3ECWA

Crystal structure of the als-related pathological mutant t54r of human apo cu,zn superoxide dismutase (sod1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNRAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and dynamic aspects related to oligomerization of apo SOD1 and its mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ecwA00
1JK9B 1SXAA 3S0PA 1SXCA 2APSA 1YAIA 1KMGA 3PU7A 1N18A 3CE1A 1PZSA 2AQNA 1DO5A 2GBVA 2AQSA 1IBFA 3GQFA 2K4WA 1CBJA 1XTLA 2LU5A 2WKOF 3MNDA 2WKOA 2R27A 1XSOA 4A7TA 4N3UA 4MCMA 3K91A 1SXSA 2VR6A 1SXZA 3F7LA 3KH4A 3ECUA 5KBLA 2C9UA 2C9SA 2Z7ZA 4A7UA 3CQPA 1SOSA 1SRDA 1IBBA 1F18A 3RE0A 3KM1A 2WYTA 2Z7WA 1BZOA 2WWNA 2XJLA 4BD4A 4FF9A 1S4IA 4U4IA 1OZTG 3GZPA 1IBDA 3L9YA 3T5WA 1IB5A 3SODB 2WZ6A 2Q2LA 1SPDA 3ECWA 2AEOA 2WZ0A 1HL5A 1Z9PA 1QUPA 3F7KA 2XJKA 4A7GF 4L05A 2AQPA 2AQQA 4A7GA 4OJAA 1YSOA 2NNXA 3GTVA 3KH3A 5KBKA 2ZKWA 2WZ5A 4MCNA 3QQDA 4N3TA 1JCVA 2WWOA 3QQDB 2VR7A 3HOGA 3HFFA 1IBHA 2C9VA 2Z7YA 1DSWA 2ZKXA 2VR8A 3ECVA 4A7VA 1E9OA 2AF2A 1E9OB 3CQQA 3H2PA 1PU0A 1ESOA 1SXNA 1U3NA 2SODB 1SXBA 3MKGA 1OAJA 3KBEA 1PTZA 1RK7A 2Z7UA 1OZUA 3GTTA 4OH2A 1SDAB 5CU9A 2ZKYA 1Z9NA 2JLPA 1E9PA 1OEZW 1E9PB 1EJ8A 3LTVA 3L9EA 1AZVA 1UXLA 2AQRA 3KM2A 1CB4A 1Q0EA 4BCYA 2ZOWA 1L3NA 2GBUA 1YAZA 2JCWA 4A7SA 1B4TA 3H2QA 1N19A 2E46A 2GBTA 5KBMA 4A7QA 1MFMA 2WYZA 1BA9A 2E47A 1F1GA 2AQTA 3GZOA 1B4LA 4BCZA 3GZQA 1F1AA 4B3EA 1HL4A 1TO5A 2V0AA 3HW7A 1SDYA 1E9QA 3KBFA 1XTMA 1E9QB 1COBA 1TO4A 1F1DA 1FUNA 1EQWA 1OALA 1JK9A 1P1VA 1UXMA
chains in the Genus database with same CATH superfamily
1OD9A 5DYFA 2CGRH 2Z4QB 4UQ3B 1ZT1B 4FNSA 1XT5A 5LXVA 1RUAH 2XT1B 3IETA 3NCCB 4Y89A 2VN6A 3IS1X 3ARRA 5MENE 6FABL 1CI3M 5MERB 1XQ4A 3UIZA 3F04A 4AUJA 1MCKA 3C6EA 1AQDB 3UTTD 3AFLA 3L1GA 5JOFA 1B2YA 2KH2B 2Y6SC 4FFZL 4OZFA 2IOIA 4QXVA 25C8H 4TLSA 5D1XD 2F6AA 1KBBA 1RD6A 2YFOA 4J3VA 3RILA 4TULH 1PD1A 3MRPB 1AGCA 1XF3B 2WBJD 3PG2A 3ZJAA 1VERA 4NC1C 4UIMA 2IDQA 2H2PD 4RMTA 2BSEA 4G8FA 1OQOA 4QHNA 1HH9B 5DLMH 1WBXA 1QFUL 2DM2A 9PCYA 1P4BH 3VXRD 4POUB 2WP3T 2ZOLB 4HAGA 5EA0H 4OKVB 4AVIA 4C83A 4E5XA 4EKJA 4GAJH 3HS8A 5C0BB 43C9A 3GPEA 1W0YT 3DECA 4MHHG 3SPJA 1NFDA 1PAMA 1QACA 3P4MA 1G9MC 1GS6X 5EIIB 3ARDC 1FL6B 1VGKB 3QUGA 2DLFH 1YJDH 4AQAB 1YEIL 4XMTA 1Q90A 2R1XA 5I1HL 1BVNT 3MNZB 1AJ7H 2JK5B 3LN5B 3LZRA 1GGYA 4R9HA 5EF1A 1Z9LA 2QKIB 5EH1A 1F4YL 5DD6A 5IROA 3STLA 4M1CC 3C5ZA 3BRGC 1M7DA 4F20A 1OL0A 1D6EA 1MVFA 3S4SB 4CC1A 1MPAL 3DGGA 4NO0A 4PUBL 4WIQA 4PR5B 3B5HA 3GSXA 5GS2D 1OPGH 2G0LA 5A2IH 1T89C 4ZMXA 4ZQKB 5SV4A 3CXDL 1U3NA 1WAEA 4F8QA 1LYQA 4U6XA 3BIBX 5I66A 4KKLD 3QEQB 2BVTA 4HAKA 3EAKA 1MIEH 1L7TH 3GXPA 5CCKH 4D0DA 4FQQB 1BWWA 2VLJD 1CICC 1F58H 3T2LA 5BUAA 2CHNA 3BPOB 1DQLL 3UBGA 2F53D 4DPCX 4BFOA 1WF5A 1P5VA 3QWRD 4F2EA 1SN5A 5G5DA 4FQXB 1S7WB 1EO8H 3CH8A 3KPTA 4P57B 4FFVD 2OTWB 2C1PA 4MQ7A 5EF3A 1QSFA 3P0YL 3IU3A 1J8RA 2QADB 4FQCH 1NBYA 5SWQA 3RVUD 1OHQA 3NIGB 3KGRA 4KTEL 3LH9A 4YVUA 3T0EC 4AGQA 3WE6B 4PP1D 2B9AA 1OAKH 1UWEL 1MVUB 4JFFD 2ADYA 1MHCA 4OCLC 4B3EA 4JRYD 4YDNA 2HRPL 4C58B 4M4RB 3SDCA 4R2GC 3PHQA 2X89A 5IB1A 4XO4A 1HOEA 1IFHL 1TNMA 4HEME 1U8HA 1A7BA 2YD5A 1JPGA 1W0WA 2XG5B 1MCHA 4PJEA 3RG1C 1OGSA 1O5DT 3EOAB 1DBML 4JPIB 1CO1A 3DVIA 5CJQL 1L9OA 1HXYA 2LOEA 3CSBA 4YHZH 3US1A 3NZHL 1G6VK 4DKDC 3RKPA 1JF1A 1IX2A 1ITBB 1TQVA 1ZEAH 5M7QA 4Z7OE 2J1KA 4Q6YA 5D2LF 3DXAB 1QNZH 1DVSA 2ZCLL 4Z78A 1K8IB 3TO2A 4LGRB 3E0GA 4PRNA 4NBXB 1Q1JH 5ESVB 3QCVL 2FH6A 4J3OC 1U8IA 1DQDL 5JPNC 5I82A 5AALA 3UMTA 5B3NA 5F6IB 1YA5A 4A38A 3BVUA 3ETBJ 1CVSC 4ADJA 2VDNL 4I1RA 4PJ7A 5FHAL 1ET5A 4P5TA 3BIKA 1MFAH 3CPLA 2ITCA 3EXJA 1HTYA 1SBBA 4QLRA 3QUZC 4DVBB 4L1LA 4Z7OB 4OD3L 1OAUH 3LKPA 4GLRI 3UADA 3ECWA 1UYWL 1GYUA 2WTRA 1A6WH 1QWHA 2IF7A 3GSRA 4BIKA 1RSYA 3LKOA 4JPWH 4W6XB 3QQ9D 5D7LA 3RKDC 4YHLL 5ID0B 5ICYA 1HHHB 2VQ1A 3UPCA 2XWEA 2OSYA 4ALAH 2GC7C 3AREC 1XH3A 2BIIA 1A6VH 3OMZA 4KOBA 4ZMAT 2XPYA 4MYWB 1VLXA 1E6OL 3AS2A 3BCFA 4IJTA 1OGAA 4LRNL 4WRLA 3TESA 4NT6B 4WO4A 3U1SL 3VVWA 4KJWD 1FGNH 2HVKB 1TF4A 3H4FA 4WEEA 4N0RA 1YECH 5I1GL 4LPVA 3LQAC 2H26B 2CDFA 2MPAL 1M7IA 3NCJH 1EXHA 3BQUA 5ILTH 1P7QD 2EEAA 1XB3A 3GYRA 5JQIB 4K7PX 3LEVL 2GTWA 4KXCA 4HEPG 2FEEL 2J5LB 3TN0B 4DEWA 1O6SA 4UI2A 5EU6D 1GTNA 5DMGC 3BP7A 4IIQB 4L8CB 3V6OA 1B0WA 2DYPD 4TUUA 3MV7A 3C2AL 4L8SC 4D9LH 3QAZB 4O02H 4AIZA 4P9HC 2A4ZA 1BBDL 3V7AG 3AITA 4Y4KC 4CADA 2FX9H 1X5YA 1UZGA 2R4RL 2ODHA 3FT4B 3QT2A 4M8RA 1NAMA 4DNLA 2YPVH 5F6HJ 3BUIA 3NFNA 5J12C 5BVJA 4LLUB 1VCBC 1C16B 4OIAA 3TO4D 3CHOA 1F4WH 4O2EB 1J1XL 3N1GC 5GZOC 3G6JA 1EZUA 3QIUB 4ODHL 3TVMB 1TJGH 4GP4B 3K6SA 1DJSA 1E67A 3HRZA 1G7LB 4HCRH 1KJ3L 3ZQ9A 3KJ6L 2GVYA 5CILH 1JZ5A 1RY7B 1LO2H 3F7VA 1ZA6A 1JZIA 4FL4B 2HLAB 1RZ8A 3DRTA 4UDUB 1Y07A 3NJKA 3ZL2A 4LVEA 1Q72H 2YK1L 3FOLA 3NPSC 4MMZC 2F5BH 2ZJSH 2ZWLT 2GIXA 1NMBH 1RMFH 4G8GE 2G5BB 2ESVD 2F58L 4FQ1L 4L3EB 4XP1H 5GRZA 1AGFA 3OMIB 4YZWA 3BI9X 1PKOA 5HI3D 5KBDA 2C9PA 1E0OB 1XD1A 4NPKA 4MA1C 4P46A 5D96B 1CTMA 1NAMH 1Q9WA 2APVA 3TM6A 3VFOB 2DDQH 5DC4B 4JB9L 1MCSA 3TBTA 3KPSA 3MOQA 2D4DA 2ITDA 4RRPM 5C0EB 4KY1H 7FABH 2QKSA 1OM9A 4XOBA 3MTXA 4YHYB 4JG1H 4HGWA 3SE9H 4WFEE 2HMID 4Z3IA 3Q9PA 2Y72A 4A66A 2EVHA 1JD7A 2P8MB 4OCXH 3L5HA 3B37A 2XKSA 2YGVA 4ZTOL 5KS9E 1J12A 1INEL 3ARBD 3MBED 2X1XR 2E7MA 3RWHB 3EJYD 1USZA 1EDHA 1T04A 2Z93A 3MNWA 4FKKA 2BSDA 2QSTA 4YE0A 5FV1L 3CLFH 1EAJA 5F7EL 3M17A 3OV6A 4Y9BA 3T65A 5DT1H 1FZKA 1P5UA 2XLLA 2DI9A 4H8QA 4G42A 1IGJB 4MAYD 4AYFA 1CBVH 2Z9TA 1JAEA 3CVHB 4ZOBA 3DUHA 4HXAL 3SDXA 1FHGA 5GS1A 4U1HA 5IFHL 1KTJA 1RAMA 2JFCA 4ZMZA 4JPSA 5D7JC 3GF8A 4QRAA 4CGTA 2VC2H 5IMLB 5LGYA 5ESAA 3G5VB 4H25A 3U4AA 4JM2A 5GGVL 3GXDA 4HK0B 2CK0L 4DGYL 1MZYA 1LEKB 4E9QA 3TJPA 2J7LA 1F1AA 4UT6L 1CQKA 5IM7B 1X5ZA 4N0YH 5D5MA 4JO3H 5HYJE 1HSBB 1BAWA 4BFJA 3X17A 5FDWA 1BYPA 1A25A 3LRSA 5EV7A 4ZAKC 4HUWB 1N5YH 2LAAA 3NIDB 5JR1H 4NQVB 1NPUA 4NZRH 4WEBH 1GW6A 4KXAA 5KVGE 1BPVA 2J1WA 5KAQG 4PJ9D 5ALBL 1Z3RA 3WELA 1WFNA 4J3OG 1BVOA 4X9FA 2H47C 4GAGL 3UC0H 4EJ1C 3WIIH 3WJLA 5D70L 4UCFA 2DI7A 4HEPA 1E65A 1M6OA 1OGTB 1OK0A 4I9WD 5CUSL 4OSUL 5D2LB 1OVZA 5AWNH 1F2QA 4JFHE 1MCNA 1GGCL 4LLMB 3LAFA 3BZ5A 5HDBF 4JO1L 3MJ9H 5KYNA 4DF9A 2ZAIA 3LIUA 4I7ZC 2X28A 5KUMA 1T83C 4E9XA 4WY7L 4KRPB 1SF5A 5DQ9A 2DH2A 4C47A 4EVNB 4OZGE 1QZ1A 1VCAA 1DBAH 4OF7A 4UZGA 4J3SA 4MX7A 4UMSA 4XCFH 1ZHNA 3O11B 3T8XB 4MDRA 4Q89A 3TV3H 3UTPD 2ISDA 2CR3A 3K8MA 4PRHD 4YPJA 2N59A 4NCDA 5DHDA 5JHLL 1GOFA 4K2UH 1UTDA 4A37A 3P30H 1G9EA 2QSCL 2O26U 3VFVB 1OTSC 1D6VH 3FQTB 2PP8A 1Z3GH 3ENEA 5DD0L 3MACH 4NI3A 4GXFA 2F7QA 3NJHA 4CVZB 1VA9A 3IFPB 3KPMA 4P2YA 4QRUB 5I8OL 1BF5A 5EF2A 1CFSB 5D7EA 5FW7A 4U6YB 3S3DB 3UXFA 1S9YA 2XVLA 1TQSA 1AYOA 1K2DA 2QHLA 3FRUB 4W9GC 3AWFA 2X6AA 5AOLA 3G08B 3ARDA 4WNQB 4D9QD 3GBML 3EYUH 4BK4A 3P9LA 5KVEH 2P5WE 1BZQK 1UA6L 1A4JA 1DJYA 3MYJB 4D0CB 4YBLC 4LEOA 5E9DD 2VIRA 2EVFA 2BNQA 1TJMA 1HESA 1TZIA 2P80A 3DJ9A 4JHBA 5DJ6B 4IS6B 4DKFL 3AXLB 5I0WA 4MA8L 4MTMA 2KQMA 3KWVA 3MN8A 2G3NA 2V9QA 3OKMA 4M6OL 1T89A 4BZ2L 4YXHH 2IPKB 2F54D 5AOMA 1YEDA 3F65A 1Z5YD 5IJBC 3FYIB 2P5WB 5KWYC 4AG4H 2BNRA 1CICA 1NBZB 3O45A 5F3HB 4UT9L 5HI4C 3PU7A 4HF5L 4HKJA 3FB5A 2VH5H 1KV7A 4HCGA 5DZVA 4Z7WF 5F7DA 3NABH 1KTRL 3L3KB 2AXFB 3S34L 2LFEA 3DMMB 1I8KB 1IGCL 2JKNA 1NGPL 3K72A 1JDDA 1K4DB 1R3KA 4IJ3C 3HE7B 3NN8A 3T0EA 4EIGB 3VQ2C 1G9MH 5JPMB 2A9MH 4APXB 1LEGA 2X2YA 4HMDA 5I1DA 2XIDA 4N2CA 1EHXA 1FAIL 1O7SA 4JUTA 5IHHA 4N87A 1DBBH 3TFKC 2O72A 4FQLH 3IXAA 2HKHH 5FECA 2X70B 1JXKA 4BKLA 2BJMH 5CBAA 3X13B 4N8VG 2WWNA 3U25A 3ZQXA 4HDIB 4F3FB 1YEKH 4WWKB 4OJCA 4LOUD 3QULB 4DZ8A 3DETC 5D7SH 3V0AC 2XRAL 3FB6B 2F8IA 2P5EE 3F6IA 3V5HB 1CFMA 5F9WC 5CD3A 4U3XA 2HT4C 1HXKA 3I50H 1PX4A 3GBEA 2F1AA 3VXSB 2N56A 3MCLL 1RP9A 1JVOA 4JQIA 4KHTH 5GGRA 4WU5B 2UVEA 3ALPA 1G7HA 3TS8A 5JPNA 3QQ4B 3OKKA 1A6UL 4LBEA 4O58H 2FX8L 5LDSA 2PCFB 2VQUA 4LHQB 4WTZA 2P5EB 4FOMA 3GIVB 3KDMA 3TBWA 1A3RH 4UV7H 1WVZA 3QUZA 3PP3K 1QSVA 3BWAA 4NDMB 4DT2A 2JCCA 5C0DB 1BYNA 2W0LA 5D1XC 5AFAA 1P53A 5KSAB 4OUOA 2BSCA 3P4OA 2Q3AA 2WBJC 4PJIF 2TAAA 4X4MA 4AL8H 2D8KA 1WDAA 3AREA 3PPSA 4GQRA 4TUOB 3IDXH 5T3ZH 1TQUA 2H2PC 4TM9A 4K5PA 5FYJE 3X11B 1ACZA 3GD1C 5E2JA 2ZCZA 3MRCA 4G8EA 4O5LL 4QWWD 5B1KA 1H8OA 1QRKA 3WHXA 5DTFB 3O8XB 1AG6A 4N2DA 1UM6H 3X3GL 2PO6B 1CCZA 2YD2A 2CRMA 3LQMA 4AQ1B 3HVDA 4M8QA 2NNAA 2YMTA 2EE9A 4Z7IA 2AGJL 2VTFA 4KXZH 1PZ5B 4S1RL 4EZLA 3LXBA 3O6FD 4DGVH 4ONFH 5CLXA 1W8NA 3CHPA 1ZDSA 3RX9A 2WXQA 4JQIH 2FQEA 2EZ0D 5MHSD 2OTPA 1AXSB 4JRXE 4NXSA 4OLZL 4X99B 5HVHB 4UINL 3TT3L 1F5WA 5HDBE 3O4OB 2ZAGA 3U6RA 2H9GA 3NCFB 1H5BB 1FF5A 3QPKA 4L8SA 4YDKH 4Q9QL 3PXLA 3UCRA 4KH2A 4PG9A 2LAGB 1JI2A 2X42A 2XN9E 2CG9X 1FNEB 4Y4KA 4OZHA 1OLLA 5EZPA 1FA4A 4LAQL 5T3XD 2PABA 4KKLC 1GOHA 5E00A 2HX8A 3MJ7A 3MRBA 4JKLA 3OMAB 5F93C 1VFBA 5DURD 4PRIB 4E41D 5MEND 4FABL 3B9KB 4JRXB 5K39A 4TSBH 4I2XA 1UD8A 1S7RB 5HDBB 3EDDA 4PJCF 1FCCA 4IU3A 5F7UA 4C4UA 1HHGB 1CFNB 3NFPA 5GZOA 4FFVC 5EZIL 4LCCC 1MFEL 3NCEB 4G80A 2AK4E 3QXUA 3SSGA 4XNXH 3SN6N 3RVUC 4BFBD 1IQDA 5DJZA 3GSOB 5HGHA 1F90H 1Q94A 4N5UA 4PP1C 3TTSA 1DLFL 2AXGB 1KTKE 3L3GA 4WVRA 5GXBB 4FLOA 4LFHG 4HPHA 2WNGA 3R8BB 2VE6B 5IFAL 4YSPA 3S36X 3PXJA 5AVZB 1ZVSA 3SZ6A 4LSQL 4MMZA 4KNTA 2XQBH 4RFNC 3RGVD 4XB8A 2JKIS 3KYKL 4CBZA 3IGKA 2WLYA 3QIWB 1MEXH 3ZZSA 4LKCB 2DQGH 4O51A 4J1UA 3QWQB 1ES0B 1GZQA 4RMUA 3HTLX 2GK0B 3JWDL 4P9HH 4AT6A 4AIOA 2K6YA 5C6PB 2AS5M 4L29A 1VZHA 5TH2A 4K71C 4TRPL 1BVKB 1UM4H 3EJQA 5T1KA 1UJ3B 5J13C 2X5PA 3J27A 3WXWH 3KVPA 4QF1B 4HCFA 1D5BA 4A67A 5FO7B 5FK9B 3SPVA 1GMIA 4OFKA 2X4PA 2Y7SA 4X98A 2I9LB 4XNUL 2FYVA 5C0RH 3IMBA 5ADOL 3T2OA 4X6FB 3QH3A 1HU8A 1NOAA 3AW5A 3QO1A 4MQTB 3CK0H 2CM5A 1E40A 2OXGA 3HBZA 5AZEH 1TLKA 4LOFA 3QUMA 4NPYB 2ZONA 2G4EA 3VJ6B 1KGWA 3FQNB 4MXWL 3GJFB 3OR6B 2E6PA 1S7XB 4F57H 4F33A 5JORA 4JDEA 1DVTA 1D2OA 4M1DL 3QQ9C 3HUJF 3HW7A 3MLWH 4Y2NA 4ENED 3D34A 3T0AA 1KGIA 4NUQA 2V5RA 4PWFA 2XKNB 4NGHH 3VTAA 2AP2A 4OGYH 2EE0A 5E8PA 5BV7L 1T1YB 4FKHA 1AFVL 2TSBA 1TPXB 2YN5A 2DMBA 3ULVH 4FNLH 3FCTB 3CN3A 3KXFE 5IW6B 1X5XA 1NC4A 5TPWH 4Z7WB 3EUUA 4LSVL 2VGLM 1JZ2A 3K6NA 2EXSA 4KJWC 2R0ZL 2AQSA 1FBIL 3SGJC 4MB1A 1SMDA 5D7JA 2Z8RA 3EFDL 4LT7A 1CGTA 1I53A 2X4SB 2ZSWA 1QBML 3BUTA 3EH3B 4G6JL 4YWGH 2A83A 1BFSA 5E6SB 2XA3A 2W95A 2I32A 1IJ9A 1BBJA 1NCNA 1MCOL 2FJFB 2NYKA 2O5NA 4OLWL 4FFZA 3FO1A 3GSUB 2BVOB 3K1DA 3KXFB 1AI1L 1AGDB 3MRQB 3FQ1A 3GBNH 4XBPB 2NX5A 5GRVL 1INQA 1JNNH 4TNEA 4A2FA 2OK0H 2D0HA 1DVFD 5EO0A 4ZAKA 1JHTB 2DH3A 2FL5A 5LGKA 5DXWA 1GGIH 1BREA 4OJDH 1SM3H 4TUJB 3DV4A 3QUMH 4FF9A 5CD5D 4DESA 2Z6FA 3LZNA 1IGML 1D5XA 2XV2A 3A6BH 1BM7A 4OGXL 2QVFB 1LD9B 2VSKB 5JW3H 2EDRA 1JFHA 1H8SA 2MCPH 3H9SE 1MI5D 3FFCA 1AKJB 3TO4C 1KYOJ 1T2QL 2C3WA 3S37H 1I4FA 3B83A 4ERSL 3HJEA 3QYMA 3WKQA 2ALAA 3GK8L 4JFOA 3JYBA 2YA0A 3MO1A 1YN6B 4PJIE 3CDYA 2CO7B 2G75B 1T83A 3UTOA 3V2AR 1INDH 4JHWH 4C56E 5KSVA 5AUMB 2XU9A 3SIKA 3FYEB 1UCBH 3N06B 5KYXA 1L0XA 1VFMA 2DIJA 4Q6IC 3UZQB 4UTBL 1OT2A 2HJFB 2R39A 3K2UH 1RURL 2J20A 3D2UD 1P84K 2NCMA 1AS8A 5IBTH 3OLIA 1QLEB 5C9KA 3DX6B 2B0SL 3VSVA 1U8KB 2CJUL 1QRNE 1URIA 3FT0A 2WQXA 5B38B 4PJIB 2NW3B 4PRPB 2NY2D 1JRHI 3B3BA 4C56B 5EU3A 1MJ8H 3A4FA 3ARXA 1YRKA 1MFBL 3ATBA 4PCYA 5C9JA 5HI3C 4XWOD 2X4NB 1JTTA 4BBWA 1DHKA 4BFFA 4L0YA 4H88L 1N19A 2DQTH 4CSTA 4HOXA 2WYZA 1XGYL 2NY6D 5I1AB 3VRJB 4PHZA 5T3XL 4D9RD 1X5AA 4OFYD 3IDUA 4GSXA 1NC2D 3N44F 5K9QG 4GQQA 4Y5YB 3GJFK 4F7MB 3DIVA 5I1HH 2HMIC 5F3BA 3D69A 2WJ5A 2VLRA 4HJGA 3U7WH 2Q8BH 2NUTA 4NJAL 3QFDA 1BIHA 2AEWA 4PJCE 1MY5A 4JHUA 4KDWA 2YLKA 3Q9QA 5EPMA 3ARBC 1I9JL 3KVQA 4CGUB 5FOBB 1MPAH 2E7CA 2NXYB 4PUBH 5I2IB 1R5VB 3EJYC 3MGOB 4GKLA 4NM4L 2HFTA 3UIYA 4RCAA 3V6ZA 4Y9EA 4M43L 3ARVA 4TNGA 1K8DB 4RDBA 2BSTA 1R46A 2QGBA 3S7GA 1N64H 4CC0A 1CD0A 3KBHE 3N1MC 4MAYC 4YN3A 1OGPA 2VMJA 4PJCB 4LCWD 5A2KH 4JREC 1I8AA 1CDYA 1CLOH 1CXKA 1KTDB 2GFBB 1QAWA 4GPVA 3ZO9A 3HN8A 3KAAA 3EJZC 2RFXA 4I9XA 1CN4A 4G8GD 5KVDL 3RX7A 2XWJB 2H0PA 2WXKA 1NIAA 2EDKA 3O2WH 5E70A 3IJSA 2D7OA 1N26A 4DQAA 3QA3A 4OR1A 3FOMB 3ZUCA 2VN7A 3HI5L 2V33A 2H1LM 1UWEH 2HAZA 5E4EB 2WQ8A 5E99L 3BT2H 5BW7C 3QUXB 1B0GA 3QRLA 5KBKA 1J9RA 1KPRB 1YYLL 2VLKA 3AACA 3IDGA 3HJ0A 4OW6A 3MFFB 2XQYK 1MH5B 4M3HA 3TIDB 1HKLH 1MCDA 4G5ZL 4L5FL 4PJ9C 1XGTA 2DLTA 2E7BA 2MTAA 4M5TA 4IYKA 4P2AA 5CXPA 1SXNA 2PETA 4XVSL 3MZTA 1SXBA 2J8UF 3TONA 3QRGH 1JI1A 4PB9L 3HMWH 5DJXB 2VXVH 2M83A 3UP1A 3SE3C 4OFIA 5CS7A 5J1SC 3ZE1F 4N9GB 4N25A 5IK3B 3GSQB 5E6IB 1ZK5A 4B96A 5I71C 2ZCLH 1E6JH 3WY3A 3BMWA 3BLBA 1X44A 5ICXB 3HUJE 4TNWF 2EDOA 4QNPF 4IEFB 1JUFA 2ZX5A 3GSNB 3QCVH 3HNSH 1DQDH 2W38A 1QFOA 3ZYOA 4KZCA 3AWEA 4H1LG 2VR4A 5FHAH 1I3GH 1G94A 3QUKB 2WN3A 5CHNA 2A73B 3II3A 3KW8A 4JFPB 4U0QB 3HCVA 3S8GB 4GKSA 3VD9A 5EEYA 4KRLB 2EUWA 3AS0A 4OD3H 1NDMB 3OGCA 1UYWH 3UTTA 2AJSH 5I1LB 2VDRL 3ZL4L 1JFQL 3HUJB 4XN5A 2K9UA 4FJ6A 1GC1H 5DJCA 5D1XA 1J11A 1FPTL 1KIPA 1T20B 4ZMPA 2FWUA 4HH9A 1U91B 1SEBB 5T1MB 4W9LC 5LAXA 2WBJA 2GTZA 3SHSA 1QUNA 4RAHA 1ZHLB 1HEZA 4XBMA 2O5XL 4FG0A 4LQFL 4PGEA 5HYJD 2DB8A 1QI4A 3IMUA 3BCDA 4NN5C 4LRNH 2ZICA 3BUDA 3VXRA 2NNFA 4KC3B 1UB6A 2EJ1A 1KTBA 4Y8DC 4F8NA 1A7NH 5CWSA 4B0MB 3US0A 2MPAH 4PJ8D 1MLCB 1PEZA 2VR6A 2XHNA 3WMPA 5KN5A 2X7LB 3BLKA 3W0WB 1A64A 5C0IB 4MD5B 4XP5H 2OXHB 1MFUA 3DUSB 2A1WL 4NIYE 5K1NA 1CT8A 1FL3B 1R5IB 2BHUA 2HSIA 1YMMD 2LW3A 3T08A 2FHFA 2OMXB 1CXEA 3U9PH 1F11B 2XTJB 1G7QA 4JFHD 3WJJC 3JWDC 1BZ9B 1A47A 5AVSB 1TTAA 4K7PL 2YUZA 3UGXA 4AH2A 1PIGA 5T1DH 5C0FB 1D5RA 1FH5L 3L4YA 4ZX6A 4A7GA 4DERA 3F01A 3AU0A 4N4YB 1JZDC 4FLQA 1S7VB 3VE0A 5GHWH 4ZT1A 1L9SA 2KMWA 2VLJA 5KSUA 3MLYL 2J6EL 1RP8A 1WWCA 4PS7A 5KOMC 1MFCH 2AJ3B 4YAQA 4QXUL 4AJWA 2F53A 1PD6A 1JGLH 3QWRA 3T2NH 4ODHH 3ILPB 3QZOA 3CU7A 4LCCA 2A2QT 2B16A 3A6OA 4XOAA 4M1GL 5BZDA 3SE4C 3LXAA 5IFJB 3QFJB 5KYUA 4OF5A 3MRGA 1MELA 4Y5XB 4JFFA 1JPFA 4JRYA 4YO0B 5H35A 2IGFH 3Q7JA 2RB8A 3R1GH 5BV7C 3H6AA 2J55A 4IDLA 3ZYIA 1TMQA 3AQYA 4G83A 3N1QC 1YO4A 3OHMB 2Z8SA 2AAVA 5F70A 2QTEA 4F5CE 1RFDL 4V1DD 1ZIAA 2V7HA 4GW1A 3RI5F 1EV2E 4B9CA 5KVFH 4LOUC 5FYKU 4EN3D 1BP3B 3GUTB 4XP4L 3UBXI 5GS2H 1AYRA 3ECQA 4AGPA 3V52H 2V17H 4HHAB 4LNRA 3FO0L 1KNOB 3CVIL 4JB9H 4K07A 4Q9RH 1JPSH 4PJHF 4MJ6B 3Q8CA 3OJDA 4QXWA 1TG8A 4N6QA 1X5IA 4UT6A 2DS4A 3WMQA 4DQOL 2OTUB 3N44B 1QBLL 1EQWA 2H3NB 1ODUA 5FGCE 3EFOA 3EOTL 3FUEA 1FE8H 5FA4A 4KOCA 2W60B 2Y7LA 4HIIB 4QT5A 3HR5B 1BPLB 3BEWB 1PSKL 3QEUB 1JSYA 1U8PA 3IJYB 4ZTOH 5LXGH 1INEH 2HA1A 3PWUB 3TNNB 3GFUA 1ZT7B 5DD1L 4MA3A 1RZIB 1I7ZB 2AJYL 5FGCB 2Y1AA 5B1BB 2EE2A 5FFOA 5MEQB 4P23D 4H1LA 5FCUL 4FEIA 3B5GA 4CJ1A 3F00A 1P6WA 1AR1D 2BFGA 2YOAA 5CFAA 2VZUA 1PZ2A 4QWWC 4E9VA 5INCB 3VRIB 1TJXA 1LE9A 3HE6D 1O75A 2Q2LA 3DHUA 2VRQA 1UEYA 1VPOH 2DEYX 3SGJA 3Q1SL 5L2KB 4B50A 5GGVH 2VDQL 3L08A 3HKZA 4NHUB 4DGYH 3GXIA 3W1ZA 4RDQF 2DZEA 3PIQB 4UT6H 1P7QA 2XWZA 1YEEH 3O6FC 2AV7B 1N9PA 3LPWA 5CJ5A 1E50A 3QXAA 2EZ0C 4QHPA 4AKOA 5JHLA 4X6EB 3J8F7 5EU6A 2A6IB 3WL9A 3OHXB 4I0CC 2QT6A 1I7UB 3BAYA 2DYPA 4GBXD 4QNPE 1KC5L 3CD4A 4JFXB 1WWWX 3D3VD 2LV4A 4KRNA 2I69A 4YSEA 4Z7VA 1JE6A 2OMWA 2R2BB 1KPUB 2J8UB 1O7DE 4FYQA 4XMPH 5SX5H 3FT2A 3VDBA 1L9MA 5LBGA 1WA1X 4P5MB 3ZE1B 4P4RB 1CFVL 4UAHA 4JFTA 4KBPA 1Q9OA 5I6KA 1W80A 3B56A 3VTMA 1GGCH 3ZT6A 2QMKA 2YD8A 3KPQB 4JLRB 3TO4A 2VDOB 3P3UA 5I8KH 2G5UA 4NAQA 3MRLA 4JFZL 4M5YH 4JRFA 3HG4A 4WY7H 5EU7C 1C08B 4OCWL 4HAFA 3LN9A 1YNKL 4EO5A 4Q6IA 1Z6JT 4G6FD 5HDLA 1BAGA 2Q7NA 3SBPA 1O9VA 3SKNA 3LHAA 2UZXA 2DTML 3JT2A 3MX0A 5DO8A 2VXTL 2AK1L 4CMMB 4YSAA 2EDQA 4BZ2A 3E80A 5HYIA 4KKQA 1M53A 3IVKA 2OX5A 2MHAB 3RGVC 3OB0H 1AD9A 3VFTA 1LQSR 1XZ0B 2LLLA 3JV6A 3GI9L 2ESVA 4P5RA 4PV8A 3HZMA 3BAJA 5KOVC 3D52A 4NQUA 3PNWA 4PREB 5CKAA 4YHOH 5IMMB 3H3KA 1BV8A 4X8CA 2Q20A 1NCCH 2AJXH 1OAZH 4ORZC 1AQMA 1U3YA 2L4OA 1R3LB 2DQHH 3ESUF 1IGTB 4JM4L 1I8UA 1K3ZA 1VACB 2BC4A 2WXGA 4MBOA 2VXUL 2C9SA 4ZMWA 2Q76A 2XN9D 5C08D 3R06A 4PY7A 3ARGB 1A4KB 4JFEE 5BZWA 4YSUA 2FBJL 1QFWM 5K1JA 4QUOA 3LN4B 3DJTA 1A8JH 1UA6H 3GEWB 1I9EA 4WFGD 2YPLE 4F7EB 1A1MA 5DCCA 2D9CA 3DX2A 3MBXL 1I8IA 3UGEA 4DKFH 4Z23A 1ULVA 3WENA 3ARBA 4UYPA 5C70A 4QYAA 5A2LH 2Q7AA 3S3PA 4P2RD 1JTOA 2AQQA 3ARFB 1N7MH 2YAPA 4ENEC 2AK4D 1HXMB 3P77B 4JFEB 4J3WA 3M45A 1BM3L 1U58A 5J11B 3SYAA 2B1AH 4I77H 4XNMB 2YPLB 3V4VH 5BOPA 5DRWB 3WD5L 2DQMA 4YQXL 4MAYA 4TQEH 4YSCA 1IBHA 3EYOA 3H9YA 4NNYB 5BZXA 5B39B 5IOPA 2EO1A 4R7NA 3BFWA 1PLGL 3QJFA 1ZT4B 4ONOA 3QDJB 2NSQA 1DJIA 1HS6A 1IGCH 1E2WA 2YD7A 4NUGL 5HD8D 1OAJA 2BCMA 3J7HA 2V3DA 4Z9KB 3SJVE 4P4KD 1H3WM 4DP1X 4QIRA 5ENWA 3IU4L 1GYCA 2H0EA 5BW7A 3RDTB 2X40A 1NDGB 4XRCB 3CFIC 2PMZA 4CC4C 1FAIH 1DVFC 5EWIH 3SDDD 4NKDB 3R0MA 2XQ0A 1NLBL 1VKXA 3O9WD 3U7YL 4YXKL 3V4PB 5CD5C 3SYCA 3PJSA 3TCLB 5GPRA 3RFZB 4M7JL 3SJVB 4L3CA 3RGHA 2BDNL 1DJZA 4PJ9A 2AQTA 4XN2A 1IC7H 4TNWK 4NKMA 3PWLB 4XE5B 2YBGA 4NO5B 5SWSE 1A9BB 1Y7VA 2IWKA 3U2SA 1F6AA 1ONQB 5HHXL 1YQVL 2JB6B 3DRQA 4U1JA 1DQQB 2LR4A 3SPIA 3SE3A 4D8PB 4PJHB 4MD0B 3LS5L 4IBQA 4Z7QE 5EB9A 5EEVA 4LNVA 2IFFH 1ROCA 2EAEA 4K8RH 5D4JA 2CBOA 5FAAA 4LVOB 4DCQA 1J05A 4N90E 1KEGL 1YC7A 4XNYH 2W0FA 4J23A 2BIQA 2ZXAA 2Q6WA 4Z76A 3GQFA 3BH9B 4BH7A 1FP5A 2FWOA 1J5CA 4KPHL 3TGXA 1TZHB 5IEHB 3SBWC 1EFXD 3QJUB 4PRHA 3NGBB 3MOBL 1UEMA 1AVAA 4ORGB 1AZBA 3MLUL 5E8OB 2NY2C 2WVVB 3BZDA 1EEYB 5E1HB 1GH7A 2NY3B 3EBIA 2I07A 2N0KA 1GW0A 2WNXA 3CG8A 4XWOC 3QQNA 1NCTA 3GTNA 1U8JA 3GMQA 4YC2B 2CJTA 1BECA 2P44B 4UMGA 5AZ2H 4CW1B 3N1PC 4P3WA 4L05A 4HIQA 3WEOA 1S9XB 4DKTA 3KYMB 1FFPB 3KS0H 1DDHA 4YDVB 4O2CA 2VUKA 3PWJB 3ZRSA 4XGZB 4HQQH 2ICWI 2M2DA 3LH8A 3DDGA 5GGSY 4NCC1 3RPKA 4X9YA 2Y36L 3H9SD 2VXSH 3TT3H 4QHMB 1UQSA 4N0CD 5H94A 5E9DA 1S7QB 5DK2A 8CGTA 1Z7JA 3DX7A 3T09A 3WJJA 3S3SA 3GKZA 1KXQA 4IKLA 4XNAA 3RPIA 2OCCB 5I5IA 4GMSL 3T4YA 1H6TA 3MRNA 2FT6A 3BVXA 2F54A 3KYOB 4TVPD 3IFOB 2MQ0A 3OWRA 4LIQL 4NQED 2OJ1A 3QSKB 4PP2A 1T6BX 4YR6A 1DEEA 2L7EA 4ZDHB 1M6UA 4MMYB 3C5SA 4KTGA 3QQ3B 1IGYB 4ZOCA 3LNEA 1YCSA 3AQDA 1QRND 4AGOA 5EZIH 1EXUB 3QDMB 1MFMA 1HJCA 5J8OA 2A5UA 1NCDH 2PW1B 3O3BA 4FCAA 4EEEA 2CXKA 1UHVA 5DF0A 5E4OA 5I1CL 1K85A 3SE4A 3UL4A 1UH2A 2TRHA 2EDMA 1XHHA 2DQDL 3WFBH 2FGWL 4HWZA 5I1KH 3PWPD 5DWUH 3L3HB 3RI5K 4A6YL 3OLEA 2FJHB 3C8HA 1OB1B 2C8NA 2KLSA 5EC1B 3LDBB 3FN3A 1ZS8B 3BSHA 3HLAA 2DKSA 3CHXA 2MRYA 3UJJL 1IEAB 2Y25A 3QI9D 5DJ8A 5JA8B 3BW9A 5K59E 3S36L 5E2TH 3QWNA 3BT0A 4S2SA 4LLQB 1T1WA 4JMNA 1CXFA 4XI5D 5I76B 2LU5A 4UQ2B 4XX1E 4PY8J 3H0TA 2QQKH 1SXSA 2YLHA 4RZCB 5EDXA 2BSRB 3TEUA 1M57B 5IV2B 1VFAA 3DI2B 4FG6D 4HXBH 3KPLA 3NJGA 1RJLB 1M1SA 1LK2B 4JM0A 2CJSA 5CP7B 1PZCA 4AJYV 4P59H 2NMSA 4JE0A 2FB4L 5IHLB 2QZ5A 4ISVA 4FD0A 1YUKB 5ADOH 1A2YB 2ZXEB 1OZTG 2AV1B 3ZKQD 1IBDA 1D5ZB 5I73C 2WINB 1CTNA 2DQIH 3EZJB 3QCUL 1A14L 4N8CH 1SUHA 1NFDF 4O2FA 4WNJA 3U2IA 5CO1A 5DMJB 1P2CB 3BD3A 3B34A 3C09C 3MSPA 5FGBC 3G9AB 3GSWA 4HZLA 4ESKA 3ULUH 3VI4E 2ICWB 5DR5H 3LRLA 4M1DH 4DN4H 3JV4B 5JXAL 4NN7B 4HLJA 2RHEA 3QNXA 2FEJA 3NSDA 2MKLC 2NZIA 5L0QC 2ATKA 4ABVA 1NOLA 4R7VA 3FBKA 4Y4FB 2VO5A 5DVLA 4PJXE 1YEJL 2C7FA 2N01B 3CQQA 4GKOA 1Z5LB 4M7LH 4LSVH 4JGJA 3WLBA 1ZHKA 1FGVL 3NACH 2R0ZH 1FBIH 4N0UA 2P48B 3RNKA 2P4AB 1OT1A 1H3PL 3E2HC 4O9HL 1LMKA 4QCIA 1S3RA 2OW7A 4G6JH 4PJ8C 2J2ZA 2VZVA 5TF0A 4UTBA 5IJKC 1NJ9B 2W9DL 2VDKB 3UCQA 1FVCB 1PKQB 3O6FA 3MRJA 5ABAA 4KNUA 3RX8A 4DHLA 4EXKA 1VEOA 2YC1B 4QXTB 3OKLA 2ZSVA 4FZ8L 5GJSH 2WCSA 1A6AA 3JYCA 5D2NC 1MCCA 3QHFL 3FK3A 1KCSL 4FQPA 1KENH 3HI1B 1D5MA 3D7PA 3CMOL 3PJNA 3TBSB 2BVQB 3IN0A 1G1KA 1UWGL 3B3IA 5EU5A 5I8CA 1FZOB 2E7HA 4QRRD 1GCFA 5ANMA 2LFGA 1WFJA 3NJMA 1E9QB 3WFDH 1IEBA 4PRBB 3D25A 2JJSC 3LYRA 4E41A 4XMKL 4C4KT 4M6NH 5MENA 4G6MH 1E8WA 2XXGA 2YD4A 4HC1L 4PJEF 4I0PB 4HS6A 5MI0C 3V0DA 5KBPA 1IM9D 1NMCB 4OVUA 2VERN 2AANA 4YLCA 3LQZA 1NANH 2FO4A 4JY5L 1LDPL 1IM3B 4Z3GA 3P9WB 5HHVH 1XGPA 1U8OA 2UZYA 3GO1H 5KANI 3D0AA 2YD9A 2NR6D 4H8WL 1L6XA 2X0WA 5D93B 2ORBH 3QUYB 5GGUB 4K3EH 2NY7H 3VG0L 4NJ9L 4XMWA 4KROB 4AWJC 4HUXA 3K74B 3MTRA 1CWVA 1LWRA 2OMTB 3GMOA 4PJ7F 3RGVA 2J12B 3Q43A 5DVNA 3LMJL 4BWTA 3IDNB 1NWPA 1MFBH 2HVJB 3PGDA 1F45A 2WXPA 3BAIA 3T6ZA 1IQWL 1XFPA 3QPQD 2WVUA 3SO3C 4AYDC 3VMPA 4KU1A 4FLRA 2EKSB 4I8DA 3L3IA 5AW1B 2IV8A 4F37F 4UTAL 5IJDC 3L4CA 4RMWA 1NCAL 1UXSB 3CH1B 4PAZA 4TVPL 3SO5A 1CGXA 4RMVA 3QQDA 2ADGA 5ESQA 2RCSL 4FN0A 4L2YA 5DZNA 4M93C 4MCYA 4KVCL 1LO5B 4G1EA 4OLEA 4U6HB 4TLKA 2BRRH 3MRRA 1DVUA 1SDDB 5DEGB 1BGXL 5DMKB 3QO0B 3N40P 3H53A 1IAKA 4TNVF 2WMPB 4ZTEA 1B0RB 3VG9B 2V3FA 1Q0XH 1IAOA 4EIZC 4JR9H 2Z91A 3N85H 5C0CD 1PMYA 1T0MB 3OF6D 4M7ZC 4YBQD 12E8L 1MAML 3QG6B 4N5ED 4ZW6A 2FCBA 4M43H 5CJBA 4KZEL 1LLAA 4P23C 2I60L 2JE8A 2BCKB 1KCUL 4UILH 1AR1C 4XB3A 1WD9A 4MZ2A 1C5CH 2Z65C 4GYBA 5H37G 5DJ0A 1TZGL 1WICA 1DE4A 3UBFA 5C0GB 5F7WC 3ZE2E 1EZLA 4NOBA 2FD6L 3HE6C 4NZUL 2QEJA 1S7UB 4G6KH 4UB0L 3RTQB 2YBRA 3VXPB 3E6FA 1VZIA 4HEMA 3C6SA 2VERA 1GVIA 3ZLQC 4NRYB 3HI5H 5EZJA 4IRSD 1H15B 3X3FL 4MCZA 3B1UA 3PDDA 5E99H 1JK9A 3MR9A 4KJYA 2F7IA 3G6JF 1QYGH 5IB5A 1RHHA 3FRPG 4IDJL 2YOCA 4PCSA 4KI5D 3IETB 4CC4A 5I1EH 3LZPA 1DVFA 2ZCHL 3V0WL 1UFUA 2VDMB 1SBSH 1JWUA 5I9QC 3JTSA 5CGMA 4WSJA 1PEWA 5JOFB 5BVPL 1G9HA 4QHKJ 2QVKA 4X4YA 4OZFB 3VGFA 4OQTL 4UQ9A 1BXAA 1NFDE 1CF1A 2DYRB 4PB9H 1KCWA 1ETZA 3MRMA 1AGCB 4IW4C 4H0LC 5T8IA 1MIML 1MI5A 4AVHA 1JVKA 5L4MA 4KXDA 1HIMH 4G11A 4NM8L 4UIMB 4XVTH 4HK3J 4G8FB 4QHNB 4DKEH 4LL4A 5GGVY 1JGVL 1UH4A 1WBXB 4PSPA 5E0QA 3WO4C 2YMXH 3U30B 3I2CL 4E5XB 4ZQTA 2BY2A 4C83B 2VMDA 3TWCH 1U33A 1EX0A 1ZSDA 1NFDB 3QNFA 3UH8A 3P4MB 1F4XH 1MQ8A 3O2DL 5IHZB 4TPRL 1MDTA 2XWBA 4XMLL 5CU5A 5B4MD 1OOWA 3D2UA 2R1XB 3SBWA 4S0HA 3OQ3B 5CGYD 1IAIH 5DFWH 1KPVA 1JNLH 3IKCA 4LLDA 4MQXD 5DD6B 3KGTA 5I18H 3STLB 3C5ZB 1M7DB 4XPBL 3FQRA 2J6EA 1D6EB 4U49A 2JJVA 4UQBA 3DGGB 5EC2A 3CFCH 1KZQA 3OAYK 4JN1L 3THML 3QZWG 3GSXB 4XCNA 2GUOA 1CD9B 2EVIA 4U6XB 5AVRB 5I66B 4ZX5A 1MOEA 4PWEA 2OJZL 4D0DB 1HILA 5FYLE 3H85A 5GRYA 3FQYA 2E9IA 3VGAB 4OFYA 3FQ4A 4PWIA 1NC2A 4LSDA 3UACA 1QLRB 1P5VB 4K3DL 5EBMA 3SDXF 3KPRA 5G5DB 4N2AA 4AX3A 2NXZB 2C1PB 4ODVL 5GJTL 3S88H 4MQ7B 4YDJA 2ERJC 1QSFB 1PX8A 1VSCA 1V3JA 1XD0A 3IU3B 1KT2A 4JM2F 4KK9D 1JPST 4PJEE 1NBYB 4YOKA 5SWQB 4XPTH 5FOJA 4MHHI 2KDYA 1JVLA 1M56B 1MHCB 5D5MF 2E59A 4YHML 1U8QA 2K8MA 2HPTA 3RWJA 1NFKA 5IMOA 2XN0A 1IGFH 2IH9A 2A9NL 4RRPG 5F1NA 5IB1B 4YDIL 4L18A 1QHPA 5DO2D 4LOEA 5J6HA 1EAOA 1TVBA 1U8HB 2ZXBA 2ZUSA 4R8WL 4YFEA 1JPGB 1YEFH 1W0WB 4PJEB 3G5YA 4H8HA 3TBYA 3ECBA 1RU9H 4LCWA 4QXUH 3L1FA 1KACB 3VACA 2CJ3A 5AB0A 4AV0A 1AZRA 1N4XL 1UATA 2NQ3A 5D9SA 1OM3L 1C9SA 4P07A 3QPXH 1HXYB 4WUUE 4LLVA 2WBKA 3MRDA 1JF1B 5HD8C 1FN4A 1OXYA 4M1GH 4GW4A 4P4KC 2PR9A 4MCMA 4BRJA 4Z78B 4J6RH 3TO2B 4PRNB 2C9UA 3BAXA 5D7LE 2R69L 2DLGA 1JYNA 3FU9A 2DQEL 1GXEA 1C12A 1USQA 2ENPA 1WZAA 1U8IB 3AT9A 3KCPA 1CTOA 1FVEA 1OAXL 2YGNA 4PJ7B 3SDDC 4P5TB 3BIKB 4IHBA 3CPLB 4RMSA 2ITCB 5A2AA 1LHZA 3O9WC 1G7JA 1OGAE 1SEQH 4U3SA 3V0FA 1PFCA 5KTEL 1ZCRA 3LKPB 4WFHE 1SHWA 2WTRB 4E9LA 1U92A 3GSRB 3F7KA 5CZKA 1L0QA 3LKOB 5D7LB 2V2XA 3NSYA 3VXNA 5ICYB 2VN3A 2VQ1B 3WIHL 3ZW3A 1NICA 4PPTA 3T77A 3WI9A 3KPNA 1TMCB 3D09A 1TDQA 1XH3B 5FS5A 3RA7L 5KS9A 1S3KH 2D03L 1N8OE 2DL2A 5HDRA 5JHMA 1OGAB 2E74C 3ECVA 3FU3A 4PI0A 4WO4B 3V6OE 2CGYA 1LVEA 5AW4B 3MV7E 1WQVT 2XWTA 1CLYH 1YQ2A 1F97A 4JCMA 1MFDH 1LO3H 2CDFB 2V4LA 1M7IB 1NGXA 4GKZA 3BQUB 3DX9A 5EO9A 2X4RA 3F2LA 5FGBA 5DD1H 4R4FL 1B90A 1CE1H 2GTWB 1WC7A 4LPUA 3WFHA 1O6SB 2KHAA 1VGEH 1I75A 3BP7B 2O4EA 1OSZA 2YGQA 4JG5A 3MV7B 1F3DH 4PS3A 4AIZB 1JXFA 3G6JE 3H2QA 5BCAA 5HYJA 4CADB 2W9LA 1NAMB 3MLXH 4U3HA 5TK2A 1SDYA 3QJXA 2Q7YA 4H8WC 5BVJB 2I5YL 2ZQKA 3HN5A 4G9FE 2QQNH 3CVHH 4U7KA 4PJ8A 2W07A 3M1CA 5IJKA 2F08A 5SWSD 3G6JB 1JZJA 4L1BA 1HAWA 3BPNB 3K6SB 3QZWA 5I28A 1N18A 3HRZB 1PZSA 4QGTA 4JCWA 1YMMA 3BP5A 4HG4J 5D2NA 1UUNA 4XO8A 4N0CC 4BA0A 5KW9L 3QEQD 3F7VB 4KMLB 1ZA6B 4G3YH 1S5IL 3M1BA 1RZ8B 1MXGA 3ILDA 1KC5H 1M2VA 1NGQL 4N90D 3P3SA 3VFSA 3FOLB 4WGWB 3OBAA 1RULL 3CBRA 2Y07H 4PLOB 3PPEA 4ZTPH 1MUJA 4Z95L 2WLLA 3KPSE 2IG2H 4OZGA 1KGXA 2P24A 1CFVH 5E8NA 3X14A 1QTPA 2JJSA 3BIAX 4NWUH 1AGFB 2E27L 1LMIA 2XJLA 4L4TD 1RIHL 2CPCA 1RZGA 4RGND 1IVTA 3H1ZA 4P46B 1E27A 1JZHA 5AW7B 2VC2B 1Q9WB 1YMHA 1KBGL 4B3VA 2QVIA 1V55B 2Y7QB 3TBTB 2MQ3A 3KPSB 3MLZL 4RRPA 2ITDB 3WKYA 2Y7NA 1C8QA 2NY4B 1OAQL 5KVGH 3GBDA 2ZKWA 2DTMH 1KGYE 3EHBB 1V3MA 3K6OA 4OM1L 5JDJA 2CHZA 5KAQF 3N40F 3BKJL 3ASWA 4J3OF 1N6UA 4EUPG 3ZDZF 3BH4A 3CLEH 3DNKA 5CJOH 4F37K 1TEFA 3GI9H 3STZA 3RB5A 1AIFA 3QI9C 3QJHA 4OI7A 5IQNA 2KL6A 2J4WH 4X9IA 3AS3A 4V1DA 4J3TA 2JKLA 3GUFA 1G0DA 4LRIC 4XI5C 5I6NA 2JCCF 1T04B 2VJ0A 2Z93B 3MNWB 3BE1H 1TKWA 3R19A 4HX1A 3T65B 3M17B 1FZKB 1P5UB 4FG6C 3JQOB 4GSDL 3NA9H 5CGBA 1HINH 4YHNA 1FSKB 1FNSH 2UX6A 4AYFB 1Y6NR 3KM2A 2AABL 3ETBF 1J1PL 3BO8A 3SDXB 4DW2L 3TZVD 2GBUA 5GS1B 4U1HB 2OJEA 4DGWC 3Q2WA 5ESAB 3DO3A 4H25B 5BRZD 4JM2B 4HU2A 2LQRA 1B4LA 3RIAK 1XF5A 4LPCA 4KKPA 5FCSH 5D5MB 3A67L 5FDWB 3PAUA 4NRZA 4B9JA 1P1VA 3EZ8A 3LRSB 5BRQA 3SPHA 1SVBA 5JDSA 2YPKA 4DZBA 4KNQA 1DQJA 4P23A 5DA4A 4B9ZA 5ISZD 3V7AE 4XAWL 4YL4A 1UD2A 1IT9H 4TMPA 4OZHF 4R5XA 2J88L 1R4XA 5E8EA 1XTLA 4KJQD 1V7ML 3GS4A 3HE6A 1M6OB 3DGDA 3U79A 4X6DF 4EIUA 1Y18A 1W15A 4ZUTA 2EIBA 3UP6A 3AY2A 2RQ8A 5SWZB 5HHOE 3GT6A 3VWKD 1KJVA 3FTYA 5DQJA 3BKML 3ETSA 2DWTA 3MC0A 5DQ9B 4HUKB 2E9WA 3UO1H 1EANA 1HFUA 2MCG1 3ISWA 4XP6H 1NLBH 4MX7B 4PMFA 1SGKA 3U7YH 1ZHNB 4YXKH 3P0VH 1XGQA 4L4VD 2IWEA 4ZMQA 1XSIA 3D3VA 4UIKL 5T33L 1S5HA 1OARL 4R5TA 3HI6L 4L8DA 4WK0B 3H42L 4LDEB 2DPKA 2DWYA 2WWKO 2O1AA 2E0PA 1YEHH 4BQ6A 1R19A 2HLFD 1P4IL 4UUJA 1RUML 4KXZI 3KL0A 4EMZA 1G84A 1TXKA 4QTIH 1KEGH 5AOJA 4F2FA 1T7VA 4J3UA 3KHQA 5AB2A 1DQTA 3H8NA 3KPMB 2LLNA 2BNQE 5TE6L 3D85D 3ESNA 4MZ3A 2ARJA 3N9GH 2YEVB 5FWQA 3WS3A 1S9YB 1J9TA 1K2DB 1JPTL 5DC2A 3DROA 3ARDB 4LCUA 3V0VA 5JIQA 3RUGE 4F58L 2QQLH 1E30A 3DV6B 3CQFA 1A4JB 5F9DC 2WO4A 2BNRE 5DZPA 4FQ2L 2CR0A 2OI9C 4LEOB 3EBAA 2VIRB 3D0VA 2BNQB 3O3EA 1TZIB 1Q8MA 1OOAA 2XNAA 2ARWA 3QPQC 2ITFA 2Q8AL 3MREA 4DUXA 5D72L 3P69A 4J2XA 3OKMB 1WG3A 1HL4A 1X6LA 2D4FA 4Y16D 1YEDB 2OR8A 1CLVA 4PGZA 4ZRGA 5KJ7E 3T0EE 3ME0B 4TSCH 3O0RL 1CLCA 2IH1A 2BNRB 1CICB 3O45B 4HKJB 1DLHA 1ZV2A 5ACMA 5JIMA 3FB5B 4YSSA 4NOFA 2XN9A 5LBSH 5C08A 1NA8A 2ZG2A 1QABA 5F7DB 3CFBA 4TOYL 5E2WH 3SGEH 4AEEA 4K94L 4ELKA 4B53A 4X80H 3K72B 2WXOA 3MGTA 2Y36H 4LARH 4Z0BH 4HFUH 5A2FA 2HRLA 2CR6A 1R3KB 4HJSA 1A7OL 3NN8B 4U3CA 3T0EB 2DMKA 1KN2L 1L9NA 5FYJH 1C1EL 1QR4A 2NQCA 3GHEL 5A2JH 5GISL 1LEGB 3ZDXF 4P2RA 3CJJA 4YBQC 4ENZA 5I1DB 2AK4A 3L5WA 4N5EC 1RSFA 1E2VA 4ZMTA 5I30H 4R2GB 3HMXL 3ZSTA 4JKWA 2HH0L 4GAAA 3IXAB 3WG7B 4PSRA 4AE1A 5FECB 4BKLB 5ITBH 2DWEA 4F15C 5JXED 5CBAB 4G82A 1RUQL 2XG4A 4N2OA 3S96B 2XBDA 5GRUH 4DZ8B 2OMBA 3ZE0F 2ZT9C 5FM5O 3VFMA 3KD4A 2MEJB 4FC3E 4ZK8A 5CD3B 2QR0A 4FHBD 3ALXA 4P4KA 1XF1A 4IRSC 2JCCE 3L2NA 3Q2LA 1T2JA 1CDBA 1JCVA 2DQDH 3G5WA 1F00I 1I31A 2FGWH 4HSQA 4M7LT 5FPIA 5I5MA 3EH4B 4I13B 5GGRB 4H8UA 4JANA 1G7HB 1FYHB 3RP1A 4BRVA 2RQEA 3FO2A 2BOLA 5JPNB 4KI5C 4X4ME 4H7VA 3ZDZB 3OKKB 4LBEB 3SDDA 2HZHA 3UJJH 3KDMB 3O9WA 1MRCL 4X7TA 5CNHA 3TBWB 3W9EA 4AC2A 3QUZB 3VTTA 2ZXGA 3BWAB 5HHMB 2JCCB 2O6DA 2FSDA 1UT1A 1AH1A 1AP2A 1NAKH 1WIUA 3QCTL 2C34A 3P4OB 4WCYH 3HNVH 4GAYA 4MJID 4AQZA 1UGKA 2VL5A 3AREB 3K8KA 1HNYA 1NGZA 4J2QA 1XR9A 3MRCB 3OZKA 4G8EB 1D7FA 4ILDA 4ZYKA 4EZMA 5E1AA 2QELA 3ABZA 4FADA 3Q48A 4O4YL 4PV9A 4R7DA 1J1OL 4AYSA 3DBXA 3QCUH 2ZZUT 1A14H 5HSFA 4JFDD 4QY8A 3ZKND 2WOBA 4TUKL 4M8QB 2NNAB 4X83A 5C92A 1AOHA 4URTB 4WUKL 1CFTA 3LRMA 3CHRA 3TA3D 5B4MC 4IKKA 1XH2A 1IKFH 4IBVA 5LCVL 2E76C 1EFXA 4V2CB 5CGYC 1MWAL 5FFGA 5JXAH 5IEKA 1MAJA 5EU4A 2FLMA 1J48A 4MQXC 3S8WA 4I2XE 4HOZA 4KKCD 3LS4L 1W6WA 4NUJA 3U6RB 2JXMA 2H9GB 3FL7A 3GJFH 3L81A 2NY5L 4L8SB 5JIIA 4LESA 3BLPX 2YZ8A 4PG9B 3OSKA 4TL5A 3QWOA 1GY1A 2IPTH 4Y4KB 4OZHB 4ETYA 1YEJH 2VLLA 2WKOA 4JZOA 4FERA 2OMVA 1IGIL 4WV1C 3T6QC 1URLA 3VSTA 2ZX7A 1BFTA 4Z0XA 5E00B 2IH3A 3MJ7B 3MRBB 3RY4A 1VFBB 1CFQA 4X6DB 4CMHC 4I2XB 4Z7NE 5J12B 2YARA 3VCLA 2W9DH 4IU3B 2WO2B 2WLZA 2D3JA 2IWGA 5LGHH 3NFPB 1O7DC 1DUYA 1S4IA 5EBLB 5T5NG 4NFCA 5F96H 4G80B 2VZ3A 4LU5L 3TF4A 4KK9C 1E3FA 4TQPA 4XP9H 3H9SA 1KCSH 2XZQL 1NSNL 3MLRL 1IQDB 4Y7OC 5DJZB 2NDGA 5HGHB 1Q94B 1B9KA 2JB5L 3ETTA 3L3GB 5JIHA 3ZHFA 1HOCB 4WTXA 4LGPB 1ZVSB 2IOMA 3IGAA 3VD7A 3NPSB 2IXQA 3TU6A 4HJIA 4MMZB 1E8YA 4LEBA 3ABKB 4UTAA 5DO2C 5IUCA 4XMKH 3LJ3A 4O51B 4J1UB 4JDVA 35C8L 4NQEA 4ODUA 1GZQB 2DLHA 4ZNCD 5T5FL 3G5XA 2O5ZH 4K3JH 1AGEA 4AT6B 4GUPA 5GRJL 5GS0D 3OM3B 2ENYA 4L29B 1QRNA 5TH2B 4A2HA 4MA1B 1LDPH 2NT0A 5T1KB 3WFEL 1XL6A 4NP4L 1YYMH 1R0AL 1D5BB 1KF9B 3BGAA 3EBHA 1ET7A 4JVPA 2ZOUA 4BFKA 5IGXH 3FHEA 4XZUA 3SPVB 4M8VA 1K5WA 5JYLA 2X4PB 3T3PF 1SY6H 3LEYH 3PWPA 4X98B 4NJ9H 2FJGA 1EHNA 4F7TA 3NCYS 3QH3B 4BFIA 4RWHA 3QO1B 2BY0A 1RLBA 3TBCA 3V0IA 2OXGB 2ZYRA 1E5AA 2VRAA 3QUMB 4Q74A 3QI9A 3BDYL 2VABA 2V2WA 1QLEH 2H7WA 4F33B 5JORB 1BXXA 4JDEB 2GJJA 1U4EA 2NY0D 3IJ7A 2UWEA 2GY7B 2DEWX 4GRLD 4WQOA 2WXJA 1E8ZA 2C9QA 4W4NA 2FDBP 1J8HD 2WQSA 3ZDXE 1ACYL 1T22A 2RCSH 3FNKA 1QO3A 5F88A 1M1XA 2UXGA 4MNGA 1NC4B 4KVCH 2VXQH 1N68A 4LSRH 3FH8A 1ZE3C 1L9TA 4BGLA 1JZ3A 5D7JB 3RB7A 4BJLA 3V4UH 3TPUA 2OZ4H 3FUIA 2ZSWB 3IMTA 5C7XL 2A83B 2J5WA 1FLRH 1RIVH 3P3RA 4X4ZA 5EIQA 4EDXA 2Q87A 3GHBL 1BBJB 3B2VL 4FP8L 1UD5A 4AIXA 1ORQA 2R56H 4XXCC 4MXQD 3REVA 3VD5A 1F13A 3FO1B 3L95A 4OQTA 1SRDA 1EO5A 3G04A 4WUUD 3ZDXB 5TK4A 5FHBH 1HHKA 3ARSA 1X7TA 2NX5B 3FB7B 3FFCE 3KM1A 4OIIL 5EO0B 4ZAKB 4HUVA 1I1CA 4DGIL 4Q97A 2FL5B 4KZEH 2I60H 2HFGH 1JN6B 3OKYA 4OJFL 4EPSA 1PNDA 5KSBA 4QLWA 3DV4B 2NY1D 3ATAA 3NYKA 1WYJA 1EHLH 1WZKA 5IKCA 2AMGA 2VISA 1JWMA 1L0YA 1TZGH 3EJJX 4G7YH 5GGQL 3REWA 2C3GA 2NW2A 3ABLB 4NZUH 4A7GF 1S7TB 3WOVA 4UB0H 5FUZH 1GIGL 2QPFA 3NFSL 2DBLH 3G5ZA 3FFCB 2IGTA 4X0KA 3JWOH 3O2DA 1TYRA 1I4FB 4I18C 4GW5A 1R24A 5CSZA 3X3FH 4JFOB 2PYED 5K33A 2QGDA 3ZTNL 3NESA 3MO1B 5AVQB 3EJRA 4CJ0A 1KZYA 2A9BA 4UV4L 4HWBL 5KSVB 2NUPA 1YUHA 4KJPD 4Y1AE 1ESOA 4JKPH 4FI6A 5KYXB 2O5YL 4K5LA 3V0WH 1K3IA 2BWDA 3VRLF 2GJZA 4XWGH 2OYMA 3HNTH 1K4CA 3RVXD 3TJEL 4XX5A 3VD2A 4YIQA 2QDVA 4QRRA 1EIBA 3DO4A 4P2OD 5IVZA 2VKWA 1VESA 4IMKC 5K93A 3CLWA 2GUYA 1LP9A 1TLMA 2QADC 2BVPA 1EJOH 4B5ZA 3O4LB 5C9JB 5JW4M 2ZOKA 3RBSA 1W0VA 4JDTH 1IM9A 1MW1A 4K94C 4RGNC 3GM0A 2FEEI 1HL9A 4IRZH 2R0WL 2ZCKH 4NO2A 4RLDA 3APFA 3IPBA 1QSZA 1QATA 3CFDA 4OLVH 5I5JA 2A0LD 4XMVA 4G43A 1J8SA 2V37A 4ZOEA 2YAMA 3EYFA 3BVDB 4WAFA 5F3BB 3D69B 3DYMA 2AI0H 4JHAL 3VYOA 2VLRB 4HJGB 2NUTB 4L48A 2EEFA 3QFDB 2D7PA 4G9FD 4YBLB 3IE4A 5EPMB 3PDGA 4AEHL 3GJEA 4FQIH 4QXGL 1PZDA 1I8LC 5AVXB 3I9GH 4KKNA 1IFGA 3MAWA 4AMXA 2JJUA 3V6ZB 2OJZH 1KSRA 3TWYA 3QORB 2DBJA 2GABA 3QJQB 2BSTB 3PUCA 4XO5A 3GMLA 5FUOH 4QD2E 1HX0A 1P69B 2R69A 3BQVA 5B1AB 3AMKA 4QJ5B 4X7SH 3HC4H 3TZVC 1EXGA 2RFXB 3IFLH 5GS0L 1IKNC 2VDNB 4FXTA 2VM4A 2Q3ZA 3GZKA 3IJSB 3WFCL 1GPOH 1KBPA 3QA3B 4NSKA 3LZFH 5DSCA 1U3ZA 4IJ3B 1BQLL 3PL6D 4QRBA 2R1WA 5F9AC 4F1SA 1FNAA 1UOVA 1S6NA 2VMFA 2EILB 5C0CA 3OF6A 1K6QL 4K73A 1XVSA 4JKKA 2VLKB 4OLYH 3IDGB 5IESH 5TDOA 2A9NH 4UU9A 4YDIH 2JKTM 1G43A 3RTLA 4DTGH 2CHDA 2AJZA 1WHPA 3OTTA 1KWGA 1XGTB 4WU7A 5KZCB 4Z7VF 4MYPA 4GXVH 4KJQC 4JZJC 1RK7A 5AB1A 4POYA 4GIAA 1S9WA 1YG9A 5PCYA 3L4WA 5D1QE 1ZLSH 4DUWA 3UTTE 3FF8A 4F5CA 1NEZA 4GO6B 4WHYH 3VWKC 4IRSA 1WEJL 2EE6A 3T3PB 1JUFB 3SKMA 4XPHL 1ZA3A 2GSGA 1OLZA 3TNMA 1CLZL 4L3AA 3OJVC 3RZWA 1TVHA 1WK0A 4HSCX 2NY5C 5EOQH 4UM9D 5CHNB 3ZGIA 4TLTA 3ZHKA 2EDWA 2VITA 2X0VA 3GZQA 3UJTL 4GKSB 4C4BA 2K4AA 3M1OA 1Q0YH 3VXRE 1RZ7H 2E9BA 2Z34A 1AY1H 3OGCB 3UTTB 1J9QA 5FO2A 3FC8A 3R8QA 2IBZX 1A7RL 1P4LA 2WZAA 3BHBA 4WI7A 1A8ZA 1G9NH 5D1XB 3QR1A 5DJCB 3POCA 1KIPB 4HH9B 4IGBD 2ZXQA 4LSTL 2VWEC 5E8DL 3HFML 5LAXB 2WBJB 2GTZB 4IBYA 2OZNA 3ZK0A 1QUNB 2EC8A 4R7XA 2YWYA 1HEZB 1U42A 5I6PA 4PGEB 2OM5A 4D8OA 2BP0A 1E5BA 3BKCL 4X6CA 5IT2H 1MCEA 1X5KA 5LHDA 3VXRB 2IDSA 2IQAB 3W37A 4MNHA 2JTYA 2UZIL 1UB6B 3RL1A 4AC4A 4I87A 3TL5A 5CWSB 2YHGA 3QG7L 2D0GA 3FUNA 5KN5B 4BQBA 3I3BA 3K46A 4A7UA 3K6DA 1OP5H 4N2KA 1U6AH 1HK6A 4KV5F 1CT8B 1J87A 4W4OC 2GI7A 4F93B 2QSVA 4YE4L 2VLJE 3F3HA 3MV8D 4OAWA 4DP8X 1R33A 3DX0A 1UKTA 1G7QB 5E1GA 1BQHG 2BZDA 2ZTBA 1PG7H 2FWSA 2F53E 2OP4H 4JO2L 3GXFA 5ALCH 3S4SG 3WU1A 1A9VA 5HHOD 5BMFL 2KDGA 1X9QA 4AH2B 4IOIA 4R3SA 3I85A 3OB8A 4FI8A 5AAWC 5D8JH 3JTTA 3T3MF 2ZE0A 3IPEA 4Y16C 5CEZD 2BNUA 3ML8A 2IWFA 4WV1A 3OPZL 5F7AA 5AD0A 3VE0B 4XN7A 2VLJB 2I5YH 3NA4A 5KSUB 4NQCE 1A1OA 5TE7L 1WV7T 4YAQB 5GGTL 4M3JA 5C2BL 2F53B 2FSEB 2V5SA 5EN2A 4DN3H 2VR9A 2Y3NA 4LCCB 3BP4A 1WD8A 2AQ1A 5BZDB 4FTVE 1U8NA 2X3AA 5KYUB 1EUTA 5DZJA 3WTTA 4HIXH 2FX7L 4X42A 3INUH 1J5OL 3MRGB 3TT1L 4ZSOE 3H54A 4HPYL 4I5BA 4KY2A 3X1EA 6PAZA 4JFFB 1ZWIA 1JPFB 4JRYB 2BOCA 2EH7H 5H35B 1NINA 2BMKB 2X05A 2NTFB 3S2AA 5MEPA 3DSFH 3MUUA 4RFNB 5JXEC 3VXQA 1EMTL 1UENA 5GZND 4J6IA 2V7HB 1JXJA 3QZBA 4A2EA 3MXWH 1ZY9A 5FM4A 1OSPL 2KLRA 3D18A 3MODL 4AKQA 4CSZA 4KITB 1ZV9A 1SFHA 1XF4A 3K6IA 1GJUA 2R2HA 4LNRB 1T03L 4K71B 1C5BL 1FC1A 2X2IA 3QNYA 4NHCL 3KBFA 3E3QE 5J13B 2FAUA 2VDOH 3OJDB 4GG6B 4C55A 1OAQH 5HDQH 1HQRA 5F0PB 2GTQA 3AG1B 3EFOB 5C09E 4IHOA 5FA4B 1XR8A 4QT5B 1MJJA 1E4JA 2GI0A 3B1TA 3BKJH 3GBLA 1UM5H 3FT3B 1BD2D 2ENQA 2Y24A 3PQYD 3TCXA 4Y9FA 2OFQA 1U8PB 2B3IA 2XBZA 5E6ID 3ZSSA 1WWAX 3HC3H 4N3UA 3KH4A 4MA3B 2LVCA 3S35L 5E23A 3W9DA 1FIGH 2AXHA 3F7PC 3GS7A 1R3HA 3KYNA 4ANXA 1EA9C 2WYTA 1EVTC 2C9XA 5DUML 5I1JL 2NPLX 3JZ7A 5EEXA 3LKQA 4ONGH 3GSVA 4OB5L 3V0GA 1J1PH 2LU3A 5L4FA 4DW2H 2VZSA 5LNEA 3N55A 1N59B 3CVCA 4YSTA 1LE9B 1EERB 2WZ0A 4GMTH 1ACCA 1BX2A 3ZKNC 3GRWL 4M48L 4JG0L 4ZS7H 3VX0A 1GZPA 5L2JA 3FF7A 3G3LA 3TYFA 4N2MA 1P7QB 3TA3C 2IAAC 2IMNA 3FHAA 5IMKA 3WMSA 4V11A 4Q9CA 4LVHC 4NX0A 2B5IC 4XXCA 1ND0A 3QXAB 1V10A 3QVAA 2H45A 4E68A 3L9RA 5EU6B 2Y06H 4C57C 3F83A 4KKCC 4GINA 3MOAL 1KEMH 3WUWG 4FA6A 2Y7MA 2DYPB 3U0PA 3DPDA 1FFOA 4EDWL 3LH2L 3RKDD 4XAWH 1V3LA 1FVDA 3NUKA 4HKBA 4Z7VB 2OMWB 5D7KE 4UT7H 3D07A 4TTDD 4RISH 1SMOA 1KGJA 3FT2B 3LV3A 2X10A 3B9DA 2XXMB 4BHUI 3BD5A 2D31A 3ZDYF 1Q9OB 1JYVA 4LB8A 4PGBA 4L3FA 1KGCE 3TO4B 1BQHA 3JVGC 4D7PA 3F7QA 4I18A 3MRLB 4Y4HD 2BIHA 5SWSA 4HHGA 3X1GA 5FW6A 3PFQA 2ESVE 3Q8BA 1ZE3H 2ZPKL 3DHPA 3GNMH 1TCRA 5EUOE 3QEQA 4HPOH 1A6ZA 4L9LB 4OBRA 4Q6IB 3SKNB 2JQMA 2UZXB 3MX0B 1AXTL 5DMGD 3V6BR 2BP5M 3TF7C 1RZJH 1WH0A 1DFXA 3HI6H 3IVKB 3VFTB 1SOKA 1AD9B 1QVOA 5K9JL 2Z0UA 4IMKA 3JV6B 3KCWA 4P57A 4PV8B 2ESVB 4PEEA 5FWRA 3HZMB 2G30A 3MROA 3V4PH 4CN1A 5FYKD 4YL9A 1PDKA 1RK0A 3PNWB 1P4IH 2MCAA 2WIMA 2Y9RT 1U8MA 2LGNA 3FU8A 2WSKA 4L4TA 5F97E 5GS0C 1WFMA 2PR4L 1MVUA 4B60A 2ZNXA 2PPAA 5EZOH 5J7CC 3CZFA 3KR3L 4K0OA 1HDMA 1KIUA 1HEHC 3CMGA 4AW4A 4DP9X 5CEZL 1MJUL 1DUZA 4ICWA 1RLWA 2BC4B 3D4CA 4KUZL 2LLGA 2Q76B 1WA0X 3T3ME 3R06B 1V05A 4PY7B 5BZWB 2J21A 2E56A 3L4XA 3O2VL 4UNTA 2B1OA 4F58H 1DBJL 5F9OL 2HX7A 3HPLA 3B7YA 3MJ8A 1SLXA 5DD5L 1A1MB 3DK0A 3HMXA 4FQ2H 3NQIA 4YZFF 5SX5K 3JWNE 1I8IB 2IADA 3GKWL 1DVZA 4HCIA 1JGUL 3OC5A 1NUNB 3ARBB 3MBEB 2Q8AH 2EICA 2Z64C 4ODSH 2NY0C 2ZIDA 4XC1H 1FZJB 3GI8L 1I8LA 3T3MB 2QPDB 2IMMA 4GRLC 1JTPA 1HZHH 3DOIA 4ZFQA 1T21A 4YGVA 5CLYA 3D51A 4MAYB 1ILSA 1L9PA 3EYOB 2WVTA 5E6YA 3ROLA 1YZZA 1RUKL 5IOPB 4JREB 4R7NB 3U7AA 1IE5A 3QJFB 1DJXA 1UZ8A 3TZVA 5JOPE 4K94H 5IVXA 3OB0K 1IKNA 1OW0C 5EORL 4B27A 5BRZA 4LASH 1JF6A 3MV11 3FTZA 4H8VA 2VDPL 1A7OH 4TS6A 3K3QA 1BLNA 2NNCA 3GMRA 5ENWB 4KZDH 4MXQC 2YIHA 3RWCA 3ZX1A 1QFWH 1WGOA 4I9WE 5F7KC 2EIDA 3P40A 1KN4L 1KJ2L 1JIBA 3BC9A 5FO8A 2JJTC 3O81A 3BN3B 5ISZA 2NY1C 1VKXB 3U6XA 4NZFA 1I1FA 4NWTH 1RJCA 4CN6A 1JRHL 3PJSB 1JERA 1SN0A 4L3CB 1CK0L 5FIEA 3GLAA 3SY6A 4PJ9B 1P7HL 2PUQT 1NCBL 4NKMB 1MNUL 5E6ZA 5BQDA 2KZBA 2MJWA 2R29L 1F6AB 3U2SB 4JZJA 4XCYA 4BKSC 3WEXA 3DRQB 4U1JB 1Y0LA 2YA2A 1X7SA 1QBBA 1MHHB 2OR9L 3FB8A 1OTTD 3H55A 4IU2A 1MZZA 2N3JA 2GT9A 1G6RA 2K7QA 2AEIT 4HLZG 3WUWA 1IJNA 5I71B 2VW4A 5EBWA 4LSSL 3FN0L 5LCVA 4IBSA 1J05B 3VWKA 4DCQB 4L2LA 3H9HA 1MWAA 2W0FB 3ZR5A 3MUY1 2Q6WB 5AOIA 4BV1A 4Z76B 4YDMA 4KJPC 4BH7B 1LWHA 1VRSA 3CXHJ 4AGLA 2FWOB 1MRCH 4NENA 3RVXC 3RRQA 1HE7A 4PRHB 4L4VA 3A23A 4O2EA 4P2OC 3VFGL 1EBPA 3KLDA 5AVUB 2G4GA 3AAZA 4AM0A 1S7SA 1TQBC 3QCTH 3BH8A 1TFPA 2K7PA 4WHTA 1YPZA 2QV4A 1UWFA 2VL4A 5F71A 2I85A 2I07B 4D9QE 3UYRH 3NG5A 1NIBA 4BH8A 3VI4A 2YD3A 3A24A 4M6ML 4NN5B 1U8JB 4Y2LA 3GMQB 1ZVNA 4MMXC 4QO1A 4O4YH 5HYSG 1E4HA 5E9DE 5DQDH 1J1OH 3UTZA 4CVXA 1CUOA 1XGZA 3D85A 4LZKA 2PF6A 1BXVA 5E94A 2WUCL 2PXYB 3OZ9L 1H3XA 1KXQE 2A0LC 1G6RH 1CURA 5CLTA 4LOVA 1YVLA 4O2CB 4PJXA 3NZUA 3KBPA 5DD3L 2WBXA 3S98A 1MWAH 2H5UA 2ED9A 3RL2A 3M7OA 4W4OA 1T7WA 4JJ5A 5CEYB 5AKRA 3TX4A 5AVYB 1UQSB 2IBBA 4S1SH 5H94B 5E9DB 5IY5B 5I75C 3U0WH 3DX7B 2PKDA 5T5FA 4XVUD 2CPUA 3BFOA 2V6HA 2YJLA 3ZU8A 2CLVA 4ZUWA 4HJJH 1A3LL 2YUWA 5AAWA 4A04A 3RPIB 3FUHA 1NANI 4Y1AD 4S10A 4OTXH 4Y16A 4M61A 1A0QL 1CZ8H 2F54B 1PGRB 4G1MA 2V5MA 3ZDYB 1MRFL 2VOTA 4PP2B 5HPMA 5CZVL 5DUPL 4YR6B 4I85A 4LFHD 5FYKL 1V5JA 4JCLA 4AMKL 1DEEB 2WHVA 5F7NC 3C5SB 2OS7A 2XWXA 4PB0H 4B41A 2OSLA 3TLRA 3O3BB 4WI3A 4TQ8A 2XZQH 3LHPL 2GAZA 3C08L 5J9PB 3UAFA 1T1XA 1SJXA 3G6DH 4HWZB 5JIPA 1IGJA 1RXLA 5IQ7L 1TJHH 2JELH 4NN6B 3KWUA 2V5TA 2IANE 5BV7B 3MGAA 3HLAB 3PRZA 4F7CA 1JHLH 4KMTL 4JDZA 35C8H 3BW9B 5DJ8B 2WUBL 1N0XH 5JXEA 4HK0A 3ZT7A 1T1WB 2WQVA 4IRJD 1TR7A 5DGRA 3ZTJG 2VJXA 1EBAA 2Y4SA 3F7RA 4U2ZA 3SKJL 4YZFE 3FU0A 1JHKL 1SLWA 3H0TB 5DYOA 2LABA 1VFAB 2CCLA 3KPLB 3R4DA 5HGBA 1KV3A 5FR3A 2D7MA 4LL9A 1SOXA 1TZAA 1GAFL 4YX2H 3VFWA 3LCYA 4XNQA 4ISVB 4ODTL 5DRXA 4X8GA 2XC8A 1ZJBA 3FUDA 4MSWA 2ZX8A 1S78D 2APTA 4L1HA 4O2FB 5CIPA 2EVJA 1HH6A 2D2CC 4ZBJA 4TQIA 5CR1A 2H6UA 3BDYH 4DFHA 2HWZH 5I23A 4FZEH 2NTSP 3GSWB 4HZLB 5TE4L 2CUAA 4N0UE 2XIBA 4DK6A 3AVEA 5IR1A 2YSSA 2V3EA 4FJZA 3PCYA 3QNXB 4X5QA 4CN4A 2EE3A 1K5NA 1GGUA 3OJMB 4IGBC 4X5PA 1AZNA 1E5ZA 4H0GA 2ATKB 4MJIA 5DDHA 5E1IA 3RVVD 1WUNT 1FNFA 3DX3A 4EBQL 1A7PL 2BLFA 2FIKA 2XA8L 3ZYJA 3D50A 1P6FA 2N4IA 4R90L 5MHSE 3GMPA 3L7FB 3WLBB 2OSWA 1FL5A 2VZTA 4HWBA 2DQJH 4N0UB 4ICXA 2HT4D 2B77A 4AYID 3RNKB 4JPKL 3EFFA 3CSFA 4QCIB 5AOKA 4JFDA 1AQKL 2J2ZB 4BK5C 2EXTA 2H8PA 1GMEA 5ANME 4Z3HA 3A6CL 1KWKA 4IKIA 1E5UI 2EEXA 1CU4L 1CGVA 3MRJB 3O6FB 3TA3A 1IC4H 5T3XE 5IHUL 3II1A 2PPFA 4Y19D 1YNLL 2A6JA 2XPGA 4H26A 4A2DA 4P06A 3OKLB 1QW8A 2ZSVB 4E41E 1A6AB 4KFMA 4MJ2A 4D3CL 1JCKA 5D1QD 4DGIH 5HYSA 1D5MB 1F8TH 1FYTD 4QRUA 1HCVA 5CIPH 5I8CB 3HG1D 32C2A 3B3IB 5EU5B 2DQUL 3FUJA 4QRQA 4CA4A 5ANMB 5C0AE 2DWXA 5EU7E 4OF3A 3OAUL 1IEBB 4KQ4L 3WCYA 4EF3A 4E41B 2X2HA 1GIGH 5DURB 4EQ3A 5MENB 3MYJA 1DCEA 3OXRA 4WEMB 1C5DA 3RDJA 2H1XA 4HS6B 5BS0E 1NDTA 1P4UA 3JVGA 3U0TA 3MMEA 2WNKA 3LQZB 1IAII 2FO4B 3QDHA 1OTUD 3FFDA 4U1MA 4HWBH 5HGDA 1XGPB 1U8OB 4A39A 4M02A 4NQQA 3O6LL 5J0BA 3SGDH 4U6VH 4XB7A 3OKOA 3TYGL 3LB6D 4N2FA 5KVDE 2OYLA 1TIUA 3TJEH 1NLDL 4MS6A 2VDLL 2WLIA 5I0YA 4HUXB 5CN1A 2HRGA 4N85A 3RPBA 1KGUA 3BUYA 3GMOB 5J89A 2VDMH 2C9AA 3RGVB 5GZNC 4HWUA 4P2QE 2PTTA 5LVEA 4JBSA 1FDLH 2BO0A 3PGDB 2WNWA 4MNQD 4OZFH 3E8UH 5C3LD 5E4EC 3LD8C 1JMZA 2LTQC 3L3IB 1WTLA 5AW8B 1BG9A 4HBCH 4L5FE 1S8DA 5EULV 3D4GA 2ZYIA 4H2CA 5ESQB 5KS9F 3QQDB 2ADGB 3QEHA 4H8PA 3TURA 5DMIL 1UZ6E 1A7QL 2PP9A 4XN1A 3FCSA 2EDFA 4MCYB 4GKNA 4G1EB 3MRRB 4N6RA 3T6XA 4JHAH 3W38A 4WHCA 1BJ8A 4XH2A 4D0BA 4GUCA 4NO3A 4HWEL 3T0WA 2MWCA 3MJGX 1IAKB 2GCYA 3IKKA 4HJEA 2DM3A 3VAEA 5J57B 4QRPE 3LKNA 4PWGA 4NQCD 2BVEA 3EDJA 2Z7UA 1Z0MA 5E6IC 4U1NA 1IAOB 3A5VA 4RGMC 4TN9A 2Z91B 1RJYA 1WBZA 2YWZA 2L7JA 4H0IA 3CCHA 2H32A 1VADA 4TVUA 2K8QA 1GGBL 4FTVD 3UG4A 3WNNA 4GRLA 1AD0A 5F72S 3VMNA 3Q6FA 4WJG3 3QAQA 2N7AA 3ZDWA 3NH7L 1J8HA 3VYNA 2FUQA 1WZ1H 2LE9A 1PZAA 4XBGA 5DJ0B 1DE4B 4DVRH 3BKYL 4TTGA 3L9BA 1PCSA 1PF3A 1WO2A 4KHXH 4BCZA 4WI0A 2OYKA 2Y6TE 1LK3H 4P9ML 2YBRB 3E6FB 4N0FA 2PWGA 3C6SB 1OW0A 4HALA 2EC9U 4ETQA 2WIIA 1G7PA 3TPKA 1FO0L 2BIMA 4GY4A 2G9HB 1MW3A 5EZJB 1SHSA 4FHKA 4MZIA 2DYSB 4MCZB 4FE9A 1JK9B 2AJUL 3MR9B 4KJYB 2VDRB 1ZLVK 1XF2A 1FFQA 1TQCC 4YUEH 5IB5B 1RHHB 4W6YB 4E0RA 4WUUA 4IBWA 4M5ZL 2E4FA 1CIUA 3CE1A 1MI5E 3V5DA 3QHZL 4K5MA 1DVFB 3V7MA 3Q5OA 4JK0D 1AC0A 2F15A 5FYLH 2JJTA 3UJIL 1NFAA 1JWUB 1Q38A 1QNIA 3JTSB 1OP3H 5C09D 4OCRL 3M8OH 2P26A 3WIAA 5CLZA 4X4YB 1WRFA 1A1NA 2R23A 4TTDC 1LO4L 5ETUA 3ZZLA 4IK7A 2WSDA 3K4AA 1RZFL 4XPAL 2HJKA 4OZGF 1ETZB 3HZKA 3MRMB 4HS8L 1IVLA 4PGDA 1M7XA 3U36A 2B4CH 4AITA 1MI5B 4OD1H 3LXCA 3EYSH 1A22B 2VM9A 3BZEA 2X88A 4YGAB 5TFSH 3SGKA 1OSYA 1WEJH 2H2SD 4PMEA 4Y4HC 2PYEA 4BDVA 8PAZA 4XPHH 1RZKC 4ANUA 1CLZH 2CCWA 1QSED 2PWFA 4JHZA 4WK2B 1JZFA 1CD1A 1OF2A 1BMZA 1ZSDB 4FQHA 4JHVA 4P8QA 1FRGL 2AHIA 1U36A 4XVJH 5CINL 1SYSA 2P7TA 3NQKA 1WS8A 5EZLA 3UJTH 4XAKD 1G1OA 1X7QA