3ECWA

Crystal structure of the als-related pathological mutant t54r of human apo cu,zn superoxide dismutase (sod1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNRAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and dynamic aspects related to oligomerization of apo SOD1 and its mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ecwA00
1L3NA 3F7LA 2V0AA 1YAZA 2WZ0A 3GZOA 1FUNA 2VR6A 3L9YA 1SPDA 1E9QB 3HFFA 1CB4A 2GBVA 2NNXA 1BZOA 1Z9NA 3MNDA 4A7TA 2WYZA 2E47A 2ZOWA 2ZKYA 1TO5A 4MCMA 1XTMA 1EJ8A 2WKOA 4OH2A 3HOGA 1COBA 4N3UA 1XSOA 2WYTA 3ECVA 3K91A 1OALA 1QUPA 2AQNA 3GQFA 2Z7ZA 1N18A 3QQDB 1OZUA 3KH3A 4A7UA 2VR8A 2AEOA 1Z9PA 2GBTA 1SOSA 4N3TA 1CBJA 4B3EA 1Q0EA 3H2PA 1HL5A 1OEZW 3ECWA 2WZ6A 2Q2LA 1IB5A 1JCVA 1F1AA 4A7QA 1EQWA 2LU5A 3QQDA 3KM1A 3CQPA 3S0PA 4MCNA 1SXZA 2JLPA 5CU9A 2JCWA 1SXSA 2K4WA 1IBBA 1SXBA 1PZSA 3SODB 1IBFA 3H2QA 2AF2A 2XJLA 1SDAB 2AQTA 1ESOA 2WZ5A 3CE1A 1BA9A 4A7VA 2Z7UA 1B4TA 1S4IA 3ECUA 1F18A 2E46A 2AQRA 3GTTA 3L9EA 1E9OA 1JK9B 2C9UA 3KH4A 2WWOA 1SXNA 3GTVA 1SXCA 1F1GA 1OAJA 1SDYA 1P1VA 3GZQA 1DO5A 1OZTG 2WWNA 2AQSA 2C9VA 3GZPA 4BCZA 3KBEA 4OJAA 4A7SA 1E9OB 2SODB 1E9PA 4L05A 4A7GF 1YAIA 2GBUA 2AQQA 3LTVA 2Z7YA 1RK7A 5KBLA 1JK9A 3RE0A 1U3NA 1SRDA 2APSA 3KM2A 1E9PB 1TO4A 4BD4A 4U4IA 3T5WA 2AQPA 1SXAA 1PTZA 3MKGA 2ZKWA 2XJKA 1AZVA 4FF9A 2C9SA 1F1DA 1HL4A 2R27A 3CQQA 1YSOA 1XTLA 1N19A 5KBKA 1DSWA 5KBMA 1IBHA 1UXLA 3PU7A 3F7KA 4BCYA 1IBDA 2Z7WA 1E9QA 1PU0A 1MFMA 2WKOF 2VR7A 4A7GA 2ZKXA 1KMGA 3HW7A 1UXMA 3KBFA 1B4LA
chains in the Genus database with same CATH superfamily
2R29L 5AZ2L 3IU4H 1YAZA 4N6RA 5CSZA 2AMGA 3LN4A 4K07A 3RZWA 4O02H 1PY0A 4MB5A 4DK6A 2PP8A 4XO3A 3ZKXB 5GPRA 3DTDA 3U4BH 2WQ8A 1IAOA 3CZLA 3Q01A 3C2AL 3MXVH 4FQLL 5B4MC 2X9YA 5KSVB 5TE6L 3H3PL 2QZ5A 3WFZA 4UQ2A 4YLCA 1IRAY 1FC1A 1HHIA 4QRSA 2ZWSA 2MHAB 3W9DB 3NP4A 1Q94A 4YUEH 4GP8B 2QR0B 4HIIB 5CIPB 4YSSA 5JPMC 4ZK8A 2K7PA 4C58B 2ED6A 1ED3A 5LQBL 1PCSA 2EQDA 5CGBA 4XRCA 5C0EA 4R4FH 2UZIH 4JFVA 1HHJA 1CLZL 2OW7A 3FHEA 5FHBL 2Q2LA 3VXRB 5C0IA 4YL9A 4ZO9A 3L8QA 2AZUA 5I1KH 4WO4A 3G9AB 2XOTA 3KNBB 1ZEAH 3HFML 3HAEA 1HINH 2FYYB 3C5SA 3F6LA 4FABL 3RL2B 3VVVA 1WPCA 4NO0A 3FNKA 1R4XA 3AWGA 2C3VB 3GXTA 3NIGF 2Y2TA 2H47C 4A63A 1IM9A 3L3DA 1TETH 1WAEA 1X5GA 2CBPA 3DO4A 1CR9H 4FNSA 2VDQB 1BIIB 1YEFH 3UADA 5EO1B 2AS5M 1OE2A 1O9WA 2D2CC 1U2HA 4R7NB 1A7BA 4W1TA 4PUBH 3FN3A 3UAAA 1BVLA 1KGXA 3GFUA 4PJ7A 3ZDXB 4NN6C 5BV7H 1K2DA 1GMIA 2BERA 2GT9A 5HYSG 1P7HL 1SMDA 4ANVA 3IRZA 3QDGD 5AW3B 2QADC 4NEHB 2YD5A 4JO5A 2BPBA 4BSWA 3MV9D 4JE0A 5I0ZA 1UZ8A 4W9IC 1N5YH 3Q1SH 3VGEA 4NAQA 2P5WB 1S9XA 3CSPA 1OAQL 3QVAA 3HUJA 4OV5A 1L7TL 3EUUA 2VDPH 3HE6C 3U6XS 3S5LG 4HJTA 3W57A 1JF1B 1PGRB 4FLQA 3C8HA 4FMKA 4BWUA 3UBHA 3GUTA 3T0WA 2J6EA 3A23A 3IMTA 2OMBA 4QRRE 4G7VL 3FYEB 5DURD 2WC7A 2XXCB 1ZGLP 4FXLA 4FP8H 3IDXH 4Y88A 2C5DC 3TV3H 1NCHA 5HHXH 5KSUB 4D2NA 1FDLL 4HFWA 2D31B 4W81A 3CHRA 1XGYL 3DECA 1ETZB 4XBMA 4YSRA 2J56A 4P57B 5BCAA 1UACL 1E6OH 1VPOH 5F71A 4L8SB 4YDKL 4F37K 3RAJH 3FOMB 3GMLA 3THML 2X70A 3C08L 3KVDD 1GZPB 4WY7H 4UQIM 3OKYA 4RISL 5DJ0A 3HHSB 4P59L 5MENE 4K71B 3DHJA 1QRND 3GMMB 4OLVH 5F2FA 1L9NA 4U3SA 5L88L 3BE1L 5GISH 4N2HA 2R83A 4NQCA 4KZCA 3CZGA 2ZCLH 5FKAA 2IDFA 5D7SL 1NH6A 1SLXA 1XGRA 3NCEB 2XKNB 5JXEA 1U3JA 1E4JA 3GHEL 4HDIA 3UC0L 3QIWD 3P73A 3I3EA 2F18A 4W9DC 1X4ZA 1GPOL 1G9ML 2BNRB 2VDMB 3SE8L 3W3BA 5EU6D 1ZK9A 1J1OL 3DI2B 1OXYA 1T4KB 2MOGA 4KROC 1FL6B 1KJ2H 3BVXA 5I8CA 5EDXA 4DVRH 4Z7WF 4LLDB 5ELIA 1T0OA 3FUIA 4R4BA 4AJWA 4KI5E 1B0RB 2EVIA 2R0LH 3AQXA 1WBYA 2XBDA 3S4SB 2Z35B 1U2CA 3GSWB 1EEYA 4JO1L 4NXKA 5DT1L 5L9DH 4AT6B 3GLDA 3TBVB 3MACH 1I9RL 4U1MB 5F7MC 3VRJB 5MERA 2R69A 5DJAB 3ZN6A 2F2HA 3QQ4B 2R51A 1MFAL 3BESR 4LLAA 4N0FA 4RFEA 4TULH 1NL0L 2NY6C 3NZUA 3QEQD 2KLSA 2Z31D 3OXRA 4HXBL 4Q6IB 1KBGH 4GO8A 1LYQA 2VISB 3NACL 1KIQB 4K9EL 4ELMA 1RZ8B 4OCXL 3B4NA 4X0NA 3V9CA 3WNIA 2AV1A 1A4CA 5SV3A 2BJMH 3NP3A 5TE4L 1JRHL 5L4JA 3LPOA 4HLEA 3FTVA 3KPNA 4GG8B 4HPOL 4GSUA 3I9PA 2VDNB 3KPQA 5IHZB 4C54A 1G7PA 4KKRA 1G9NH 1MHEB 3TBSB 5DQ9B 2G60H 5AVUB 3GSXA 1GGBH 3DC0A 4L05A 4ZFOA 4OFKA 4DSYA 5BOPA 1OGTB 4U3CA 3GS7A 3VQMA 4N5ED 2YMTA 4WTQA 1KXQE 2C3GA 3HC2A 3KM2A 4F57L 3V9EA 1F4WL 3FFCB 4AC2A 5EOCH 1ZE3H 4M7LT 3TO2B 4M6AA 4XOBA 3TYGL 4G9FB 3TVMC 4XPBL 3IFLH 1HDMB 4XCFL 4YEEA 2WCGA 4GW1A 3PDOB 4H88H 4CC4C 1LXMA 2NY0C 4FKEA 3PIQA 5ANME 4E9SA 1YEHL 3QQ9D 5T1KA 5I1IL 1AGEA 4ZUUA 4EDWH 3MMEB 4XPFH 4NSKA 1W72A 2LT9A 3NSCA 4GBXB 4QJ4B 1YLBB 1CMOA 4IHBA 4U1GB 4I9WE 4Y16A 2E7CA 4JGNA 3B3BA 1Z3RA 4N3UA 3JTTA 1P84K 5GJSH 4JJ5B 3BVUA 1A7NL 1MFEL 3IN0A 1KXVA 2J25A 4JQXC 1NCAH 3VB9A 4D0DA 4G8IB 3EGSA 4JHVA 5E9DA 5IB3A 2J1WA 2GQHA 1GGCL 4M43H 1WUNT 2G5RA 4DKTA 1CWVA 3VW3H 4ALAC 2FR4A 3IJYB 4AENB 4X4XB 5L8LB 2EJ1A 3AMLA 3MV8A 3RNQA 4I48A 1G1KA 1CE6A 1GYCA 2B59A 4NP4H 5F7BA 4ADIA 4OR1A 1PQZA 35C8H 1BD2B 4OGXL 4AYFA 1HSBA 2WIMA 4JHUA 1BXXA 3ATDA 3LV3A 4P2RA 4PRHB 5CMAA 3NPSC 1C7SA 4G71B 4UQ3B 3U7WH 2XBTA 4RDBA 2PYED 3P69A 4AV5A 2XN2A 5CD5C 3HZKA 3MAWA 2PO6C 4FXGC 3IDMB 2PXYA 2WLIB 4AEIL 1U8HA 1KFAH 3FC8A 4JN1H 4HUVB 2G5BA 3C12A 1X9UA 4LSUL 5L6YL 2QZQA 1JXGA 3UEZA 4MJ5B 1T2QH 5I30H 1K8DB 3O3AB 1SBSL 2CCWA 3OLDA 1XR8A 4O9HH 1T6VN 3BN9D 4ZMWA 5JR1L 2I9TB 2X89A 2YKLH 4IDJL 4GKOA 5TDPB 3RZCC 1HE7A 1PKOA 3PQYD 5E6IA 2IV9A 3FQTB 3ZT6A 4MZ2A 1BOGB 2J8UB 5D8JL 2XNAA 3DIDA 1N0XH 4OGYH 3VXPB 3K2UH 1NC2D 3UYPA 3V5DB 4G7YH 3HG2A 5D7JD 1FF5A 4A39A 4DP8X 4KKAD 1UD2A 4OZIA 2CM6A 1YN6A 2UZXB 2VKWA 1V7NH 1LP9E 1KY6A 2LABA 5ADOH 5CJXA 1LK3L 4PWHA 3VU1A 3DX9A 1T22B 3BH9A 2F68X 4KK8D 1B3JA 3GDBA 3C60A 4KTEH 3S35H 3D69B 4QXUL 4GKZB 3AJ7A 2HT2C 3MGTB 2FTAA 1ZS8A 2H6UA 3JYBA 5AW6B 3KPSB 4JPIA 2OYLA 2DLFH 4FQ2H 3V0EA 3VXTA 4R7DB 1JPFB 2XA8L 5AOKA 5ES4B 5CF3A 3EFFB 2WLNA 1WVZA 2H1PH 4XMVA 5CBAB 2V5YA 4GYBA 3L48A 3BHBB 3PGFH 3QZNA 5DJ2B 4XCNA 1KYFA 1JTOA 3UJTH 1I4FB 2JKWA 5D7KD 4C57C 1DBJH 3H7BB 2VW4A 1FYTB 4JM2D 3L95A 1XD1A 1FNHA 1PLCA 5DJ6A 3OWEA 1OTTC 3VXRE 1JN6B 1WDAA 1NDGA 1I1FB 4APQA 2VQ1B 4FEIA 5HI3C 3POHA 3VXQB 5DLMH 3AGWA 3S5LA 5I5JA 1CFNA 1JVOA 1E4XL 5AG9A 1Q0YL 2QSVA 4PB9L 3WE1A 1EDYA 5CLTA 2Z8SA 5KVDE 1V3LA 2XETA 3VXNB 3PJSB 3MJ7A 1YY8B 1F58L 1HL8A 1HWWA 2IDCA 1MCKA 4KMTH 5GHWL 1JZFA 5KVGL 2AEIT 5B1KA 1WAAE 5J6HA 4MB3A 2X4NB 1V3KA 2QTEA 3W82A 1XL4A 4CJ1A 4F8NA 4YHOH 4KGLA 3ZDXE 3AT8A 5E1HB 4JFTA 2G4EA 3KLQA 3HRZC 3QXTA 1CDGA 5TK2A 3RVXD 5IQLA 3WKQA 4MJ2A 3KYNA 3CSTA 5IK3B 3V0VA 3ZR6A 1MHCB 3KCWA 2IDQA 5DLLA 1QBMH 4MMXA 1IGML 3B9KB 2NY1C 5E8OB 1NA8A 4TNWF 4RAUA 5AOMA 2P5WE 4A2EA 2F7OA 3NGBC 1VFUA 3IGAA 3CVCA 3IPEA 1W16A 4J3OH 4LPYA 2ALAA 4CADA 2FSEA 3T3MF 2UXVA 1P7QA 3QNYB 4CSSA 3K71A 3TZVB 1BVOA 2NY3D 2ZD0A 2JSFA 3NFSH 5E2UL 4ZAKC 3HG0A 1LDPL 3BAEL 2RGSA 4TVPE 3U4AA 5KBNC 3GSUB 2BX5A 3H9SA 3TN0B 5A2IH 4MX7A 4FNPA 3BVWA 2NXZC 1SLWA 1RFDL 3FKUS 5DS8A 2X6CA 4GKLA 3PHQA 3RG1C 1AIFB 3IJSA 4GSRA 1XDTT 5H94A 1ZLVH 4S0HA 2CBTA 2XY1A 2Q7YB 4RWYH 4KUZL 5KS9B 4LLQB 3GMQB 5FWRA 3Q6FA 5JHAA 4PJAB 4LSDA 4MJIA 3ULVC 1UJ3A 4NZDA 1Z5LB 4E2OA 1CLYL 5EBGA 5D93B 5DWUH 3HCVB 4F7PB 2MJWA 5AAMC 4ONGL 43C9A 1LEIA 3QUZD 3OJ2C 1I9IL 1QFUH 3VWKB 2ZPKH 3V10A 4DUXA 4QJ5B 3RDTA 3O11B 2Z91B 1DE4A 4Z0BL 1GZQA 2BRRL 3TYFB 4LKCA 2YPVH 3OKKB 3HN5A 4N0CD 3K5SA 3OQRA 5CD3B 2BNRE 3OB0K 1AD9A 2EE3A 1I3UA 2GTQA 4FZEH 4WTZA 5IIEB 5DZVA 3PL6A 3B2PA 4HKZB 4HT1H 4NCC1 3V5KA 1DDHB 2MOVA 5IW1B 2XTJB 3UIYA 5E8EB 2BCKA 2OXHA 1PKQB 1FCGA 3AG4B 4BFEA 4CMHB 3R1GL 3D4GA 1VGKB 1GGIH 2K70A 1TQCB 4UB0H 1ZVSA 1CXIA 2ADGA 4YN3A 2DM4A 1WIUA 5CSGA 5D1ZA 1XF4B 1YNTF 5J3HD 2VAJA 4HK3N 3EJJX 5HHNB 1T0NB 3DO3A 5ITBH 4D3CL 4KRLB 3L5XL 3GSNB 3V4VL 5DU7A 1AHKA 3B9VA 2X3AA 3KMDA 3A5VA 4Z7WA 3GXMA 3CN4A 1S3KL 4G6MH 4HS8H 4J8RA 4NKMB 5C0ND 3OXSB 3NABH 3FRUB 5TDNB 1UA6H 3TNMB 1Z9OA 5IVXE 2Z7UA 3O9WC 5E94A 1MVFA 1GS7A 4PR5A 4JVWA 2AJVH 3HRPA 3VH8A 3MUHL 4P3CH 3RGVD 2J2ZA 1GRWA 2BS9A 4JFHE 2V2TB 3BJLA 3LPGA 4OLZH 5IFJA 2FUTA 3LPFA 1MRFH 1REIA 2OP4H 5AZEH 4R8WH 3GZPA 4AUYA 2EUXA 4ZOCA 3C8KA 4MQ7A 3SDCD 2CLRA 5K9QG 2XZAH 2XKUA 1VERA 2H3NB 4DGVH 4ZUVB 2VLRB 5DEJA 5F7HA 5DDHA 2AQQA 2ESVD 1N59B 3L1OH 3ZDYB 3N6YA 4JFQB 3FFCE 2JWYA 2GIMA 2APSA 4PHXA 1DUYA 3LH8A 1OAXL 2ILLA 4CUCA 1PY4A 3KPMB 3Q9PA 2BXZA 5E2JA 4XNZC 5DD6B 3U0TA 5EU4A 1EAPB 1IZKA 4XCCH 5K1JA 4DEWA 5KVEL 3E9UA 4HJSA 1CS6A 4QY8B 4DKEH 3VD4A 2TSAA 4QXTB 1C8QA 2VT0A 5BW7C 3SPHA 1NGWA 3KLLA 4ZS6D 2IMMA 1ZA6A 3SCMC 2NUTA 3WJMA 4WJ5B 3QI9B 3CLFH 1OLLA 1EGJH 1NLBL 3ZKND 5D9SB 1RMFH 2WYIA 3N91A 4KZ0A 5J7CC 2LFGA 4WO4C 2R9HC 3DK0A 4UM8B 1NIFA 3GSRA 3L3KB 2X4OA 3L4TA 4Z0XB 2W65A 4MDIB 4JO2H 1KCSH 3LRMA 5JHDB 2VMEA 3LHAA 3QBTB 4NPYB 3U83A 3CHQA 3MRDA 3K6IA 1JHTB 4YSTA 1OD9A 3H3BC 4ESKA 4JG9A 1OCRB 1NUFA 3UO8B 3CDCA 5IBUB 2ZOTA 3V6ZB 1PX8A 1XIWD 1D6VH 1WZ1L 4W68A 1BD2E 3TJHD 3N42F 1K3IA 3QNXB 3NFNA 1NINA 3GS0A 4R90L 3CV5A 1O6SA 2A38A 2P7TB 3GBML 4S0TD 5KSAB 1AKJA 4PRHE 4IBSA 1L7IL 1ECZA 2IH1B 4LLMB 4MVBC 4JRYA 1E90A 1F13A 4PG2A 1CVRA 1GC1H 3UJJL 3I2CH 1KF9B 1SXSA 1CICA 2K4WA 5GGTA 2VZTA 5INDA 3WGVB 1UT9A 3KG5A 3WNMA 4M5ZL 4UINL 1NGQL 1G6RH 1GW6A 1R5WA 5JXAH 4LBEA 3VFUB 3DO7B 5CFHA 1O7VA 4G7RB 4J3UA 2P49B 4X99B 2UVEA 4KMLB 3KLSA 4KO6A 4B53A 5HDQL 3WG7B 2OX5B 1ERNA 2YLHA 3VRLE 2B39A 1NFIA 3PGDB 4AKQA 2EVGA 1HXMB 3NJIA 2HT3D 5ADPL 5T1LB 3DBXA 2ZWKA 4DPRA 4GFTB 2KQMA 1UWYA 1SJMA 4HC1H 2IAMB 4JW3A 1ASQA 4P23C 2J8UE 2O61A 1RZIB 3VTAA 1ILSA 5E1AB 2JVUA 4GH7B 5CBEA 4OGQC 1S7VB 4ONOA 1G0DA 1URIA 6FABL 1ID5I 4PMEA 4YWGH 2CR3A 4IKKA 4V1DA 3L45A 1M2OA 3L54A 1ICTA 3FO1A 4TRPL 4YPGA 1IAII 2UY6A 3PFQA 2EXTA 3M1BB 3ULUF 3KWTA 1DUZA 1Q9LA 3CZJA 5E4EB 3PPEA 3ES6B 1I8KB 3UBXI 4LCWA 4UI2A 1RULL 4PSRA 3VFRA 4DN3H 4AL8L 3QJHB 5DRZB 3W11C 2XIBA 4PJEB 1HH6A 3L3JA 2P5EB 2WZ0A 5I1AB 4ORGA 1MNUL 2B0SL 2G0KA 3KPSE 4N2DA 1XHHA 1G9NC 1HHGA 4ZMPA 3IDYB 4AYID 3JWNH 4GAAA 2WAQA 4TUJA 4FFWC 4P49A 5AYQA 4X6CB 3VXRD 3AU1B 3NCYP 5HVWA 1U8OB 2NZ1A 5CJ8A 3H3KA 4JL2A 2X4PB 3RUGF 3TLRA 3CHSA 4MMYB 4B5EA 1A9VA 3WNJA 3ABLB 3F7YA 3H42L 2E27H 1P69B 4K7PH 1U6AH 5T1JA 1E4WH 1FYTE 1NFAA 2CALA 3QQDB 3C6SB 1NMCC 4A7UA 1E28A 4AJ0A 2KZKA 4KO7A 2A9MH 1U93A 3ARRA 4BSVA 3PWNA 4PRBB 1OV8A 4XXDB 1AR1B 5LGHL 1U95B 5IJVA 4L0PB 2QELA 5BJTB 1G1YA 3M45A 5CLXA 3UBGA 4ZX5A 2ZX7A 4D94A 2C7UA 5GS1B 3O4OB 1EHLL 5AZ2H 1ULVA 3EYOA 1U33A 4NFDA 4BWWA 3IXAB 2J1YA 2P5WD 3BUQA 2QQQA 3FU7A 3WU1A 1T3FB 2X88A 2YUXA 3FK3A 5C0JA 3WHXB 2YN5A 3MREA 3UTQA 4AH2A 2OZ4L 3QEGH 1AXSA 1PS3A 1FJ1B 3C6EA 3O2VH 4UTBA 4UIMB 5CLZA 4TVPD 5ESQB 3O3UN 3STLB 3VFSB 1EJFA 4ZXBC 1CLOH 3R0MA 4UUJA 2KH2B 1N64L 3N44F 4POYA 5IV2A 3FN9A 5J5EA 2BDNL 1P4LA 3EFOB 4YDVB 3BKCH 3H2WA 3RB7A 5AOZA 4FQXC 4NOBA 4XMZA 3ZQWA 1URLA 2DJSA 3KYAA 1P4UA 3FB5A 1QFHA 2HJLB 1MW1A 1MCPH 3WJLA 3CH8A 1DBML 2ZOKA 4G1EA 4I4WB 1B2WH 4IIZA 4NQQA 5FHBH 3NQKA 2VZ3A 5A16A 5CN1A 4EUPH 2KKQA 4NYLA 2ED7A 4Y4KA 1TKWA 4IMLB 5BS0B 4HH9B 4JFUA 4ODHH 2IH3B 4I88A 3KJ4B 2FNWA 5T3XE 2Q1EA 4I18B 5JLZB 3NBNA 1EXUA 1PG7L 4GXVH 2V8MA 4J6RL 2BRQA 5K39A 4UANA 1ZT1B 1HL4A 5KS9E 5FIEA 1B3IA 4OF8A 4HLZG 4Q4EA 2A6KA 1GS8A 4QXGH 1OT4A 4PJAE 1G7JA 4X80H 2ZOLB 4ZFQA 3GZOA 1Z3GH 1TYJA 3BT0A 1NMAH 2BNRD 4LP5A 3G5ZB 1KCLA 4DZBB 3HZYA 2MQCA 2R23B 5E5LA 3REVB 1YHPA 1T0MB 4XGZA 5DHVB 1X3DA 2ZKYA 4JFFA 3G6AB 3KHOA 1D7BA 1AQKH 4XCYB 4NO2B 5AOIA 5HGBB 5IVZA 1OAQH 1QSEA 2Y69B 2CHWA 4XOAA 1IAKB 3CPLA 4AQEA 2P48B 1NAML 1MCQA 3SY0A 3EH1A 1T1YB 3K5RA 2C34A 3PP4H 4CSTA 3GDCA 3CUPB 3HHRB 3OG6B 3RFZA 1KB3A 5GZND 2ZCKH 5F1KC 2XTJE 2C1OB 4ENED 1ZWIB 5EBLB 5IFAH 1DQLL 1A7OL 1RJCA 3EO0A 3CFNA 1FPTH 4XVTH 3FT3A 3TOPA 1SHXA 1BGXH 4L4VA 5DJXA 1CPUA 1DBBH 3ALPA 2YO3A 2OMZA 3WNOA 1ZA3A 4AQAA 3FFOA 4KH9A 5ITFB 4X6DF 4MQXC 3NCWA 3K1DA 5J11C 1ORSB 3D39B 1LD9A 1XGYH 3L4WA 4EAEA 1H6TA 5EEXA 3EYQC 4LGSB 2C8NA 4C4BA 1DN2A 4JFHD 4LAQL 4W6YB 1P1ZA 3US9A 1IBBA 5F72S 3BI9X 1RIUL 1S7TB 4HH8A 5GRWA 4NN5B 3QEHA 4U6XB 4P59H 1UZGA 2WKLA 4JCLA 2BSRA 2XFXA 2WIIA 2WK2A 3AB0C 4NKOA 1FH5L 5JPMB 1YNTA 3BE1H 4ODTL 1SJEB 1UM6H 3OKDA 3FFCD 5F9JB 3IVKB 1K5NB 5ACZB 4NKDB 1G1CA 3U79A 1SXNA 4QCIB 1B90A 2H8PA 2Y6SD 3RHWK 1CQYA 1AS8A 2ENPA 2WVVA 4Q89A 3UC0H 1HIML 1LQBC 2GK2A 4KQ0A 3DRTA 2YPLA 1G9MH 5I6KA 2JKNA 3ZT5A 2YA1A 4WDIB 2VLRE 3V0WL 1BVKA 3EBIA 1M7UA 2BWQA 2H3XC 5DJ8A 1L9OA 2MCMA 2O5ZL 5LBSA 3ZDYE 2VCOA 4TF4A 1BF8A 1OGSA 1R24A 4RGNC 5FYJU 2Y1AA 1UB5B 4PJ5B 1HILA 2KUTA 4GBXD 5DEFB 2L7EA 1TOXA 4U6HA 4M4RA 2X12A 4NENB 4L9LA 2HUHA 2B2XL 4NUMA 2V3DA 1MW3A 4GP5B 3VACA 3ZZSA 4YHNB 5D6CA 1UA3A 1ECYA 4E0RB 4XHJD 3DGGB 5C0CB 2WQWA 1MW2A 2BP0B 2G30A 4MD5B 2EECA 4NN6B 3VRIB 4BFKA 2WXIA 5IFHL 3SKUD 5JIQA 4NQVA 1Z1WA 2X1PA 3NIFF 3QDAA 1S7SA 4PSPA 4EN2A 1YNLH 2CSPA 3DYPA 4HZLA 3L7FA 5DI8A 2DH2A 4QR7A 2B1OA 4APQC 5DC0A 4GO9A 2CUMA 2OYKA 2IDUA 2JJSA 2K6ZA 2JIXD 4OCXH 3K4DA 3MODL 1BAGA 1II4E 3B9DA 3I9GH 3MJ8B 3RPKA 1ZOXA 3Q3GB 3VCLB 2O6CA 4PJGF 5GS2D 4AIOA 5F6IC 3VI3B 4UOJA 5BUGA 3HE6B 1COBA 5JHDE 2GIXA 4MJHA 1UWEL 2ED8A 2Q8AH 5I73C 5E2TH 2BZCA 1OALA 3CFCH 3BRDA 3ARFA 5E9AA 1TU2B 5FYLH 1R19A 4KQ3H 1R3IH 4PWEA 1SY6H 4K3EL 4GRWE 2ITCB 5D71L 4JR9H 2DWEB 2V7HB 3MOBH 3ALWA 4ETQB 3BZ4B 2WGXA 3D3VB 2C4FT 3L4UA 3WMPA 4NC1E 2XN0A 4XNBA 3WFBH 2NSMA 3AABA 4XO9A 3EFDH 3G5YA 3E6HB 3V0JA 4XCFH 2DQTL 1GCFA 4MMXC 4W9GC 2ZT9C 1KCUH 4LL4A 3JZYA 4XAWL 4E41A 5ILTH 2AGJH 2BSSB 4BKTC 3S36X 2VXQL 4Z7OF 1YMMA 1YEHH 5I1IH 5CHNA 3VX1A 4FI6A 5IW6A 3GJFA 3ZTDC 5TH2B 3EXLA 4XP5H 3B7UX 4PGDB 2C9AA 3FTWA 1P6AB 1PLGH 2WO3B 3GXPA 3BUTA 4M61A 3L3IB 1MWAH 1MIMH 3WEBA 2GY7B 1ZGLM 5IJCC 1AS7A 3DXAB 3U2SA 3U48A 2VB5A 1A2YB 1YA5A 1O9ZA 1Q9OB 3IBOA 5FOBA 2PW2A 1VFAB 1DQVA 2YAQA 5I82A 4OIIL 4HOZA 4LEOB 2LVCA 1VHPA 2X6AA 1LO3L 4MJ6B 1F6AB 3D85B 1QEWA 2MPAH 1MG2C 4GEJA 4KROB 1QG3A 3TFKD 1GGCH 2NX5B 3BXNA 3S3BB 1KTJA 4KRPD 1AXTH 4X9FA 3BVNA 4P2OA 3FCSA 4V2CB 4LCCA 3V4UH 3VD0A 5AW4B 3RWFA 1HE8A 4UT9L 2DQUH 5BVPL 1U2YA 4PJCB 4LB8A 3FCUB 1O7SA 2P44B 3ISWA 4OGXH 4OI9A 2L4OA 2JQAA 4PWGA 2FO8A 1RIVL 3QUGA 5DHMC 4APXB 1JPGA 3IJ7A 4YSOA 3I75A 4JNXA 5D5MB 2AXGB 5CCJA 3INUL 4PJEE 2P5EE 4EZMA 1OWWA 3GMRB 4V33A 1OAKH 1I7UA 1XXDC 3SPVB 1T0PB 3JT2A 3PL6C 2ICEB 1FYTD 1JOIA 4FD0A 4FZ8L 3B3IB 5FF6A 5GJTL 4JE4B 4PIBA 3U25A 4X6CE 5IT2L 4GQPH 2CRYA 5KVDL 1H0DB 1VADA 2X44D 4J4PC 5I1DA 1KB5A 4JKPH 1TMCB 1FZMA 3N40F 4XNDA 2WUBL 1KPRB 2WTRB 5AFAA 4IDJH 5LJYH 2OMWA 3ECVA 4JK0D 3LKSA 5AD0A 5EU5A 5HP5A 1CFTA 3LH2H 5D8JH 2JJWA 2QGDA 5CM1A 4KZDL 3HJ0A 3O81A 2YXMA 3NJKA 3B8YA 1OSPH 3QYCA 3F58L 1R3KB 1U58B 4OIAA 3TVMB 1AGCB 1ZS2A 3RUGA 5BRPA 1H9DA 2WTPA 2R2BA 3CN2A 1BQLL 3QIUC 5DMYA 1CI5A 1RZ7L 2VN5A 4JMXA 1N6VA 4KO9A 2EUZA 3B9KD 4N8CH 5FR3A 4HETA 1UM5L 4KJQC 4TVSa 4MA7H 1I8MB 4HUNB 4UMSA 3WIHH 2CDGA 4OCNC 1BWMA 5FXCH 2VO8A 2HJFB 3ZBMA 3TIEB 2CLVB 1NBQA 4ENZA 3TWCH 4Q9RL 4FFVD 5C0AA 1Y1UA 4X4YA 2JJUA 3QDGA 1NZRA 2VDLH 1EUUA 1NBVL 2VN7A 4GMSL 4PGBA 3C87A 4PJIB 5JDSA 4Z18A 1U8NB 3VFGL 1EXHA 5T3XD 1E4KC 1A1NA 4MD0A 1PZBA 5D7LB 3RWDB 5C8JB 1AD0B 5I1HL 3CSGA 5IMOA 3RWCB 4NWTH 4ZMNA 2PPDA 4YC2C 1QRKA 4DF9A 1GC1C 2QQLH 1YUHA 2VE6A 1EWHA 1NKGA 2GW5A 2ODHA 4OM1H 4XXWC 5BS0E 2HYMA 1AQ8A 1J8KA 4PI2A 3TIDB 5DZNA 4HAKA 4ZPTB 2ZXCA 1Q0YH 4PB9H 1SRDA 1UM4L 4MWFA 1NEZA 3PG2A 2VJ8A 3BIKA 4PJHB 4F2EA 4Z7NB 2OMUA 5CCKH 3TTYA 3B6SA 1F58H 1MRDL 2YSSA 3BP4B 3CFUA 2PO6B 4ZSOA 2EH8L 4FXGB 4YSQA 2YQGA 2YLKA 2OS7A 3AG2B 3RX8A 4JLRB 2QPUA 1U0QA 4N9OB 5IQ9A 1LWHA 3KYKH 3FULA 4YE0A 4JANA 3GRWH 4EVNA 1KV3A 3T3PF 3MO1A 5I2IA 1S9WB 2Y2YA 3LKOA 3QFDB 3EOBB 4K8RL 3X11B 1NCJA 5EFIB 3CIAA 2W0FA 1GA2A 3ATBA 5F3BA 2HMIC 4D7PA 4PG2C 5EUKB 2DPKA 1HQ4A 4N1CA 4P46C 1HCZA 4U6VH 4W9FC 4FQCH 2G2PA 5LGKA 3BWAA 3FO9B 5E4OA 2ENJA 4CBZA 2AMUA 5IB5B 1MI5B 1AHWA 4DETA 3BP6A 1F2QA 1J9TA 3UAJA 3ENEA 4ZFZA 1I9JL 4Z3IA 1IEAA 2EC9U 4I77H 3VWJA 4UIKL 4TLUA 1RY7B 3VFPA 3ECBA 2VDNL 3AS3A 2YAEA 4Y19B 5SWZA 1BDYA 2X10A 1IB5A 4EBQL 3D39E 2XPYA 3UTTE 5ALBL 1G43A 3JWNC 3DVGA 5MEPA 3MBWB 3MRPA 1QFWH 1JXJA 3BP7B 1E27B 6CGTA 1PX3A 2JCWA 3RY4A 4IRSA 5E2VH 2OMVB 1PZSA 5FC9A 1DVUA 1HNYA 2A4CA 1XGPA 3WXVL 4Z8FL 1FHGA 1X4XA 1CLYH 1E40A 2IPTL 4YLQT 2W0PA 2VLRD 2ADJB 1AE6L 1U9KA 4PJFB 5TE7L 3BPLC 4X6DA 1P9MC 1LGVA 2Q7NA 3LEYL 5C2BL 1I8IA 3MCLL 4BFNA 2WBJA 4NO5A 1IGFL 1G9EA 2KBGA 4PRDA 1FE8L 2BMKA 4HAFA 3C6LA 5HI4C 5IHBA 1BMZA 4HJ0C 2ITEA 2DQIH 1OSYA 1JWUA 2AI0L 5F96H 4J3OF 1WTGT 2PWFA 2X4UA 3OBAA 2HVJB 3WN5C 2BOCA 3BEVA 1RUAL 4IJ3C 4ZW6A 3PWJB 3MLTA 3LY6A 1TQTA 4HPYL 4YX2L 4R7XA 2OSLA 3ARVA 3F83A 2SODB 4KKBC 2QEJA 5I1EL 1CE1H 1SJVA 3V4PL 5LAXB 3FTXA 3J07A 1DN0A 2BHUA 3UROR 2B1HH 4PB0L 3BPOC 2RQ8A 2GJJA 4ZNEA 4EO5A 4FULA 4QOKB 4OQTH 3FQXA 4OCSL 3QYMA 2Y7MA 3A4EA 4D3CH 4UM9D 4HUWB 1IILE 3JV6A 3MHZA 5DK3A 3V4VH 5C0CE 2DMGA 5HY9A 3BKMH 3ZTNL 3SYCA 4UYQA 4QKTA 3ECQA 3CHPA 5ID1B 2Z7WA 4LL9A 3HRZB 5G55A 5LWYL 1FSKC 2F1BA 4FI7A 4NQXA 4FLOA 3AS1A 1O5DT 2Y7QB 1KGCE 3UGEA 3H55A 4PTUA 5INCA 1UXSA 2JB6B 2NY1B 3WEXB 1FL3B 4XP4L 1BZOA 3VI3E 3F6IA 3NGBB 4YXHH 5HYQB 1PMYA 1JNLH 4OSUH 3P77B 4ZUWB 4AZUA 5KSAD 3NIDF 4JRXD 4OD3H 3EG9A 3ZE2B 3QP3A 1IE4A 2WSPA 1XH2A 4R4NC 4NNYA 4OBSA 1INEL 4TQPA 5FM4A 3D3VE 4DKAA 4Z7QF 2I25N 2NXZB 4J3OG 4PGCA 3WS3A 2PWEA 4PJGA 5EIIB 4RIRB 2EIBA 1M9WA 1OAXH 1I1YB 1MFDL 4YR6A 4OF7A 3PWVB 5BXFA 1W8OA 1KCRH 1BVNP 5GGRB 3MA7B 3HI5L 1JWMA 4NQDB 4XVOA 1IGJB 4WK4B 1M71A 1CG9A 5L7XH 3N0AA 3GIZH 3CZFB 1N7MH 2Q87A 3FRPB 3OGCA 4PJBF 3VDAA 2VDOL 4ZTPH 2PR4H 2IWKA 1W0WA 4F7MA 5IUSA 2R1XB 1KTRL 1NLBH 2R59A 3ATFA 2WSKA 4GRMA 1FVDB 4B97A 4ZW3A 2JQMA 3AY4C 3LZFH 3LKNA 1BOYA 1XF3B 1I3VA 4MA8L 5DRWA 4Y4KC 3FUMA 3UDWA 3WNKA 3DXAE 3HVDA 5IHHA 4EIBA 2PTUA 4N2FA 4JCMA 4N0UA 5FYJL 2AAAA 4NT6B 4KVCH 4YMPA 2APFA 3CVHL 3ET9F 2DQDL 2VWEC 3PQYA 5HPMA 3O45B 5DMKB 1EFXA 5HYJB 1G7QA 4I0PA 3ATEA 5B39B 5JIIA 3EHBC 4UT7H 2K9UA 2NX5E 4R5VA 3QZWB 5TQ2L 4DGIL 4DK5A 3T4AA 5I0VA 4PEEA 3GWJA 5C09D 1OGAB 4O02B 4BCZA 4R0LA 4IOSA 5DEGB 3ABZA 4JG0L 2CJTA 2BIQA 3CBKB 4MA3A 2P5ED 5AOJA 2KPNA 4PJCE 4WU5A 1LO4L 5AEAA 4AMKL 2BSCA 2F5AH 3LXBA 4X2UA 4AKOA 4NZTH 2RQEA 3MJ9L 4BRVA 3UERA 3GC3A 4XC1H 3SD5A 5CGMA 5GIRA 1S7QA 3KL5A 1J8HA 3SDDD 5I15L 2NW3A 3MRLB 4LSTL 5D5ME 5EHFA 3IEAA 1WE5A 4G2AA 1Y1DA 1YEJL 3ME0B 1TZHB 2YC1B 3SBQA 5LGJB 2R0ZL 3N3EA 4NM4L 5K9KB 1NGQH 5KBMA 3ARDD 2FO4B 4CVZB 1UT1A 1ADQH 3O9WB 1YJDH 1LM8V 5DVKA 1I3RB 2QHLA 4AQ1A 4PJXB 1SOXA 1TLKA 2WCSA 1NQBA 4YO0A 5D1ZI 5J9PB 1AR1D 3MYJA 1E9QB 1A4JB 3HE7D 4AK2A 3ZHKA 1JZDC 2OMNA 3FAWA 1EAOA 2MCG1 1I8LA 4P2QA 2GPZA 4G8GA 4KO5A 4NWUL 2R8SL 1J0KA 3ARTA 4N4YB 3LN4B 5CSZB 2CA4A 1SVCP 1EJOL 2F54A 1TT6A 1F86A 4CNIA 3GEWB 4JM2A 1IAOB 3FUKA 4I0KA 3DOIA 1DBKL 1K6QL 3T6WA 3K6DA 3DMMD 3V5HA 1YC7A 3N1QC 1M56B 4UQ2B 1MF2H 6FABH 4QRSB 1ND0A 1Q94B 2P80D 2X2IA 3QQ3A 1G1OA 4FNUA 3AAZA 3T09A 2NZ9D 3AC0A 1RV6X 4AGLA 5E8DH 4CMMA 2O6PA 3R7RA 3BGFC 4JPWH 3Q43A 2JKIS 1O75A 1ED3B 2BSBA 2IALA 2CO3A 2W07A 3MGAA 5CEYA 5TF1H 4LSVL 3VYNA 3NRFA 5C0EB 4OFIA 3MRFA 2XICA 3T0VA 2VDPB 5C0IB 3O6LH 2B0SH 2TSBA 4WO4B 2Z8RA 4BINA 2V37A 2F19L 3OJDA 5TFSL 1DQIA 5LGYA 5CEZL 2AJSL 3C5SB 5SWSD 1MRCL 3I50H 4NO0B 4PJIE 4YHLL 4YEFA 2P5PA 3M6DA 1S4IA 1KTBA 4NM8L 4BFRA 1I75A 1JNJA 5D7LE 2AK4A 1M7IB 3CCHB 5B38A 4L8DB 2FX9H 3BWSA 2A83B 3G6JF 2X40A 4IDLA 3T04D 1RLWA 5EC2A 5GXBB 1OARH 4PJ7B 4U1LA 2L0DA 4KU1A 6PAZA 3Q7JA 2IADA 4OM0L 2GT9B 3GHBL 1CL7H 1U8IA 4HOMA 4U49A 1GY2A 1KIPA 2KL6A 4OAWA 5B21A 4W93A 1IC4L 2E5EA 3DV6A 4KFMA 4N2MA 2JJSC 4UOQA 5JIMA 3APMA 4BSWB 2V3EA 1UZ8B 2FD6H 4Z7NE 3EZJB 4PJHE 1S9XB 5CJOL 5B8CA 4OV5B 4QNPE 4WKZA 1L0XA 4KKQA 3NESA 1KJ3H 1TQUA 4W9KC 2H1XA 4LHUG 1ACCA 4G8FB 4X7SL 3DBSA 3ULAB 4F24A 4O2EA 3L9RA 4BA0A 1AP2A 3ARFC 2CGRH 4E5XG 3GUTB 4WK0B 2WUCL 1IFHH 2CHDA 1D5IH 1P0SE 3ARGA 3MOAL 2VJXA 1T5WB 3A4FA 4JY6B 4QYAA 5D96C 5T3ZL 5JW4M 2ZWZA 2CO7A 5IB4A 3SDXF 3BUPA 3ELQA 4HSCX 3HTLX 2PF6A 4HFWB 2DLIA 2Y2WA 4TV3A 3V0DA 1T04A 1A7PH 4K3DL 1OQOA 2A6DA 1LNUA 1N64H 2CBOA 3HPLA 3Q2LA 3UMNA 4RLDA 2H32H 1N3NA 3D39D 2X70B 3UTTD 4RZKA 1RURL 1QSVA 4JG5A 4ZTOL 1MI5E 3ZL2A 3LQMA 5DJ0B 3QUMA 4JB9L 4GT7A 1WK0A 5GGSA 3Q13A 2FQFA 2GSIA 3IS0X 2I24N 4CBPA 2NR6D 1Z32X 2VR3A 2HP4A 4NQCB 4Y19E 4NI6A 1O6VA 2ORBH 5E2WL 2FX8H 1XGRB 1PFOA 4YIQA 2YZ8A 5IJKA 2A77H 2N1KA 1IARB 1KIRA 4LDEB 4HFUH 3GXIA 2ZNXA 3DURB 5KJRH 1URZA 2IBGA 4XP1H 2BIIA 3PREA 4F2FA 2BC4A 3S35X 1CTNA 4KAQL 3VFVA 1FV1A 4P2OC 4RX4D 2FEEI 3WOVA 1BG1A 1EMTL 5AKRA 1HKLL 2BSED 3F85A 2QV4A 1VFMA 2X87A 4PJFE 4R4BB 4BZ2L 2W9EL 1TSHA 3LQAH 5LCVH 4KRMB 3WHE0 1F6LL 2WOYA 4TNVF 3UJIH 5IESH 1WBYB 1WITA 1MFCL 1XCQB 2C26A 1KDIA 4PYGA 2ZSVA 4NHCH 2IOMA 1K9TA 1INDH 1O0VA 1TJXA 5MERB 1ZLSL 1TSRA 1NMCB 1KN4H 1Q0XL 4KC3B 1L9MA 5IQNA 2F58L 3UFIA 1QFWM 1NAMH 4HULB 1I9EA 4ZUTA 4RFEB 5GGVY 4HKBA 4PRAB 5JOEA 1P1VA 5HD8D 3HS9A 3OXRB 2ZUSA 1HWGB 3FSWA 1A6VL 1E8ZA 5C0CD 2HFFA 3VDBA 3TT3L 4UAHA 4AEHL 1DQLH 4N87A 1P5UA 5DJDB 1MFBH 3RU8H 1RSYA 1YNKH 3V6OC 4H4NA 1AFVL 3KPNB 3VSTA 1RJYA 3KPQB 1KGCD 1FFOA 1G7PB 4QOKE 2W8CA 4Y0GA 1VZHA 3IWVA 2FZ3A 3GSXB 4MXVE 5HJDA 4ZFOB 3HE6D 3LJ3A 4PBDA 3H56A 2EE6A 2C3XA 2F74A 4UDTB 3FT9A 3MKKA 3DRQA 4U4BA 1KMGA 1ETJA 3HZVB 1MOEA 1VEPA 4F33A 3O0RL 4WI9A 1XO8A 4ZXBB 5I74C 1ZMYA 5BZXA 1T7WA 3D3VD 1L6XA 1TZAA 4GW1B 2GBAA 4P04A 1H9VA 3L3OA 4MCZA 4IRJD 3IU3A 4NN7C 4RMSA 5SWQA 2EEXA 4AK1A 2YQ3A 1IU1A 1KB9K 5T1KB 1AGEB 2HG5B 4ZUUB 2QSQA 4ZFGL 1EJ8A 1WYJA 3ZE2E 2NTSP 5FUCE 1KYDA 4NSKB 1JGVH 1K4CB 1W72B 3DROB 1CFQA 4A66A 4C4KT 1L5GA 4OV6F 2KT6A 2G0LA 2DL2A 3TS8A 3IDNB 5CAYB 1RL1A 1JNNH 2CJSA 2J57A 2DMHA 1LQSR 1W0VA 3GPEA 4OB5L 4NQDE 1MUJA 4GW4B 3DXAD 3HC4L 1MJJB 4ZODA 4EUPG 2EVJA 4FFYL 4M1DH 5A7BA 2Z0UA 3LD8C 3EGSB 4H26A 4Q56A 4YGVA 1V27A 5E9DB 1HFUA 4FQIH 3ULVE 5GGVL 2ICWI 4CW1A 3DGCR 3LKQB 4NUQA 3SQOH 1PNDA 1JZ2A 5IFHH 4FNRA 3D85D 3S0PA 2OW6A 4BXVA 3JV0A 3RNQB 4I48B 1XZ0A 4ZO8A 2B59B 1DZBA 1PQZB 2KZ1B 4ZMAT 3TONA 1L9QA 1B6DA 4QHNA 1HSBB 3QRGL 4MASA 4P2RB 5EA0L 3AM8C 3BZFA 3PXHA 5CMAB 1FA4A 3L4XA 4BH8B 1WAPA 5J1AA 3WDIA 2OTUA 5M7QA 1TTGA 3MCYA 5JW5A 2MRYA 1UWEH 1HC1A 4HUUA 1AXIB 4PJBA 4WLCA 5HDWA 5KANG 3VA2C 1DBAH 5HYJE 1Q1JH 3ZIMA 3OPZL 4OJEH 3PV6A 5T5FH 2W81C 1E50A 2Y7OA 2G5BB 4G11A 4GI8A 5CN2A 1OP3H 3N55A 4UT6L 4A7SA 1QLRA 5D2LB 1HS6A 4QRPE 3MUJA 1XEDA 1ZLVK 3U9PL 1XR8B 4L4TA 1NFDF 3N06B 4GY4A 5E6IB 2HX7A 1MCLA 3NPZB 1E6JL 2P45B 4K3JH 2X4TB 1TO4A 3W1ZA 2OMTA 3QIWC 1BIHA 3CWGA 2DM2A 4I3RH 3UYPB 7FABL 5ETUA 1AHWC 3AB0B 3CBJB 1RP9A 3IDJB 3KYOB 4LK4A 4OZIB 4JY4A 1G84A 5K9QI 1TVHA 4PJXE 1B4LA 2IBZX 5BQ7A 4FTVA 1ZLUH 1P7BA 1MY7A 1SVZA 2DQJL 1NBCA 5T5NG 2QLVB 2CXKA 3DX9B 1DVSA 3HFFA 3M8OH 2XA3A 1F4HA 4PJ9D 1OHQA 3BH9B 4HUCA 5GRXG 3CFBA 1TITA 1WSST 4Z76B 5FYKL 3Q8AA 4PPTA 3ZL4H 5ACMA 1JZHA 1RZKC 3M1OA 4A1RA 4NUGL 1RUKL 3SDAD 1ZS8B 3P4OA 5J0BA 3UAEA 1KJMA 5IHUH 4RGNB 5L4FA 4A2GA 1S7UA 3VXTB 4M1GL 4ZOBA 2PKDA 2X38A 5BVPH 3STBA 3OMIB 1AI1H 4ONFH 5FA3A 4AUUA 5ENWA 5CIPH 1CDYA 4KDTA 3B83A 3OMAB 1SHWA 3BPNC 1GAFH 2ZJSL 2P24A 2WBJC 5H8DA 4XX1G 4XCNB 4QHLB 5HHPB 2CK0H 3C6LC 4JPVH 1ANUA 2DMKA 3INUH 1N4XL 5DJ6B 4HJEA 1JZ7A 1NDGB 5D7LD 4TSCL 3CQPA 4APQB 1BQKA 4XVSL 4N5EC 4WCYL 1YDPA 3R4DA 3PV7A 1CFNB 1RIHH 1RZPA 5IT2H 5F6IB 5KVDH 5CZKA 2OL3A 5B1JC 2PPCA 3MLYL 1FFPB 2UY7B 3I9AA 5E5MA 3GMOA 3MJ7B 4ZJ9A 1OSZA 1PD6A 5I73B 4I3SL 1CXFA 1U8QB 2VDQH 3LDBC 4QIRA 5J6HB 4CDGC 3QQ9C 2YEZA 2B1AH 1DJYA 1WT5A 2QQNH 2WXKA 5CD5D 3ILEA 2GK0A 2XUWA 3BT2L 4PJ7E 3BUBA 2EAEA 4IK6A 2I85A 4HK3J 4WWID 1C12B 2PCYA 1E67A 1BX2A 1RH8A 2V5MA 3V0VB 4ZTEA 4LAJH 3WTWA 3V0GA 2FJFA 2GVYA 4MMXB 1BQLH 2HFTA 3LIZL 5AVSB 4WF7A 3EYSH 3KYMA 4FFZA 3APFA 4EXKA 2E8ZA 3H9ZA 5SX4I 4S2SA 3IGAB 5KW9H 1FAIL 3G6JA 4OZFA 5FEBA 4JQIL 4U2YA 2FSEB 1UM5H 4CADB 1P7QB 1QD0A 3ZZ1A 3DX6B 5HGGS 5DD3L 4TVPH 2I07A 1YSOA 1T03H 3F8UB 3H9SB 3NTCH 4P5SA 4MX7B 4Q9RH 4YBHA 4JFPB 3LB6D 4X8JA 1NGXA 5DS8B 2ICCA 1S78D 1NBVH 5C6PB 1Q72L 3PHQB 3FN0H 1MIEL 3IJSB 5H94B 3L13A 2X0VA 5IW3A 2R56H 1WP6A 2IFFL 3CU1A 2XBZA 1JFQH 4DFHA 5I1HH 5FECA 4N25A 4ELKB 1IGIH 2CJUH 4O51A 1RK1A 4MJIB 4B3VA 1UJ3B 5DR5L 5EZIL 2AXFA 5CILH 4MQSB 4PP1D 3TPUA 2XWBB 43C9B 3PWLA 4WFGD 1LEIB 4YDLC 3QGVA 3BN3B 3V0FA 3UDWC 1KTKE 1UOWA 3COOA 3DPDA 4NQCE 2RD0A 4I85A 3MLZL 3HLAA 3PWPB 1YJDC 4MHHG 3QR2A 1DE4B 4EOWL 3LNGA 1GZQB 3BN9C 3CC1A 4LKCB 3DUUA 5CCHE 2VDMH 5D2NC 4DKFL 4AQ8A 1AY1H 2VABA 3PL6B 4FQPA 5L2KD 4P5RA 2SEBA 3WTUA 3M17A 4RFOL 4ACTA 1B4JL 2R7EA 4AZ8A 3WLWD 4IRZL 5CU5A 3T4AC 1J1XL 1DVZA 2OXHB 4Y4HA 4U7SA 2YSTA 3P4LA 5FFOA 3O2WH 1DQQA 4RVBA 5F1IA 4QRUA 3RPBA 3FTSA 4KKAC 1XB8A 1ZVSB 1G0XA 2ADGB 3SYAA 4KXZH 2V9TA 3GIVA 2IANA 2VXUH 4M7LL 4EJ1C 1FO0L 5EORH 4ILDA 2R29A 4GQRA 1AMXA 3OPUA 3MNMA 2H41A 4KK8C 4XT1C 5F0JB 2CQVA 4N2BA 3SEPA 1BEYH 4DO6A 4K7PX 5DHDA 4Z7WB 5BPPA 1PF3A 2X1OA 4G8EA 2LR4A 2R2HA 4AJYV 1WFJA 4NQEA 1IGCL 3EH4B 1HSAA 1J1PL 3QG7L 3EJYC 3F05A 3KVQA 4ODWA 4PR5B 5TF0A 3VH8B 4ZMTA 2ZX6A 4L3CA 2EABA 4UIKH 2DZEA 4HWZA 5DFVD 1WGVA 3HC0A 5F3FA 5C9KA 3UC2A 2VDNH 3IS1X 1YEIL 4RMVA 5EZJB 2A6IA 3EJRA 3N85L 4KVPA 5B7EA 5IFJB 4EBQH 1L4IA 2ZKHL 1NCDL 2NY1D 5ALBH 3SZ6A 1YAIA 1QLFA 1M1XA 1NUDA 3C8KB 4MQ7B 4E9RA 2CLRB 1KBPA 2BH0A 5CJQL 3UO1L 4JHZA 1EA9C 4WI0A 4JM2C 2V17H 1GGTA 1U8MA 4DAGH 1RU9L 4I2XA 5DDHB 4GIAA 3RBSA 4HJJH 4GEIA 4L1LA 5CEXA 1KLUA 4MBRA 4QT5B 5HXMA 1VESA 4G43A 4NUJA 4ZT1A 4FYTA 1A8ZA 5EU4B 5C2BH 3CVBA 2AJXL 1GJIA 3RKPA 3PNWB 3FH5A 1MHHA 1H19A 4RCAA 2QQKH 5CNHA 5EWIL 3GMPA 2B16A 4P2YA 2MCPL 1NGWB 5IEKA 5TK4A 1DVXA 4OVUA 5T8IA 1OHZA 2QVTA 2EDTA 4UQEA 1ZA6B 2H0JA 2NUTB 3WJMB 4HJ1A 1RUAH 1CUOA 1CIUA 3IFOA 1XBDA 3KLAA 3RVXC 2YEVB 3FPXA 3IE9A 2X4OB 3F84A 4NO3B 2BVEA 1FNGA 4XBPB 4YHIA 5CXPA 4TQEL 4PB0H 2VXSH 4DPBX 3D05A 1E4HA 1CBJA 3PXLA 4Q58C 4QTHA 2IPKB 1QHQA 4FXKA 2F7RA 3PRZA 5IBLC 1M05A 3B5HA 5E9DE 1Y6MR 5CKAA 4DK3A 4M6NH 1DSFL 3B1UA 4X6FA 2DLTA 4XNQA 4XR8C 2H2SD 3ZGIA 1A6UH 2G9KA 2UXGA 2V5TA 3ZRFC 3MV8E 5HYJD 5A2AA 1ODAA 2D2OA 5GS2H 1GIGL 4GNKB 5AG8A 1GKEA 3NFNB 2DQCH 3QJUB 5DO8A 1O6SB 1QKZH 4P2RE 1EH9A 1AKJB 1SFHA 2DWSA 1CDJA 4W4NA 3IDIA 2VH5L 1G7HA 4JRYB 3N43F 5F0PB 4X7FC 1A6ZA 5JORA 1F8TL 1SBBA 3S6CA 5A7EA 3A4DA 1A0QH 5D7IF 4QRPD 2M1KA 2YAHA 4R96B 5INDB 1QLEL 4XPGL 1KWKA 1BHGA 1R5WB 2VM3A 4LBEB 2EUVA 5AVXB 2HH0L 1XCTA 5I5MA 1INEH 4AG4H 1LL1A 1G7IA 3SN6N 4F27A 2YWZA 2Q7AA 2E4TA 4Y9EA 2X3CA 4GSDH 5D2LE 3KPOB 3O9WD 1OGPA 4FG4A 1MQKL 4OLXL 1UYWL 2LVEA 3MRRA 3QUZC 4MFHA 4YHZL 1FAKT 5KBDA 2ENYA 4J6IA 2RR3A 2YMXL 3DBXB 3V4LA 1C8PA 3VTMA 4G3YL 4B9CA 3LN5B 2CUIA 5A2CA 2O61B 4N0CC 4Z7UA 5L4IA 1SXAA 1IGTA 4Y5XC 5TGBA 4OZIE 4L37A 5H4YA 3BPLB 4V1DB 3FU6A 5SV4A 2OA9A 3VJ6B 3FO1B 2HKFH 5MI0B 3QDMA 1MN4A 3HB3D 4KV5E 1NFDA 2UY6B 3HW7A 4JL1A 3EOAA 4CVUA 1AGBA 4LDOB 1T66D 1DUZB 2JB5H 3EH2A 4LCWB 3VFRB 2DQDH 3WN5B 4IJ3B 3BSZL 5FHAL 3L3JB 1IC7L 3BVDB 3BVTA 3KPRB 1UEYA 2AEPH 4PGJA 1HHGB 4FAAB 1CT8B 1FNLA 3DV4A 3ETBJ 4LT7A 4RGNE 2GJPA 3HIZA 5C0NC 4F7KA 4TUJB 1LO0H 4J1UA 5DRNA 2C9RA 4AMKH 2B3RA 2NW2A 3ZYZA 4N0YL 2BY0A 1DCEA 1QUNA 3SKNA 5C6TH 4G72B 1EO8L 3F7YB 3A22A 1KNOA 1JK8A 4NRYA 3FU8A 4U6TA 3TNNA 5IG7A 4ALAL 2OK0L 3O41A 4M6ML 1E28B 1FSKB 1IM9D 2NDFA 4OLEA 1U93B 2R0ZH 4OZHB 3SDCC 1UCBH 1WICA 2HPOA 3PWNB 5AAPA 5J57B 1MAKA 4BZ1A 3VMPA 5IJVB 2RTTA 3B2XA 4U1JA 4CU6A 2BVUA 3CAFA 5JW4Q 5PCYA 1YQ2A 1QEXA 1GTNA 1P4BH 3T2QA 1P5UC 4Y1AB 2A0LD 2BNQB 3WIIH 2C7UB 1EZLA 2XQYA 2IG2H 1I7TA 1YPZF 3D0LA 3OLEA 3V52L 1U8JA 2IOOA 4NZRH 4UQ9A 5IR1A 1SMOA 2OR8A 1SEQL 4CKVX 3ECUA 4CN4A 2WTOA 5C0JB 3UZVA 1DBKH 3S2CA 5A3IC 2BOBB 3MREB 2DDQL 1XQ4A 3IKCB 2W80C 4H2AA 4AH2B 4LMQE 4X9YA 4QRTA 4G6JH 1RZJH 1D6EA 4PLKC 5JQ6H 4MMZA 3WY3A 4TSBH 3SE9H 3I84A 1IEHA 5FUOH 4S1QL 5IQMA 4UUJB 2C9PA 4DEPC 3U1SL 5IV2B 1JPEA 2V9RA 1P4LB 2XXGA 3L4CA 3L3OC 3LRLA 3RL1A 5CO1A 1ASPA 4QRAA 4LSVH 2YPKA 3U1QA 3VNZA 1Q4NX 4QF1B 4OT1L 3FB5B 3X1BA 1R34A 4OUOA 1C1EL 1KENL 1PZDA 4WUKL 2ZOKB 4G1EB 3PABA 2VAAB 2VKXA 3IAGC 4NYLB 4Y4KB 3H9SE 4K15A 1W15A 4AV0A 2BVPA 3GO1H 5CINH 5T3XH 4JFEB 2VUYA 1IBDA 3ZJAA 3VXUA 1U8LA 3GSVA 3T0BA 1IM3A 5K39B 2BWIA 3T3MB 1ET7A 2G2RA 5LBGA 5I71C 1EDHA 4JS7A 1J5DA 3VFTA 3X12A 3EHBB 1S9KC 1F3DJ 1Q8MA 2A6KB 5DQDL 1JZGA 4HD9A 4MJIE 2Z93A 5JXED 2FBJH 4MA1B 4NQSA 5KZCB 2QKIA 4GKSB 4XWGL 5FGBA 5J13C 2VL5A 3LZOA 4Y5YA 4YZWA 1DR9A 5DQJA 5E6UB 4JDTL 1WJ3A 4HXAL 4OKVA 1MJUL 2H7WA 3KGTA 1IC4H 1KXTA 2D3NA 4FMVA 3QIBA 1Y7VA 5B1CA 3RVVC 4Z7VA 5ACLA 3BW9A 4QGYA 5GGRY 4YZFF 3EOTH 2HT3C 5IVZB 5E7FA 1ZRUA 1QSEB 4N3TA 2CO6A 1BAFL 3CPLB 2DWYA 3BQUA 5DD1H 2CD0A 1A3QA 2RA1A 3SY0B 2XQBH 3US0A 3TBWA 3M1CA 1XF2B 1ASOA 1H5BA 3WTVA 3SBWC 2B20A 4RA0C 2YN3A 1GOGA 5MEOA 4LRIA 3RFZB 2C3HA 2ZUXA 3IGLA 1RJZA 3AU0A 3NJGA 2DTML 3ZKXC 1ONQA 2WN2A 3EO0B 4RBPH 3FT3B 5DJXB 1AO7A 4L4VB 1H6EA 4GQQA 4AQAB 4IQHA 3CLEL 1ZK5A 1LD9B 4KXAA 3RURA 4C47A 4RRPM 5DK0A 2BHYA 3A6BL 3GSNH 1TNMA 4IM8A 3SIKA 4G7QB 3FOLB 3PWUA 3Q5YA 3NQIA 5EZOH 4Z7WE 5KYWA 2YD3A 3QEHB 2OAAA 4YDNA 2QJDA 2W0LA 3C8DA 4PV1C 2AQRA 2CWRA 3ARWA 1AZUA 3OKNA 5K59E 1NJ9B 2BSRB 2WIIB 4HGKC 4NKOB 3BKJH 2XXMB 1YNTB 3BGFB 2D3VA 3S97C 3OKDB 3IF1A 4FFTA 4OJAA 2FHCA 3AZUA 5E2WH 5ALCL 1WCQA 3S96A 3GTNA 5IMKA 5J6GA 1QVOA 3CTTA 2H8PB 1DLFH 5DVMA 4MAYD 2B14A 2RHEA 2WVVB 3ZHDA 3CDGB 4UM9A 2GEEA 4PBXA 3UYOD 1SDDA 3DWTA 2EIZA 3LXUX 4A37A 2OJZH 4BQCA 1BVKB 1UXWA 5DJ8B 2NY2C 2HLAA 5DUBA 1BWWA 1R0AL 1PSKL 1R24B 2MIZA 1HKLH 1HILB 2BFGA 4BZ2H 25C8L 2W9EH 3UG3A 5AAWA 4M4RB 1PBYA 2CKBL 4M5TA 2EDLA 4Y16D 3PY9A 4HMEA 4PY7A 3HR5A 1OD7A 3SZKC 2MPVA 5FO9A 4IU2A 1WGOA 5D6CB 3L3HA 1NTDA 3ULVL 3E1ZA 3WLBA 1P5VB 3ROOA 1U91A 1WCBA 4UILH 3IYLW 2YD0A 3T2PA 2CH8A 4HCFA 4MKMA 2ZOWA 2IGFL 3AT9A 1KGYE 4X8GA 1S7SB 4NS0A 3QPXL 2JELL 4HZLB 3L7FB 4H1LH 5DI8B 5JHLH 4HUXA 4Q2ZA 3FQ1A 2FSDA 4MAUH 2C9XA 3SKOA 3BFWA 3X1EA 5B3NA 3MV8D 2X1QA 3GQFA 3LOWA 1UD8A 1AJ7L 3T77A 4P8QA 1NMBH 2F8OA 4OBRA 2XN9D 5DXWA 5EUOF 4P2RD 1OCOB 2BS8A 4N0RA 4X50A 1EEUA 5TPWL 4JPKL 4DZ8A 2BNUA 3ARFB 3HN3A 5HHMB 2Y25A 3E8VA 3O6KL 1RSFA 3IU4L 4WEUD 2RALA 4YHKH 4O02L 3LZLA 4GRWH 3U4BL 3QYNA 3H85A 2V8LA 1CD1A 3MXVL 5D96B 5E00B 4YSPA 2ZUQC 2PXYD 1M57B 3LSOA 1RUPL 4NPKA 4OFYA 2CCVA 2YBGA 3G5YB 4HCGA 1NDMA 1DZ0A 1L9RA 1PPIA 4KI5F 2VN6A 4JRYE 4MB4A 2QLYA 4MDJB 4K71C 2GB2A 4LEXH 1KYOJ 4YUEL 2ZONA 2HSIA 3HMXH 1FCCA 4E41B 1CURA 3S5ZA 1ZLDA 4NBYB 3IAPA 3EYQD 3FQWA 3MNZA 5CHNB 5IW6B 2X89D 3TJPA 4U7KA 1D3CA 5E6ID 1VACB 2XV2A 1JE6A 3T2NL 5C09A 4R4FL 4LESA 2UZIL 3WY4A 1IFRA 1Y6KR 3W81A 2BY1A 5I1KL 1SDYA 1CD9B 4Y4FA 5C0BD 1ZEAL 2COVD 2AK1H 1D2OA 4MNQD 3UZEA 4M1CC 1GVIA 5D7IA 1HINL 2PW2B 1KGUA 2EUWA 1A1OA 2LTQB 3SGKA 4QYOA 4L3FA 1U3YA 5DTFA 1ZVHA 1QEWB 3CPUA 3MRCB 2A9NH 5GGVH 4ABWA 2Z7YA 5KBLA 1TETL 1SOQA 3C60D 3WKMH 4AM0Q 1CR9L 3BVNB 4P2OB 2N0KA 3FCSB 1YEFL 2MNUA 2E9IA 4LCCB 4R97C 1PJWA 4ODXB 3WIFA 4OI7A 4PUBL 4V1DE 1PEZA 5GZNC 3DSFH 1AZVA 2R27A 4WQOA 4ENEC 5DJZA 1IC0A 3BDBA 3O6FA 4OGAC 4OIFA 4KX8A 4RGND 2B4CH 3FQ4A 5C0DB 3RI5F 4PGEA 4Q6IC 3FU0A 1IAMA 3DJZA 1JPGB 3I75B 2OQJA 4IJTA 4FHBD 4LCWE 1N5YL 2ZSWA 3Q1SL 1QOKA 5CP7A 2VDPL 3KPRE 1CI3M 1TMQA 4BFGA 4ZDHA 4YSUA 2BINA 1SZNA 5FB8A 4X5WB 4ERSH 3LH9A 5DZOA 1FLRH 1XTMA 5EU7E 1RQ5A 4Y4HC 1X5YA 2XG4A 5BRZA 2A6JA 3BZEA 4APQD 1S5HB 4PWIA 1KOAA 4PVLA 1KB5B 1MCEA 1KDJA 1FZMB 4FP8L 5GSVA 2QFPA 3MLWH 5DHYA 3TV3L 3X1NA 3KH3A 5HHXL 2OMWB 1BG9A 2VDLB 1CQKA 3LKSB 5KJ7E 2D3LA 2NQDA 2Y6SC 1R75A 1E6OL 1VPOL 5KTEH 4OZHE 3KLKA 3RAJL 4UTAH 1CGWA 3AW5A 3LRKA 5FO7B 1RI8A 4JGUA 3GMNA 2ADYA 1WLHA 4N8PA 4WY7L 4A2FA 5I74B 5L8KB 3RUGB 3GGWB 1BVNT 2R2BB 3MYZA 1BFTA 1ILUA 2HA1A 5C07D 5SWSA 4Y1AE 4NN7B 2BNQE 1A6AA 3CN0A 3QJSB 4NHUA 4X98A 5LG1A 4GBXC 1AZZC 1LK2A 4XP6H 5GISL 1QW9A 2RFXA 3H2QA 5FCSH 3RX5A 1IIKA 3KR3H 1YRKA 2ZCLL 2WNKA 4HBQA 3P3YA 2CDGB 2FQDA 3IN2A 3U9UA 2NYKA 3AT0A 4NUGH 1OW0A 4FCAA 3O2DH 1NIBA 5C3TA 2ARJA 3FB8A 1F02I 4F20A 4U3XA 1P7QD 3M46A 3P9WB 4M1GH 3T4YA 3QDGB 4DVRL 4HJGA 1Z0NA 2E7LA 2YD4A 1MCCA 4KWUA 1YPZA 3H9SD 4PGBB 2G5UA 1QHPA 4ZYKB 1GSMA 5JDSB 4HWNA 1R5VA 4M3KB 2R0LL 1A1NB 3LD8B 3QUXA 1QZNA 5MEQA 3GKWH 5L9DL 1OF2A 1ZHBA 1H3TA 4I5BA 3GBNL 3MACL 1VZGA 1IBYA 2CDEA 4K94H 3RA7H 4F92B 3DJRA 4JM4H 2YRZA 4QRBA 2GFBA 4PV8B 1I8AA 4TULL 3T0XA 1MJ8H 2ID5A 5T1DH 4JFEE 2Q9OA 1KBGL 1E3ZA 4RZCA 1BQHA 1M42A 1QBAA 5GRZA 2XRAH 2EO7A 4TNGA 3Q2WA 4MWFB 1NEZB 4YFEA 5IM7A 1FZOA 2VWEE 2OMUB 4KX7A 2BJML 3DHUA 1L6PA 2WLHA 1MCWW 3B6SB 3T3ME 2YSSB 5D7HA 4I3SH 2XCMC 3TM6A 4ZSOB 3DKHA 3RDTD 5AW1B 5IZ7A 1G9NL 4R26H 4E9YA 3S2AA 5IQ9B 5IB2A 5KYYA 3BT2H 3WUZA 2E47A 1E30A 3QARA 4D7BA 4JANB 1QRNB 1TQBC 5E8NA 4QHPA 4WFHD 3PL6D 1TTUA 3REWA 3MO1B 2EEDA 1A4AA 4UOZA 5I2IB 5EF2A 1A3ZA 4C8XA 4X6BA 3LKOB 4JFFE 4D8OA 4KITB 5EOCL 4ZMXA 1NOLA 4CL7A 2W0FB 1Y18A 2EE0A 3MRNB 3QXUA 1GMEA 3KPPB 5F3BB 2R69L 1QSEE 3IFLL 4P5KB 2OYMA 3B7TA 2VR8A 1HQ4B 4LDLB 4HSAC 5D1ZD 4TOYH 3QIWB 4H88L 1FAIH 2XWXA 4QEGA 1QTPA 3BWAB 2ITDB 5EU6B 2R1WA 5AALA 3LZRA 4P99A 1AHWB 5F1OB 3PJNA 1ZHLB 3BP6B 3TFKC 5CZXC 4EDWL 4XPFL 1IKNC 4KRPC 4ZFZB 1IEAB 4U1KB 5BZZA 2VLME 3VWJB 2EVFA 3O4LA 1DVFA 3DJ9A 4POUB 3VFPB 3ECBB 1R6VA 4L4VE 5TD4A 3SQBA 4ES8A 5SWZB 1A7RH 3B56A 5JDJA 1T89C 1Q72H 2WP3O 5DRXA 3MBEA 1NCNA 2VDKB 5GJSL 4FNLH 1IBZA 3EDJA 1G5GA 4PY8I 2IFFH 4XNMA 3CFIC 3MRPB 5J1TC 5IROD 1JPSH 1SDAB 1P53A 2GY5A 4BM7A 4JVPA 1T21A 1WAAF 4NRXA 2DI8A 4IRSB 1NCAL 3ZIYA 5EEVA 3H0TA 5DC9B 3CZNA 3F6JA 3QEQB 2J72A 2R0KH 1BA9A 2XTSA 1XGPB 3MLXH 4M43L 3CX5J 5JW4R 3VW3L 2ZOUA 1AZCA 1OPOA 5F3HB 5AW7B 1CTMA 1X6NA 4X6DB 3L9EA 3KH4A 4NP4L 1I8IB 3H9HA 3L6FA 35C8L 2WBJB 1CF1A 4NO5B 2WNWA 2D7QA 2BMKB 1WO2A 3C6LB 4Y2DA 4WV1A 4EKXA 1UENA 3AG3B 3NRQA 3U7WL 1A47A 3LS4H 4YAQA 1X5KA 2E7MA 1JSYA 2BOCB 4L29B 5CEZH 2AVGA 3B2VH 4XH2A 1BYPA 3QFJA 1HNGA 1B4JH 2OSLB 4NZUH 3SE3A 4IRZH 1J1XH 3Q6GH 3T2LA 1DFXA 3WS6C 2DJMA 2AQPA 3A3YB 1OT2A 1DJGA 2YK1H 1KFAL 5I1LA 4M48H 5I30L 3FQXB 3LDBB 1XGTA 1DJHA 4NUPA 2CHXA 1KCVH 1RZJC 4O9HL 4KUCF 5IOPA 3LVEA 3IMBA 2YKLL 3B9KC 4HCRH 5HGDA 5HY9B 1HOCA 5B3SB 4NQXB 1AGFA 2I9LA 4I8DA 1QX1A 1N0XL 4OGYL 4QRRA 4MRBA 3K2UL 1J9RA 2YXVA 2OZ4A 2WWMC 1J1PH 5F9WC 4M7KH 4PTUB 1UXSB 1ES0A 5INCB 4BKLB 4FFVC 2LFEA 2AVFA 3FONB 4ZI8A 1V7NL 5ADOL 1DJZA 3H7LA 5DYFA 1AKJD 3VSVA 2GUOB 3EG9B 3MV7A 1FZJA 5H37H 5IB1A 5HHME 3GUFA 4JG1L 1YUKB 5CJQH 1CICD 3PHOB 1JBJA 3KDPB 1YEKH 2DQHH 1ZKAA 5B1AB 1BZ7A 3ZOAA 4B0MB 3MRQA 15C8L 1BMWA 3QG6A 2FE0A 3VGGA 5C97A 3WS3B 2DJ4A 2K8MA 4KDVA 4H25A 4PJGB 2DLFL 3NA4A 3CN1A 4YR6B 1IEBA 1M53A 4MMZC 4N8VA 2VITB 1DSYA 5EUOA 2OI9C 5EZLA 5D93C 1W80A 3SE4A 2PYEB 3F7VA 4E41E 1M71B 3GSQB 1CG9B 4HS3A 2H1PL 5EWIH 3PGFL 2MCPH 1D7DA 2GJ6A 3FSOA 3GLZA 1YYCA 4K7FA 5JOFA 5KVMC 1HJBC 3OGCB 4ZUSA 3H53A 2Q20A 1DBJL 3WD5L 5E6SB 3NN8A 4F7MB 2ZYIA 2FB4H 4G6FD 4GRMB 3CU7A 4YDLB 1JIBA 3LKNB 5DRWB 5F6HI 4S1DD 2FLRT 1F90H 4YK4B 5DLML 2FECI 1MCWM 4V1DD 3I6LE 1FN4A 1A64A 3BIBX 4Z7AA 5E4IA 2OR9H 3QWQB 1IQDA 3JQOB 3KBEA 1PG7X 3PQYB 4IKIA 5HPMB 4OCWH 1AZRA 4JN2A 1T1XA 1EFXB 3DIFA 4I0PB 5HVFB 1ZHKB 2YRBA 3IMUA 3T4AB 4LCWD 3RJDA 5JIPA 3MA9H 3EF4A 4R0LB 2HT4D 1JK9A 3EH3B 4RRPG 3SD2A 2YFOA 2QKIC 3PHAA 1PIGA 4WU5B 5FGBC 4Y5YC 4F37F 3GRBA 5M94B 3WUWB 2B9AA 2ZKWA 4XZ4A 5GIRB 1TCRA 2M26A 2VH5H 4RMTA 1QBML 2HFEA 4BV1A 1J5CA 1YCSA 2NW3B 4YDMA 5DVOA 3NCYS 5BUAA 2NRDA 1R3LA 3MCKA 4N2IA 4YHMH 3BQUC 2X53A 3HI1B 3VD1A 3FUEA 3S4SG 2FLBT 1YEGH 3HMWH 3JUZA 3KXFD 3U2IA 2DTSA 3B5GA 1UB6A 3HNTH 2P47B 4LRIC 1FNSH 3MNDA 5DGRA 3FHAA 4AQ1B 2APXA 4NJAH 3V6OE 4YO0B 3ULUE 3HG3A 1DQMH 3MYJB 1WBZA 4U1IA 4IGBA 2W91A 3BAWA 1UYWH 3U6XA 4GAJH 4G8GB 3VU2A 1YVLA 1PZCA 2YR3A 8PAZA 1IE5A 2F54B 3B2MA 5D7EA 4JM2B 4CNIB 2A5UA 4RWYL 4FNQA 1BYOA 3V5HB 4FQQA 2E86A 3DHMA 3FDWA 3QQ3B 1QNIA 3FTGA 3RUGE 3WYRA 2X6VA 5DWUL 1KUMA 3LCYA 4AIZA 4CMMB 4XB3A 1IC5H 1D5BB 5E1GA 2ZNWA 4PJDB 2IALB 2VUKA 2ATKA 2W07B 4HKJA 2AHIA 2ZPKL 3OG4B 5I8EA 2AW2A 1WA2X 2DI9A 1NLDH 2VTFA 3MRFB 4XAKE 2CR6A 3MX0A 1WD9A 2OFQA 1Z9MA 2YPVL 3B37A 1HESA 5D4JA 5I66B 3H8NA 3VFOA 1ESOA 4PRIA 2XZCH 4FZEL 2RAMA 2O26U 4Z6AT 3OJDB 3Q2VA 2CBMA 5C0AE 4CGTA 2ZUUA 3QDGE 3BKYL 2OYPA 1P2CA 4JCWA 1PZ3A 3G5XA 1TQWA 5AAWC 3VRLF 1JERA 1AQMA 1GGIL 1I3GH 4UB0L 3DX4A 3LRGA 2EIDA 3J7HA 2VOTA 4AQ1C 4QKXB 2JKLA 4ALAH 1OCWH 2AK4B 3WTSA 5B38B 1NCWL 1JMZA 3BD3A 4HK0A 4Y9GA 4JGMA 3FU5A 2J8UF 3NRPA 5EC2B 3TGXA 4HWBH 3EHBD 5K9OB 2IADB 5KANI 1WIPA 2A73B 1U8IB 4HS8L 2ZIDA 1QAWA 4OAWB 1TZGH 4HHWA 2X0UA 3DV6B 1UA6L 3ZQ9A 3DX8B 4LCYA 5KYUA 4TS6A 5KAQF 2AJVL 5DF0A 2GCYB 1XTLA 4PI0A 2OMXA 1DSWA 4WKZB 5A2BA 3W0WA 2BO0A 3HS0A 2GI7A 2ZE0A 1NFKA 4JFFD 4ZSOE 4OLZL 1GYUA 1A14H 2VXQA 4O2EB 1MRFL 3L9RB 2OP4L 5AZEL 1ACYL 1AP2B 4R8WL 2IC2A 2KQNA 3OMZA 3UBXA 1DQTA 2XZAL 2P8LA 3X2QB 4GI6A 4MNHA 2QVKA 2V2XB 2PYFA 4KKNA 5AVVB 5HDOA 4NZJA 5IB4B 4L3AA 2E75C 3VI4F 2XPGA 2WXMA 5AKVA 2J88H 4JX0A 4OZGF 1WFUA 2VLMD 4S1QH 2A6DB 1LNUB 3HPLB 4EZKA 4L4VD 1NGPH 1BPVA 3BO8A 4XCCL 4EPSA 2B4CC 3ABKB 5EU6E 4DKEL 1X5LA 5L2KA 1B0IA 4Y5XB 3TT1L 2G3MA 2BY2A 2OBGA 3ML8A 3QUMB 2K3HA 3T3PB 5GGSB 3S8GB 3MC0A 3TTSA 4TQ8A 4D9RE 5HSFA 3QRLA 1T83A 4UT9A 3CLFL 2QR0A 5KVFE 1C7TA 3DJSA 3GJEA 4FJ6A 5SWZE 1RMFL 2D7MA 4MLSA 4X5LA 1IAIH 3IDGB 5K9JH 1KLFA 2OTWB 4U33A 1M6UA 1S7RA 4YIQB 4UOW0 1FZKA 5ESVA 1DJIA 3SGKC 4LIQH 5E51A 3PXJA 3SDDC 2XDHA 2I60H 2DKUA 1IGYA 1VFBB 4RESB 2CO2A 3F62A 1JUFA 1BVZA 4IBYA 2Q6WA 4AVKA 1BXAA 1SHMA 4YFDB 5EZPA 1FV1B 3ARDC 4NP9A 1U3HA 2YPLD 1OP3K 3EOYG 5EV7A 4L3ED 2E7BA 4X6DE 1EO5A 4IKJA 3RL2A 1OP5H 3DTXA 5ABAA 4K5LA 1LJMA 3GS4A 1TEYA 2C3VA 2CE6A 3HE7C 2YOCA 1FNEA 2YD1A 3LYRA 4CILA 3ARED 3GZQA 2DW5A 4KOBA 2BZDA 1WAAA 1BIIA 4XO5A 5EO1A 4R7NA 1GC1L 1CFVH 3I2CL 1N12A 4X9HA 1ZVNA 5DZPA 1HHKB 4K7PY 3DMMC 1G6RL 4I3GA 2ESVB 2HFFB 5JXAL 1G0YR 3KE0A 1JNHA 1MELA 2GABA 2X6UA 1ZLUK 1C08A 1P5UB 3KBPA 4R5XA 1JRHI 5J12C 3W9EB 5IJDC 3VGDA 1C5BH 5EB9A 3EUDA 1L6ZA 2NZ9C 1FFOB 1BFSA 1JVKA 1P6WA 2MTPA 5ICUA 4ZNEE 5DFAA 3ZTJH 4DGYH 2FZ3B 2VSCA 1HL9A 4BFJA 4JFDA 1FG2B 4B9PA 1ZLWH 5F7YC 2VSMB 2DEWX 2F74B 3DSNA 4HC1L 2C7FA 1I1RA 3MFFA 3D0AA 4U1NA 3DRQB 5HHMD 5TJWK 3FT4A 4L5FH 1Z9NA 2WY3B 5FK9A 4HZ1A 3P54A 3OSKA 1NPNA 2WQSA 4YWGL 3PCYA 5FW8A 3TBYA 2WZPA 3S7GA 2D31A 3VA6A 4DEPB 4D8PB 4NGHH 4K94C 3R06B 2EDYA 4MCZB 3L3OB 4LCVA 5SWQB 3IU3B 3E9TA 4P57A 3R0NA 4L8SA 1I82A 2ICWJ 3FOMA 3HBZA 3M88A 3NA9H 4FOMA 2EYRA 1UH3A 1GZPA 3RX9A 2WJ7A 4WNQA 4E41D 4DN3L 4F15B 2KMWA 1YMMD 4M62H 1CFQB 4FADA 3GMMA 5ABZA 2P8MB 3KWWA 4UDUB 1PSKH 1JGEB 4PJGE 4FYRA 4KK9C 3VUAA 2J5WA 1LTXA 1P6FA 2YBRB 1MUJB 1WS8A 2BVYA 1HTYA 5I71B 5CFAA 3QW9A 4PRPA 4ZOEA 3P3SA 4H26B 4YGVB 3I6LD 4LPXA 1V54B 3D4YA 2QMJA 1IJ9A 3L2NA 2F53D 2PP9A 1OPGH 1MCDA 1U6AL 2VZUA 4K7PL 4Z7QB 1DQDH 1E4WL 1MCOH 2IGFH 1AIZA 1XZ0B 1CD8A 1ZVYA 1A21A 4LLDA 5E70A 1AOZA 3QR1A 2A9ML 3BIAX 4FJZA 4W9HC 4A7VA 2BVQA 4XMUA 3SB3A 5BO0D 3SOTA 1T80A 4DTGH 3OB8A 5IQ7H 5AYUL 5J1AB 2OTUB 3TH4T 1LP9B 3ZR5A 3PQYE 3EYVA 1A7QH 2ZCZA 4MBOA 4PJBB 2F08A 4FS0A 2Q8BH 4PS8A 5C08A 4DP9X 1LWJA 3QULA 3O6KH 1PAMA 2BFVH 4MKTA 2BP8A 1F3DH 2PW1B 3PF2A 5CP3H 1J5HA 3PV6B 2VMFA 3ESUF 1JYXA 3LTVA 5AB1A 3P0YH 1KV7A 2DMBA 5G4NA 1B88A 4CJ0A 1QLRB 1RUPH 3RWEB 2YFNA 2PNDA 3NCBB 3QEGL 4FEMA 3IJ8A 4NN5C 2NR6C 4GG8A 3O2VL 4YSAA 5I8OH 1A9EA 1J8HE 1MHEA 2N3JA 1NCBH 3ULUD 4BIKA 3F7KA 3ASWA 1CLOL 4JGJA 3WE6B 5D1QA 2B7DT 1MVUA 2OMTB 1OGTA 2EKJA 4BWTA 3MRMA 3BKCL 3KZ8A 5IKCA 4GG6F 1CIDA 2VQ4A 5ETUB 4UU9B 4P4RA 4PWJA 3CXDL 3T2NH 2JF1A 4JY4B 4N2NA 1J7VR 1TVHB 3L3GA 3X1FA 1MCPL 3TO2A 3K2MC 1QR1A 1B2WL 2FWOA 4G9FA 4LASH 5BQ7B 1HDMA 4E9QA 2ZG3A 3RWIB 5LDUA 4MQTB 3PDOA 4A6YH 2NDGA 4ODHL 2FWLB 3CSBA 4OH2A 4G8GE 5FV2A 2HWZH 3IE4A 4GXVL 5D7KE 1JZEA 2F54E 2YA2A 2HB0A 1E3FA 4EIUA 5E08L 2NY2B 2G75A 4DVBA 3P4OB 1N67A 1SOSA 1KIUA 1KJMB 3MNVB 4QXGL 4B3EA 1S7UB 4XAKD 5HD8C 3QPQD 4X80L 2VQTA 5FA3B 1Z3GL 4X4MA 5ENWB 1NMAL 1KTDA 3V4PA 4WI2A 4JHWL 1DANT 2BVTA 4A2MA 4N26A 5C0AD 1DP0A 1HJCA 3GBDA 2P24B 4PJDE 4YDJB 2WAHA 4KQ4H 2CGYA 1SXZA 2NY7H 1CDCA 1AQKL 3HZMA 4JBSA 3ZX1A 4N85A 4ZMYA 4PRNA 1V8HA 1F41A 3IJYA 3TCTA 1CDBA 3M7FB 2UZYA 3GSOA 4FC3E 4X4XA 2X2HA 1OCCB 2JLLA 4UF7C 4O58H 3HAEH 1YDPB 3PP4L 1BD2A 2P8PA 2G2NA 2DBLH 1E4XI 3A6CH 4M8VA 4Q9QH 1U92A 1WZMA 2ZCKL 3KWXA 3P40A 4PRHA 5CLYA 5IFAL 3G9VA 2E46A 1D9KA 1RVFH 3NOIA 4UQ3A 5E5MB 2ROXA 3GMOB 1FPTL 1OSZB 4LSSH 1PD1A 4XVTL 4G70B 4YXKH 1BGXL 1DBBL 2NT0A 1NCOA 4WIQA 3AACA 4IRJC 3ELAT 5DD5L 2KZWA 2AK4E 4B9KC 3WFHA 4BDVA 2Y3NA 4J8QA 1ROCA 3IDMA 2WLIA 4HV8A 2GK0B 2NYYC 4B41A 1S7XA 4HUVA 1JS4A 2ZUQB 4PWKA 5I1CH 2R4RH 3PAVA 1BX2B 4YJZL 2N01B 3LQZB 1TPXC 2FJFB 1SJXA 3I9IA 4ZMVA 1K8DA 2MEJB 4LLVA 2WPGA 4Q0XH 2V7NB 1CGTA 2X9ZA 4HGMA 2VRQA 3IPBA 2EZ0D 5IBUG 4J2XA 4S2SB 1UM6L 4LXFA 5AQ0A 4OZFB 1LO2H 1ZT7B 3NMEA 1ZT4A 4RNRA 5GS0D 4M8RA 2J6EH 1L9SA 4ADJA 2XFGB 2VQUA 2I07B 2R39A 5EOTA 5DHXB 4LEEA 1JXFA 3B2UD 3CDZA 1JGLH 3R7QA 4DERA 1AH1A 2Y0SA 2EDQA 4X8JB 3UAJD 1ACXA 4X6CF 1AS6A 2ZZUT