3ECTA

Crystal structure of the hexapeptide-repeat containing-acetyltransferase vca0836 from vibrio cholerae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
176
Chain Sequence
LEKMLKGHASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hexapeptide-Repeat Containing-Acetyltransferase VCA0836 from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Transferase
molecule keywords Hexapeptide-repeat containing-acetyltransferase
total genus 60
structure length 176
sequence length 180
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ectA00
4E1KA 3P1BA 4E6TA 2OEFA 3NZ2A 3TDTA 1KGQA 4HCQA 3I3AA 5ADXU 1THJA 3BSWA 3SPTA 2OI7A 3SRTA 3R5CA 1QQ0A 4EA9A 1OCXA 3R5AA 3DJ4A 4EAAA 2VHEA 1LXAA 3MQHA 3OUPA 1FWYA 4N6BA 3Q1XA 4R37A 1YP4A 1G95A 2GGOA 3KWCA 3R8YA 4G3QA 4AA7A 1SSTA 2WLFA 3BXYA 3D8VA 3IGJA 3PMOA 4G87A 4M99A 1T3DA 1S80A 2QIAA 2ICXA 3V4EA 4EA7A 4M2BA 4HZDA 1TDTA 1QRFA 4MFGA 5DG3A 3HSQA 1G97A 3DHOA 4M28A 4KQLA 2W0WA 3P47A 1V3WA 2V0JA 4HZCA 5E3QA 4EGGA 4EA8A 1XHDA 2IU8A 3BRKX 3FSCA 2WLGA 4IHHA 4KNXA 4M98A 5L6VA 3VBPA 3MC4A 2V0IA 3VBJA 3FWWA 3OTMA 4KNRA 3KWEA 4G3SA 1MR9A 3MQGA 3TISA 4DCLA 3R0SA 3DK5A 3KWDA 2OI5A 1QRLA 3ECTA 4EQYA 1FXJA 2QIVX 4FCEA 4ISXA 4N69A 3VBNA 3FSXA 3TV0A 2JF3A 4HURA 4MYOA 2JF2A 1QREA 3TIOA 2IUAA 3ST8A 2IC7A 3I3XA 1KHRA 2QKXA 1MR7A 2OEGA 1QRGA 2NPOA 4M2AA 4N27A 4E75A 3FSBA 3FSYA 5DEMA 4J18A 3VNPA 2ICYA 4KPXA 3OTZA 1HM9A 4AAWA 5ADXV 5U2KA 3FTTA 3JQYA 3VBMA 1KK4A 1KRVA 2V0KA 3EEVA 5E3RA 4E6UA 1KRRA 4E79A 1QRMA 4EABA 4M9CA 1KRUA 4R36A 4AC3A 3GOSA 2W0VA 4N6AA 3F1XA 2AQ9A 3GVDA 3FOQA 3R1WA 2I5KA 3TK8A 1V67A 3R3IA 4MZUA 3EG4A 1SSQA 2WLCA 2WLDA 3CJ8A 3HJJA 5E3PA 3VBLA 1YP2A 2V0HA 2OI6A 2P2OA 4IHGA 3R5DA 2FKOA 4H7OA 4HUSA 5DEPA 3BFPA 3OU9A 5AFUU 4G3PA 4IHFA 5L6SA 3T57A 3GUEA 3C8VA 1MRLA 5F42A 2WLEA 2GGQA 2Q4JA 1XATA 3R3RA 1KGTA 2RIJA 3R5BA 4J09A 1YP3A 3EH0A 3TWDA 1Z90A 2TDTA 3OW5A 5AFUV 1HV9A 3IXCA 1HM8A 1KK6A 1KQAA 2XATA 1HM0A 3BSYA 3FS8A 1SSMA 3VBKA 4KPZA 2V0LA 3VBIA 4K6RA 3R2WA 1KK5A 3D98A 2VD4A 3BSSA 2IU9A 1J2ZA 4R7PA
chains in the Genus database with same CATH superfamily
4E1KA 3P1BA 1L0SA 4E6TA 2OEFA 3NZ2A 3TDTA 1KGQA 4HCQA 3I3AA 5ADXU 1THJA 3BSWA 3SPTA 2OI7A 3SRTA 3OGZA 3R5CA 1QQ0A 4EA9A 1OCXA 3R5AA 3DJ4A 4EAAA 2VHEA 1LXAA 3MQHA 3OUPA 1FWYA 4N6BA 3Q1XA 4R37A 1YP4A 1G95A 2GGOA 3KWCA 3R8YA 4G3QA 4AA7A 1SSTA 2WLFA 3BXYA 3D8VA 3IGJA 3PMOA 4G87A 4M99A 1T3DA 1S80A 2QIAA 2ICXA 3V4EA 4EA7A 4M2BA 4HZDA 3OH3A 1TDTA 3OH4A 1N4IA 1QRFA 4MFGA 5DG3A 3HSQA 1G97A 3DHOA 4M28A 4KQLA 2W0WA 3P47A 3OH1A 1V3WA 2V0JA 3GQAA 4HZCA 5E3QA 4EGGA 4EA8A 1XHDA 2IU8A 3BRKX 3FSCA 2WLGA 4IHHA 4KNXA 4M98A 5L6VA 3VBPA 3MC4A 2V0IA 3VBJA 3FWWA 3OTMA 4KNRA 3KWEA 4G3SA 1MR9A 3MQGA 3TISA 4DCLA 3R0SA 3DK5A 3KWDA 2OI5A 1QRLA 3ECTA 4EQYA 1FXJA 2QIVX 4FCEA 4ISXA 4N69A 3VBNA 3FSXA 3TV0A 2JF3A 4HURA 4MYOA 2JF2A 1QREA 3TIOA 2IUAA 3ST8A 2IC7A 3I3XA 1KHRA 2QKXA 1MR7A 2OEGA 1QRGA 2NPOA 4M2AA 4N27A 4E75A 3FSBA 3FSYA 5DEMA 4J18A 3VNPA 2ICYA 4KPXA 3OTZA 1HM9A 4AAWA 5ADXV 5U2KA 3FTTA 3JQYA 3VBMA 1KK4A 1KRVA 2V0KA 3EEVA 5E3RA 4E6UA 1KRRA 4E79A 1QRMA 4EABA 4M9CA 1KRUA 4R36A 4AC3A 3GOSA 2W0VA 3OH0A 3GQ9A 4N6AA 1M8NA 3F1XA 2AQ9A 3GVDA 3FOQA 3R1WA 2I5KA 3TK8A 1V67A 3R3IA 4MZUA 3EG4A 1SSQA 2WLCA 2WLDA 3CJ8A 3GQ8A 3HJJA 5E3PA 3VBLA 1YP2A 3SUCA 2V0HA 2OI6A 2P2OA 3OH2A 1Z2FA 3R5DA 2FKOA 4H7OA 4HUSA 4IHGA 5DEPA 3BFPA 3OU9A 5AFUU 3GQ7A 4G3PA 4IHFA 5L6SA 3T57A 3GUEA 3C8VA 1MRLA 5F42A 2WLEA 2GGQA 2Q4JA 1XATA 3R3RA 1KGTA 2RIJA 1EWWA 3R5BA 4J09A 1YP3A 3EH0A 3TWDA 1Z90A 2TDTA 3OW5A 5AFUV 1HV9A 3IXCA 1HM8A 1KK6A 1KQAA 2XATA 1HM0A 3BSYA 3FS8A 1SSMA 3VBKA 4KPZA 2V0LA 3VBIA 4K6RA 3R2WA 1KK5A 3D98A 2VD4A 3BSSA 2IU9A 1J2ZA 4R7PA
chains in the Genus database with same CATH topology
4E1KA 3P1BA 4E6TA 2OEFA 3NZ2A 3TDTA 1KGQA 4HCQA 3I3AA 5ADXU 1THJA 3BSWA 3SPTA 2OI7A 3SRTA 3R5CA 1QQ0A 4EA9A 1OCXA 3R5AA 3DJ4A 4EAAA 2VHEA 1LXAA 3MQHA 3OUPA 1FWYA 4N6BA 3Q1XA 4R37A 1YP4A 1G95A 2GGOA 3KWCA 3R8YA 4G3QA 4AA7A 1SSTA 2WLFA 3BXYA 3D8VA 3IGJA 3PMOA 4G87A 4M99A 1T3DA 1S80A 2QIAA 2ICXA 3V4EA 4EA7A 4M2BA 4HZDA 1TDTA 1QRFA 4MFGA 5DG3A 3HSQA 1G97A 3DHOA 4M28A 4KQLA 2W0WA 3P47A 1V3WA 2V0JA 4HZCA 5E3QA 4EGGA 4EA8A 1XHDA 2IU8A 3BRKX 3FSCA 2WLGA 4IHHA 4KNXA 4M98A 5L6VA 3VBPA 3MC4A 2V0IA 3VBJA 3FWWA 3OTMA 4KNRA 3KWEA 4G3SA 1MR9A 3MQGA 3TISA 4DCLA 3R0SA 3DK5A 3KWDA 2OI5A 1QRLA 3ECTA 4EQYA 1FXJA 2QIVX 4FCEA 4ISXA 4N69A 3VBNA 3FSXA 3TV0A 2JF3A 4HURA 4MYOA 2JF2A 1QREA 3TIOA 2IUAA 3ST8A 2IC7A 3I3XA 1KHRA 2QKXA 1MR7A 2OEGA 1QRGA 2NPOA 4M2AA 4N27A 4E75A 3FSBA 3FSYA 5DEMA 4J18A 3VNPA 2ICYA 4KPXA 3OTZA 1HM9A 4AAWA 5ADXV 5U2KA 3FTTA 3JQYA 3VBMA 1KK4A 1KRVA 2V0KA 3EEVA 5E3RA 4E6UA 1KRRA 4E79A 1QRMA 4EABA 4M9CA 1KRUA 4R36A 4AC3A 3GOSA 2W0VA 4N6AA 3F1XA 2AQ9A 3GVDA 3FOQA 3R1WA 2I5KA 3TK8A 1V67A 3R3IA 4MZUA 3EG4A 1SSQA 2WLCA 2WLDA 3CJ8A 3HJJA 5E3PA 3VBLA 1YP2A 2V0HA 2OI6A 2P2OA 4IHGA 3R5DA 2FKOA 4H7OA 4HUSA 5DEPA 3BFPA 3OU9A 5AFUU 4G3PA 4IHFA 5L6SA 3T57A 3GUEA 3C8VA 1MRLA 5F42A 2WLEA 2GGQA 2Q4JA 1XATA 3R3RA 1KGTA 2RIJA 3R5BA 4J09A 1YP3A 3EH0A 3TWDA 1Z90A 2TDTA 3OW5A 5AFUV 1HV9A 3IXCA 1HM8A 1KK6A 1KQAA 2XATA 1HM0A 3BSYA 3FS8A 1SSMA 3VBKA 4KPZA 2V0LA 3VBIA 4K6RA 3R2WA 1KK5A 3D98A 2VD4A 3BSSA 2IU9A 1J2ZA 4R7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1K A;  3P1B A;  4E6T A;  2OEF A;  3NZ2 A;  3TDT A;  1KGQ A;  4HCQ A;  3I3A A;  5ADX U;  1THJ A;  3BSW A;  3SPT A;  2OI7 A;  3SRT A;  3R5C A;  1QQ0 A;  4EA9 A;  1OCX A;  3R5A A;  3DJ4 A;  4EAA A;  2VHE A;  1LXA A;  3MQH A;  3OUP A;  1FWY A;  4N6B A;  3Q1X A;  4R37 A;  1YP4 A;  1G95 A;  2GGO A;  3KWC A;  3R8Y A;  4G3Q A;  4AA7 A;  1SST A;  2WLF A;  3BXY A;  3D8V A;  3IGJ A;  3PMO A;  4G87 A;  4M99 A;  1T3D A;  1S80 A;  2QIA A;  2ICX A;  3V4E A;  4EA7 A;  4M2B A;  4HZD A;  1TDT A;  1QRF A;  4MFG A;  5DG3 A;  3HSQ A;  1G97 A;  3DHO A;  4M28 A;  4KQL A;  2W0W A;  3P47 A;  1V3W A;  2V0J A;  4HZC A;  5E3Q A;  4EGG A;  4EA8 A;  1XHD A;  2IU8 A;  3BRK X;  3FSC A;  2WLG A;  4IHH A;  4KNX A;  4M98 A;  5L6V A;  3VBP A;  3MC4 A;  2V0I A;  3VBJ A;  3FWW A;  3OTM A;  4KNR A;  3KWE A;  4G3S A;  1MR9 A;  3MQG A;  3TIS A;  4DCL A;  3R0S A;  3DK5 A;  3KWD A;  2OI5 A;  1QRL A;  3ECT A;  4EQY A;  1FXJ A;  2QIV X;  4FCE A;  4ISX A;  4N69 A;  3VBN A;  3FSX A;  3TV0 A;  2JF3 A;  4HUR A;  4MYO A;  2JF2 A;  1QRE A;  3TIO A;  2IUA A;  3ST8 A;  2IC7 A;  3I3X A;  1KHR A;  2QKX A;  1MR7 A;  2OEG A;  1QRG A;  2NPO A;  4M2A A;  4N27 A;  4E75 A;  3FSB A;  3FSY A;  5DEM A;  4J18 A;  3VNP A;  2ICY A;  4KPX A;  3OTZ A;  1HM9 A;  4AAW A;  5ADX V;  5U2K A;  3FTT A;  3JQY A;  3VBM A;  1KK4 A;  1KRV A;  2V0K A;  3EEV A;  5E3R A;  4E6U A;  1KRR A;  4E79 A;  1QRM A;  4EAB A;  4M9C A;  1KRU A;  4R36 A;  4AC3 A;  3GOS A;  2W0V A;  4N6A A;  3F1X A;  2AQ9 A;  3GVD A;  3FOQ A;  3R1W A;  2I5K A;  3TK8 A;  1V67 A;  3R3I A;  4MZU A;  3EG4 A;  1SSQ A;  2WLC A;  2WLD A;  3CJ8 A;  3HJJ A;  5E3P A;  3VBL A;  1YP2 A;  2V0H A;  2OI6 A;  2P2O A;  4IHG A;  3R5D A;  2FKO A;  4H7O A;  4HUS A;  5DEP A;  3BFP A;  3OU9 A;  5AFU U;  4G3P A;  4IHF A;  5L6S A;  3T57 A;  3GUE A;  3C8V A;  1MRL A;  5F42 A;  2WLE A;  2GGQ A;  2Q4J A;  1XAT A;  3R3R A;  1KGT A;  2RIJ A;  3R5B A;  4J09 A;  1YP3 A;  3EH0 A;  3TWD A;  1Z90 A;  2TDT A;  3OW5 A;  5AFU V;  1HV9 A;  3IXC A;  1HM8 A;  1KK6 A;  1KQA A;  2XAT A;  1HM0 A;  3BSY A;  3FS8 A;  1SSM A;  3VBK A;  4KPZ A;  2V0L A;  3VBI A;  4K6R A;  3R2W A;  1KK5 A;  3D98 A;  2VD4 A;  3BSS A;  2IU9 A;  1J2Z A;  4R7P A; 
#chains in the Genus database with same CATH topology
 4E1K A;  3P1B A;  1L0S A;  4E6T A;  2OEF A;  3NZ2 A;  3TDT A;  1KGQ A;  4HCQ A;  3I3A A;  5ADX U;  1THJ A;  3BSW A;  3SPT A;  2OI7 A;  3SRT A;  3OGZ A;  3R5C A;  1QQ0 A;  4EA9 A;  1OCX A;  3R5A A;  3DJ4 A;  4EAA A;  2VHE A;  1LXA A;  3MQH A;  3OUP A;  1FWY A;  4N6B A;  3Q1X A;  4R37 A;  1YP4 A;  1G95 A;  2GGO A;  3KWC A;  3R8Y A;  4G3Q A;  4AA7 A;  1SST A;  2WLF A;  3BXY A;  3D8V A;  3IGJ A;  3PMO A;  4G87 A;  4M99 A;  1T3D A;  1S80 A;  2QIA A;  2ICX A;  3V4E A;  4EA7 A;  4M2B A;  4HZD A;  3OH3 A;  1TDT A;  3OH4 A;  1N4I A;  1QRF A;  4MFG A;  5DG3 A;  3HSQ A;  1G97 A;  3DHO A;  4M28 A;  4KQL A;  2W0W A;  3P47 A;  3OH1 A;  1V3W A;  2V0J A;  3GQA A;  4HZC A;  5E3Q A;  4EGG A;  4EA8 A;  1XHD A;  2IU8 A;  3BRK X;  3FSC A;  2WLG A;  4IHH A;  4KNX A;  4M98 A;  5L6V A;  3VBP A;  3MC4 A;  2V0I A;  3VBJ A;  3FWW A;  3OTM A;  4KNR A;  3KWE A;  4G3S A;  1MR9 A;  3MQG A;  3TIS A;  4DCL A;  3R0S A;  3DK5 A;  3KWD A;  2OI5 A;  1QRL A;  3ECT A;  4EQY A;  1FXJ A;  2QIV X;  4FCE A;  4ISX A;  4N69 A;  3VBN A;  3FSX A;  3TV0 A;  2JF3 A;  4HUR A;  4MYO A;  2JF2 A;  1QRE A;  3TIO A;  2IUA A;  3ST8 A;  2IC7 A;  3I3X A;  1KHR A;  2QKX A;  1MR7 A;  2OEG A;  1QRG A;  2NPO A;  4M2A A;  4N27 A;  4E75 A;  3FSB A;  3FSY A;  5DEM A;  4J18 A;  3VNP A;  2ICY A;  4KPX A;  3OTZ A;  1HM9 A;  4AAW A;  5ADX V;  5U2K A;  3FTT A;  3JQY A;  3VBM A;  1KK4 A;  1KRV A;  2V0K A;  3EEV A;  5E3R A;  4E6U A;  1KRR A;  4E79 A;  1QRM A;  4EAB A;  4M9C A;  1KRU A;  4R36 A;  4AC3 A;  3GOS A;  2W0V A;  3OH0 A;  3GQ9 A;  4N6A A;  1M8N A;  3F1X A;  2AQ9 A;  3GVD A;  3FOQ A;  3R1W A;  2I5K A;  3TK8 A;  1V67 A;  3R3I A;  4MZU A;  3EG4 A;  1SSQ A;  2WLC A;  2WLD A;  3CJ8 A;  3GQ8 A;  3HJJ A;  5E3P A;  3VBL A;  1YP2 A;  3SUC A;  2V0H A;  2OI6 A;  2P2O A;  3OH2 A;  1Z2F A;  3R5D A;  2FKO A;  4H7O A;  4HUS A;  4IHG A;  5DEP A;  3BFP A;  3OU9 A;  5AFU U;  3GQ7 A;  4G3P A;  4IHF A;  5L6S A;  3T57 A;  3GUE A;  3C8V A;  1MRL A;  5F42 A;  2WLE A;  2GGQ A;  2Q4J A;  1XAT A;  3R3R A;  1KGT A;  2RIJ A;  1EWW A;  3R5B A;  4J09 A;  1YP3 A;  3EH0 A;  3TWD A;  1Z90 A;  2TDT A;  3OW5 A;  5AFU V;  1HV9 A;  3IXC A;  1HM8 A;  1KK6 A;  1KQA A;  2XAT A;  1HM0 A;  3BSY A;  3FS8 A;  1SSM A;  3VBK A;  4KPZ A;  2V0L A;  3VBI A;  4K6R A;  3R2W A;  1KK5 A;  3D98 A;  2VD4 A;  3BSS A;  2IU9 A;  1J2Z A;  4R7P A; 
#chains in the Genus database with same CATH homology
 4E1K A;  3P1B A;  4E6T A;  2OEF A;  3NZ2 A;  3TDT A;  1KGQ A;  4HCQ A;  3I3A A;  5ADX U;  1THJ A;  3BSW A;  3SPT A;  2OI7 A;  3SRT A;  3R5C A;  1QQ0 A;  4EA9 A;  1OCX A;  3R5A A;  3DJ4 A;  4EAA A;  2VHE A;  1LXA A;  3MQH A;  3OUP A;  1FWY A;  4N6B A;  3Q1X A;  4R37 A;  1YP4 A;  1G95 A;  2GGO A;  3KWC A;  3R8Y A;  4G3Q A;  4AA7 A;  1SST A;  2WLF A;  3BXY A;  3D8V A;  3IGJ A;  3PMO A;  4G87 A;  4M99 A;  1T3D A;  1S80 A;  2QIA A;  2ICX A;  3V4E A;  4EA7 A;  4M2B A;  4HZD A;  1TDT A;  1QRF A;  4MFG A;  5DG3 A;  3HSQ A;  1G97 A;  3DHO A;  4M28 A;  4KQL A;  2W0W A;  3P47 A;  1V3W A;  2V0J A;  4HZC A;  5E3Q A;  4EGG A;  4EA8 A;  1XHD A;  2IU8 A;  3BRK X;  3FSC A;  2WLG A;  4IHH A;  4KNX A;  4M98 A;  5L6V A;  3VBP A;  3MC4 A;  2V0I A;  3VBJ A;  3FWW A;  3OTM A;  4KNR A;  3KWE A;  4G3S A;  1MR9 A;  3MQG A;  3TIS A;  4DCL A;  3R0S A;  3DK5 A;  3KWD A;  2OI5 A;  1QRL A;  3ECT A;  4EQY A;  1FXJ A;  2QIV X;  4FCE A;  4ISX A;  4N69 A;  3VBN A;  3FSX A;  3TV0 A;  2JF3 A;  4HUR A;  4MYO A;  2JF2 A;  1QRE A;  3TIO A;  2IUA A;  3ST8 A;  2IC7 A;  3I3X A;  1KHR A;  2QKX A;  1MR7 A;  2OEG A;  1QRG A;  2NPO A;  4M2A A;  4N27 A;  4E75 A;  3FSB A;  3FSY A;  5DEM A;  4J18 A;  3VNP A;  2ICY A;  4KPX A;  3OTZ A;  1HM9 A;  4AAW A;  5ADX V;  5U2K A;  3FTT A;  3JQY A;  3VBM A;  1KK4 A;  1KRV A;  2V0K A;  3EEV A;  5E3R A;  4E6U A;  1KRR A;  4E79 A;  1QRM A;  4EAB A;  4M9C A;  1KRU A;  4R36 A;  4AC3 A;  3GOS A;  2W0V A;  4N6A A;  3F1X A;  2AQ9 A;  3GVD A;  3FOQ A;  3R1W A;  2I5K A;  3TK8 A;  1V67 A;  3R3I A;  4MZU A;  3EG4 A;  1SSQ A;  2WLC A;  2WLD A;  3CJ8 A;  3HJJ A;  5E3P A;  3VBL A;  1YP2 A;  2V0H A;  2OI6 A;  2P2O A;  4IHG A;  3R5D A;  2FKO A;  4H7O A;  4HUS A;  5DEP A;  3BFP A;  3OU9 A;  5AFU U;  4G3P A;  4IHF A;  5L6S A;  3T57 A;  3GUE A;  3C8V A;  1MRL A;  5F42 A;  2WLE A;  2GGQ A;  2Q4J A;  1XAT A;  3R3R A;  1KGT A;  2RIJ A;  3R5B A;  4J09 A;  1YP3 A;  3EH0 A;  3TWD A;  1Z90 A;  2TDT A;  3OW5 A;  5AFU V;  1HV9 A;  3IXC A;  1HM8 A;  1KK6 A;  1KQA A;  2XAT A;  1HM0 A;  3BSY A;  3FS8 A;  1SSM A;  3VBK A;  4KPZ A;  2V0L A;  3VBI A;  4K6R A;  3R2W A;  1KK5 A;  3D98 A;  2VD4 A;  3BSS A;  2IU9 A;  1J2Z A;  4R7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...