZFA 2W57A 1DP7P 2FU4A 3U2RA 4HF0A 4GCVA 1R58A 4PCQA 3T1BA 3DQVC 1WWXA 3QU3A 1QPMA 1XCVA 1REPC 2F2EA 1YW9A 1Z6RA 3BWGA 1P2FA 4LGWA 4A6EA 1YTYA 2FSWA 1GXQA 1B9MA 3HSRA 1O7LA 2LF7A 2QQBA 1STZA 2JZYA 1B9NA 5DCFA 4HLYA 2D2WA 3BZ6A 4LB6B 1XDUA 2W25A 1BI1A 4Y17A 1T0FA 5HLIA 1YQAA 1KU3A 2GIVA 3GO5A 1W7PD 4I0BA 4ZZLA 5HOOA 1G6NA 2A6HF 3BY6A 1MKMA 4Q47A 5FFXA 1BI0A 3QP6A 2XROA 2LF8A 5L3GA 2A69F 2V1DA 1I27A 3K2ZA 2IP2A 1YO5C 2LKPA 3WTVC 3GLXA 4M9XA 3I5UA 4P55A 3LAPA 4Q48A 2DO7A 2F5EA 1TBXA 3JAMK 2F5CA 2XAHA 3FM5A 3R6SA 4DNCA 3L2CA 2G7UA 3RTRA 5KK1A 1J2XA 5AONA 3E97A 2KIFA 2CYYA 3PQJA 4S04A 3T8RA 4M9ZA 4NQWA 1VTNC 4RGXA 3MEXA 1QZZA 1W4MA 5FGMA 3J80K 2XV4S 2XKPA 3CUOA 1LDJA 1AWCA 2Z9OA 2VN2A 3ROUA 2FRHA 4PZJA 4CO8A 3HRSA 1U5TB 2ZXJA 4KFCA 2ZMEB 2V9VA 4UVAA 3TOAA 1FBUA 3BJ6A 2PEXA 2NYXA 1J75A 5E20A 2O0YA 4KIFA 4ETSA 1O3SA 3U1DA 2VBYA 4PDKA 3E5QA 4MNUA 1WQ2A 3RI4A 5LRRA 1LB2A 2ESHA 3ECHA 4MGRA 3V7CA 2PBIA 2X4HA 1OYIA 4GXOA 2PMUA 2TDXA 4ZYDA 3DPTA 1P4WA 2BGCA 2BE5F 2ACJA 4CICA 4L5IA 4LD5A 2JPCA 3I64A 4HX7A 4OIOF 2JT1A 1FBQA 2HZTA 3DPLC 4GO1A 4LB5A 3W6KB 2DPDA 2RGVA 1KQ0A 3ABUA 4WXHA 1KYWA 3LQQA 2PN6A 2IRFG 2X0LA 5KVRA 5F1RA 1MGTA 1ZRDA 5LHIA 3CUQB 2VXZA 4B09A 3KZZA 2Z5UA 3CJNA 4A6DA 3TQNA 2V1UA 5BMZA 3P9IA 3K1NA 5DUIA 5CJ9A 5E17F 3GEZA 2OD5A 1R36A 4MQ9F 4Q5SF 1XB4A 4HDVA 3N4MA 1SFXA 4DQ2A 1R5HA 5D5UB 4KDPA 1G3SA 3GF2A 4LMYA 2O8XA 3JAMZ 3COAC 1FPQA 2V1XA 3Q9SA 3F8NA 1XMAA 3LA7A 4L9JA 3ECOA 1DPUA 1ZARA 2Q0OA 4HV6A 2EFQA 1W5SA 3J80Z 2FBKA 4KN7X 2HEOA 4HV5A 3IHUA 2W84A 2D45A 3V8JA 2ZO4A 1OKRA 4OU0A 3JSOA 2E7WA 1Z6TA 3M8FA 3VOEA 3GX4X 2KKOA 3RKXA 2P4WA 5IT3A 3KLNA 4I2OA 4QLCU 1ON2A 3WTZA 4U7DA 1OPCA 3M7GA 1F9NA 2EA4A 2FBHA 4WXDA 1IRGA 2FQ3A 3L00A 4OIPF 3RIRA 2QVOA 1IZ1A 2E7XA 1OMIA 1W5TA 4JBAA 5DD8A 4A0XA 2V79A 3T8TA 2RNJA 3RPUA 1IN7A 3IWFA 1ZH5A 1HSTA 3H3ZA 1BJAA 3QOPA 5CVUA 4F7ZA 2RN7A 3F6OA 3MZYA 2O6GE 2CWEA 1SFUA 2P7CB 3FWEA 2K4BA 2PMHA 1ZHFA 1E17A 4JK1X 4U0VA 1XD7A 5JHUA 2DTRA 3HIFA 3RKYA 3I71A 2VOPA 2VODA 3WGIA 3HOSA 2NRAC 3M9AA 2Z99A 5LGUA 2XKOA 4MEXF 1XSVA 3ZN1A 3MQ0A 2MLGA 4EM0B 4HAMA 4UV8A 2R7DA 4M72A 3S2WA 2VBWA 3QPTA 4L5JA 4XLPF 2XASA 3BJOA 2A68F 1HQCA 4Q4ZF 4LK1F 1XMKA 4M6YA 4EM1A 2OZ6A 3JSPA 1PDNC 1AOYA 2FNPA 3PQKA 1O3RA 2V6CA 1I1GA 1B59A 1S6LA 2YSRA 6PAXA 1BIAA 3TO9A 1G3WA 1Z91A 5CVIA 2Y0MA 2AS5F 1YIOA 3QAHA 1Z05A 2KIUA 3V8KA 1RUOA 2HYGD 5BS6A 5AIQA 3HOTA 2HTJA 3ZMUA 4EJTA 3QRFF 3EDPA 2GWRA 5EEHA 1S7OA 1DUXC 5TJJA 2Q2EA 1HW1A 4BAYA 1T6SA 1IXCA 1ZG3A 4EVIA 5K5RA 4N0BA 3U9GA 1YS7A 4BNCA 2QZ8A 3LWFA 3WE2A 4G8XA 3MZHA 3IWZA 4O6JA 5LHHA 3HHGA 2YR2A 4OMYA 5H20A 2EB7A 3KETA 2EA2A 3ERED 1TW2A 1FT9A 3DV8A 4EV0A 3P9KA 1UFMA 4PGGA 4MTDA 4BH9A 3I53A 1MZBA 1MJ9A 4HYEA 3D5LA 2FOKA 3B73A 1WKMA 3MAJA 3KP4A 4KN4X 5E18F 4TV7A 1F5TA 5FFZA 3MWMA 2HYFA 3SQNA 4LLNA 2L02A 5ICCA 5DUKA 4R1HA 4RGSA 3EETA 4XRFA 1K79A 3ZN0A 1IN4A 3EUHA 1MDMB 2OQRA 1ZGAA 4G7ZF 1FLIA 2P5KA 4G9YA 4LG0B 1YLFA 3I54A 3K0LA 5FD5A 2H09A 1QQIA 1CGPA 2R7FA 1KU2A 4KUMA 4ESJA 3KCCA 3HHHA 1V3FA 1F1ZA 2FXAA 1IN8A 2WWYA 4XLNF 1SD7A 4U7BA 5D4SA 4LLLA 2OZUA 3H92A 4IF4A 4RB1A 1BOAA 2FBIA 1KQ8A 4HX4A 3NEUA 2EWNA 2MH2A 3WTXC 3M1EA 1T38A 2M45A 2ESNA 5F6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9T A;  4UNO A;  4U0Y A;  3R61 A;  1JE8 A;  3GUD A;  4S05 A;  1H9G A;  5DCM A;  1ZG5 A;  5D5V B;  5J6X A;  5LHG A;  3HSE A;  5J8C A;  1MD0 A;  1W7P B;  2KJB A;  3NRV A;  4ESB A;  2FE3 A;  1A04 A;  1HKQ A;  1XGO A;  2DFI A;  4BHP A;  1TQP A;  4P9U A;  3KP2 A;  2EK5 A;  3GFL A;  2IA2 A;  1KU7 A;  1BBY A;  2WV0 A;  5D4R A;  4CGZ A;  1XGS A;  2HOE A;  2QQ9 A;  2DW4 A;  3CUQ C;  4WX9 A;  4L0Y B;  4BQA A;  3J81 K;  2A5Y B;  1HW5 A;  1OR7 A;  4HF1 A;  3KZY A;  4LFU A;  1D5V A;  2UXN A;  2HGC A;  1BI2 A;  3FMR A;  4YG2 F;  4Z2Y A;  3SXY A;  1D3Y A;  3R60 A;  1S3J A;  5JFR A;  4GGG A;  2L4M A;  1R1T A;  3LST A;  1C0W A;  2BYV E;  4R79 A;  2HKO A;  2BV6 A;  3F8C A;  5CLS A;  4XBF A;  1NHA A;  2A61 A;  3F72 A;  1QNT A;  4IRG A;  5JR3 A;  4ENM A;  1K78 A;  5ERI A;  5J8F A;  4AIJ A;  3GYH X;  4G6Q A;  1I6X A;  1KGS A;  2ISZ A;  1OYW A;  5ILV A;  2CG4 A;  4FHT A;  2VE8 A;  3ZMS A;  2GAU A;  5TRD A;  2VOO A;  2K86 A;  2F5D A;  4CDG A;  1T2K A;  3G3Z A;  3P7N A;  3T5X A;  4K2E A;  2WTE A;  3FXR A;  3C18 A;  5BPI A;  5BOX A;  2DQR A;  3WTY C;  3LA3 A;  4IVN A;  3E6B A;  2HFH A;  1JXS A;  2ZJ2 A;  3ULQ B;  4HQE A;  3HRM A;  4N9H A;  4I01 A;  1FC3 A;  1RUN A;  4CXF A;  2PFB A;  2A3S A;  3SZT A;  4BHC A;  2NS0 A;  3FXU A;  4ZYE A;  5K5Q A;  3OV8 A;  2E1C A;  3F6V A;  3FX3 A;  3OOP A;  5ILU A;  1R5G A;  1Z9C A;  1EH8 A;  4G7O F;  4GYI A;  5HVQ C;  4RS8 A;  5DD4 A;  4FT8 A;  2EFO A;  4E70 A;  4EJU A;  2M30 A;  2XUB A;  3FZV A;  2RC4 A;  1RIO H;  1PUE E;  2QYO A;  4CHU A;  4A12 A;  4GYG A;  2M8E A;  1MJA A;  2VBX A;  3BPV A;  4EJO A;  4L18 B;  4OMZ A;  1SD4 A;  5D5X B;  3J81 Z;  5ICG A;  5D6F A;  4RAY A;  4BYY A;  4ZYG A;  3GVA A;  5F64 A;  3RPQ A;  1DPR A;  1BC7 C;  2HKX A;  3IKT A;  1YW8 A;  2VC0 A;  4AIK A;  2PG4 A;  1QZY A;  2JRT A;  2CFX A;  2BBY A;  4NHJ A;  2QUF A;  3BRO A;  2CW0 F;  4HOB A;  4KIB A;  3Q9V A;  2YPR A;  2M5W A;  1LNW A;  2DAO A;  1FYM A;  4OIQ F;  1P4X A;  3VEP A;  4L9N A;  2EV0 A;  3ZMD A;  5DV5 A;  3VFZ A;  4LJZ F;  3MFK A;  2CSO A;  1PP7 U;  2D1H A;  2P6T A;  3K1M A;  3V8L A;  1RNL A;  2GZW A;  4MHG A;  4OOI A;  1YW7 A;  2JPB A;  1O3Q A;  1LDD A;  4OIN F;  3ZMT A;  3EYY A;  3HYI A;  2RDP A;  1RZ4 A;  2B0L A;  3O2P E;  3CTA A;  3L09 A;  1FBS A;  2ZBK A;  4NB5 A;  1ULY A;  1UCR A;  1ZYR F;  3E6D A;  2HQN A;  5FB2 A;  5LBQ A;  1FSE A;  3GXO A;  4M74 A;  1J7K A;  3C1D A;  1G3Y A;  3L7W A;  2COM A;  4EJV A;  3ELK A;  1JGS A;  3HTS B;  4CYD A;  1Q1H A;  1SD5 A;  1XCB A;  2QBY B;  1LEB A;  1T98 A;  1G3T A;  4MTE A;  2XAJ A;  2K4J A;  2LNB A;  1H0M A;  2IT0 A;  2IJL A;  3R0A A;  4YFN F;  1QO0 D;  5L3E A;  1U3E M;  1HSJ A;  2DT5 A;  4O3M A;  1IXR C;  1V4R A;  3KE2 A;  4XSZ F;  5E1W A;  2QM3 A;  5LRS A;  1R00 A;  2VON A;  2IVM A;  4UHT A;  2VT3 A;  1YS6 A;  2H6C A;  2L4A A;  1GXP A;  1GVJ A;  1YFH A;  1HKS A;  1S29 A;  4BHB A;  1IAW A;  1OYY A;  4WF2 A;  3DXJ F;  4A5N A;  1TQI A;  5IT9 K;  1LDK B;  4Y15 A;  3SHF A;  1CF7 A;  5HDN A;  3KFW X;  3TKY A;  1E2X A;  3IL2 A;  1IUY A;  4HF2 A;  2K7L A;  1ZLJ A;  2Z3Y A;  5HDK A;  1Z7U A;  3GZ6 A;  1P4A A;  2OQG A;  3Q5F A;  3JTH A;  5DEQ A;  2PQ8 A;  3V4G A;  3LAJ A;  3IKV A;  4PGH A;  5DYM A;  1BC8 C;  3LQR A;  1U2W A;  4UXN A;  5BQT A;  2L3D A;  1RI7 A;  1UHW A;  2CQK A;  1YG2 A;  3I59 B;  2GQQ A;  2K02 A;  1SD6 A;  1KQ9 A;  4L9V A;  3FHZ A;  2OU2 A;  1B1B A;  3EYI A;  1FP1 D;  5HDG A;  1UB9 A;  3J7A O;  4UV9 A;  1JHF A;  1FWZ A;  1GHC A;  3ABT A;  2A07 F;  5A2Q K;  4IHS A;  1T39 A;  2EV6 A;  1X3U A;  4P96 A;  5D8L B;  3ZPL A;  4EGZ A;  1WI9 A;  2ISY A;  4O5V A;  1JHH A;  3RYP A;  4WXC A;  1EH6 A;  4IRI A;  5FLX K;  1ZRF A;  3GWZ A;  3TDU C;  2ELH A;  3RYR A;  4YFK F;  2UXX A;  2IA1 A;  3WG9 A;  2YU3 A;  4U88 A;  3FMS A;  2F5F A;  1TW3 A;  1HBX G;  3DEU A;  3GFJ A;  2ZKZ A;  1USS A;  1J9I A;  1L3L A;  2FEZ A;  2IA0 A;  1U5T C;  3DP7 A;  2ZNZ A;  1ZGJ A;  2MA3 A;  1P6R A;  2PI0 A;  3HRT A;  1IF1 A;  3E6M A;  3C3W A;  2XVC A;  3D0S A;  1J0R A;  4CZZ A;  1H9T A;  1Z1D A;  1XN7 A;  1FY7 A;  3W6J B;  2ZFW A;  1XGN A;  5CVV A;  3WGG A;  5LLQ A;  5BPD A;  1ONV A;  5LEK A;  1J5Y A;  1D8J A;  1WRJ A;  3CO7 C;  4HBL A;  4EMS A;  4A2U A;  1IW7 F;  5IT9 Z;  3GFM A;  2J5O A;  4G94 A;  1PP8 F;  2HDC A;  2M1B A;  1W7P A;  3WTT C;  3F8B A;  2EJR A;  2OBP A;  3WTU C;  3AAF A;  2H6B A;  3TO6 A;  4KT5 C;  4M73 A;  3F8F A;  2EFP A;  4XSX F;  4ENK A;  5DCM B;  3FMQ A;  1QBJ A;  4UVB A;  5D8K B;  4MEY F;  1ZRE A;  3KEO A;  2STT A;  1R22 A;  3WOD F;  2IPQ X;  4I02 A;  3KP7 A;  3DF8 A;  3E5U A;  5LGN A;  5CYV A;  2M87 A;  2RKH A;  2P6S A;  5HS8 A;  3ZMZ A;  1IN6 A;  1XDS A;  1U5T A;  2E1N A;  1Y0U A;  5A2Q Z;  1O3T A;  3HRU A;  2ZME A;  4KA4 A;  4ZZD A;  1SAX A;  2CO5 A;  3VB2 A;  1ON1 A;  3BP8 A;  2AXL A;  2XHK A;  4G6D A;  4I09 A;  3FXQ A;  4N9I A;  3IC7 A;  5FLX Z;  2UWM A;  3CLO A;  2R3S A;  3IRR A;  2MLK A;  4G7H F;  1WSU A;  4LK0 F;  2H27 A;  2HS5 A;  3BPX A;  3E6C C;  3SFZ A;  3G73 A;  2EFN A;  3TGN A;  4R8H A;  2QWW A;  4RGR A;  2WC2 A;  2A6E F;  4RB3 C;  1ZG1 A;  2IW5 A;  2J5P A;  1ZN2 A;  2ZNY A;  3F21 A;  5ICE A;  3KP5 A;  2QEN A;  3SZP A;  4P9F A;  1K78 B;  3R4K A;  5L3B A;  4AD9 A;  4AVP A;  4HW0 A;  4KNY A;  4WCG A;  2DK5 A;  2Q8K A;  3E3V A;  3MCZ A;  4KYW A;  3QPH A;  3ZP5 A;  4YFX F;  2NNY A;  4IPA A;  3CUQ A;  1U8R A;  3WU0 A;  1U78 A;  1K6O A;  2W24 A;  3F8M A;  5DDG A;  2DI3 A;  4P5O A;  2ZCW A;  4HA8 A;  3O3K A;  4FX0 A;  1FZP B;  2ADU A;  1O57 A;  3IRQ A;  1KYZ A;  2VBZ A;  3LA2 A;  4EGY A;  3BDD A;  1FX7 A;  3VOD A;  1XSD A;  4UUV A;  1J59 A;  3I4P A;  1IN5 A;  2D1V A;  4EQQ A;  1TNT A;  3RDI A;  4L9T A;  1XSX A;  1SFE A;  4L0Z B;  2DLL A;  4ASN A;  1O7F A;  4U0W A;  2STW A;  1R23 A;  5HS7 A;  1FP2 A;  1FNN A;  1MJB A;  2GA2 A;  4AIH A;  2DU9 A;  2C6Y A;  2H94 A;  2HTS A;  2HR3 A;  2FF4 A;  2FMY A;  2KJC A;  4YII A;  4A0Y A;  1FYK A;  1R1U A;  3F23 A;  4Y13 A;  2Z33 A;  4FX4 A;  3H3U A;  4JQF A;  5ICF A;  5LEJ A;  2MH9 A;  2VT2 A;  4B8X A;  3GW2 A;  2O61 A;  2RQP A;  4ZYH A;  3HTU A;  2YX7 A;  1S7A A;  2PLY A;  2DBB A;  3N97 A;  2KRF A;  3P9C A;  3TO7 A;  2FA5 A;  2MBF A;  2LSO A;  4IXA A;  4WK8 F;  3GFI A;  2HWV A;  1B6A A;  4BXU A;  3KEQ A;  2XRN A;  2XAQ A;  4EM2 A;  3KLO A;  4KIC A;  3CO6 C;  2MD5 A;  3HSF A;  2YX4 A;  4EJW A;  2QQA A;  2W85 A;  1R7J A;  4IRH A;  2JTV A;  1FOK A;  1DDN A;  5L3C A;  1IRF A;  1HXD A;  5HLG A;  2FNA A;  1UST A;  5JI6 A;  5FO5 A;  4KMU X;  4RGU A;  4H0E A;  2RVC A;  3PFI A;  5FD6 A;  2EV5 A;  3T0Y A;  3WE3 A;  2DQL A;  4OIR F;  5E8G A;  2P7V B;  3R0J A;  4HDU A;  3BJA A;  2HQR A;  5LGT A;  1HKT A;  2K27 A;  2XAG A;  3K69 A;  3KP6 A;  1KA8 A;  4RB2 C;  3HUG A;  3V7R A;  4D0P A;  3QP5 A;  3F3X A;  3L9F A;  2XAF A;  1XGM A;  4YIF A;  1BN5 A;  5K1Y A;  1U6G A;  2QLZ A;  2P5L C;  4AWX B;  2BEO A;  4IJA A;  1KU9 A;  4KMF A;  1SMT A;  3C7J A;  4ENJ A;  4I7H A;  5CVJ A;  5ILS A;  5L3F A;  2NNN A;  2QBY A;  3DFG A;  3RJP A;  1TTY A;  1FYL A;  4A5M A;  5HS9 A;  2G9W A;  5H6Q A;  3ZQ7 A;  3QU6 A;  2UZK A;  4ENN A;  5K5O A;  4WWC A;  2G7H A;  1D8K A;  5E8I A;  1EV7 A;  3CDH A;  3WU1 B;  2OAZ A;  1TQM A;  1BIB A;  5AIP A;  5E1Z B;  1L0O C;  4MQV A;  3EQL F;  5ED4 A;  3I58 A;  4M71 A;  1SMY F;  1I5Z A;  4HLX A;  3JTG A;  3V7S A;  2VC1 A;  2EFW A;  1BM9 A;  4M9S A;  1K7A A;  3F22 A;  2O03 A;  2OA4 A;  1R1V A;  1TLH B;  3M8E A;  3REO A;  1ODD A;  2NAZ A;  4I98 B;  2DPU A;  2XIG A;  2Y75 A;  2GXB A;  3RKW A;  2FML A;  3LFK A;  1LVA A;  4QWQ A;  5JVT A;  2PJP A;  3I0T A;  1P92 A;  3DKW A;  1S8N A;  4UVC A;  5L3D A;  1EH7 A;  3ZMV A;  1BI3 A;  2LDU A;  1ZAO A;  4ZH4 F;  2KIM A;  1CF7 B;  1IXS B;  2L54 A;  3KP3 A;  2JSC A;  1ZRC A;  1FSH A;  3I59 A;  4RAZ A;  1LQ1 A;  5H6R A;  3WGH A;  4RB0 A;  1B4A A;  3ISP A;  2GA1 A;  4ON0 A;  3K1P A;  4ESF A;  2RV8 A;  4A0Z A;  4HQM A;  5D5W B;  2P8T A;  5E1X A;  3B02 A;  2Y48 A;  4KIG A;  3ML6 A;  3NQO A;  5D6E A;  1UHM A;  2CGP A;  1LEA A;  3FM3 A;  3WTW C;  2XGX A;  4I0A A;  2ETH A;  2GXG A;  3BOQ A;  4M6X A;  1F4K A;  3FF5 A;  3JW4 A;  1MDM A;  1ZLK A;  1HW2 A;  4LG0 A;  3TDZ C;  2MC3 A;  3GZ5 A;  4IHT A;  2DK8 A;  4LLG F;  3TOB A;  1QGP A;  4HX8 A;  5HLH A;  2P5V A;  2L01 A;  3E5X A;  1G4D A;  1TNS A;  2O3F A;  5EEG A;  1YYV A;  5CVR A;  3O6B B;  1I1S A;  3WTS C;  2VE9 A;  1LJ9 A;  4HZF A;  2W57 A;  1DP7 P;  2FU4 A;  3U2R A;  4HF0 A;  4GCV A;  1R58 A;  4PCQ A;  3T1B A;  3DQV C;  1WWX A;  3QU3 A;  1QPM A;  1XCV A;  1REP C;  2F2E A;  1YW9 A;  1Z6R A;  3BWG A;  1P2F A;  4LGW A;  4A6E A;  1YTY A;  2FSW A;  1GXQ A;  1B9M A;  3HSR A;  1O7L A;  2LF7 A;  2QQB A;  1STZ A;  2JZY A;  1B9N A;  5DCF A;  4HLY A;  2D2W A;  3BZ6 A;  4LB6 B;  1XDU A;  2W25 A;  1BI1 A;  4Y17 A;  1T0F A;  5HLI A;  1YQA A;  1KU3 A;  2GIV A;  3GO5 A;  1W7P D;  4I0B A;  4ZZL A;  5HOO A;  1G6N A;  2A6H F;  3BY6 A;  1MKM A;  4Q47 A;  5FFX A;  1BI0 A;  3QP6 A;  2XRO A;  2LF8 A;  5L3G A;  2A69 F;  2V1D A;  1I27 A;  3K2Z A;  2IP2 A;  1YO5 C;  2LKP A;  3WTV C;  3GLX A;  4M9X A;  3I5U A;  4P55 A;  3LAP A;  4Q48 A;  2DO7 A;  2F5E A;  1TBX A;  3JAM K;  2F5C A;  2XAH A;  3FM5 A;  3R6S A;  4DNC A;  3L2C A;  2G7U A;  3RTR A;  5KK1 A;  1J2X A;  5AON A;  3E97 A;  2KIF A;  2CYY A;  3PQJ A;  4S04 A;  3T8R A;  4M9Z A;  4NQW A;  1VTN C;  4RGX A;  3MEX A;  1QZZ A;  1W4M A;  5FGM A;  3J80 K;  2XV4 S;  2XKP A;  3CUO A;  1LDJ A;  1AWC A;  2Z9O A;  2VN2 A;  3ROU A;  2FRH A;  4PZJ A;  4CO8 A;  3HRS A;  1U5T B;  2ZXJ A;  4KFC A;  2ZME B;  2V9V A;  4UVA A;  3TOA A;  1FBU A;  3BJ6 A;  2PEX A;  2NYX A;  1J75 A;  5E20 A;  2O0Y A;  4KIF A;  4ETS A;  1O3S A;  3U1D A;  2VBY A;  4PDK A;  3E5Q A;  4MNU A;  1WQ2 A;  3RI4 A;  5LRR A;  1LB2 A;  2ESH A;  3ECH A;  4MGR A;  3V7C A;  2PBI A;  2X4H A;  1OYI A;  4GXO A;  2PMU A;  2TDX A;  4ZYD A;  3DPT A;  1P4W A;  2BGC A;  2BE5 F;  2ACJ A;  4CIC A;  4L5I A;  4LD5 A;  2JPC A;  3I64 A;  4HX7 A;  4OIO F;  2JT1 A;  1FBQ A;  2HZT A;  3DPL C;  4GO1 A;  4LB5 A;  3W6K B;  2DPD A;  2RGV A;  1KQ0 A;  3ABU A;  4WXH A;  1KYW A;  3LQQ A;  2PN6 A;  2IRF G;  2X0L A;  5KVR A;  5F1R A;  1MGT A;  1ZRD A;  5LHI A;  3CUQ B;  2VXZ A;  4B09 A;  3KZZ A;  2Z5U A;  3CJN A;  4A6D A;  3TQN A;  2V1U A;  5BMZ A;  3P9I A;  3K1N A;  5DUI A;  5CJ9 A;  5E17 F;  3GEZ A;  2OD5 A;  1R36 A;  4MQ9 F;  4Q5S F;  1XB4 A;  4HDV A;  3N4M A;  1SFX A;  4DQ2 A;  1R5H A;  5D5U B;  4KDP A;  1G3S A;  3GF2 A;  4LMY A;  2O8X A;  3JAM Z;  3COA C;  1FPQ A;  2V1X A;  3Q9S A;  3F8N A;  1XMA A;  3LA7 A;  4L9J A;  3ECO A;  1DPU A;  1ZAR A;  2Q0O A;  4HV6 A;  2EFQ A;  1W5S A;  3J80 Z;  2FBK A;  4KN7 X;  2HEO A;  4HV5 A;  3IHU A;  2W84 A;  2D45 A;  3V8J A;  2ZO4 A;  1OKR A;  4OU0 A;  3JSO A;  2E7W A;  1Z6T A;  3M8F A;  3VOE A;  3GX4 X;  2KKO A;  3RKX A;  2P4W A;  5IT3 A;  3KLN A;  4I2O A;  4QLC U;  1ON2 A;  3WTZ A;  4U7D A;  1OPC A;  3M7G A;  1F9N A;  2EA4 A;  2FBH A;  4WXD A;  1IRG A;  2FQ3 A;  3L00 A;  4OIP F;  3RIR A;  2QVO A;  1IZ1 A;  2E7X A;  1OMI A;  1W5T A;  4JBA A;  5DD8 A;  4A0X A;  2V79 A;  3T8T A;  2RNJ A;  3RPU A;  1IN7 A;  3IWF A;  1ZH5 A;  1HST A;  3H3Z A;  1BJA A;  3QOP A;  5CVU A;  4F7Z A;  2RN7 A;  3F6O A;  3MZY A;  2O6G E;  2CWE A;  1SFU A;  2P7C B;  3FWE A;  2K4B A;  2PMH A;  1ZHF A;  1E17 A;  4JK1 X;  4U0V A;  1XD7 A;  5JHU A;  2DTR A;  3HIF A;  3RKY A;  3I71 A;  2VOP A;  2VOD A;  3WGI A;  3HOS A;  2NRA C;  3M9A A;  2Z99 A;  5LGU A;  2XKO A;  4MEX F;  1XSV A;  3ZN1 A;  3MQ0 A;  2MLG A;  4EM0 B;  4HAM A;  4UV8 A;  2R7D A;  4M72 A;  3S2W A;  2VBW A;  3QPT A;  4L5J A;  4XLP F;  2XAS A;  3BJO A;  2A68 F;  1HQC A;  4Q4Z F;  4LK1 F;  1XMK A;  4M6Y A;  4EM1 A;  2OZ6 A;  3JSP A;  1PDN C;  1AOY A;  2FNP A;  3PQK A;  1O3R A;  2V6C A;  1I1G A;  1B59 A;  1S6L A;  2YSR A;  6PAX A;  1BIA A;  3TO9 A;  1G3W A;  1Z91 A;  5CVI A;  2Y0M A;  2AS5 F;  1YIO A;  3QAH A;  1Z05 A;  2KIU A;  3V8K A;  1RUO A;  2HYG D;  5BS6 A;  5AIQ A;  3HOT A;  2HTJ A;  3ZMU A;  4EJT A;  3QRF F;  3EDP A;  2GWR A;  5EEH A;  1S7O A;  1DUX C;  5TJJ A;  2Q2E A;  1HW1 A;  4BAY A;  1T6S A;  1IXC A;  1ZG3 A;  4EVI A;  5K5R A;  4N0B A;  3U9G A;  1YS7 A;  4BNC A;  2QZ8 A;  3LWF A;  3WE2 A;  4G8X A;  3MZH A;  3IWZ A;  4O6J A;  5LHH A;  3HHG A;  2YR2 A;  4OMY A;  5H20 A;  2EB7 A;  3KET A;  2EA2 A;  3ERE D;  1TW2 A;  1FT9 A;  3DV8 A;  4EV0 A;  3P9K A;  1UFM A;  4PGG A;  4MTD A;  4BH9 A;  3I53 A;  1MZB A;  1MJ9 A;  4HYE A;  3D5L A;  2FOK A;  3B73 A;  1WKM A;  3MAJ A;  3KP4 A;  4KN4 X;  5E18 F;  4TV7 A;  1F5T A;  5FFZ A;  3MWM A;  2HYF A;  3SQN A;  4LLN A;  2L02 A;  5ICC A;  5DUK A;  4R1H A;  4RGS A;  3EET A;  4XRF A;  1K79 A;  3ZN0 A;  1IN4 A;  3EUH A;  1MDM B;  2OQR A;  1ZGA A;  4G7Z F;  1FLI A;  2P5K A;  4G9Y A;  4LG0 B;  1YLF A;  3I54 A;  3K0L A;  5FD5 A;  2H09 A;  1QQI A;  1CGP A;  2R7F A;  1KU2 A;  4KUM A;  4ESJ A;  3KCC A;  3HHH A;  1V3F A;  1F1Z A;  2FXA A;  1IN8 A;  2WWY A;  4XLN F;  1SD7 A;  4U7B A;  5D4S A;  4LLL A;  2OZU A;  3H92 A;  4IF4 A;  4RB1 A;  1BOA A;  2FBI A;  1KQ8 A;  4HX4 A;  3NEU A;  2EWN A;  2MH2 A;  3WTX C;  3M1E A;  1T38 A;  2M45 A;  2ESN A;  5F6F A; 
#chains in the Genus database with same CATH topology
 3K9T A;  4UNO A;  1WJF A;  4U0Y A;  3R61 A;  2KPM A;  4IO9 F;  1JE8 A;  2DCE A;  2BVM A;  3GUD A;  1H9G A;  4S05 A;  5DCM A;  1ZG5 A;  5D5V B;  1JKR C;  5J6X A;  5LHG A;  3HSE A;  5J8C A;  1MD0 A;  2Z2S B;  1W7P B;  3PSI A;  2KJB A;  3W2A A;  5HNF A;  4NNJ A;  3NRV A;  3L1P A;  4ESB A;  2R93 J;  2FE3 A;  1A04 A;  1HKQ A;  1W5C C;  1XGO A;  2X48 A;  2DFI A;  4BHP A;  1TQP A;  4P9U A;  3KP2 A;  2EK5 A;  1ZQ3 P;  9ANT A;  3GFL A;  2IA2 A;  4BXX J;  4MFE A;  2CMP A;  1T56 A;  2HPM A;  1KU7 A;  3JRH A;  1BBY A;  2WV0 A;  4DYQ A;  5D4R A;  4CGZ A;  1JUS A;  1XGS A;  4DZJ A;  2BW3 B;  2HOE A;  2QQ9 A;  3ABK H;  2DW4 A;  3CUQ C;  4WX9 A;  4RDU A;  4L0Y B;  4BQA A;  5EEA A;  3J81 K;  2M7B A;  1X1A A;  2A5Y B;  1HW5 A;  5KNL A;  1OR7 A;  1WI3 A;  1UG0 A;  3OIQ A;  4HF1 A;  5B1B H;  3KZY A;  4LFU A;  1FTT A;  1D5V A;  1JTY A;  2UXN A;  4BKX A;  2K40 A;  2K85 A;  1B72 B;  2HGC A;  2JVH A;  1Y8R B;  1BI2 A;  3RQI A;  2JMW A;  3FMR A;  1HA8 A;  4D1Q A;  4YG2 F;  4Z2Y A;  3DBH B;  3SXY A;  3FK6 A;  1D3Y A;  4Y52 J;  3R60 A;  1S3J A;  4RBO A;  3IAM 2;  5JFR A;  2HVR A;  4GGG A;  1U9O A;  2L4M A;  1R1T A;  3LST A;  1C0W A;  2BYV E;  2KDZ A;  2DOE A;  4R79 A;  2HKO A;  3Q0U A;  4E7I A;  2BV6 A;  3F8C A;  4NQW B;  5CLS A;  2QF7 A;  1FJL A;  3HGG A;  3VSL A;  4XBF A;  2L7M P;  4CYC B;  3EUA A;  5TIS C;  1AKH A;  1NHA A;  3HG9 A;  2VKV A;  2A61 A;  4BJ5 C;  2ZSI B;  3F72 A;  1JGG A;  1QNT A;  4XR6 A;  1D1A A;  4IRG A;  5JR3 A;  4ENM A;  1B8I B;  1K78 A;  5ERI A;  5J8F A;  2R7Z J;  4IHV A;  5JLX A;  4AIJ A;  3GYH X;  4E7S A;  4G6Q A;  1I6X A;  1KGS A;  2ISZ A;  5B66 C;  1OYW A;  5ILV A;  2CG4 A;  5KHD A;  2WBM A;  3MKW B;  4FHT A;  3NWS A;  5EZH A;  3G71 I;  2VE8 A;  1UEL B;  3ZMS A;  2GAU A;  5TRD A;  4YEL A;  2VOO A;  2K86 A;  1MSF C;  2F5D A;  4FET A;  4CDG A;  4ZDL A;  1OCP A;  1ETV A;  2VJ5 A;  4M3F A;  3G3Z A;  1T2K A;  3P7N A;  2NVY J;  3T5X A;  1ERD A;  1RET A;  4K2E A;  2WTE A;  3S15 J;  3FXR A;  3C18 A;  4RAF A;  5BPI A;  5BOX A;  3K7A J;  2DQR A;  3TMO A;  3WTY C;  5C3E J;  1S7E A;  2YS9 A;  3LA3 A;  4HPQ A;  2E2I J;  4IVN A;  3E6B A;  3HOY J;  3EPZ A;  3CCU I;  1ZR2 A;  2HFH A;  3OY9 A;  1JKO C;  1HDD C;  1JXS A;  2ZJ2 A;  3ULQ B;  4HQE A;  1A36 A;  2V26 A;  3HRM A;  4N9H A;  4I01 A;  1FC3 A;  1RUN A;  2E5Z A;  4CXF A;  4B1R A;  3PJR A;  2PFB A;  4D7N A;  3HKZ N;  2A3S A;  4RM2 A;  3SZT A;  4BHC A;  2NS0 A;  3FXU A;  4ZYE A;  2CV1 A;  2E1M B;  5DM7 F;  1RR7 A;  5K5Q A;  3OV8 A;  2ZJR F;  2E1C A;  3F6V A;  1PUF A;  1MND A;  3M8J A;  4W97 A;  1UMQ A;  1RRJ A;  3FX3 A;  4UY8 I;  1X2N A;  3OOP A;  5ILU A;  5J40 A;  1R5G A;  1R9T J;  1OJL A;  1Z9C A;  1EH8 A;  4G7O F;  5GPA A;  4UUS B;  2ICW G;  4GYI A;  3JRD A;  2TRT A;  5HVQ C;  2XF5 A;  4FTH A;  2WY8 Q;  4RS8 A;  4C3J J;  5DD4 A;  4FT8 A;  4YIR X;  2EFO A;  4E70 A;  1JJ8 C;  3F0C A;  2L9R A;  1ACI A;  4EJU A;  1JUM A;  3K4C A;  2WAE A;  2DMN A;  2M30 A;  2XUB A;  3FZV A;  2RC4 A;  2KLO A;  2LLK A;  1RIO H;  1VQ5 I;  2OPT A;  2Y2Z A;  1PUE E;  2ID6 A;  2JA5 J;  1BJZ A;  1WH5 A;  2QYO A;  1NTC A;  4CHU A;  3OIP A;  4A12 A;  4GYG A;  2XPW A;  1T33 A;  2M8E A;  1VQ9 I;  1MJA A;  2ECB A;  2LKS A;  2VBX A;  3QWL A;  3GTL J;  3BPV A;  5C4X J;  1W0U A;  1I50 J;  1MH4 A;  1WJD A;  2GOM A;  4OMZ A;  4EJO A;  2DXI A;  4L18 B;  1SD4 A;  5D5X B;  3J81 Z;  2DMQ A;  4E6K G;  5ICG A;  1X3W B;  5D6F A;  4HST A;  4RAY A;  2YU9 J;  4BYY A;  3CC2 I;  2E60 A;  4ZYG A;  3GVA A;  2HI3 A;  2NVX J;  5F64 A;  3RPQ A;  1DPR A;  3AG4 H;  3G4S I;  3CQZ J;  5FRO A;  1BC7 C;  2HKX A;  3IKT A;  1XG1 A;  1YW8 A;  2F48 A;  2VC0 A;  4AIK A;  4ZC3 A;  1TP4 A;  1G8X A;  1TZL A;  2EZK A;  4H4K C;  3LSJ A;  2PG4 A;  2JJ7 A;  4QSH A;  1QZY A;  2JRT A;  1SC7 A;  2CFX A;  3CC4 I;  2BBY A;  1Z0X A;  2QUF A;  1MMD A;  5IY5 H;  3RKQ A;  3BRO A;  4EEF G;  2CW0 F;  4NHJ A;  2XB0 X;  4HOB A;  1WVR A;  4KIB A;  1YX3 A;  1WJB A;  3Q9V A;  2YPR A;  5K7H A;  2M5W A;  2R92 J;  1LNW A;  4Y7N J;  1LE8 B;  2DAO A;  4PJN A;  1FYM A;  3PUF A;  4OIQ F;  1P4X A;  3SJM A;  3VEP A;  4L9N A;  1OCO H;  2EV0 A;  3ZMD A;  3HJE A;  5DV5 A;  3VFZ A;  4DYR A;  3OR2 C;  4LJZ F;  2ZFU A;  2HVQ A;  3SDG A;  3MFK A;  2CSO A;  2Y9Y A;  1PP7 U;  2XGE A;  4D5C A;  2D1H A;  4DW6 A;  2P6T A;  2Z16 A;  3K1M A;  3GTO J;  3V8L A;  2DDA A;  2E71 A;  2E34 A;  4FCY A;  1RNL A;  2GZW A;  4MHG A;  4OOI A;  3BR5 A;  4IZZ A;  1QA6 A;  1YW7 A;  4A3J J;  2JPB A;  3LSG A;  1ZR4 A;  1O3Q A;  1LDD A;  1D0Z A;  2CJJ A;  4OIN F;  3JRC A;  3ZMT A;  2PX9 A;  3SYT A;  2LG4 A;  2WA0 A;  3EYY A;  3HYI A;  2AQF A;  4IHY A;  1BOB A;  2MAB A;  1NG7 A;  3HBL A;  4ZTJ A;  4W1U A;  2DA6 A;  2RDP A;  1T8I A;  2ELJ A;  1RZ4 A;  2B0L A;  2F6C A;  1YHQ I;  3O2P E;  3CTA A;  4MIM A;  3L09 A;  1TT0 A;  1OLT A;  2M8G X;  3GTJ J;  1FBS A;  3HDD A;  1WPK A;  4D7M A;  3H9G A;  1TWA J;  2ZBK A;  2DA1 A;  1E0E A;  4NB5 A;  1ULY A;  1YI2 I;  1UCR A;  1ZYR F;  3O8G A;  2HU9 A;  3KPH A;  3E6D A;  2HQN A;  2JA8 J;  3CP2 A;  3PFY A;  5LBQ A;  5FB2 A;  4IHX A;  1G59 A;  1EA3 A;  1FSE A;  3GXO A;  2CQX A;  4M74 A;  1J7K A;  3M3Y J;  2KDO A;  1XPX A;  2DMT A;  3C1D A;  1Y1W J;  2W48 A;  3OYJ A;  1OIS A;  3H0G J;  1G3Y A;  3L7W A;  4II3 A;  3DU5 A;  4F3Q A;  3S2H J;  4D9J A;  1UHS A;  2IEK A;  2QGU A;  4LOC A;  2COM A;  2ME6 A;  4EJV A;  3RPU D;  3AFH A;  3ELK A;  1JGS A;  3A0H C;  3HTS B;  2VIX A;  1YRN A;  3OYB A;  1QVU A;  4DBQ A;  4QPQ A;  4CYD A;  1VZ0 A;  1Q1H A;  1SD5 A;  3ESW B;  1XCB A;  5IYC J;  3LSP A;  2QBY B;  1LEB A;  1RKT A;  1T98 A;  1G3T A;  4MTE A;  1FIP A;  2R5Z A;  2XAJ A;  3A02 A;  2K4J A;  2LNB A;  1H0M A;  2IT0 A;  3KZI C;  3BZK A;  1XS9 A;  2IJL A;  2KZG A;  3R0A A;  2DOA A;  4YFN F;  1M1E B;  1QO0 D;  5L3E A;  1U3E M;  2CQN A;  1HSJ A;  2PMZ N;  4DOZ A;  2HOT A;  2DT5 A;  4O3M A;  1IXR C;  1V4R A;  3BG5 A;  2L0K A;  4EAT A;  3KE2 A;  3DTK A;  3W3C A;  2NVU B;  4CSW A;  1GLN A;  4A3C J;  3CCL I;  4XSZ F;  5E1W A;  2QM3 A;  5LRS A;  3A01 B;  1VQL I;  1OQY A;  3CCV I;  1R00 A;  2QEX I;  2VON A;  2GLO A;  2IVM A;  4JX6 A;  2MW8 A;  4RM3 A;  3GTQ J;  4A3B J;  4UHT A;  1FEX A;  2RNG A;  2VT3 A;  4XOR A;  3OYH A;  1YS6 A;  3WHC A;  2CUF A;  2M7A A;  2H6C A;  4AC0 A;  2EZI A;  3IH4 A;  4FE4 A;  2L4A A;  3W6V A;  1WJE A;  1GXP A;  1GVJ A;  3IUO A;  3VYR B;  5EGO A;  1YFH A;  3S2D J;  3DWL E;  1HKS A;  1S29 A;  4BHB A;  1RR8 C;  2R7O A;  1IAW A;  2EQR A;  2Y69 H;  1OYY A;  1Y8Q B;  2LKX A;  1GV2 A;  2H1L A;  1FOW A;  3H9J A;  3DXJ F;  4WF2 A;  2FX0 A;  5E3O A;  4A5N A;  4N4N B;  2RQQ A;  1TQI A;  5IT9 K;  1LDK B;  1WJC A;  4Y15 A;  2CFO A;  3SHF A;  4F92 B;  4CCN A;  1FOX A;  1CF7 A;  2E36 A;  2YUS A;  5HDN A;  1VQN I;  5IOY A;  1VND A;  3KFW X;  1R4M B;  1K4T A;  3TKY A;  1E2X A;  3IL2 A;  3IH3 A;  4AVZ A;  1X4O A;  1MMN A;  2VAS A;  3HKZ A;  3MN2 A;  4NC6 A;  4OAZ A;  1IUY A;  1Z3Y A;  2ELK A;  4HF2 A;  2K7L A;  1LKX A;  5FKK A;  1ZLJ A;  2Z3Y A;  3MKZ A;  5HDK A;  1XMX A;  1Z7U A;  3DEW A;  3RCO A;  1P4A A;  3GZ6 A;  2OQG A;  3LNQ A;  4YRV A;  3Q5F A;  3JTH A;  4J01 A;  2EH3 A;  5DEQ A;  2PQ8 A;  2ZXI A;  1N77 A;  3V4G A;  3Q0V A;  4XLF A;  5EDN A;  3LAJ A;  4JOM A;  3IKV A;  3DPU A;  4PGH A;  2HVS A;  4C2U A;  5DYM A;  1D1B A;  3K6G A;  1BC8 C;  4XNF A;  5KCM A;  3OYI A;  5GAE J;  3LQR A;  1IUF A;  1U2W A;  1HCR A;  5EG0 A;  4UXN A;  5BQT A;  2L3D A;  4NBQ A;  1RI7 A;  1UHW A;  3BCB A;  2CQK A;  2Q2E B;  1YG2 A;  4C9Y A;  2LD5 A;  3I59 B;  2GQQ A;  2IBD A;  2K02 A;  3HM5 A;  3GTP J;  3G2B A;  1XTA A;  1SD6 A;  4HNT A;  1KQ9 A;  4L9V A;  3FHZ A;  2QQ8 A;  1LPQ A;  2OU2 A;  1B1B A;  3ZQL A;  1FP1 D;  3EYI A;  4A3L J;  5HDG A;  1IO2 A;  2ZJQ F;  1F36 A;  5KAF C;  1UB9 A;  3J7A O;  2H8R A;  4ZDO A;  5M3F J;  4UV9 A;  1JHF A;  1FWZ A;  1GHC A;  3ABT A;  2A07 F;  3DTI A;  1P9Q C;  5A2Q K;  2A6T A;  4IHS A;  4AU7 A;  1GT0 C;  4I99 C;  2M0C A;  2IS1 A;  4ITV A;  1T39 A;  2EV6 A;  2R7V A;  4AYB N;  5C4J J;  3WU2 C;  1X3U A;  4P96 A;  5D8L B;  3ZPL A;  3G1O A;  3ZXS A;  4EGZ A;  2R7S A;  1U9N A;  1WI9 A;  2E19 A;  1S9H A;  3Q3S A;  1I39 A;  3ZGK A;  2ISY A;  2Z1D A;  4O5V A;  2LBF B;  1JHH A;  3RYP A;  4WXC A;  1EH6 A;  1WGX A;  4IRI A;  5FLX K;  2P81 A;  1ZRF A;  3GWZ A;  3TDU C;  2ELH A;  3RYR A;  1XC5 A;  4YFK F;  2DA4 A;  2IA1 A;  2UXX A;  4M3E A;  3WG9 A;  2X6Y A;  3AL0 B;  2QKL B;  3NAR A;  2CUJ A;  2YU3 A;  3B6C A;  2LY2 A;  4U88 A;  3FMS A;  4CCJ A;  2F5F A;  4BXF A;  1TW3 A;  1HBX G;  3OYM A;  3DEU A;  3GFJ A;  2ZKZ A;  4UB8 C;  1USS A;  1AU7 A;  4C30 A;  1J9I A;  1DP3 A;  3CCM I;  1L3L A;  2FEZ A;  2IA0 A;  1U5T C;  2WB1 A;  3DP7 A;  2ZNZ A;  1OCR H;  1ETX A;  4X1E A;  1ZGJ A;  2MA3 A;  3BR1 A;  2QCO A;  2ZME C;  1P6R A;  4RLQ A;  2PI0 A;  3K4M A;  3A1Y A;  3HRT A;  1W36 D;  1IF1 A;  2HDW A;  3C3W A;  3E6M A;  1SAN A;  2XVC A;  3D0S A;  3JRG A;  2K3F A;  1SFO J;  1J0R A;  2Y30 A;  3RQ4 A;  2K9Q A;  3CJQ B;  3OOU A;  4CZZ A;  1H9T A;  1Z1D A;  4XLA A;  1XN7 A;  3SEZ A;  1FY7 A;  3W6J B;  2ZFW A;  2PJR A;  2XRL A;  1XGN A;  5CVV A;  3WGG A;  5LLQ A;  5BPD A;  3QPS A;  3OSF A;  4HEA 2;  3AG2 H;  3ONQ A;  4XK4 A;  1TC3 C;  2W7N A;  1ONV A;  3BR2 A;  5LEK A;  1J5Y A;  1HLV A;  1D8J A;  1VQK I;  1WRJ A;  3OR1 C;  3CO7 C;  1IRX A;  4HBL A;  2BY2 A;  4EMS A;  4A2U A;  1IW7 F;  2V4J C;  2TCT A;  5IT9 Z;  3GFM A;  2J5O A;  5IOZ A;  4G94 A;  1PP8 F;  1D1C A;  3ZRG A;  3S1R J;  2HDC A;  2M1B A;  2KIQ A;  1U0J A;  1W7P A;  3KIO A;  3WTT C;  2L7F P;  3F8B A;  3OYK A;  2EJR A;  2OBP A;  3WTU C;  3AAF A;  3NWT A;  2KRC A;  4E7K A;  2H6B A;  3TO6 A;  3OYA A;  3PNV A;  1U8B A;  3D5S C;  4KT5 C;  2K9L A;  4M73 A;  3L2V A;  3MKL A;  3F8F A;  2EFP A;  1JTX A;  4XSX F;  4A3E J;  4BGD A;  2Y9Z A;  2LMD A;  4ENK A;  5DCM B;  1GDT A;  3FMQ A;  3CF5 F;  1QBJ A;  4UVB A;  5D8K B;  4MEY F;  4PJM A;  3UNG C;  1ZRE A;  3BTJ A;  3KEO A;  3L2R A;  4JYK A;  2VKE A;  2STT A;  5CQG A;  1R22 A;  5F1J A;  3WOD F;  2FD5 A;  2IPQ X;  2EIL H;  4I02 A;  1FTZ A;  3KP7 A;  1EF4 A;  2KHM A;  3DF8 A;  1MBE A;  3BG9 A;  3E5U A;  3FXL A;  2HQA A;  5GPC A;  5LGN A;  5CYV A;  3FHN A;  3DKY A;  1FMV A;  2PMZ A;  3CJT B;  2M87 A;  2RKH A;  3FBN B;  3DLL F;  2P6S A;  1Y39 A;  5HS8 A;  5GAG J;  3ZMZ A;  4BAC A;  1W0T A;  1IN6 A;  3K2A A;  3C2G A;  4Y4R A;  1XDS A;  1E3H A;  2K9S A;  1U5T A;  2E1N A;  2V6E A;  1PVE A;  1Y0U A;  5A2Q Z;  3FXM A;  4KIT B;  3HRU A;  1O3T A;  2ZME A;  1X3Z B;  4KA4 A;  3A03 A;  4ZZD A;  1SAX A;  2CV0 A;  2IS2 A;  4IOC F;  3BTI A;  2VLA A;  2CO5 A;  1XX5 A;  1MBG A;  1WHU A;  1A5J A;  3VB2 A;  1VQM I;  1QPI A;  1ON1 A;  3BP8 A;  2AXL A;  2XHK A;  2BHY A;  4G6D A;  4I09 A;  4A3G J;  3FXQ A;  3G1M A;  3CMA I;  1X1C A;  4JX4 A;  4N9I A;  3K10 A;  3IC7 A;  3CDI A;  5FLX Z;  1YOV B;  3I3L A;  3CCY A;  3L2Q A;  3S1M J;  2UWM A;  3CLO A;  2R3S A;  3IRR A;  4BY1 J;  2MLK A;  2W82 A;  4B3A A;  2VXD A;  4G7H F;  4LK0 F;  3VDX A;  3FDY A;  2HS5 A;  3BPX A;  3E6C C;  3SFZ A;  1Y1V J;  3G73 A;  1K61 A;  3UR3 C;  2K5C A;  2EFN A;  3TGN A;  4R8H A;  1LFB A;  1NH3 A;  2QWW A;  4RGR A;  2WC2 A;  2A6E F;  3CF2 A;  1WFX A;  4RB3 C;  3TW7 A;  2NXN B;  1ZG1 A;  2LOO A;  2IW5 A;  4XKC A;  2J5P A;  1X2M A;  5GTI C;  1ZN2 A;  3SFI A;  1A35 A;  2ZNY A;  3F21 A;  1AKH B;  2MYS A;  1N25 A;  5ICE A;  3JRB A;  3BT9 A;  4PFP A;  4I6Z A;  2JA6 J;  3KP5 A;  2QEN A;  1KZH A;  3SZP A;  3VYS B;  1P7J A;  4DIQ A;  3VWB A;  3K4N A;  4P9F A;  1K78 B;  3H3V K;  3R4K A;  5L3B A;  4AD9 A;  2X1C A;  4HW0 A;  4AVP A;  1P7I A;  4KNY A;  1H89 C;  4WCG A;  1JUP A;  2LRE A;  4G12 A;  3BCA A;  2DK5 A;  2DJN A;  2Q8K A;  4OAY A;  3E3V A;  4BEH A;  4F93 B;  3HOW J;  3BZC A;  3MCZ A;  3VYT B;  2KP6 A;  4KYW A;  4A93 J;  3MD2 A;  3A2K A;  2F4O B;  3QPH A;  3CES A;  2KFD A;  3ZP5 A;  4YFX F;  2NNY A;  2OF7 A;  1WZ2 A;  4IPA A;  3CUQ A;  5F0F A;  4A3M J;  2DDB A;  1U8R A;  3WU0 A;  1U78 A;  1K6O A;  2JA2 A;  2W24 A;  2COB A;  3CME I;  2JK3 A;  3F8M A;  1MNM C;  3DBL B;  3LFU A;  2O9L A;  5DDG A;  2WAQ A;  2DI3 A;  4P5O A;  3TL4 X;  2GM4 A;  1QHH D;  2BY3 A;  2ZCW A;  4HA8 A;  4E7L A;  3O3K A;  4FX0 A;  1MBJ A;  1TT5 B;  3ERM A;  1D5Y A;  3PO3 J;  2EBI A;  1FZP B;  2ADU A;  3S1Q J;  4M3B A;  4AM3 A;  3LSR A;  1O57 A;  3IRQ A;  1KYZ A;  2HYJ A;  2VBZ A;  3LA2 A;  4EGY A;  1PUF B;  3BDD A;  5FLV A;  2IGM A;  4AYB A;  5M5X J;  1FX7 A;  3VOD A;  1XSD A;  4UUV A;  1J59 A;  3ABM H;  2IS4 A;  3ZQH A;  3I4P A;  3PIP F;  4Z6Y A;  4XL9 A;  2I10 A;  1IN5 A;  2KZV A;  2D1V A;  4EQQ A;  1Y56 A;  4KJZ A;  1TNT A;  3RDI A;  4L9T A;  1XSX A;  3QYE A;  1SFE A;  4L0Z B;  5J1Y A;  2DLL A;  1QU3 A;  4ASN A;  1O7F A;  4U0W A;  2STW A;  2LC2 A;  1R23 A;  2R7Q A;  5HS7 A;  1FP2 A;  1FNN A;  1MJB A;  2GA2 A;  2OC6 A;  4AIH A;  2DU9 A;  2C6Y A;  1Z77 A;  3ASN H;  2H94 A;  2HTS A;  2HR3 A;  1X1B A;  2FF4 A;  2FMY A;  2KJC A;  4YII A;  4A0Y A;  1FYK A;  1R1U A;  3F23 A;  4Y13 A;  4QPO A;  2DMP A;  2XF6 A;  2Z33 A;  4V2G A;  1RPW A;  4FX4 A;  3H3U A;  3ZQG A;  1KON A;  4JQF A;  5ICF A;  3QPL A;  3WG7 H;  1V5G A;  5LEJ A;  4E7Z A;  2MH9 A;  2VT2 A;  4B8X A;  3GW2 A;  3BR6 A;  2O61 A;  2RQP A;  4ZYH A;  2X1E A;  3HTU A;  2JUC A;  2CUZ A;  2YX7 A;  2Q1Z B;  2XPU A;  3FIS A;  4C3H J;  3CDL A;  1S7A A;  2PLY A;  2DBB A;  4MFD A;  3N97 A;  2KRF A;  4LG3 A;  3P9C A;  3TO7 A;  1R71 A;  2FA5 A;  2MBF A;  5FJ8 J;  4XID A;  1VI0 A;  2LSO A;  2DYR H;  1V55 H;  4B43 A;  4IXA A;  4BUP A;  4WK8 F;  3C2B A;  2HWV A;  1B6A A;  1OCC H;  3HXL A;  3LSI A;  5K7F A;  5C44 J;  3IV5 A;  2D5V A;  3RZO J;  4BXU A;  3KEQ A;  2XRN A;  2XAQ A;  4EM2 A;  3KLO A;  4KIC A;  3CO6 C;  2DTZ A;  2MD5 A;  3ZOB A;  4CZC A;  3HSF A;  2CH0 A;  2YX4 A;  3BQY A;  5J4Y A;  4EJW A;  3O8H A;  2QQA A;  2W85 A;  5FKM A;  3QYB A;  1R7J A;  4IRH A;  1NK3 P;  2ZSH B;  2JTV A;  1MBH A;  2A5W A;  1DDN A;  1FOK A;  5L3C A;  2V9K A;  4D5F A;  1WJ5 A;  2NS8 A;  1IRF A;  2VQL A;  1HXD A;  5HLG A;  4XRM A;  2FNA A;  3HPG A;  1UST A;  5M5Y J;  5JI6 A;  3WHB A;  5FO5 A;  4KMU X;  4RGU A;  4H0E A;  2RVC A;  1H8A C;  3PFI A;  4CH7 A;  5FD6 A;  1AA7 A;  2EV5 A;  1GVD A;  5M3M J;  3TW6 A;  3OYF A;  3T0Y A;  3WE3 A;  3FXK A;  2DQL A;  4OIR F;  5E8G A;  2P7V B;  2L9N A;  1T08 B;  3R0J A;  2LFB A;  5J4V A;  4HDU A;  3BJA A;  2HQR A;  5LGT A;  4C3I J;  1HKT A;  1BW6 A;  2K27 A;  4N4O B;  2XAG A;  1Z3X A;  3HOU J;  5J1U A;  1BW5 A;  3K69 A;  3KP6 A;  1WCM J;  1KA8 A;  3H1C A;  4RB2 C;  4IEJ A;  1J09 A;  3HUG A;  1QVT A;  1X4P A;  3F9K A;  3OWT A;  3V7R A;  3OL4 A;  4D0P A;  3QP5 A;  3F3X A;  2O8K A;  3L9F A;  1A31 A;  5E3M A;  3HEF A;  2M0M A;  2O7O A;  2XAF A;  2HNH A;  1XGM A;  4YIF A;  5J47 A;  1BN5 A;  4XM3 A;  1Y0N A;  3SDB A;  5K1Y A;  3ZQC A;  4F91 B;  1U6G A;  2QLZ A;  1ZEL A;  2P5L C;  5FKL A;  2BEO A;  4AWX B;  2VJJ A;  2UV1 A;  4IJA A;  1KU9 A;  1BR4 A;  2ME0 A;  4KMF A;  1SMT A;  3C7J A;  4ENJ A;  4I7H A;  3TP0 A;  1E3O C;  1BR2 A;  5CVJ A;  5ILS A;  5L3F A;  3TP3 A;  2NNN A;  4ZYA A;  3DFG A;  3RJP A;  2QBY A;  4BDY A;  3LL7 A;  1TTY A;  2KRH A;  1FYL A;  4A5M A;  3JR9 A;  5HS9 A;  2EIJ H;  3KYD B;  5DM6 F;  1HDP A;  3MMY B;  2G9W A;  3I56 I;  1K4S A;  4XLC A;  5H6Q A;  3ZQ7 A;  3QU6 A;  5IP9 J;  2W00 A;  2UZK A;  4ENN A;  4DYC A;  1WH7 A;  2LYC A;  3FXJ A;  3S3O A;  5K5O A;  4WWC A;  2F4M B;  2G7H A;  1D8K A;  2JUG A;  3BTC A;  5E8I A;  2JSP A;  1YRN B;  1EV7 A;  3CDH A;  3WU1 B;  3MZ8 A;  2OAZ A;  2CW8 A;  2OJE D;  1TQM A;  3DEE A;  1BIB A;  3E7L A;  5AIP A;  5E1Z B;  4KT6 A;  3A01 A;  3HC7 A;  1L0O C;  2GIZ A;  1VF9 A;  4MQV A;  2CQQ A;  3JRF A;  3EQL F;  5ED4 A;  2R5Z B;  4ABZ A;  1T95 A;  2HZD A;  4LIT A;  3CP8 A;  4AUX A;  3I58 A;  4M71 A;  4FIS A;  3ZCO A;  3GTM J;  1FIA A;  1SMY F;  2VKH A;  1I5Z A;  4XLE A;  4J19 A;  4HLX A;  3EUK L;  3X2Q H;  4MO7 A;  3JTG A;  1AHD P;  3V7S A;  2VC1 A;  4UUT A;  5BNG A;  2LP0 A;  3W2W A;  3D1N I;  2EFW A;  1BM9 A;  4M9S A;  1K7A A;  3K70 C;  4YEJ A;  3FBI B;  5EZG A;  1TWH J;  3F22 A;  4A3D J;  2O03 A;  2OA4 A;  3KEY A;  1R1V A;  1K6Y A;  2QSG X;  1TLH B;  3JCU C;  3M8E A;  2KMU A;  3S1N J;  3REO A;  4IQJ A;  3BC8 A;  1YIT I;  1ODD A;  3PM1 A;  2NAZ A;  1IRZ A;  4G6T B;  2LR8 A;  4I98 B;  2DPU A;  2FQ4 A;  2XIG A;  2XC7 A;  2Y75 A;  2GXB A;  1PYV A;  3RKW A;  5EGO B;  2FML A;  2VJ4 A;  4HRI A;  3BG6 A;  3LFK A;  1LVA A;  2WAD A;  4JP0 A;  4QWQ A;  5JVT A;  2PJP A;  4A3K J;  3I0T A;  1P92 A;  3DKW A;  4HNV A;  1S8N A;  1PJR A;  4MLO A;  4UVC A;  5L3D A;  1EH7 A;  3ZMV A;  2HXO A;  3L2U A;  1BI3 A;  3VYU B;  2LDU A;  1ZAO A;  4ZH4 F;  2KIM A;  1CF7 B;  2FOW A;  3OYL A;  4C2T A;  1IXS B;  2L54 A;  3KP3 A;  2OCC H;  3KYL A;  2F5V A;  2JSC A;  1ZRC A;  1FSH A;  1UZC A;  3I59 A;  1BR1 A;  4RAZ A;  2EZH A;  1MMA A;  1LQ1 A;  3OSG A;  3K4J A;  5H6R A;  4XKV A;  2H8W A;  3GZN B;  3WGH A;  4XN3 A;  3C2H A;  2VPR A;  2L7Z A;  2MGQ A;  4RB0 A;  2ZC2 A;  1B4A A;  3ISP A;  4F55 A;  5IP6 A;  2GA1 A;  4ON0 A;  2N8G A;  2VQH A;  1ETQ A;  3K1P A;  4ESF A;  1ZKG A;  2RV8 A;  4A0Z A;  4HQM A;  5D5W B;  3H5N A;  1X1D A;  2QKM B;  2P8T A;  3IP4 B;  5E1X A;  2HXI A;  4XRS A;  1VQO I;  5EG0 B;  5M5W J;  3B02 A;  2XAU A;  2QSH X;  2Y48 A;  4KIG A;  4ZDP A;  3ML6 A;  3NQO A;  1T0F C;  2I5U A;  5D6E A;  1UHM A;  2CGP A;  1LEA A;  3FM3 A;  5E79 C;  3WTW C;  2LK2 A;  4DJA A;  3S32 A;  2XGX A;  4I0A A;  2ETH A;  3H5A A;  2IGO A;  2GXG A;  3BOQ A;  2HPI A;  4XLH A;  4M6X A;  4BE0 A;  1R49 A;  2RAE A;  2LTP A;  1F4K A;  3PO2 J;  3H9Q A;  3S14 J;  4GRI A;  5IP7 J;  3FF5 A;  1IG7 A;  3J7Z I;  4CCM A;  3JW4 A;  1MDM A;  1ZLK A;  2A05 A;  1HW2 A;  1MH3 A;  3DLA A;  2DMU A;  4LG0 A;  3TDZ C;  2MC3 A;  3GZ5 A;  4IHT A;  1EJ9 A;  2DK8 A;  2LRD A;  4LLG F;  3TOB A;  1QGP A;  4HX8 A;  5HLH A;  2P5V A;  2H1K A;  2R5Y A;  3OS2 A;  2L01 A;  2BZT A;  3E5X A;  1G4D A;  1TNS A;  4CCK A;  1TWF J;  2O3F A;  2NVT J;  4NDL A;  5EEG A;  1LFU P;  4B47 A;  1YYV A;  2BXY A;  5CVR A;  2DJI A;  3O6B B;  1I1S A;  2AQE A;  3WTS C;  2VE9 A;  1LJ9 A;  4HZF A;  5IYB J;  2AXT C;  2W57 A;  4HG2 A;  1DP7 P;  2FU4 A;  3U2R A;  4HF0 A;  4GCV A;  1MMG A;  1D0X A;  2QSF X;  1R58 A;  3E0J B;  4PCQ A;  2FUG 2;  3T1B A;  3DQV C;  3A4C A;  3OYD A;  2P0W A;  4L5E A;  1WWX A;  3QU3 A;  1QPM A;  2IGK A;  1XCV A;  2MG4 A;  1REP C;  2F2E A;  2DA7 A;  1YW9 A;  4ANJ A;  2L5Q A;  3L2W A;  1Z6R A;  1IDZ A;  2BXZ A;  3U21 A;  5LD2 C;  4A69 C;  4IOA F;  4IX7 A;  3S17 J;  3M1C A;  3BWG A;  1P2F A;  1QRY A;  4BE1 A;  3CJR B;  4LGW A;  4A6E A;  1YTY A;  1I3Q J;  3LOC A;  5F27 A;  2FSW A;  1GXQ A;  1MBK A;  1B9M A;  1YIJ I;  3H35 A;  3HSR A;  2XSJ C;  4B44 A;  1O7L A;  2X85 A;  2LF7 A;  2V1N A;  3PSF A;  1V5E A;  2QQB A;  2E2H J;  1STZ A;  2DOD A;  3HGY A;  2JZY A;  1MNE A;  1B9N A;  2WV1 A;  5DCF A;  2DOF A;  4HLY A;  2R7U A;  2D2W A;  3BZ6 A;  4LB6 B;  1XDU A;  2W25 A;  1BI1 A;  2V9P A;  2GBY A;  4Y17 A;  3DTE A;  1T0F A;  5HLI A;  2B63 J;  1YQA A;  3Q0W A;  1KU3 A;  2GIV A;  3GO5 A;  1IC8 A;  1W7P D;  4I0B A;  1JJ6 C;  2X6W A;  2BW3 A;  4XQF A;  4V19 K;  2ECC A;  4ZZL A;  5HOO A;  1G6N A;  2A6H F;  4NC8 A;  4XKB A;  3J7Y J;  3I4N J;  3BY6 A;  1X1P A;  2E1M C;  3CMY A;  4PUS A;  3GLL A;  2CV2 A;  1MKM A;  4Q47 A;  5FFX A;  1BI0 A;  3QP6 A;  2XRO A;  3DKX A;  2LF8 A;  4V2F A;  2V7F A;  2A69 F;  3CMM A;  5L3G A;  3JRA A;  2V1D A;  1ITY A;  1I27 A;  5CKT A;  3BQZ A;  3K2Z A;  2IP2 A;  1YO5 C;  1B72 A;  4A3I J;  2LKP A;  2OCE A;  3WTV C;  3GLX A;  3AKZ A;  4M9X A;  1Z21 A;  3I5U A;  4P55 A;  5TGT A;  4Q48 A;  3LAP A;  1VQ4 I;  2H27 A;  2DO7 A;  2F5E A;  1TBX A;  4AID A;  3JAM K;  2F5C A;  4IHW A;  3I4M J;  1HC8 A;  2XAH A;  3FM5 A;  3R6S A;  4DNC A;  2UUZ A;  3L2C A;  2K9N A;  2G7U A;  3RTR A;  4X6A J;  5KK1 A;  1J2X A;  2B7E A;  3PNT A;  5AON A;  3E97 A;  5B3S H;  2KIF A;  2JRM A;  1QHG A;  2VUM J;  2W1O A;  2CYY A;  2L9V A;  3PQJ A;  4BQO A;  4S04 A;  1HF0 A;  3T8R A;  4M9Z A;  4NQW A;  1VTN C;  4RGX A;  3MEX A;  3SZG A;  5EYR A;  1QZZ A;  2JA7 J;  4CYC A;  1W4M A;  5FGM A;  2X6X A;  3J80 K;  2XV4 S;  4F52 A;  3BLY A;  2XKP A;  3CUO A;  4PJ0 C;  4CCO A;  3PIO F;  1MIJ A;  1LDJ A;  1AWC A;  2Z9O A;  2VN2 A;  3ROU A;  3GTG J;  2FRH A;  4PZJ A;  4CO8 A;  1QZE A;  5IPA A;  1B8I A;  3HRS A;  2LVS A;  1U5T B;  2ZXJ A;  1EKE A;  2R0Q C;  2ZME B;  4KFC A;  2BHZ A;  1A6I A;  4ZJZ A;  2V9V A;  4OWR B;  4DZP A;  5FLM J;  4UVA A;  1S5L C;  3JRE A;  2VPL A;  2MSY A;  3H0D A;  2EZL A;  5IYD J;  3TOA A;  1YE9 A;  1FBU A;  3BJ6 A;  2PEX A;  4XMY A;  1YX5 A;  3S93 A;  2R7R A;  3K4K A;  1G2H A;  2NYX A;  2BY0 A;  2CQ7 A;  5HNH A;  2DA3 A;  3HPH A;  3LSK A;  1J75 A;  1V54 H;  5E20 A;  2I8D A;  2JN6 A;  2O0Y A;  4KIF A;  4ETS A;  3AG3 H;  1O3S A;  2DT7 B;  2KQR A;  3U1D A;  3G6E I;  2VBY A;  4PDK A;  3OS0 A;  4NUB A;  1R5I D;  3E5Q A;  4MNU A;  4PSX A;  1WQ2 A;  3U1K A;  1WJA A;  3S16 J;  3RI4 A;  5LRR A;  1LB2 A;  1BL0 A;  2ESH A;  1R6R A;  2E2J J;  4E7J A;  2VQG A;  3ECH A;  4MGR A;  3V7C A;  2PBI A;  2WY7 Q;  3A0B C;  1N78 A;  2X4H A;  2XDV A;  2JVG A;  1ZTR A;  1OYI A;  1FMW A;  1Q1V A;  3BR3 A;  4GXO A;  2CS3 A;  2PMU A;  2TDX A;  4RA2 A;  5FKN A;  3DPT A;  4ZYD A;  1ZK8 A;  1P4W A;  3FKJ A;  4XOT A;  2KL4 A;  2BGC A;  2BE5 F;  1DGR M;  2ACJ A;  4CIC A;  4L5I A;  1NK2 P;  4LD5 A;  2JPC A;  3I64 A;  4HX7 A;  1RKW A;  4OIO F;  2JT1 A;  1FBQ A;  2HZT A;  3DPL C;  3QYF A;  4UUS A;  4GO1 A;  4BEH B;  4LB5 A;  2DT6 A;  4UB6 C;  3W6K B;  1OFC X;  2DFH A;  2DPD A;  2RGV A;  4XIC A;  1SVO A;  1KQ0 A;  3ABU A;  4LIV A;  4WXH A;  1KYW A;  3LQQ A;  2PN6 A;  2IRF G;  4E4H A;  2X0L A;  5KVR A;  5F1R A;  2DA2 A;  1MGT A;  1ZRD A;  5LHI A;  3CUQ B;  5B5E C;  4PJL A;  2VXZ A;  2X1D A;  4B09 A;  2JQ7 A;  3KZZ A;  2Z5U A;  3CJN A;  2NOG A;  2DN0 A;  4XN0 A;  3BR0 A;  1TL8 A;  4A6D A;  3TQN A;  2V1U A;  2WAF A;  3M07 A;  5BMZ A;  1CQT A;  3P9I A;  2B9S A;  3K1N A;  3MVP A;  5DUI A;  5CJ9 A;  5E17 F;  3GEZ A;  2OD5 A;  1R36 A;  4MQ9 F;  4Q5S F;  2RRE A;  3CCR I;  1XB4 A;  4KIS A;  4HDV A;  3N4M A;  1VFC A;  2MC4 A;  1SFX A;  2E1O A;  4DQ2 A;  3HB9 A;  3PNY A;  3CCQ I;  1APL C;  3PUB A;  3OL3 A;  3BTL A;  1R5H A;  1JT0 A;  5D5U B;  4KDP A;  1G3S A;  3GF2 A;  2IS6 A;  1SAU A;  4LMY A;  2O8X A;  5GAD J;  3JAM Z;  3COA C;  4BE2 A;  1FPQ A;  4J00 A;  2L2O A;  2V1X A;  3SEQ A;  1MBF A;  3Q9S A;  2R7W A;  3F8N A;  2VKD A;  1XMA A;  3LA7 A;  4L9J A;  2VL8 A;  4LIU A;  3ECO A;  2VQC A;  1MSE C;  2X9D A;  1VQP I;  2G0E A;  1DPU A;  1ZAR A;  2Q0O A;  1LE8 A;  4II2 A;  2F4I A;  4HV6 A;  1ETY A;  2EFQ A;  1DQU A;  1W5S A;  3S8P A;  2FBK A;  3J80 Z;  1VQ8 I;  5HOD A;  4KN7 X;  1VQ6 I;  2K9M A;  3HZJ A;  5F04 A;  2HEO A;  2X51 A;  4HV5 A;  4BBR J;  4B3X A;  2KIS A;  2JWT A;  1UAA A;  3IHU A;  2W84 A;  1S72 I;  2D45 A;  3V8J A;  5F08 A;  3N05 A;  2ZO4 A;  1OKR A;  4OU0 A;  3FK7 A;  5GTH C;  3HOX J;  4Y33 A;  1D0Y A;  3JSO A;  3OMY A;  2E7W A;  1Z6T A;  3M8F A;  3VOE A;  3GX4 X;  2KKO A;  1Y6I A;  3RKX A;  2P4W A;  5IT3 A;  3KLN A;  4I2O A;  2Y0S N;  4QLC U;  1ON2 A;  3WTZ A;  2WB1 N;  4BS9 A;  3GFI A;  3CCS I;  5JVG F;  2XB5 A;  4U7D A;  1IV8 A;  1OPC A;  1ETO A;  4M3D A;  4Y3O A;  3W2V A;  3M7G A;  3QOD A;  4X0G A;  1VQ7 I;  2ID3 A;  2XF7 A;  2DYS H;  3CC7 I;  1F9N A;  2EA4 A;  3GBG A;  3GCM A;  2FBH A;  4WXD A;  1YJW I;  2L9S A;  3S3N A;  1IRG A;  2FQ3 A;  3I9V 2;  3LSH A;  3L00 A;  4OIP F;  2M9H A;  3P5J A;  3RIR A;  2VI6 A;  3FXO A;  1TWC J;  1BA5 A;  4HNU A;  2CU7 A;  2QVO A;  3HOV J;  1IZ1 A;  1LUJ B;  3LMM A;  2E7X A;  1NG6 A;  2GOX B;  3OIO A;  2VB6 A;  1OMI A;  2ZXH A;  3PL8 A;  1W5T A;  3TBI A;  2MD0 A;  4JBA A;  1W1W E;  5DD8 A;  4PJJ A;  2DFF A;  4A0X A;  2V79 A;  4QTR A;  3T8T A;  2RNJ A;  1DU0 A;  3RPU A;  1IDY A;  1IN7 A;  1IGN A;  4XOP A;  3IWF A;  1ZH5 A;  3HUG B;  3CLQ A;  1V5F A;  1HST A;  3H3Z A;  2M2E A;  1BJA A;  3QOP A;  5CVU A;  2OTL I;  5DS9 A;  3E1S A;  3HOZ J;  4F7Z A;  2RN7 A;  4IQ4 A;  3M4O J;  2M4K A;  2LH9 A;  3F6O A;  3MZY A;  2O6G E;  1FOY A;  1LVK A;  2CWE A;  4IL6 C;  1SFU A;  5J3L A;  4PFO A;  2EPF A;  3BG3 A;  4XKW A;  3HL2 A;  2P7C B;  3FWE A;  3NAU A;  1LFP A;  2IAI A;  2K4B A;  2PMH A;  2GXA A;  1MMS A;  1ZHF A;  1E17 A;  4JK1 X;  4U0V A;  1XD7 A;  3ZQF A;  4DBR A;  5JHU A;  2DTR A;  1TWG J;  3HIF A;  3RKY A;  3I71 A;  2VOP A;  2EIK H;  3DBR B;  2VOD A;  4RLF A;  4S0H B;  3OYE A;  3WGI A;  4RMN A;  2MFZ A;  3HOS A;  2HDD A;  2NRA C;  3VPR A;  3RZD J;  5FRM A;  3M9A A;  2Z99 A;  1DU6 A;  3CCJ I;  5H2F C;  5LGU A;  2XKO A;  3CCE I;  1XSV A;  4MEX F;  4IKF A;  3ZN1 A;  4BJT A;  2M34 A;  3MQ0 A;  1ORK A;  2MLG A;  1ZGW A;  4EM0 B;  2X6O A;  1WSU A;  4HAM A;  4UV8 A;  2R7D A;  1R4N B;  4I76 A;  4M72 A;  4BQQ A;  3S2W A;  2VBW A;  1JT6 A;  3QPT A;  4L5J A;  4XLP F;  2BY1 A;  2XAS A;  3BJO A;  3AL0 C;  2A68 F;  1HQC A;  4BL0 B;  4Q4Z F;  4LK1 F;  1JKQ C;  4BDZ A;  1XMK A;  4M6Y A;  4EM1 A;  2OZ6 A;  3G1L A;  3JSP A;  1H88 C;  4FE7 A;  3KYC B;  1PDN C;  3FKI J;  2E5N A;  1SFK A;  1AOY A;  3ZQQ A;  2FNP A;  3PQK A;  1O3R A;  2QA4 I;  2V6C A;  1UG2 A;  2CUE A;  1I1G A;  1YJN I;  1B59 A;  1S6L A;  2CW7 A;  2YSR A;  6PAX A;  2DFE A;  4CCL A;  1HOM A;  3OYG A;  3EUH C;  1W36 C;  1BIA A;  2KT0 A;  1Z7L A;  2M4G A;  1DGW Y;  1ETK A;  3TO9 A;  2NVQ J;  1G3W A;  4XON A;  3QQA A;  1Z91 A;  2R4G A;  5E3L A;  5CVI A;  5J1R A;  2Y0M A;  1UJ8 A;  2AS5 F;  1E3P A;  5EJC A;  1YIO A;  3QAH A;  4BBS J;  4NC7 A;  2M3A A;  1Z05 A;  2KIU A;  3V8K A;  1SEU A;  2XGC A;  2HYG D;  2L7K A;  5BS6 A;  2HOA A;  1RUO A;  5AIQ A;  3HOT A;  3DU6 A;  4JX5 A;  2HTJ A;  3ZMU A;  3OYN A;  4EJT A;  1A6Q A;  3QRF F;  5DTD A;  3EDP A;  2OUM A;  2GWR A;  1ENH A;  4XRS G;  5EEH A;  1S7O A;  1DUX C;  5TJJ A;  2Q2E A;  5KAI C;  1F43 A;  1HW1 A;  2OV7 A;  1T6S A;  4BAY A;  1IXC A;  1ZG3 A;  4EVI A;  5K5R A;  1SVM A;  2ZB9 A;  2R7T A;  3LSM A;  4N0B A;  3U9G A;  1YS7 A;  5GAH J;  4BNC A;  2QZ8 A;  1JI8 A;  3LWF A;  3ASO H;  4BY7 J;  3ZQI A;  4PSW A;  3WE2 A;  4G8X A;  3TED A;  2EIN H;  3MZH A;  2NS7 A;  3IWZ A;  5E3N A;  2AO9 A;  4O6J A;  4A3F J;  5LHH A;  4GDF A;  2R7X A;  2OTJ I;  4RAG A;  3HHG A;  3ZR8 X;  2YR2 A;  4M3G A;  3RSN A;  3UKG A;  5JHF A;  5EF6 A;  1YJ9 I;  4OMY A;  5FKO A;  5H20 A;  1N75 A;  2EB7 A;  1OCT C;  3DCF A;  4BU2 A;  3KET A;  2EA2 A;  3ERE D;  2K3P A;  1TW2 A;  4CUG A;  1OCZ H;  3H36 A;  1FT9 A;  3DV8 A;  4EV0 A;  3P9K A;  1UFM A;  2WAQ N;  3D5R C;  4PGG A;  5F0C A;  4MTD A;  2W4S A;  2HQ5 A;  4BH9 A;  2FJ1 A;  4QIW N;  2LBF A;  5F0H A;  2XGD A;  3I53 A;  1MZB A;  1MJ9 A;  4HYE A;  2ZXW H;  2LY1 A;  4M6V A;  1POG A;  3IAS 2;  3D5L A;  2FOK A;  3K4L A;  3B73 A;  4PK4 A;  2E35 A;  5FRN A;  1WKM A;  4FAS D;  3FIW A;  3MAJ A;  3KP4 A;  3J7A Y;  3GME A;  4KN4 X;  5E18 F;  3K4B A;  1Z67 A;  4TV7 A;  1O4X A;  3H5R A;  3QOE A;  2BVL A;  4FQG A;  1F5T A;  5FFZ A;  1GUU A;  3ABL H;  3MWM A;  4E7H A;  2HYF A;  3SQN A;  4LLN A;  2L02 A;  4ZTF A;  1RC9 A;  3BG7 A;  4BQN A;  5ICC A;  5DUK A;  4R1H A;  5JLW A;  4RGS A;  1OR7 C;  2XSD C;  5CPR B;  3EET A;  3VSK A;  3I55 I;  2NOJ B;  4XRF A;  2BOL A;  5CQE A;  3MKY B;  1K79 A;  3ZN0 A;  3IH2 A;  1IN4 A;  3K70 D;  3EUH A;  2DA5 A;  1MDM B;  2OQR A;  1ETW A;  5HLT A;  1ZGA A;  4G7Z F;  1FLI A;  3B6A A;  2P5K A;  4C2M J;  5K7Z A;  1I6H J;  2AHQ A;  4G9Y A;  4HSR A;  4B4C A;  1RES A;  2LY9 A;  3CD6 I;  4LG0 B;  1MW7 A;  2XPV A;  1YLF A;  3I54 A;  3K0L A;  3OYC A;  1I3A A;  2Y0S A;  5FD5 A;  4GFB A;  5GP9 A;  2EIM H;  4U87 A;  2H09 A;  1SVL A;  1QQI A;  2Y31 A;  3S3M A;  1CGP A;  4P1W A;  2R5Y B;  2R7F A;  4BJ6 C;  1KU2 A;  4KUM A;  1K83 J;  4ESJ A;  3KCC A;  2CRG A;  3V42 A;  3HHH A;  1V3F A;  1F1Z A;  2FXA A;  1IN8 A;  2IXS A;  2WWY A;  4CA0 A;  3CZ6 A;  4XLN F;  3KX2 A;  3JRI A;  1GV5 A;  2HOS A;  3GTK J;  1SD7 A;  2IGN A;  4U7B A;  1JKP C;  2ZJP F;  5D4S A;  4LLL A;  1IJW C;  2OZU A;  3H92 A;  4IF4 A;  4RB1 A;  4DGW B;  1BOA A;  2FBI A;  1X19 A;  2VJI A;  4B48 A;  1KQ8 A;  2PJR B;  3OS1 A;  4HX4 A;  1X58 A;  2O5R A;  5LFA A;  3NEU A;  2EWN A;  2MH2 A;  3WTX C;  3M1E A;  1T38 A;  1IV6 A;  2M45 A;  2ESN A;  5B1A H;  5F6F A;  3AG1 H; 
#chains in the Genus database with same CATH homology
 3K9T A;  4UNO A;  4U0Y A;  3R61 A;  1JE8 A;  3GUD A;  4S05 A;  1H9G A;  5DCM A;  1ZG5 A;  5D5V B;  5J6X A;  5LHG A;  3HSE A;  5J8C A;  1MD0 A;  1W7P B;  2KJB A;  3NRV A;  4ESB A;  2FE3 A;  1A04 A;  1HKQ A;  1XGO A;  2DFI A;  4BHP A;  1TQP A;  4P9U A;  3KP2 A;  2EK5 A;  3GFL A;  2IA2 A;  1KU7 A;  1BBY A;  2WV0 A;  5D4R A;  4CGZ A;  1XGS A;  2HOE A;  2QQ9 A;  2DW4 A;  3CUQ C;  4WX9 A;  4L0Y B;  4BQA A;  3J81 K;  2A5Y B;  1HW5 A;  1OR7 A;  4HF1 A;  3KZY A;  4LFU A;  1D5V A;  2UXN A;  2HGC A;  1BI2 A;  3FMR A;  4YG2 F;  4Z2Y A;  3SXY A;  1D3Y A;  3R60 A;  1S3J A;  5JFR A;  4GGG A;  2L4M A;  1R1T A;  3LST A;  1C0W A;  2BYV E;  4R79 A;  2HKO A;  2BV6 A;  3F8C A;  5CLS A;  4XBF A;  1NHA A;  2A61 A;  3F72 A;  1QNT A;  4IRG A;  5JR3 A;  4ENM A;  1K78 A;  5ERI A;  5J8F A;  4AIJ A;  3GYH X;  4G6Q A;  1I6X A;  1KGS A;  2ISZ A;  1OYW A;  5ILV A;  2CG4 A;  4FHT A;  2VE8 A;  3ZMS A;  2GAU A;  5TRD A;  2VOO A;  2K86 A;  2F5D A;  4CDG A;  1T2K A;  3G3Z A;  3P7N A;  3T5X A;  4K2E A;  2WTE A;  3FXR A;  3C18 A;  5BPI A;  5BOX A;  2DQR A;  3WTY C;  3LA3 A;  4IVN A;  3E6B A;  2HFH A;  1JXS A;  2ZJ2 A;  3ULQ B;  4HQE A;  3HRM A;  4N9H A;  4I01 A;  1FC3 A;  1RUN A;  4CXF A;  2PFB A;  2A3S A;  3SZT A;  4BHC A;  2NS0 A;  3FXU A;  4ZYE A;  5K5Q A;  3OV8 A;  2E1C A;  3F6V A;  3FX3 A;  3OOP A;  5ILU A;  1R5G A;  1Z9C A;  1EH8 A;  4G7O F;  4GYI A;  5HVQ C;  4RS8 A;  5DD4 A;  4FT8 A;  2EFO A;  4E70 A;  4EJU A;  2M30 A;  2XUB A;  3FZV A;  2RC4 A;  1RIO H;  1PUE E;  2QYO A;  4CHU A;  4A12 A;  4GYG A;  2M8E A;  1MJA A;  2VBX A;  3BPV A;  4EJO A;  4L18 B;  4OMZ A;  1SD4 A;  5D5X B;  3J81 Z;  5ICG A;  5D6F A;  4RAY A;  4BYY A;  4ZYG A;  3GVA A;  5F64 A;  3RPQ A;  1DPR A;  1BC7 C;  2HKX A;  3IKT A;  1YW8 A;  2VC0 A;  4AIK A;  2PG4 A;  1QZY A;  2JRT A;  2CFX A;  2BBY A;  4NHJ A;  2QUF A;  3BRO A;  2CW0 F;  4HOB A;  4KIB A;  3Q9V A;  2YPR A;  2M5W A;  1LNW A;  2DAO A;  1FYM A;  4OIQ F;  1P4X A;  3VEP A;  4L9N A;  2EV0 A;  3ZMD A;  5DV5 A;  3VFZ A;  4LJZ F;  3MFK A;  2CSO A;  1PP7 U;  2D1H A;  2P6T A;  3K1M A;  3V8L A;  1RNL A;  2GZW A;  4MHG A;  4OOI A;  1YW7 A;  2JPB A;  1O3Q A;  1LDD A;  4OIN F;  3ZMT A;  3EYY A;  3HYI A;  2RDP A;  1RZ4 A;  2B0L A;  3O2P E;  3CTA A;  3L09 A;  1FBS A;  2ZBK A;  4NB5 A;  1ULY A;  1UCR A;  1ZYR F;  3E6D A;  2HQN A;  5FB2 A;  5LBQ A;  1FSE A;  3GXO A;  4M74 A;  1J7K A;  3C1D A;  1G3Y A;  3L7W A;  2COM A;  4EJV A;  3ELK A;  1JGS A;  3HTS B;  4CYD A;  1Q1H A;  1SD5 A;  1XCB A;  2QBY B;  1LEB A;  1T98 A;  1G3T A;  4MTE A;  2XAJ A;  2K4J A;  2LNB A;  1H0M A;  2IT0 A;  2IJL A;  3R0A A;  4YFN F;  1QO0 D;  5L3E A;  1U3E M;  1HSJ A;  2DT5 A;  4O3M A;  1IXR C;  1V4R A;  3KE2 A;  4XSZ F;  5E1W A;  2QM3 A;  5LRS A;  1R00 A;  2VON A;  2IVM A;  4UHT A;  2VT3 A;  1YS6 A;  2H6C A;  2L4A A;  1GXP A;  1GVJ A;  1YFH A;  1HKS A;  1S29 A;  4BHB A;  1IAW A;  1OYY A;  4WF2 A;  3DXJ F;  4A5N A;  1TQI A;  5IT9 K;  1LDK B;  4Y15 A;  3SHF A;  1CF7 A;  5HDN A;  3KFW X;  3TKY A;  1E2X A;  3IL2 A;  1IUY A;  4HF2 A;  2K7L A;  1ZLJ A;  2Z3Y A;  5HDK A;  1Z7U A;  3GZ6 A;  1P4A A;  2OQG A;  3Q5F A;  3JTH A;  5DEQ A;  2PQ8 A;  3V4G A;  3LAJ A;  3IKV A;  4PGH A;  5DYM A;  1BC8 C;  3LQR A;  1U2W A;  4UXN A;  5BQT A;  2L3D A;  1RI7 A;  1UHW A;  2CQK A;  1YG2 A;  3I59 B;  2GQQ A;  2K02 A;  1SD6 A;  1KQ9 A;  4L9V A;  3FHZ A;  2OU2 A;  1B1B A;  3EYI A;  1FP1 D;  5HDG A;  1UB9 A;  3J7A O;  4UV9 A;  1JHF A;  1FWZ A;  1GHC A;  3ABT A;  2A07 F;  5A2Q K;  4IHS A;  1T39 A;  2EV6 A;  1X3U A;  4P96 A;  5D8L B;  3ZPL A;  4EGZ A;  1WI9 A;  2ISY A;  4O5V A;  1JHH A;  3RYP A;  4WXC A;  1EH6 A;  4IRI A;  5FLX K;  1ZRF A;  3GWZ A;  3TDU C;  2ELH A;  3RYR A;  4YFK F;  2UXX A;  2IA1 A;  3WG9 A;  2YU3 A;  4U88 A;  3FMS A;  2F5F A;  1TW3 A;  1HBX G;  3DEU A;  3GFJ A;  2ZKZ A;  1USS A;  1J9I A;  1L3L A;  2FEZ A;  2IA0 A;  1U5T C;  3DP7 A;  2ZNZ A;  1ZGJ A;  2MA3 A;  1P6R A;  2PI0 A;  3HRT A;  1IF1 A;  3E6M A;  3C3W A;  2XVC A;  3D0S A;  1J0R A;  4CZZ A;  1H9T A;  1Z1D A;  1XN7 A;  1FY7 A;  3W6J B;  2ZFW A;  1XGN A;  5CVV A;  3WGG A;  5LLQ A;  5BPD A;  1ONV A;  5LEK A;  1J5Y A;  1D8J A;  1WRJ A;  3CO7 C;  4HBL A;  4EMS A;  4A2U A;  1IW7 F;  5IT9 Z;  3GFM A;  2J5O A;  4G94 A;  1PP8 F;  2HDC A;  2M1B A;  1W7P A;  3WTT C;  3F8B A;  2EJR A;  2OBP A;  3WTU C;  3AAF A;  2H6B A;  3TO6 A;  4KT5 C;  4M73 A;  3F8F A;  2EFP A;  4XSX F;  4ENK A;  5DCM B;  3FMQ A;  1QBJ A;  4UVB A;  5D8K B;  4MEY F;  1ZRE A;  3KEO A;  2STT A;  1R22 A;  3WOD F;  2IPQ X;  4I02 A;  3KP7 A;  3DF8 A;  3E5U A;  5LGN A;  5CYV A;  2M87 A;  2RKH A;  2P6S A;  5HS8 A;  3ZMZ A;  1IN6 A;  1XDS A;  1U5T A;  2E1N A;  1Y0U A;  5A2Q Z;  1O3T A;  3HRU A;  2ZME A;  4KA4 A;  4ZZD A;  1SAX A;  2CO5 A;  3VB2 A;  1ON1 A;  3BP8 A;  2AXL A;  2XHK A;  4G6D A;  4I09 A;  3FXQ A;  4N9I A;  3IC7 A;  5FLX Z;  2UWM A;  3CLO A;  2R3S A;  3IRR A;  2MLK A;  4G7H F;  1WSU A;  4LK0 F;  2H27 A;  2HS5 A;  3BPX A;  3E6C C;  3SFZ A;  3G73 A;  2EFN A;  3TGN A;  4R8H A;  2QWW A;  4RGR A;  2WC2 A;  2A6E F;  4RB3 C;  1ZG1 A;  2IW5 A;  2J5P A;  1ZN2 A;  2ZNY A;  3F21 A;  5ICE A;  3KP5 A;  2QEN A;  3SZP A;  4P9F A;  1K78 B;  3R4K A;  5L3B A;  4AD9 A;  4AVP A;  4HW0 A;  4KNY A;  4WCG A;  2DK5 A;  2Q8K A;  3E3V A;  3MCZ A;  4KYW A;  3QPH A;  3ZP5 A;  4YFX F;  2NNY A;  4IPA A;  3CUQ A;  1U8R A;  3WU0 A;  1U78 A;  1K6O A;  2W24 A;  3F8M A;  5DDG A;  2DI3 A;  4P5O A;  2ZCW A;  4HA8 A;  3O3K A;  4FX0 A;  1FZP B;  2ADU A;  1O57 A;  3IRQ A;  1KYZ A;  2VBZ A;  3LA2 A;  4EGY A;  3BDD A;  1FX7 A;  3VOD A;  1XSD A;  4UUV A;  1J59 A;  3I4P A;  1IN5 A;  2D1V A;  4EQQ A;  1TNT A;  3RDI A;  4L9T A;  1XSX A;  1SFE A;  4L0Z B;  2DLL A;  4ASN A;  1O7F A;  4U0W A;  2STW A;  1R23 A;  5HS7 A;  1FP2 A;  1FNN A;  1MJB A;  2GA2 A;  4AIH A;  2DU9 A;  2C6Y A;  2H94 A;  2HTS A;  2HR3 A;  2FF4 A;  2FMY A;  2KJC A;  4YII A;  4A0Y A;  1FYK A;  1R1U A;  3F23 A;  4Y13 A;  2Z33 A;  4FX4 A;  3H3U A;  4JQF A;  5ICF A;  5LEJ A;  2MH9 A;  2VT2 A;  4B8X A;  3GW2 A;  2O61 A;  2RQP A;  4ZYH A;  3HTU A;  2YX7 A;  1S7A A;  2PLY A;  2DBB A;  3N97 A;  2KRF A;  3P9C A;  3TO7 A;  2FA5 A;  2MBF A;  2LSO A;  4IXA A;  4WK8 F;  3GFI A;  2HWV A;  1B6A A;  4BXU A;  3KEQ A;  2XRN A;  2XAQ A;  4EM2 A;  3KLO A;  4KIC A;  3CO6 C;  2MD5 A;  3HSF A;  2YX4 A;  4EJW A;  2QQA A;  2W85 A;  1R7J A;  4IRH A;  2JTV A;  1FOK A;  1DDN A;  5L3C A;  1IRF A;  1HXD A;  5HLG A;  2FNA A;  1UST A;  5JI6 A;  5FO5 A;  4KMU X;  4RGU A;  4H0E A;  2RVC A;  3PFI A;  5FD6 A;  2EV5 A;  3T0Y A;  3WE3 A;  2DQL A;  4OIR F;  5E8G A;  2P7V B;  3R0J A;  4HDU A;  3BJA A;  2HQR A;  5LGT A;  1HKT A;  2K27 A;  2XAG A;  3K69 A;  3KP6 A;  1KA8 A;  4RB2 C;  3HUG A;  3V7R A;  4D0P A;  3QP5 A;  3F3X A;  3L9F A;  2XAF A;  1XGM A;  4YIF A;  1BN5 A;  5K1Y A;  1U6G A;  2QLZ A;  2P5L C;  4AWX B;  2BEO A;  4IJA A;  1KU9 A;  4KMF A;  1SMT A;  3C7J A;  4ENJ A;  4I7H A;  5CVJ A;  5ILS A;  5L3F A;  2NNN A;  2QBY A;  3DFG A;  3RJP A;  1TTY A;  1FYL A;  4A5M A;  5HS9 A;  2G9W A;  5H6Q A;  3ZQ7 A;  3QU6 A;  2UZK A;  4ENN A;  5K5O A;  4WWC A;  2G7H A;  1D8K A;  5E8I A;  1EV7 A;  3CDH A;  3WU1 B;  2OAZ A;  1TQM A;  1BIB A;  5AIP A;  5E1Z B;  1L0O C;  4MQV A;  3EQL F;  5ED4 A;  3I58 A;  4M71 A;  1SMY F;  1I5Z A;  4HLX A;  3JTG A;  3V7S A;  2VC1 A;  2EFW A;  1BM9 A;  4M9S A;  1K7A A;  3F22 A;  2O03 A;  2OA4 A;  1R1V A;  1TLH B;  3M8E A;  3REO A;  1ODD A;  2NAZ A;  4I98 B;  2DPU A;  2XIG A;  2Y75 A;  2GXB A;  3RKW A;  2FML A;  3LFK A;  1LVA A;  4QWQ A;  5JVT A;  2PJP A;  3I0T A;  1P92 A;  3DKW A;  1S8N A;  4UVC A;  5L3D A;  1EH7 A;  3ZMV A;  1BI3 A;  2LDU A;  1ZAO A;  4ZH4 F;  2KIM A;  1CF7 B;  1IXS B;  2L54 A;  3KP3 A;  2JSC A;  1ZRC A;  1FSH A;  3I59 A;  4RAZ A;  1LQ1 A;  5H6R A;  3WGH A;  4RB0 A;  1B4A A;  3ISP A;  2GA1 A;  4ON0 A;  3K1P A;  4ESF A;  2RV8 A;  4A0Z A;  4HQM A;  5D5W B;  2P8T A;  5E1X A;  3B02 A;  2Y48 A;  4KIG A;  3ML6 A;  3NQO A;  5D6E A;  1UHM A;  2CGP A;  1LEA A;  3FM3 A;  3WTW C;  2XGX A;  4I0A A;  2ETH A;  2GXG A;  3BOQ A;  4M6X A;  1F4K A;  3FF5 A;  3JW4 A;  1MDM A;  1ZLK A;  1HW2 A;  4LG0 A;  3TDZ C;  2MC3 A;  3GZ5 A;  4IHT A;  2DK8 A;  4LLG F;  3TOB A;  1QGP A;  4HX8 A;  5HLH A;  2P5V A;  2L01 A;  3E5X A;  1G4D A;  1TNS A;  2O3F A;  5EEG A;  1YYV A;  5CVR A;  3O6B B;  1I1S A;  3WTS C;  2VE9 A;  1LJ9 A;  4HZF A;  2W57 A;  1DP7 P;  2FU4 A;  3U2R A;  4HF0 A;  4GCV A;  1R58 A;  4PCQ A;  3T1B A;  3DQV C;  1WWX A;  3QU3 A;  1QPM A;  1XCV A;  1REP C;  2F2E A;  1YW9 A;  1Z6R A;  3BWG A;  1P2F A;  4LGW A;  4A6E A;  1YTY A;  2FSW A;  1GXQ A;  1B9M A;  3HSR A;  1O7L A;  2LF7 A;  2QQB A;  1STZ A;  2JZY A;  1B9N A;  5DCF A;  4HLY A;  2D2W A;  3BZ6 A;  4LB6 B;  1XDU A;  2W25 A;  1BI1 A;  4Y17 A;  1T0F A;  5HLI A;  1YQA A;  1KU3 A;  2GIV A;  3GO5 A;  1W7P D;  4I0B A;  4ZZL A;  5HOO A;  1G6N A;  2A6H F;  3BY6 A;  1MKM A;  4Q47 A;  5FFX A;  1BI0 A;  3QP6 A;  2XRO A;  2LF8 A;  5L3G A;  2A69 F;  2V1D A;  1I27 A;  3K2Z A;  2IP2 A;  1YO5 C;  2LKP A;  3WTV C;  3GLX A;  4M9X A;  3I5U A;  4P55 A;  3LAP A;  4Q48 A;  2DO7 A;  2F5E A;  1TBX A;  3JAM K;  2F5C A;  2XAH A;  3FM5 A;  3R6S A;  4DNC A;  3L2C A;  2G7U A;  3RTR A;  5KK1 A;  1J2X A;  5AON A;  3E97 A;  2KIF A;  2CYY A;  3PQJ A;  4S04 A;  3T8R A;  4M9Z A;  4NQW A;  1VTN C;  4RGX A;  3MEX A;  1QZZ A;  1W4M A;  5FGM A;  3J80 K;  2XV4 S;  2XKP A;  3CUO A;  1LDJ A;  1AWC A;  2Z9O A;  2VN2 A;  3ROU A;  2FRH A;  4PZJ A;  4CO8 A;  3HRS A;  1U5T B;  2ZXJ A;  4KFC A;  2ZME B;  2V9V A;  4UVA A;  3TOA A;  1FBU A;  3BJ6 A;  2PEX A;  2NYX A;  1J75 A;  5E20 A;  2O0Y A;  4KIF A;  4ETS A;  1O3S A;  3U1D A;  2VBY A;  4PDK A;  3E5Q A;  4MNU A;  1WQ2 A;  3RI4 A;  5LRR A;  1LB2 A;  2ESH A;  3ECH A;  4MGR A;  3V7C A;  2PBI A;  2X4H A;  1OYI A;  4GXO A;  2PMU A;  2TDX A;  4ZYD A;  3DPT A;  1P4W A;  2BGC A;  2BE5 F;  2ACJ A;  4CIC A;  4L5I A;  4LD5 A;  2JPC A;  3I64 A;  4HX7 A;  4OIO F;  2JT1 A;  1FBQ A;  2HZT A;  3DPL C;  4GO1 A;  4LB5 A;  3W6K B;  2DPD A;  2RGV A;  1KQ0 A;  3ABU A;  4WXH A;  1KYW A;  3LQQ A;  2PN6 A;  2IRF G;  2X0L A;  5KVR A;  5F1R A;  1MGT A;  1ZRD A;  5LHI A;  3CUQ B;  2VXZ A;  4B09 A;  3KZZ A;  2Z5U A;  3CJN A;  4A6D A;  3TQN A;  2V1U A;  5BMZ A;  3P9I A;  3K1N A;  5DUI A;  5CJ9 A;  5E17 F;  3GEZ A;  2OD5 A;  1R36 A;  4MQ9 F;  4Q5S F;  1XB4 A;  4HDV A;  3N4M A;  1SFX A;  4DQ2 A;  1R5H A;  5D5U B;  4KDP A;  1G3S A;  3GF2 A;  4LMY A;  2O8X A;  3JAM Z;  3COA C;  1FPQ A;  2V1X A;  3Q9S A;  3F8N A;  1XMA A;  3LA7 A;  4L9J A;  3ECO A;  1DPU A;  1ZAR A;  2Q0O A;  4HV6 A;  2EFQ A;  1W5S A;  3J80 Z;  2FBK A;  4KN7 X;  2HEO A;  4HV5 A;  3IHU A;  2W84 A;  2D45 A;  3V8J A;  2ZO4 A;  1OKR A;  4OU0 A;  3JSO A;  2E7W A;  1Z6T A;  3M8F A;  3VOE A;  3GX4 X;  2KKO A;  3RKX A;  2P4W A;  5IT3 A;  3KLN A;  4I2O A;  4QLC U;  1ON2 A;  3WTZ A;  4U7D A;  1OPC A;  3M7G A;  1F9N A;  2EA4 A;  2FBH A;  4WXD A;  1IRG A;  2FQ3 A;  3L00 A;  4OIP F;  3RIR A;  2QVO A;  1IZ1 A;  2E7X A;  1OMI A;  1W5T A;  4JBA A;  5DD8 A;  4A0X A;  2V79 A;  3T8T A;  2RNJ A;  3RPU A;  1IN7 A;  3IWF A;  1ZH5 A;  1HST A;  3H3Z A;  1BJA A;  3QOP A;  5CVU A;  4F7Z A;  2RN7 A;  3F6O A;  3MZY A;  2O6G E;  2CWE A;  1SFU A;  2P7C B;  3FWE A;  2K4B A;  2PMH A;  1ZHF A;  1E17 A;  4JK1 X;  4U0V A;  1XD7 A;  5JHU A;  2DTR A;  3HIF A;  3RKY A;  3I71 A;  2VOP A;  2VOD A;  3WGI A;  3HOS A;  2NRA C;  3M9A A;  2Z99 A;  5LGU A;  2XKO A;  4MEX F;  1XSV A;  3ZN1 A;  3MQ0 A;  2MLG A;  4EM0 B;  4HAM A;  4UV8 A;  2R7D A;  4M72 A;  3S2W A;  2VBW A;  3QPT A;  4L5J A;  4XLP F;  2XAS A;  3BJO A;  2A68 F;  1HQC A;  4Q4Z F;  4LK1 F;  1XMK A;  4M6Y A;  4EM1 A;  2OZ6 A;  3JSP A;  1PDN C;  1AOY A;  2FNP A;  3PQK A;  1O3R A;  2V6C A;  1I1G A;  1B59 A;  1S6L A;  2YSR A;  6PAX A;  1BIA A;  3TO9 A;  1G3W A;  1Z91 A;  5CVI A;  2Y0M A;  2AS5 F;  1YIO A;  3QAH A;  1Z05 A;  2KIU A;  3V8K A;  1RUO A;  2HYG D;  5BS6 A;  5AIQ A;  3HOT A;  2HTJ A;  3ZMU A;  4EJT A;  3QRF F;  3EDP A;  2GWR A;  5EEH A;  1S7O A;  1DUX C;  5TJJ A;  2Q2E A;  1HW1 A;  4BAY A;  1T6S A;  1IXC A;  1ZG3 A;  4EVI A;  5K5R A;  4N0B A;  3U9G A;  1YS7 A;  4BNC A;  2QZ8 A;  3LWF A;  3WE2 A;  4G8X A;  3MZH A;  3IWZ A;  4O6J A;  5LHH A;  3HHG A;  2YR2 A;  4OMY A;  5H20 A;  2EB7 A;  3KET A;  2EA2 A;  3ERE D;  1TW2 A;  1FT9 A;  3DV8 A;  4EV0 A;  3P9K A;  1UFM A;  4PGG A;  4MTD A;  4BH9 A;  3I53 A;  1MZB A;  1MJ9 A;  4HYE A;  3D5L A;  2FOK A;  3B73 A;  1WKM A;  3MAJ A;  3KP4 A;  4KN4 X;  5E18 F;  4TV7 A;  1F5T A;  5FFZ A;  3MWM A;  2HYF A;  3SQN A;  4LLN A;  2L02 A;  5ICC A;  5DUK A;  4R1H A;  4RGS A;  3EET A;  4XRF A;  1K79 A;  3ZN0 A;  1IN4 A;  3EUH A;  1MDM B;  2OQR A;  1ZGA A;  4G7Z F;  1FLI A;  2P5K A;  4G9Y A;  4LG0 B;  1YLF A;  3I54 A;  3K0L A;  5FD5 A;  2H09 A;  1QQI A;  1CGP A;  2R7F A;  1KU2 A;  4KUM A;  4ESJ A;  3KCC A;  3HHH A;  1V3F A;  1F1Z A;  2FXA A;  1IN8 A;  2WWY A;  4XLN F;  1SD7 A;  4U7B A;  5D4S A;  4LLL A;  2OZU A;  3H92 A;  4IF4 A;  4RB1 A;  1BOA A;  2FBI A;  1KQ8 A;  4HX4 A;  3NEU A;  2EWN A;  2MH2 A;  3WTX C;  3M1E A;  1T38 A;  2M45 A;  2ESN A;  5F6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...