3ED5A

The crystal structure of yfnb from bacillus subtilis subsp. subtilis str. 168
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
232
structure length
232
Chain Sequence
MKRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKPNVPEIIPTYEIRKLEELYHILNIENT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YfnB
total genus 85
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3ed5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ed5A01
1L6RA 4Y2PA 5ALEA 1L7PA 2IOFA 2WF5A 4FE3A 2I55A 1J8DA 4YH1A 2AGVA 4C4RA 3WKEA 2OA0A 3ZVNA 5AIAA 2HI0A 4Y2UA 3S6JA 4UMFA 4CF4A 5A3RA 2I33A 1ZD5A 1T5TA 1Z4NA 2FPSA 4GXTA 1MH9A 3P96A 2FPUA 2P9JA 3U26A 1EK1A 5AVUA 1L7OA 1WR8A 2ZBGA 1AQ6A 3ZU6A 1N8NA 2FUCA 3W5DA 1Z88A 2YMQA 3QNMA 2O2XA 5ALQA 3R4CA 2BDUA 1O03A 5ALFA 5AKKA 2W11A 3QUTA 1Z4LA 4Y2XA 1U7OA 3QX7A 3OCZA 2GHTA 4KNVA 3OCYA 3SKXA 4IFTA 3AR9A 1YV9A 3BA6A 3OCUA 3ZVMA 5AKYA 1S8OA 3WK6A 3BWVA 3GYGA 4XQ0A 2YJ5A 4I9FA 1VFPA 5AICA 1LVHA 2P27A 2Q5EA 5ALHA 4NABA 5AVYA 3EF0A 2IA5A 3QU4A 3RF6A 3PDWA 3L1VA 2HHLA 4Y2QA 5AVZA 4G63A 4UAVA 3A1CA 3WK4A 4QQFA 5A3SA 4PNHA 1KYTA 4CF3A 4KX5A 4Y2TA 2R8EA 4CNQA 3NUQA 3WGUA 1RQNA 3ZX5A 1U7PA 1ZD2P 2GO7A 4Y2SA 1QH9A 2ZXEA 3L0YA 1ZOLA 1Z5UA 1U2SA 5ALOA 1NRWA 3QXGA 5A3QA 2NO5A 2IYEA 1RLOA 3PGLA 4UMDA 4RESA 5AM2A 2ZBEA 5E0OA 5AI9A 4RETA 1QQ6A 5AW2A 1TE2A 3KDPA 3UMBA 4XOUA 3N5KA 3HLTA 3ONNA 5ALLA 3D6JA 4BNDB 3MMZA 4J03A 5FP0A 5AM5A 5ALIA 3ET4A 2RARA 5AKHA 4BBJA 3NRJA 4KNWA 3ESQA 5ALZA 4HGPA 2JAOA 2B0CA 4FYPA 5AK3A 5AVXA 2CFSA 2MSNA 4E88A 5AKGA 4Y2RA 4EX7A 4NAVA 5AI0A 4BEVA 3AR2A 3NANA 5AHXA 2IOHA 2HSZA 4DFDA 2ZBDA 3R9KA 2CN1A 2B82A 4KX3A 2AMYA 5AKEA 4HGNA 1L7MA 1RRCA 4B6JA 2C8KA 3L8EA 1TJ3A 1XPJA 2G08A 3N8GA 3NASA 5AW8A 2GMWA 4UM7A 4OHFA 4XE5A 2FI1A 3ZX4A 1WVIA 4Y2YA 3OTQA 3NALA 2GHQA 5AKJA 1T9ZA 4UATA 5AKXA 3B8EA 3IB6A 2WM8A 3SKYA 2AUTA 5AW0A 1RMYA 3QU2A 1Z4QA 3WKAA 4GIBA 2G0AA 3ESRA 2VKQA 4UU1A 3U7FB 5AK6A 2FPWA 1Y8AA 4XPZA 1Z5GA 2R8YA 4C4TA 1RDFA 2D2VA 3L7YA 4Y2VA 1VJ5A 1FEZA 2DQSA 1EK2A 2HEGA 4L6AA 3QUCA 3VAYA 2G1AA 3AR6A 1Z4KA 2YJ6A 3F9RA 3U7EB 5AKIA 3AR3A 1Z4MA 5AVVA 1SU4A 4EZEA 4C4SA 1YJ5A 3U7HB 4UU0A 5AM1A 3I28A 2I7DA 4UASA 1F5SA 3PGVA 3U19A 3OCWA 1J97A 1NF2A 5AW6A 1U02A 2HF2A 3DV9A 2ODAA 3AR8A 4AP9A 1SWVA 1NNLA 3UMCA 4YGYA 4CE6A 3FPBA 2PR7A 2X4DA 2JAUA 4FFDA 4JDPA 5ALVA 2OM6A 5AM0A 4NFLA 2MU2A 1WZCA 3L0CA 4AS2A 1X42A 2W4MA 1ZD3A 4JB3A 3DNPA 2C8LA 3AR7A 2RAVA 5AW1A 3NIWA 2YBDA 1JUDA 3SF0A 1QYIA 4BYGA 5ALSA 5AESA 4UM5A 4UW9A 4OCZA 3WK5A 2HCFA 2I6XA 2R8ZA 4MWOA 1RPZA 2MU1A 3RFUA 2ZBFA 3ZTWA 4MUMA 2C4NA 1L8OA 3WGVA 3DDHA 3IRUA 3A1DA 5AM4A 5ALUA 3CNHA 3EWIA 5ALRA 5IT4A 4CF5A 4HYTA 1RQLA 5ALXA 4YCNA 1Q92A 2PKEA 3A3YA 1TJ5A 3W5CA 2CFRA 3WK9A 1ZJJA 2WFAA 3WKBA 3W5AA 1L8LA 5AW5A 1YNSA 3J7TA 3W5BA 1RLMA 2WF7A 2O9JA 5AVTA 4F72A 1RMTA 3UMGA 4HGQA 5AW9A 3DAOA 2NYVA 2EAUA 5ALDA 5AK5A 5AM3A 1LTQA 1RKQA 5AW4A 5IS2A 2R8XA 2ZG6A 1CR6A 1RC8A 3B9BA 1QQ7A 2FUEA 3SD7A 5ALTA 1N9KA 2YFYA 1T5SA 4KN8A 4Y2JA 1L7NA 1ZD4A 4UMVA 4ZEXA 2NO4A 3QU9A 2BY4A 3HYCA 3N28A 2JAWA 3R09A 2HOQA 2JGAA 2WF6A 3AR4A 3M1YA 3QU5A 3EPRA 2EATA 2GFHA 2RB5A 4J2TA 1S2OA 4BNDA 2EARA 4BKMA 2G06A 4EX6A 2QLTA 2YY6A 3KC2A 2C88A 3ZW7A 4KYTA 2YMLA 3N07A 3OPXA 1TA0A 1ZRMA 4DWOA 2Q4RA 4HGOA 1PW5A 2I34A 4NV0A 3MC1A 3ZI4A 3EF1A 2WHEA 5ALWA 1XP5A 2B30A 2FPXA 3ZTYA 5AW7A 3KOOA 4L57A 5AK4A 3FVVA 1CQZA 3WK8A 2JARA 2G09A 3TLMA 3I76A 3SHQA 3CZ4A 3SLRA 2G80A 3QLEA 3K1ZA 2YMPA 3L8FA 3NAMA 3AR5A 3L5KA 1VJRA 3FZQA 3QUBA 5AW3A 2YJ4A 2HO4A 4BEWA 2HX1A 2YN4A 1WPGA 2W43A 2OBBA 4DCCA 3MN1A 2FDRA 2YMMA 2B1RA 5ALNA 3IJ5A 3OCVA 4NWIA 3L8GA 2Q4TA 5AKZA 3N1UA 3ZWKA 4I9GA 4UMEA 3WK7A 4G9BA 2C9MA 3I1YA 5ALJA 1ZS9A 1Z4JA 2B8JA 1YS9A 3SMVA 2HF7A 1Q91A 2FEAA 3FPSA 3QU7A 3WKCA 3KZXA 3QYPA 5AKLA 3M9LA 3QUQA 5AI8A 3QGMA 3MPOA 1IWOA 4HAIA 5AVQA 2AH5A 3B9RA 4BX0A 4H1WA 4AS3A 3FGOA 3ZWDA 3ZVLA 2P69A 1RKUA 1TJ4A 2B8EA 4QJBA 1SWWA 3E84A 2RBKA 3E81A 1RKVA 3PCTA 2I54A 4DW8A 4F71A 2PQ0A 4UAUA 1RLTA 3L8HA 2G07A 3E8MA 4BX2A 4OFZA 3ZUPA 3ET5A 4YCMA 3KD3A 5JJBA 2WF8A 5AI4A 5AVWA 1Z4PX 1YDFA 3L0BA 1ZRNA 2WF9A 2QYHA 2P11A 3OCXA 5ALGA 2YJ3A 5AVSA 2CFTA 4Y3UA 2HDOA 3L1UA 1QQ5A 4ZEWA 4EENA 2BDEA 1U2TA 4HGRA 1K1EA 4L6CA 1XVIA 2FPRA 5IT0A 3FM9A 5AIBA 1RMQA 3U13A 2IOFK 5AI5A 3E58A 3A1EA 4IG4A 5ALPA 1Z4OA 4ZEVA 1O08A 3KBBA 3UM9A 4YIHA 1Z4IA 5AVRA 3ED5A 4EEKA 2OYCA 5ALYA 4BX3A 3U7GA 3WKDA 4EELA 2B1QA 3I6BA 5ALMA 4O8CA 4OD0A 4YIKA 5T41A 4UARA 1YMQA 4YCLA 2ZOSA 5ALKA 5AI6A
chains in the Genus database with same CATH superfamily
3C1ZA 3B82A 4H7DA 4MQEB 2XVZA 2EH9A 4IXMA 1XTSA 4E12A 5ALEA 4S3MA 1JKJA 4M87A 4JEMA 3FZEA 1CU1A 1MB9A 4MUIA 2QVXX 4DV2B 1YVRA 4D5EA 1W46A 3HJUA 4C4RA 1XJWA 1PEAA 3E27A 3IQZA 3RREA 3MUFA 4HS4A 2L2QA 3DLAA 4L08A 4M38A 3UB3A 5ICGA 4P33A 1Z25A 1EFHA 8ICEA 1NA5A 2FPSA 3CH7A 3IE2A 5CA7A 2H3QA 1SH7A 4HGYA 2ZTLA 4O2BA 2JK0A 1TK3A 1RHRA 4QM7A 5LQKA 3A3PA 3RUIA 5ETJA 1WXEA 1XL0A 1LF5A 1WD5A 2PMCA 5EP4A 4AKEA 3T3IA 4PW0A 5IAEA 4W5RA 1Z7BA 2YV5A 3P4YA 1VG1A 5LLSA 1PQ4A 5LN1A 4KLMA 2ZIXA 2X5KO 4FWIB 4ED7A 4O5KA 1NXXA 2QL9A 4HC4A 2CVFA 5TGZA 5LB4A 4TUYB 4GEKA 5CIQA 3EIEA 4N3BA 2R6CA 1V48A 2WG0A 1OVMA 3IOYA 2VYCA 5K03A 1CBUA 3RADC 3U37A 2QTCA 3V7LA 1NRXA 4ZWNA 1IY0A 8ICIA 3AJ9A 3R7DA 4ZGWA 4DV3B 1G4HA 1Q1BA 4IL5A 1TU3A 1AE1A 2OK8A 4FZ3A 4IJUA 1ODIA 4ZC1A 5C9ZA 5JI3E 1YXMA 2C0CA 4FGKA 4H31A 4LAFA 2UDPA 4B40A 2ZQ5A 1S3FA 3EC1A 3I8OA 3ZU2A 2I71A 3EXIB 2DR2A 1VPDA 5DB7A 3RH4A 1EG7A 1ZJ6A 3AVQA 3K2QA 5HYVA 2E8PA 1AM4D 1XF9A 3LXMA 4N3CA 2WUWE 3AVOA 4REMA 4U6PA 4YP6A 1C9JA 3HBAA 1VPVA 4ZVTA 3WGIA 1RC0A 1U1DA 2FN9A 3R7LA 3ZDYB 1TK9A 3ZXIA 2ZYSA 3PA8A 3SF8A 4G8DA 2BCRA 2PX0A 4JOBA 4AMZA 4B31A 4YAKA 4Y6LA 2CNNA 2QA5A 2YDYA 4RYDA 3PZBA 3RYFA 5H81A 3TW8A 1NOJA 2Q8QA 2V4QA 3NMUF 3LI2A 3TNLA 4F50A 3B38A 5JSKA 3V8QA 1LI5A 1P77A 3TSCA 4GUDA 4EMUA 4UAVA 2QTBA 5F76A 4HYEA 1JYFA 1T3QA 2B9EA 3B78A 1FTQA 1QS0A 1FOEB 2Q3BA 4AN0A 1CEYA 4R6WA 4L2IA 1UPAA 1JR2A 4QTXA 1M3SA 3VH3A 5CA0B 1KAGA 1KL7A 4WDRA 2WYHA 4U5XA 5FUWA 3ZH2A 2GO7A 4B48A 4B8WA 4BO8A 4K4IA 2XYRA 4R54A 1T1JA 3LIPA 2JCXA 4DGSA 2PX3A 2FR0A 4PX3A 4WGGA 4AXXA 4Q18A 5M29A 2ZJ3A 3I62A 1UBLS 3UG7A 2O0JA 2IYEA 4HUTA 2IJGX 4KE8A 4RHFA 4RWEA 2BMWA 2O6LA 5SYAA 3ZV7A 4YLYA 4CTJA 3G85A 1ZR4A 4YC7A 5C8YA 4LJYA 3WSTA 1IDN1 4XEHA 4ECYA 1HDIA 1A8HA 2CYBA 1RRGA 3DULA 4UBCA 2HR1A 4YFKA 2YC4C 5JSZA 4B8ZA 3JTEA 2VPWA 2H0RA 2BW0A 3AHJA 3GZJA 4FT2A 2JEZA 2KS6A 1EVKA 4YUZA 2QM0A 1IOZA 1BQEA 3KZCA 4MWZA 3SSMA 2VJAA 4QGSA 4TOIA 2IUTA 1B8OA 4FLFA 4CF7A 1VIAA 4KI7A 1HDOA 3WNZA 3ZGXA 5CJPA 3TL6A 3TZQA 4GOLD 5HRCA 3KVVA 1UODA 1XTJA 1LPNA 4J03A 1PKXA 2LMRA 3V6KA 1JV2B 2RGDA 3DFIA 3SP1A 3TTVA 4D4LA 2XGJA 3JQCA 1UA0A 2AW3A 4G9GA 3TR6A 1T36A 3GLUA 3BGWA 1S8FA 2PD3A 3QI2A 2WSLA 1QRDA 2O4UX 1V4BA 4ODIA 4C4YA 3AU9A 5C4IA 1H3EA 4RCZA 3PKJA 2O5RA 1KJIA 4OMFG 4Y1RB 5AVOA 4YMIA 3SEZA 2GFIA 3ZHYA 2CNKA 4DMKA 4IMIB 2XCPA 5BORA 1VP3A 3F90A 2C9OA 1JHPA 4EF6A 2B34A 1JMYA 3NANA 4MJ3A 1XE3A 4PYRA 3RRFA 2HA3A 3GLSA 5AHXA 3L07A 4PSVA 3G0CA 2JGDB 3GA0A 5G1NA 3MS7A 1U7ZA 2VANA 1SKSA 4DR2B 2XJ4A 4OPMA 3OHBA 4W5HA 2V59A 4IIUA 3MR5A 3OMLA 2FE9A 4LEIA 3VBEA 4CM8A 3P7MA 2CV0A 4RXUA 4DLNA 4FINA 1Y9DA 1AKQA 2G0NA 1WMFA 2ZXFA 3RYIB 1XQYA 3F7NA 3H9BA 4WESB 2JFYA 4BZQA 3V00A 1UT6A 3FUWA 2PZJA 4BRSA 4ARVA 1EP9A 3PX6A 4MS1B 3IC5A 5AT1A 1Y7PA 3WYFA 3GNQA 5BT8A 5IVPA 4A23A 1PZGA 4LMRA 3NNNA 2H3EA 5AOCA 3P5SA 4G1FA 2K87A 4JXJA 4PZAA 1HMPA 1P8AA 4Z7QB 5CVCA 1M1XB 3PSHA 1VLHA 1Z08A 4R41A 1N0HA 1K7EB 3LCUA 2GN4A 4D4HA 2NUPB 4IIJF 4GPAA 2YB1A 1KJ9A 1T43A 3D6TB 2J6TA 1BOOA 2MR5A 5AK6A 1HSZA 4G5HA 1Y8AA 3H6HA 4NMLA 5I9TA 1R0WA 2VP4A 3M6KA 1TK8A 4FTWA 4F6LA 1QXSA 5LM3A 3HK2A 1TO1E 3EK2A 1FDUA 4CMIB 4MSUA 3WYGA 4B3TB 3BGIA 2HHJA 4MYUA 1FFXA 1K3FA 4TS4A 5ILOA 2DBVO 3O03A 1CYEA 2O7VA 1VL2A 3G5AA 2RSLA 3OT1A 3BRSA 3TRJA 1OD6A 2NX2A 4DSKA 4E09A 5AKIA 2P2GA 5KYGA 4NZMA 2BRUA 1E2EA 1RPLA 1ZGAA 3CPSA 3AH8A 2VA9A 4FMDB 3LVBA 2JIZD 4PF1A 3KKKA 3NEPX 3HY4A 1MNAA 3N70A 2O2SA 1JN0A 4PBRA 4GECA 5T4FA 1Z6AA 3HEMA 3HR4A 1NW4A 2C03A 1KDYA 3W6NA 2IL1A 1G8GA 3WLLA 4EQ6A 4BTLA 1GZ6A 2HU2A 1GUFA 1CI4A 1UOQA 1CUZA 5HUQA 2EDUA 4QAJA 4J16A 2HLDA 3TDKA 2PUVA 4BGEA 1E9AA 4I2BA 3IJRA 1DSSG 3RTGA 2JAUA 3ORHA 5TPZA 4R31A 4HNVA 2ZTHA 7MHTA 1MDBA 3G23A 1KERA 2ATVA 4UBIA 1DAEA 4X65B 3UMJA 3GO4A 5TVGA 4CFYA 2KNJA 4FZLA 2C8LA 2XRMA 1T3GA 4JJKA 4WY8A 3WMXA 4A15A 4NX2A 1FU8A 1U8FO 2NZ8A 1P7CA 3SEFA 1AGPA 3NIWA 4QLBA 3R5HA 4R1QA 2BM1A 2YYAA 3I61A 4X91A 3WK5A 2ZVPX 1DUSA 1TKBA 4RMHA 1CWUA 1DP4A 3UMMA 3WQSB 4ELUA 2DX7A 5JTIA 3H9JA 4M22A 4DUGD 4YY3B 4C8NA 2OGZA 1OWNA 3NNDA 3URMA 5L1IA 2MSKA 4EPYA 3II6X 1IJBA 2DKFA 1J2JA 5ALRA 3A31A 4DFJA 5FBWB 3KXPA 5TNXA 3UGJA 4QZ9A 1WABA 2CK3A 4TVSA 3JWIA 3CF2A 1U4BA 1U2GC 4MI1A 4N7MA 4ONEA 3WMFA 1KMNA 2FE4A 4IKPA 1L8AA 2NZUG 4IGAA 4ZEOA 3SZ2A 3A3YA 3JZIA 1AKEA 3E5NA 2HMXA 3ZCVA 1GXSA 5HOEA 1N4DA 1A0PA 2NV3A 1E1KA 2CFRA 2DFKB 3LO5A 3QELA 3H17A 1C0IA 4EVRA 2WFAA 1GTL1 1IIRA 4B83A 3WKBA 2GYYA 3VKHA 1UDBA 5AW5A 5K6AC 1Z00B 2AK3A 3F4KA 3FWHA 2MAXA 2HRQA 5DHQA 2BT4A 5JRTA 1VL8A 2Q4BA 1Z5ZA 2N46A 4P22A 4E13A 3W2GA 4ZVSA 5A04A 4HGQA 3B36A 2HLPA 5KAIU 1YS4A 4DLZA 1QP4A 2W4QA 2VOJA 4UUAA 4B4WA 1BG6A 4S0XA 4UNRA 3HUUA 4WXPA 1DTWB 4UQLA 3J81A 2IDJA 3H2JA 3D3WA 3TI9A 2A33A 1G6OA 2GASA 2HTFA 2ODTX 2ZG6A 3F0TA 4RGBA 3SXUB 4BYMA 1UJ4A 3KRTA 3KQHA 3IEVA 3Q8PB 1KRHA 3WZLA 1EZ4A 1BH2A 2AIRA 2GA8A 2O50A 1YHNA 1ZMRA 3EGDA 1ES9A 4RUCA 2PM8A 2JFVA 3NTXA 1W25A 4E2FA 5BR7A 5IEJA 1N9KA 1RE0A 5GONA 1X8LA 3VTAA 1CZHA 1T9GS 1KYXA 4ZPJA 4Y2JA 3DKKA 8ICRA 3BB4A 4AKTA 1WWUA 3UPTA 2NO4A 1XZMA 1KPHA 2HHHB 2BY4A 4QWWA 1U7DA 3E7DA 1ID8A 2XWJI 3OM9A 1GCAA 1RAHA 3R5JA 4QDZA 4BBPA 2B2XA 3R75A 2F4VB 1H8ED 3PE3A 4ZMRA 3G2HA 2WAQC 4NV1A 1MP0A 4QPCA 4EY7A 1U4SA 1SBIA 1EP3B 3QVXA 1X74A 4EABA 4ZGBA 1PVRA 5L3SA 2OLEA 5DV9A 1UPTA 4CT5A 5A1TA 1PKEA 3QPAA 3QIAA 3EGWA 3D64A 4FFSA 4X20A 5HFJA 4B6FA 4C7BA 1YZHA 1XR3A 4EX6A 1AQYA 2CW5A 3X43A 3PRHA 3RC7A 1KOGA 1QLWA 2P3QA 1UOEA 3U40A 3EG9B 5BSFA 1CDEA 4DBLC 2JVKA 3ORRA 3F4LA 2BEVB 3SYMA 1ADBA 2M9MA 3I2GA 5K6AA 2QTTA 4INPA 5K4LA 4LTMA 3Q5EA 4XCXA 2XMDA 4CM8B 2NTEA 1E9FA 3HMKA 3D2NA 4TTJA 4HCJA 4R1UA 5C4GB 4B9UA 1JI3A 4GP9A 3SC2B 3BQMB 3Q1LA 1JHAA 2YV1A 3IAS6 3PC4A 1TNDA 4BVAA 4QT4A 3U16A 1F7UA 4YUVA 5KDDA 4K5QA 4JWNA 4RK4A 3SS9X 5IT5A 3U39A 1NVKA 2I6FA 4H0CA 5CFOA 4N5NA 2YMPA 1BVUA 1MRNA 1NE7A 1SXJB 1WQ4A 2RHBA 3LP6A 3NAMA 4HB0A 3THYB 1IVSA 5DB6A 2HMTA 4AJOA 1VI5A 5A71A 2K60A 1WCNA 3Q8QB 5GM1A 4HWKA 4Y6GB 4RQ7A 3MTGA 3PF8A 4BIIA 2W7PA 5EJ8A 1LI4A 1NSTA 1N56A 1D8BA 4HATA 1OLXA 1NVDA 3ZZUA 1E3JA 2OD2A 2JBAA 2PI4A 1SQ6A 3OCVA 5FXMA 2A9OA 4UB2A 1L6NA 3CWCA 4GLFA 5AKZA 3WICA 2R8IA 4DSNA 1AV6A 1T3LA 4US9A 3G8DA 2WKRA 2OB2A 4LQ4A 3DBLB 2QVBA 1W73A 4PSKA 1SD1A 2KJQA 4RBNA 1Q1AA 1KJ8A 3DVRX 3CVOA 3VX4A 4CCYB 1X40A 2DP4E 4XSVA 1TKDA 3G2LA 5T14A 2XX3A 4GX5A 2EX4A 3OP4A 4NF2A 1IRIA 4BLOA 3T7RA 2TMKA 2EGUA 3A3OA 3B12A 3FPSA 3BDPA 3PYMA 1WCIA 3CWQA 3DT9A 5J2TA 1NM5C 3CUSA 1KA9H 3B52X 3K0EA 1TYDE 3NVDA 1VB3A 4XW2A 2KBEA 3D7LA 3I0ZA 2C5HA 1EX7A 1E1QA 2C5FA 3FGZA 1S3SA 4LOLA 4UNIA 3I9JA 3IEUA 1J07A 4Y9SA 3KLNA 2YWRA 3G7NA 4EMTA 1ZQDA 2ECKA 3C5GA 4DVGA 4HN9A 4WOCA 4GM4A 3DFUA 3ZWYA 1HBJA 4QJFB 5B1EA 3HVJA 2L42A 4PN3A 4WZBE 1J2RA 3V7NA 1KI4A 1L7VC 2FETA 1S4MA 1EQAA 1TGVA 2H57A 3OF5A 4CEHA 3VR3A 1C20A 3R41A 1MX9A 4CR8A 3DVAB 4HB4A 4R65A 5CVEA 2O59A 4LWZA 3NP7A 4JXZA 1RRPA 2IU0A 3F5DA 1L5HB 3I37X 3ISVA 4FYYA 1W6UA 4N03A 1N6KA 4XA8A 1PWXA 3W8DA 1NULA 4YPVA 1IBMB 1GUBA 2LNDA 4CBVA 3C5EA 1GO3F 1JNYA 1A96A 1TAQA 1NU6A 1GITA 2IYQA 2OG1A 2JS7A 2ZRQA 4KQXA 1TLLA 4RPHA 2CKMA 4BMPB 3SM3A 1S0VA 5FNVA 3FZGA 4M8NE 3KD3A 2H5XA 3HJAA 3O3MB 1U2EA 1T6BY 3ND7A 3ORSA 1BVSA 4BNNA 4L15A 2GPSA 1NMXA 1UZMA 2V6FA 3EFOA 4W82A 3TSOA 4OSPA 1N0WA 3DUFA 4JP2A 3IV9A 3L0ZA 2WF9A 2WJIA 1S5LU 2NQ2C 3OCXA 1SCUB 3C2LA 3KL4A 2QRNA 2UZ1B 2YQZA 3LT2A 1Q7RA 3N2KA 2W83A 1TQ6A 2JLSA 2AQHA 1DIGA 2Y1KA 3NM6B 5CAEB 3VR6A 2IW1A 3PPYA 3EZ5A 3RUHA 5LD2C 1HZZC 3RK1A 4HVLA 1OBCA 1K75A 4Z4EA 5H9WA 3T3DA 3BSSA 3L7MA 2Q99A 1IFXA 1PTJA 4NFHA 5EESA 3U4IA 4E4RA 5J8YC 2DUYA 2XO7A 4XCQA 3UICA 4ZYZA 1ZNZA 5E9JA 4R1TA 4O5AA 3A04A 2WQ6A 2QDKA 3QVKA 4AX4A 3IP1A 4TSKA 2ZS9A 2BCVA 4M2YA 3SU8A 1R64A 2K4HA 3G2KA 1BWSA 3L7IA 3OTGA 5F64A 3VNQA 2NTNA 4FCVA 4XVQA 5C7IO 4KRFA 2V9WA 3UJDA 3LT0A 4ZC8A 1DXOA 2PH1A 2OYCA 3OZXA 4DANA 4F4HA 4EELA 1PWZA 4MR9B 4ATNA 5T41A 5CDYA 1IOVA 3V2HA 3OIFA 2NZYA 3ENZA 2FY8A 3CX8A 2QD5A 3B60A 3RTCA 4HFRA 1E77A 3TD2A 3QNUA 3IAXA 1PVOA 4S35A 3E7WA 1NV8A 4U9IS 1AQJA 2AJDA 1F3OA 5A6VA 3NR2A 2Y0DA 5TV2A 3DYIA 1U80A 2V0NA 4FFWA 4J7AA 5I7RA 2ZIVA 2GBCA 4GMXA 1ZUWA 3DMRA 4PYLA 4ZT7A 5IIMA 3ESDA 3MS2A 4GPTA 4LPKA 2BHLA 2XZOA 4OREX 5C53B 1ONSA 1JIHA 4AYTA 2AXEA 1IVYA 1UQVA 2XB4A 2CZGA 1M34B 2YV4A 3FVRA 4LZJA 4MVYA 5IM5A 4P3YA 4B3CA 1U0SY 1Z4NA 1UMBA 2H4WA 4OV6B 4RX1A 5DT2A 1OYOA 1MOQA 4MS4B 2ERCA 2QL6A 3K5PA 4GZ3A 5EPEA 4E2XA 5GY7A 3AOEC 1PGNA 1Z7WA 3ADCA 1L7OA 3HCEA 4JLAA 4QOGA 4TKMA 3SJAA 3ZK7A 2WDPA 1TYZA 4FP9A 5DGXA 1A4RA 1P4AA 1VCMA 2XUDA 4PHTA 4RDCA 4GWLA 4RTRA 1RYUA 4YYZA 1ZQTA 4PTYA 3BRWD 4HO1X 2D3DA 1Q20A 2RI6A 4G5OA 1R8YA 3R5TA 4OKNA 1WCYA 4OGLA 4BJHB 3R5FA 2HU8A 2D3TA 3R3UA 5FO0A 1I0LA 1HWYA 4O02B 4KV7A 4ZEMA 5ALFA 5CTAA 1V16A 2I9PA 2IV7A 1YR7A 2XITA 3OY2A 1AHHA 1BZYA 5HF6A 4EEZA 1RW4A 2BR5A 4UD2A 1ISMA 3BGVA 3FTCA 2EZ4A 5LKAA 2UZ4A 2XGPA 2Y0SF 3PXEA 4HX5A 5IHPA 4RJKA 2UYGA 4Z4CA 3MTDA 2VH1A 2KE5A 3L1JA 1GA6A 1M33A 3DBIA 1NK4A 5E6RB 4DEVA 4NLBA 1S0NA 1JI0A 3OCUA 5GJVC 4L95C 2GJ4A 4BRWA 4CTMA 1P2FA 2P9BA 2YWBA 3EXHC 1TCUA 3MOSA 3N7AA 4GFDA 1GPH1 1C9MA 1UMCB 2YJNA 2ZK7A 2H29A 3AX6A 2HK6A 3KEQA 5CVVA 5AJWA 4KSYA 5DE3A 4QBIA 1ZJZA 4DLVA 2JLVA 1XNRB 1NF3A 3C1AA 1ZQAA 2HRRA 3REQA 3ILSA 3O92A 4PAQA 3S55A 2ODWA 4KDCA 5JLJA 1BCRB 4X00A 1U6IA 1MR3F 3AONB 2PL3A 3OJOA 1S8AA 4UB3A 2CCKA 2AOUB 2VTBB 1XQXA 1YB2A 2G71A 1ZQ1C 1VXOA 2V8BA 4YD2A 2WBLC 1GN9A 1GNQA 1JQLB 1ESMA 2X8LA 1POWA 3OTIA 3N4MB 1OTXA 2WYOA 4AY6A 2RHLA 5JAQA 1NYLA 1O95D 1M74A 2YXLA 3H2ZA 1ZWKA 1TF5A 1XJQA 3CEJA 1QH9A 4WECA 5KFNA 1JTVA 2NO6A 3KKPA 2C5GA 4RANA 5LQSA 3VO8A 1WTAA 2BR3A 4CCWA 1GNPA 1NRWA 3IP3A 2Q7OE 3QXGA 1CZKA 2NP6A 3DOOA 5FPTA 4LV6A 3PVXA 2QV7A 4XIJA 5HK9A 4YR3A 4YP9A 1TM2A 2C4WA 3UMSA 2QYSA 4GNRA 3AEVA 5DZSA 2HA7A 2PGJA 3E3AA 3R7BA 3MCWA 3BMNB 2NSLA 2PPLA 2W71A 2NO7A 1SKMA 4IQWA 1JSZA 4AJLA 3CNNA 4UTPA 2VP9A 5BWLA 1L8XA 4I1UA 4S12A 4MVXA 3DZHA 2V7BA 4U7WA 3HLTA 3ZR4B 3V7YA 4V0KA 1P1RA 3H8SA 4KLIA 1YJ8A 3OJEA 3UVEA 4B4OA 1TUEA 4YP1A 4LYHA 1PYDA 2P0YA 1G8HA 1R5BA 1X39A 1PT7A 4B4KA 4EJSA 5BVGA 1RXUA 3V1UA 2VWGA 5ALIA 1GARA 2NO9A 1O89A 2AOTA 1QH1B 3JQQA 2CE7A 5B1IA 4X6UA 3VISA 3PWSA 3U62A 3OT5A 3NRJA 4YAOA 3W7BA 3RWMB 4KNWA 3BTOA 3QFRA 1UAGA 2I2XB 3VPGA 5J2DA 5I7OA 1M6VB 4M6WB 3GGSA 2XWSA 5AK3A 5FNVB 3ROZA 1FXSA 3RTVA 1FLDA 2HN9A 2X40A 5D49A 3SQIA 1YOBA 3CW2A 5IM4A 4QBKA 1G20A 4TXNA 3QVUA 4ARBA 4EVIA 4JXXA 1LLFA 1HI9A 5IPFA 2B7BA 3G7SA 1JZSA 3R9KA 1ECGA 4JFRA 4LY9A 4XH9B 2CDAA 1GKLA 5ILQA 3E48A 3CN7A 3MYYA 3DL4A 3EBOA 3DEEA 4M99A 2CDNA 3UMVA 1W2GA 1SBTA 3KO8A 4MVJP 4F8RA 1JFRA 2P8SA 5TZVA 1SRRA 4RL6A 5K0TA 5BWCA 2H3ZA 3DEHA 4JLSA 5PGMA 3KLPX 1IB6A 4KWTA 1D9ZA 4CG1A 2ONYA 1TZCA 1JHQA 3PEYA 3BS5A 3RANA 1HRKA 3VR5D 1CRZA 3B0XA 4J49A 3CUUA 1RXEA 3Q8MA 1FNCA 1YZUA 1BGVA 3EFEA 4QZEA 4CM7A 4D3SA 3C43A 1DLIA 3AKCA 3IMCA 3A1FA 1YQGA 2VJDA 1E4OA 3NAGA 3UXYA 1A9TA 1SA0A 2GD1O 1NZJA 1G41A 2JFHA 5DX1A 2VH5R 1L8QA 4S1VA 4JYAB 2HXGA 4RIFA 4CW7A 1E2FA 2JFNA 3GRYA 1JPJA 3OSZA 4UTZA 3MK31 3TTYA 4M1TA 2CJWB 2P2ZA 2TMGA 2FFBA 2CVQA 3NNSA 4ZANA 1GAWA 1EVJA 2FPWA 2NUBA 1MRZA 3EPPA 4I2VA 4KO2S 1CJTC 1JHZA 1BYUA 2NQTA 4JD5A 4LHEA 1NUHA 2BFCA 2QQGA 2C99A 2G1UA 3WL7A 4XQEA 2JDID 1U63A 3RJEA 1FSZA 1RDFA 1ZD9A 1GVHA 1OX4A 4Y0NA 2QUHA 1P19A 2AC4A 2WTMA 4V38A 2I4RA 4BP1A 5IAAA 1D7OA 2V7TA 2GTIA 1VA4A 1CE8B 1BKYA 3BWEA 4OYHA 3W8FA 3WYBA 5IINA 3IR7A 1EK2A 4UZEA 1W0KA 1XHFA 1AKVA 1R9NA 5EXSA 3F6PA 1S2DA 2RHJA 4MB6A 1KJJA 2P41A 1URJA 1F4LA 1RP7A 1BFKA 3TD6A 1HE4A 4R7GA 3BN3A 3FUCA 4GQIA 5FWYA 3FF1A 1B16A 5IBCA 1HTTA 1CLEA 4X71A 4B80A 1KY4A 4F5YA 1RBQA 5FBHA 5GVSA 1NVTA 1DX6A 4UU0A 5AM1A 1HQKA 2WM9B 4V02A 4D0NA 2XCTB 4MQUA 3UJ7A 4KU4A 1ZMTA 2Q45A 4PYNA 4D8UA 4RA6A 4EFLA 4DJDC 3FAHA 3CZ9A 1SWVA 1XWLA 1FSFA 1HFKA 2JA1A 3PQ4A 4CU2A 4YRZA 5HGXA 1F9EA 1ZW6A 4RL4A 1GKIA 3LDFA 2CRXA 1J7KA 2WVAA 3OX4A 1M7BA 4Z49A 5HIJA 3HT3A 4A8HA 4I0WB 3L7OA 2NU8B 3GVCA 4GBMA 2H2AA 4IY1A 4KW7A 4M1EA 4JV1A 1FSSA 1U3UA 3R5XA 1OQAA 4F46A 4NOLA 4YRQA 1YT5A 4JB3A 2YW9A 3LL7A 3A8TA 3T7IA 2ZIZA 2UYOA 4MPTA 2BF7A 3WA6A 4A73A 7MDHA 4MCJA 1EA7A 4OKIA 4C0BA 1A8SA 3KXDA 4O5OA 4B47A 1Z83A 2OECA 4JJ6A 3I4CA 3OUTA 4PGAA 4EPVA 5CFQA 4TQAA 4DMRA 2I6XA 4HUJA 5GTIU 1CY0A 5EMMA 5CUQA 1B8PA 3W1EA 4YBRA 1CUGA 5A6SA 2F90A 2VCEA 5DLQC 4DQKA 3A0BU 2XA9A 3PSFA 5AM4A 5ALUA 2G5IB 3CNHA 1JEDA 2V7UA 2VWQA 2VZEA 3BPSA 4KACA 4YAWA 4DIBA 2AKEA 3BEOA 3ETHA 4QOSA 1N3IA 1E7WA 1PK1A 2YB4A 5BUQA 3TOSA 1DIRA 1REQB 2QNBA 3UXHA 1NVEA 4AULA 1TJ5A 3EVGA 4B3JA 5JR3A 3IDAA 2VF5X 1QIMA 2ARKA 4MB0A 1CRWG 1B93A 2AW5A 1P7YA 3IIMA 1V6AA 3L77A 3N87A 5CDTA 2BGMA 4DB2A 1YJCA 4MW6A 4YV2A 3J7TA 3IHTA 4M3NA 2PSDA 1N36B 2WF7A 2FLLA 1QK3A 2BGLA 4K86A 4NJOA 3ZCUA 1N8SA 1JMSA 1MPTA 3BF8A 2EP5A 1TB4A 2B4AA 2XB6A 2HMYB 4PRLA 1GGEA 2ZJ1A 4F4ZA 4XR9A 1U3GA 3UBTA 2QB0B 4PIPA 5DGTA 4DG5A 3QEAZ 2WU1A 3KOWA 2ZR8A 2QTAA 5FJIA 1V2HE 2GRUA 5IZCA 5C8ZA 1KI8A 4XX0A 1SPBS 3AESB 1DIOB 2IHVA 1CJUC 3GFPA 1RYFA 2MSEB 1I51A 1X1DA 3KG2A 4O5EA 3AVXA 4L4ZA 3SD7A 1PL8A 2R65A 2D54A 2C97A 2UXCB 1RM5A 4C8MA 1F2TB 1GFIA 4TV8B 4FW9A 4MW2A 4B3FX 1FFCA 4BZZA 4EGCB 4CHGA 1JE1A 2VSNA 3BZKA 3Q11A 3TRDA 2UYQA 2V45A 3DLTA 1NXPA 3BZCA 1KRPA 3WNVA 4GVPA 2DQYA 2PQ6A 4GOXA 4IX9A 1IXKA 3WYDA 2AK2A 2HMWA 4M47A 9ICSA 2JAWA 3BRCA 4AY5A 2W42A 2X0NA 2YJZA 1WW3A 3LY5A 2J3JA 2CFIA 2WV9A 1G19A 2FW6A 3H7AA 3Q9SA 2E48A 4R2WA 4Z0NA 4V3CA 4C0WA 4EDHA 3MGBA 2C95A 1ZK1A 4WW0A 1VE9A 4UB8U 2F17A 2NIPA 3AYXB 3DSRA 4MWTA 5FBKA 3CT4A 5B57C 1QVVA 3VHXB 5HQ3A 4FKBA 1PLLA 1PZNA 4G8JA 4KBFA 2E4ZA 1N61A 4L4UA 4RC9A 3ZDDA 1OUQA 2REOA 3ITEA 3JWEA 5K3BA 5A5VA 2DCMA 3BG5A 2X9LA 1MCZA 2PVPA 2MSLA 4R64A 2YMLA 1G5QA 2QJWA 2QLJA 2XY6A 1RWBA 2XGMA 2Z2JA 3GBSA 3L6UA 4HRYA 2QN3A 1OWLA 3KSMA 1Q74A 3DT8A 1CJBA 3GAAA 2Q4RA 5KFRA 3N86A 4O29A 3E5HA 3U1BA 1LSUA 2XXJA 1A5ZA 2B4TO 1D4FA 3FOBA 2WJVA 1GQSA 1VCHA 1L5QA 2MYNA 3AB7A 3ZTYA 3SJUA 4A0RA 3VO2A 1MOPA 1QHXA 2DBZA 4LJ9A 1BGXT 1GGMA 4WKGA 1Z63A 1PFGA 1SAYA 1E8DA 1R4MA 5FPPA 3E0XA 4R6XA 1O2DA 5E9WA 4MRMB 1OF1A 1FBTA 1DWOA 1L7DA 3ANXA 3H04A 3N0RA 4O59O 4Q4HB 3QLEA 4RS4A 3OKCA 3URKA 4E1AA 5J2UA 3L8FA 4FNMA 2LWIA 5CGZA 4EHLA 5J47A 3AFIA 3FZQA 1J22A 4Q9JA 3GLHE 1R74A 5FFMA 4UTVA 3ZV4A 1ZBQA 3R6GA 1NDQA 3AF5A 4HAOA 4MI9A 2OLJA 3ABSB 1N7IA 1QV6A 2LR0A 1UPFA 2P2SA 3IX7A 3NHSA 3OE7D 5DMHA 4BCCA 2D5AA 2H31A 2DWUA 3PEFA 5KFYA 5H4HA 4IKEA 3R76A 5EJGA 5IJXA 4D80A 5IKPA 1ZONA 3IE1A 3ASYA 3NTUA 4YXMA 1A50B 3IVXA 4C3UA 1NXSA 1KMQA 3IJ5A 4X6LA 3ZWQA 1ECBA 3LWLA 1EK0A 2G70A 2KI5A 4U4AA 2EJUA 3EBLA 3JD2A 1Z5VA 3OWXA 3UK7A 3HM9A 1ICIA 1NONA 3PVZA 5FAXA 2K8BB 4TSFA 5TMEA 3G8AA 4EJFA 1EFTA 2RGNA 4PHCA 4Q4LA 1II8A 1Y8RA 1RD4A 2F3NA 5TEVA 3OF3A 3UC5A 3GRKA 3RB4A 4G25A 1ILEA 2GAFA 3L8DA 2OO7A 2Y1IA 1E60A 1S89A 4LDJA 4KQWA 4RABA 2HKIA 3OSUA 4M98A 4D02A 3M9LA 1UM9B 2NU7B 4U0JA 1V71A 4B9VA 2ZE5A 5I4KA 3EZ7A 5I8ZA 5IVHA 5C8YF 1JF8A 3WB2A 3L7JA 2EKLA 2CZCA 2EWWA 3L7NA 4L74A 4P7KA 5C32A 1SBNE 2G9VA 1TECE 4GC9A 2FKNA 4PTZA 1LF0A 3ZLUA 4FONA 1K4MA 3AERA 4QHTA 4KN4A 2GESA 5YASA 5KFVA 3LM8A 2JMGA 4GXNA 5FPHA 5KU7A 1GG2A 1XQ9A 3QVMA 4MH0R 4QXQA 4CU5A 4X1KB 2ZE6A 1B4FA 3OFKA 1EDEA 2E18A 3MTEA 1W4CA 4OFBA 1SWWA 2MJLA 3RBXA 4F06A 1S5PA 1TADA 3OIGA 1RKVA 4QHSA 3ES9A 1TAHA 4DV7B 1HL7A 1KDRA 1QHHA 3H2GA 1XL1A 4EG4A 2B92A 3CH6A 5A9SA 2DPIA 2WUVA 2Y6UA 1QWOA 3E8MA 5F73A 3IFSA 2W0SA 2BZSA 4V24A 1Q17A 4HYKA 2P79A 2SHKA 1AZWA 1T6YA 2BCEA 3OJSA 1OTHA 3CSDA 3JWPA 1RYDA 1WRBA 5DBIA 5T57A 4WCDA 5DKFA 1GPWB 2NVOA 4Z0TA 1TVMA 5AXBA 4Q9HA 4YCSA 1M2HA 2VJQA 3NT4A 4AJKA 4FQ7A 3HTXA 4MZDA 1U9IC 1WA5A 5AI4A 2EBFX 1YI8A 2VYNA 5CEHA 2FP4A 3SR0A 2UV8A 4QT0A 2HZBA 4BZPA 5KG3A 1MN6A 1Y6JA 3DO8A 3N6VA 3IT0A 4J75A 3WMGA 2FFAA 3ZHUA 3A7DA 4PVCA 3TMKA 1E2PA 1P9WA 2QTLA 4NCXA 3FCUB 4JLDA 3QXHA 2XF2A 1BE8A 2GPAA 4YQFA 2IX3A 1MTOA 3HJGA 3OOJA 1BIFA 2V6BA 3G0GA 2ZJAA 1X66A 2JB9A 3QK7A 5JAIA 1NBEA 1YVEI 5CCDA 5CP8A 5AO9A 3EGOA 5ANRB 1JJAA 5KFIA 4HUQA 3WX0A 5KG4A 4HQNA 1AJEA 4M53A 1E5XA 1W85A 4M60A 3HDHA 4OK3A 1ENOA 3DLIA 1IMJA 9ICMA 2C3UA 3I1JA 1Z4IA 3M9WA 4RSMA 1WU7A 2TSYB 2ISQA 3D8UA 4GDMA 3U4HA 4D8VA 4JR1A 4ID9A 3I6BA 3Q9NA 4DSTA 1ZQFA 2X9GA 2YWGA 4ZI7B 1UEXC 4UARA 3NVYA 3GCZA 3KZ1E 4YCLA 5ALKA 1MLDA 3GQVA 1H6DA 3KHSA 1CUDA 4BASA 2ADMA 3UXMA 4C4ZA 2H51A 4XIGS 1N5RA 4J43A 1MVLA 1ULUA 3SZ3A 1PLJA 1UADA 3SIPA 3GJ0A 3G0HA 3RHTA 1E2DA 4W7SA 1RHQA 1X70A 5SYMA 4JBIA 1EDDA 5KBYA 4BE9A 2QRQA 1D2RA 2Z57A 2PGAA 2NXNA 3E23A 5KYVA 4ZKDA 1P5RA 1PYOA 1L4BA 2UVRA 1HY3A 3DJYA 2A0UA 3OVMA 5FA8A 2XTZA 4CT4B 3N74A 5GV8A 1PUIA 3VR2A 2D2XA 1JG3A 3A11A 1GPKA 3SBEA 3S81A 4JHLA 1XTVA 4X1KA 1R9GA 4BFVA 4KMOA 3MAGA 1QAMA 3PL5A 3SIRA 2WAAA 2B1JA 1NJXA 4FZVA 4WVFA 4ESHA 4EKYA 3CVWA 3FROA 1ULZA 4ZYVA 2BQUA 2O7QA 1C1YA 3L04A 3UB4A 4WDQA 4LG1A 2UVDA 3C16C 4LCEA 3V8PA 5GIPE 2E6KA 1ZGBA 1G8AA 2OV2A 4JC5A 4MKZA 4P4GA 2BCJQ 3V1NA 4MPDA 2A1TS 2C7GA 1TTHA 3ZNOA 3NHZA 4YRAA 1H2WA 3P0HA 4QJIA 1ZOPA 1FDTA 2GXQA 1LX6A 2FDXA 2HBQA 2Q29A 3FY4A 3QUTA 2GEFA 3I2FA 3K2IA 4J0IA 4JEIA 3SY8A 2QWXA 4CKCA 5HRAA 4KCGA 2YC2C 3SX4A 2XQVA 1KOFA 1OVGA 1QYVA 3LDHA 1PK9A 3VPSA 3D8SA 1L5MA 2H7XA 2GHTA 2Y93A 1EXDA 1IEXA 3NPMA 1HC7A 3FDXA 1QUEA 1I3LA 3X0DA 1ZI9A 4MYTA 3MWEA 1IY1A 2OXTA 4AMVA 4B6RA 2JI7A 3FNEA 4DLXA 4RK6A 4BO9A 4QYMA 3UOWA 3GG9A 1P4HA 1PFKA 1W29A 1WSWA 2GTHA 2I76A 2OMKA 3PV0A 3ACDA 5TPWB 2OH2A 3LH5A 4F4FA 3P32A 1XRJA 1RXCA 1G6HA 4M0UA 1ISHA 3JQ6A 3MQFA 5F23A 4RH3A 4F4XA 4KSBA 4A7PA 1H42A 2Z4TA 1V45E 3L8YA 5K0EA 2Q6IA 1QAOA 4NABA 3TPZA 2UZAA 3KQLA 3O84A 1DTWA 5BNTA 2ZM6B 1Y80A 2PXHA 2YV2A 1YB6A 3VNBA 5EGNA 5JLAA 1JLLA 2DTXA 3KKZA 1T8RA 4R5HA 1GPDG 5AJXA 4C4XA 4HTFA 2QP9X 1A77A 2OVFA 2VRNA 2WWHA 4UEOA 2FUNB 4YLGA 5K3FB 4EB8A 1GRVA 1LC0A 1WCV1 5GPBA 2RC6A 1VDVA 1RQPA 1RQRA 2ID8A 2P9YA 3KUUA 3ONEA 3DFFA 5AXCA 1ENYA 4Z51A 4EP1A 1H6AA 4EQZA 2GN1A 1JSXA 1LB1B 1D4AA 2FWAA 3C3JA 5EJIA 3BXXA 1K27A 4ZA2A 3F1KA 4K46A 1Y6FA 2XYPA 3JARB 1UJCA 1MA7A 5LUAA 1LNZA 4XGKA 1P29A 2WICA 2X5JO 4LI3X 2OPHA 5AJHA 5MDHA 1YL6A 2AR0A 1RLOA 2Y68A 1QSSA 2D0DA 4TRMA 3HKZF 4RESA 3HVIA 4XJSA 5D00A 4EB3A 4G1UC 4WJKB 3A6KA 4CCSA 5AUPB 4ZYWA 2H4YA 3D54D 5A9TA 3STUA 2HREA 3WWZA 3U09A 2KG5A 3O73A 5K0FA 4DM4A 4ZTUB 1NZPA 2VHZA 2ZRMA 3OIWA 2J4DA 3KDPA 2XEXA 4XGRA 5FBZA 2LI6A 2H92A 1GGFA 2DWPA 2JGJA 8ICNA 1V38A 1JXLA 1G8MA 1TEXA 2VJMB 2ZWAA 4H17A 4YRCA 3VBCA 2VIIA 2AFVA 2QT1A 4PAWA 2CF6A 2R84A 3HDTA 4AD8A 2XKAA 3DDUA 4WVLA 2LD4A 3UJ3X 4RM2A 1CRXA 2VRCD 2VDWA 4R8SA 2Z2XA 3RUEA 3PQ5A 2O0LA 3RK4A 3HDQA 2H1SA 1Q15A 1Q95A 4XRRA 1VG8A 4IQVA 1VKNA 2QEQA 121PA 2IEGA 3OE4A 1DS6A 2VN8A 3M3HA 3T1NA 1T4GA 1MA3A 2GZAA 1XQVA 1L0BA 3MWJA 3T7EA 2NUTB 4L85A 3HKBB 1RYEA 1GRRA 1AGYA 1K8ZB 2P5TB 2R6DA 2VHVA 2XQJA 4BLPA 8LDHA 3RC9A 1FJ2A 3UKJA 3SKVA 4YS6A 2WHYA 2HBKA 5LP6C 3JAMA 3HLKA 3BXOA 3LC7O 3K6JA 3LJKA 3CE6A 4G4IA 4AQ7A 3AW9A 2PGNA 4FS2A 3QFHA 2IOHA 4PFJA 5DGIA 4B4UA 7ICTA 3OZIA 1YRYE 3CVYA 4DL5A 5I7HA 1J0BA 1G1MA 4DMLA 4LJXA 3G6VA 3WDKA 1SBCA 4DSLA 4L9WA 3K0CC 4MJ7A 4CKWB 3PGA1 1Y1SA 4P80A 3UOGA 1ZXBA 5DX0A 1HM5A 3MRSA 2V65A 1R0KA 3ESZA 1M5UA 4GM1A 4NR0A 3NASA 4Q7JB 4Y7DA 4UXHA 2HW3A 1VE1A 1M2WA 5IHXA 1YQDA 2FN3A 2GD0A 4I2IA 1L9XA 2C83A 1CEXA 2PZAA 4XE5A 3DM5A 5CA0F 5EXXA 1I3MA 4LHZA 5DOVA 3GRCA 2YN0A 3TXAA 3I5XA 1MB0A 5AKJA 3CLTD 3WYAA 3UAOA 6GPBA 1XZDA 5KWEA 5JPDA 4BLUA 2B6GA 1ESNA 1SKQA 3OJCA 2C92A 2YWHA 3VXKA 4OSOA 4PG7A 2JAPA 5IN4A 2ZITA 1D3AA 4Q3OA 5EQTA 4FSHA 4QTUB 3UHJA 1DG9A 1A4IA 3I6IA 1P3DA 3LWBA 5J43A 4JI8B 3DMYA 2NZXA 9ICLA 3F3SA 3ZE8A 2PZMA 1K7SN 2PJRA 3FYUA 4B7XA 1YQXA 2O07A 1KTIA 5C7LO 4GR4A 1CR1A 1VJ5A 1T15A 1R8QA 1I30A 1YRHA 2H54A 2JJMA 4W6ZA 4FFNA 3V5NA 5HQTA 3OCJA 1YL5A 2EC5A 4JUDX 2ET6A 1KJYA 2VDVE 4RQ6A 2B4KA 1WDLA 3M2TA 1Y6ZA 3GC6A 4ECEA 1XJ0A 5KQPA 4C0HA 1HQYE 3R3ZA 1Q22A 3N97B 1NX9A 3NIGB 4NZYA 1ZDMA 2J3EA 3V80A 4NOKA 1Z4MA 3I58A 3SVLA 2DHEA 2GEJA 3L79A 1NE2A 1UCFA 2FA9A 2J6BA 4P7FA 3L7AA 3TUJC 1H1LA 1QHFA 2CF5A 1NRJB 1NSFA 3E3MA 4GI1A 4QDUA 3DDNA 5ERXA 1P6QA 3KKLA 4LYDA 2GZDA 2ONKA 1F8UA 2FSVA 4UB5A 2QR3A 2ODAA 4IIGA 4M76B 3AF1A 4YROA 2IYZA 5EA2A 1FFSA 2H2IA 4EH1A 5K0JA 3Q8XB 2VA3A 4DR6B 4IUCS 3W5UA 1ZH6A 2FZVA 2VQEB 1LSSA 3FJ1A 2B2NA 2IPMA 4OUDA 2QRPA 2PWYA 3H99A 4JDPA 4KVAA 3USCS 4C0QC 1H2AS 2OM6A 5AM0A 2IW3A 4GGMX 4KPYA 2PLWA 3DMGA 4D3YA 3GWGA 1SVOA 2Q6TA 4NNPA 3H42B 8ICZA 1DELA 1O8BA 2HFKA 5FCDA 1WUKS 2B25A 3AR7A 1A7AA 3WBBA 1GUYA 1UKEA 1CNFA 1N78A 5E0KB 3EAFA 5CW1A 5KPJA 1HR0B 3KKEA 4MUNA 1EUQA 3I0NA 4G2NA 1BMDA 4B4DA 5J0RA 4C0ZA 4LDNA 2HCFA 4I4TB 1D5WA 4ID3A 1NJGA 3BEDA 3BE6A 4G5GA 3L8CA 2YZ2A 2ZBFA 4P4SA 4WXHA 3ZTWA 3LLUA 9ATCA 4KRYA 4MUMA 1DGQA 3SV4A 3IE0A 3PHCA 1T2CA 3WXBA 5FWNA 1GEEA 1J6UA 2WYIA 3A2NA 4QO8A 1PI3A 3ESYA 1E3LA 2H1VA 3LX8A 1RAEA 4F8JA 2Q0ZX 3GA5A 2PWAA 2XIQA 3RIMA 4BCDA 5CYPA 1JTFA 1T9HA 4TXHA 2EF0A 3AL0C 4NCBA 2YZGA 1DOAA 3CKMA 3GJSA 3BKWA 5HIIA 2RLTA 1KIMA 4DIFA 3VNSA 2ZTSA 1CETA 5FTKA 1NP7A 5DQIA 1UBTS 3TLEA 4ZXPA 4BKUA 3F67A 1U1EA 4QBHA 2I4TA 4Q44A 3RU2A 5JY6A 1ZIXA 1RLMA 4XWOA 1M7GA 3NV9A 4Z7NB 1RJ9A 2HT1A 3MMSA 1PO7A 4CWAA 5ADUS 4I99A 5EL0A 5KNCD 3BFJA 3RI3A 2F4NA 2CT8A 4LVUA 1KR5A 1JX4A 3NRCA 3B7WA 1IDOA 4Q9IA 2NZ2A 2VAXA 3MLAA 4KRGA 5HG0A 5AJYA 1D8YA 3FFAA 3WJ7A 1R0YA 2G9UA 5LMNB 1F20A 3UANA 1GG9A 1X1RA 3C5VA 5M5BA 1OUMA 3DDSA 1RC8A 3O93A 1IYZA 3TNJA 3ANTA 1CULC 1HQCA 2BZGA 2XZLA 3ABIA 2JI4A 1JVNA 2OV3A 3C3BA 2LE0A 2REQB 3NZEA 4GXRA 3GIIA 4B73A 3BXHA 1YH3A 4D81A 3E7XA 3C3PA 1RZ3A 2GD2A 3IAM6 4IOJA 4WPGA 3RTBA 2CMFA 2GKSA 4OJTA 2FOXA 1YA6A 1X7XA 3AFHA 2CNBA 4G0WA 3EXFB 3PUXA 1KETA 3KFXA 4E4YA 1BQ3A 1MABB 2I80A 4IVRA 1ZGGA 2QAGC 3KJFA 4CLOB 2OEPA 3ZCQA 1U3DA 1FRQA 2QNIA 4HDKA 1C4XA 1HEYA 4YJGB 3QU5A 2H1RA 4AZ0B 5JATA 2AZMA 1I1QB 1N0IA 1NJ5A 2FWJA 3R3XA 3VPBA 2PS1A 2GX6A 3TTTA 1I94B 4X60A 3FMGA 2Y1LA 5J0YA 4BKMA 4CMAA 4IHJF 1Y6QA 4TGLA 1L7XA 2PD4A 4D41A 2QLTA 3A7EA 4HLDA 3NKFA 1IUPA 1Z17A 2HF8A 1GR0A 2W5UA 4P7JA 1J0AA 2COEA 5HKBA 4DS5A 1Y9EA 4S2UA 1XG5A 2YHAA 4W63A 4O2BF 2YASA 4OXXA 4FILA 3D6NB 5H70A 1UPCA 4HGOA 1TIPA 5HNKA 1X92A 4HAXA 4LDQA 3WJ2A 5KSPA 2GTPA 3OHPA 4F0JA 2HOFA 4II3A 2A5GA 2V7XA 2E4VA 2ZT6A 3KOOA 1W8IA 5HKKA 3L4PA 3ABOB 1E1DA 4MFFA 1E2JA 4G89A 4BLRA 5LLTA 2FPGB 1G63A 3ZXXA 1HLDA 4GXJA 2FUKA 2QX7A 4FFRA 4OI4A 4RPKA 3FJOA 3QVWA 2WU4A 1DRGA 4D8TA 5HKOA 3K6SB 5HIKA 1L4EA 2JLQA 3UB2A 1Q0RA 1YU9A 2XODA 2G80A 2HJSA 2JA2A 3WLJA 4EW1A 3S2ZA 2WU3A 5JAZA 1EGAA 2PKCA 4FD2A 1OIXA 2BGNA 1T9CA 5EGSA 4AKGA 1DGSA 4O4IB 3UJNA 1DKQA 2UVUA 2YHSA 5BT9A 2VPTA 4UCWA 4WXMA 3VR5H 3PE4A 3E9QA 1SUEA 2AE1A 1REQA 3RT7A 5TJ9A 1S7GA 4W8OA 3MN1A 5CYOA 7ICRA 1ECPA 4NE2A 4NWIA 1QOQB 3RV3A 2FZWA 2V7VA 3W2FA 4UQGA 4N6NA 3L05A 1CY7A 1NN0A 2FVYA 2WMNB 5BN4A 4AU1A 3I1YA 2IXBA 2OGUA 3CLRC 4FDAA 3ZOKA 3HB1A 2XCIA 3QEOA 5BNWA 4FIZA 4UAZA 2J3HA 1PW7A 5CP2A 5G5GA 1U98A 2P9FA 5JV5A 1QPZA 1VLJA 4ZI5A 3JPYA 3KZXA 3TM4A 1PF7E 4BDSA 1XDGA 5JASA 2BHRA 3BFPA 2ZIWB 1U8YA 4QATA 5E79U 3PW0A 1VSUA 2CLLB 4UOZA 4MUYA 1NK7A 2AR7A 3GJQA 1ZHFA 1J8MF 1KMMA 3B2NA 4KR6A 1X1BA 2UUCB 3N05A 3IDWA 4BLWA 1YGPA 5HWSA 3EH2A 2D1RA 4Q34A 2VHTA 1TOAA 1DC4A 4QD3A 4RF4A 3UKOA 3IAM1 4DILA 2B69A 2ZRDA 1WUJS 1DEAA 3U3OA 2MSDB 3NHLA 1AZTA 1M76A 3LCMA 2CC2A 5K8LA 1B0PA 4R8VA 1Y8CA 2PH5A 2IXTA 2OXFA 5EJ5A 3U44A 2NRWA 3UA3A 1YB7A 4YJKA 3OZRA 3E81A 3PR2B 3SV3A 1XRQA 4Z9FA 1JDUA 5B6PA 4H6XA 1ZITA 2MMGA 1ZVJA 3AI3A 2O8DB 1X1CA 1P1HA 4KN5A 3D2QA 3TLBA 2ZI5A 1YCHA 1Q14A 3C8DA 1TZMA 1GZVA 3GZNA 4KQHA 1XVUA 2P9TA 3LHIA 5EZYB 4NZNA 1UWLA 2Q5CA 3KFUF 2FR8C 3QEMB 2DSTA 4CXMA 1M1UA 1EE2A 4YI3A 2WF8A 3H2KA 3HSKA 4ZXFA 1A9PA 5E6UA 5GVRA 2A5JA 2B3TA 1TMOA 4WV3A 1C1XB 1N9GB 2QM3A 5G4KA 3VPCA 1ZQLA 2IP2A 3ELDA 4FBUA 1PNOA 2YZNA 1S10A 5ICFA 4TUPA 4I55B 4ZT4A 3Q7PA 1HYEA 1N0VC 2E4XA 3HV2A 3A27A 1JDZA 3ESXA 2C0QA 3EULA 3FH0A 4CIVA 5BNIA 5CBPA 5K0NA 1XKLA 1QQBA 3F5AA 2IY9A 4IVPA 4GAEA 4O4LA 4PVDA 3IUEA 3BIFA 4J0CA 2EKBA 1W52X 4EBCA 1E99A 2I22A 3MXOA 1G16A 1TIBA 3OZEA 5FOQA 1OASA 2A9PA 3HKEA 1CHNA 1V5IA 4AZSA 3OZWA 4RD0A 2Q3LA 5SZKB 3N58A 2C7VA 1ZJNA 2ETVA 2C04A 4B5KA 2CNWD 3HJHA 3TRKA 2WSYB 3E35A 3PXCX 4YMSA 1J20A 4DADA 1SHZA 3WGKA 2FZGA 1YU6A 3E1KA 1XDUA 2I87A 4QEZA 5EKUA 1QS0B 1XPUA 1RC1A 4Q9DA 5DB8A 2IV2X 1C9KA 2R9VA 1DFGA 4YJFA 3S1LA 4EPTA 5FTLA 1S96A 1H22A 2Q3DA 4QE3A 5AVKA 3TW0A 1V7QA 2B6HA 1QFXA 3IALA 5AI6A 7YASA 3HZZA 2J30A 1W5AA 1C7FA 2ZJZA 1XZCA 3WNCA 4JI7B 3U3KA 4Q7EA 4ZTZB 3CKLA 1AH2A 3UO8B 4JN6B 4KLSA 2WF5A 2QS9A 1WWKA 2X19A 3LC1O 3OJLA 4QXRA 3VR4A 2CLOB 1HT0A 3I9LA 3PQFA 3B6MA 1UXOA 3RSLA 1MFPA 3S2IA 4C1NA 3LY7A 5DNCA 3WRXA 4DNOA 2Q2WA 3DCNA 3KQTA 2VFAA 5AIAA 1B15A 1D1PA 1SB8A 1MKYA 3COSA 3DE5X 4FJ2A 3M3DA 3TRFA 1ID1A 4DDHA 4PGYA 1EEXB 2WT4A 2YICA 1XGKA 4NS4A 2XE4A 1OZGA 3SHTA 1JXEA 5LP1A 3O7WA 5HCUA 4ES6A 1U5CA 5JD3A 1K3TA 3QBJA 3PHJA 1KZYC 2AC7A 1TF2A 1DX4A 2MINB 4WK4B 4S1OA 4YRBA 1EK1A 3HFRA 1RPAA 5BR1A 1L5UA 4NCAA 3RF9A 1WZNA 4ECAA 1SZPA 5F3RA 4OLHA 4DF4A 2WTEA 3WB9A 1WVGA 4EVSA 2LZ0A 4OX9Y 3MJRA 5KQSA 3M0EA 2WZQA 1NHWA 4E7OA 2W2LA 4US2R 3VKGA 1CY8A 1JDTA 1YZKA 2B99A 3EGXA 3QVTA 4LQDA 5BN5B 2E1EA 4GXQA 3T34A 4KN9S 1TTQB 3AUAA 4GLOA 3OIUA 4KRXA 4WBNA 4RTQA 3RB6A 3V4PB 3I9V6 3F71A 3P19A 4LJSA 2AFIE 3WSVA 2EW8A 2GEBA 4AP6A 3AN1A 1XEFA 3BILA 3CF0A 5L45A 3ID6C 1JIVA 1ZK4A 3NJ8A 1NK8A 1QH8A 1KVTA 1HE8B 2J85A 3MCZA 4FFOA 4WNCA 3T6KA 3PR3A 4O1HA 1BHJA 4GQBA 4TYNA 2HK7A 1C7EA 2H08A 4FDVA 3JZAA 2IDKA 3HCNA 4AJPA 1TDJA 4BO1A 2QU8A 3ZVMA 4I2FA 2P6RA 1JIUA 4W1QA 3FRIA 1LY1A 3LG2A 4P4NA 4XTCS 3QVLA 1TF7A 2UUOA 3X2SA 2GBIA 3DGFC 1DOQA 4K2AA 2RAPA 2R87A 3RC3A 2PU7A 4IIJB 4QM6A 1V35A 1X80A 4UAJA 5ENVA 2R8PA 2J9FB 3LLCA 4IV0A 3RRYA 4ETNA 1MORA 1SXQA 4ED3A 2BH2A 2HD4A 4TMVA 5JQGA 2NU6A 1SVMA 2ASVA 3CMMA 1IM5A 1W0KD 2Y71A 2POQX 3OOHA 4TT8A 5B2FA 3JYQA 4ZO9A 5CCXA 9MHTA 4UHHA 4YJHA 1GNRA 3TH5A 2QD1A 1C7IA 2ZQZA 5BV8A 1IJFA 3WK4A 3DBHB 2WIBA 3N0XA 3MS4A 3TAUA 1W36D 1VLBA 5DYNA 3B13B 3FKSA 3HFGA 3C3CA 3LLSA 5CPFA 4DOMA 1JHDA 5HSGA 3ZXYA 3IDFA 1G8SA 1SGGA 2I67A 3O8QB 4PLVA 2VOEA 4F91B 4Q39A 5DXJA 3O26A 3NM4A 3KT8A 421PA 4LBWA 3TX6A 3QF4B 2OHJA 1THTA 2SECE 3KHTA 2P1ZA 3Q9UA 3P2OA 5DCYA 1IZ7A 4DEYA 4EEXA 3SFTA 4W5WA 5KFMA 1GSIA 1W5SA 4IQTA 1CJSA 2JGRA 3TM5A 1JQEA 1KH1A 1NJYA 1DUVG 1FFAA 1MQ3A 3MTQA 3PDIB 4X93A 4CIYA 1XP8A 3NWPA 1GLGA 5KFBA 4P35A 3RYCB 1PNRA 2C84A 2IIVA 3RODA 3WLAA 3TARA 1F8GA 2D5LA 4RLFA 4W1RA 1UJ6A 1E6CA 4Y0AA 3VU8A 4WFIA 4E5VA 1HUZA 3C5CA 3S99A 2GSWA 2AYYA 3Q3VA 4AN1A 3RJGA 1RXYA 4GW3A 4MAMA 1OC2A 4IJMA 3REFA 1WETA 2Q5QA 4LX0A 1L5OA 4XFJA 4YMWA 1P2VA 3FCYA 1SK8A 3KQQA 4QGAA 2GZHA 2HLDD 2R1VA 3NV7A 1B76A 4PGQA 1JROA 3F6RA 4FMDF 5DG7A 1CRPA 3C70A 3FNIA 3NAQA 1T2AA 4BB6A 3TAQA 1LDEA 1CPYA 2WJAA 3D6MA 1IUNA 2LW7A 3GPBA 4MYCA 2QTHA 3AG5A 5IBRA 3SG0A 3T7AA 3H1BA 2DPLA 3DOEA 5M2QA 1RKXA 1HE1C 3U7QA 3ESCA 1RWPA 4AY4A 1OBOA 3BK2A 2JJ2D 2CLDX 3PUVA 3RVKA 3ZLVA 4Y2RA 2Z9BA 2YWEA 4JY7A 1E89A 3JD1A 3RBDA 2RCYA 3PDJA 4MQFA 2WT9A 2W8BA 2XV1A 2ACEA 2R8JA 1M0TA 2GJSA 3HU5A 5DLEA 4QGFA 3HILA 3C97A 4E2YA 4G24A 4LC9A 1XEWX 3IT3A 5ECGC 4YRLA 1SKBA 1EJBA 1PJ4A 4BAZA 5FV7A 4ALIA 2G76A 3R9XA 1RRCA 3FTFA 1QGYA 1XPJA 3TUZC 1PJCA 4YA6A 4B3MB 2GMWA 3IIKA 1FW6A 3ISJA 2ZM5A 4MKIA 4OHFA 3OLYA 3OMXA 3F6EX 5IF9A 3K92A 4M9XA 4MPRA 1CF9A 4XI9A 1YGYA 4MR8B 3PENA 4AW9A 3PWZA 4DMMA 4ZCTA 2KM1A 3JZDA 3FHTA 2GHQA 4YQYA 5A5DA 3PTAA 1SVLA 3DVLA 3C7KA 2CBXA 4XCVA 3HXQA 1NKBA 4LKOA 1KO5A 4LYEA 4B3DA 4BB5A 3EXEB 1OA1A 5DQGA 3EY9A 3VO9A 4NC9A 3HXPA 2W2KB 4I19A 3FMPB 3T4PA 4AYXA 3OOYA 1N2EA 4NPAA 5ELXA 4GIBA 7ICKA 1M67A 2GBFA 2Q1WA 2VYVD 1RVV1 5EHNA 2XT6A 5B1SA 1L5LA 1X6JA 1RWOA 4HPXB 1DBIA 2K2QB 4M9CA 4GX2A 1BXGB 5JDCA 3TEMA 2O5CA 3TFWA 2E9SA 2OM2A 1I5RA 1QCYA 2P2NA 3PT5A 4YFVA 2PGLA 1K9VF 4LYGA 4LFBB 2C5BA 2J6IA 5LDDC 3HR7A 3C6MA 4D9EA 3GJRA 1FEZA 4FEYA 5EEGA 3HP4A 3TBFA 3IPXA 1OWOA 2EANA 1POXA 1NI4B 2BHTA 5EP1A 5DDYA 5KT7A 2YJ6A 4M9JA 3HXKA 1LPPA 3IHQB 1I2DA 3BJZA 1Y7LA 3CBGA 4U7FA 3B3AA 4YT2A 3UCXA 3ZDRA 2M0NA 1ZESA 4IAOA 4CL8A 1K5GA 4Q93A 3RV4A 3UTCA 2BTQB 2DPXA 1JU3A 3K5IA 1FS4A 4NM1A 1T0HB 3KAJA 3QY9A 4YV0A 2LM4A 1DKPA 3ETJA 4ZAYA 1YZ6A 4HPJB 4A27A 2DUJA 5LZ4A 3DZFA 5JD4A 3NTQA 1FMCA 1QPGA 1UJNA 2W70A 3PLAE 2NUAB 2KE7A 2KIWA 1F2VA 4QXOA 4BGIA 4HV4A 2W6ZA 1E6KA 4G0VA 4L8LA 1DAPA 1MXFA 1DC3A 2BKVA 2VKTA 3KQPA 4YWHA 3U7RA 1F6BA 4C89A 2R44A 2IHMA 2WINI 1WZCA 3GGGA 3AUFA 5IXJA 1G8PA 1RACA 2HHUA 1V6SA 3NDIA 3THVA 1ELOA 1QE3A 4RMNA 1R0XA 3BM5A 4UBLA 3WJAA 3TG8A 1QE0A 5J2BA 2Z9CA 2BMEA 9LDTA 2E82A 1Z75A 3KVRA 3N2GB 4MGYR 4UW9A 1XNQB 3EQ2A 3ADPA 2GZ2A 1VL5A 2AN3A 4O4JB 3LLVA 3OQOA 2HSWA 5JNUA 2MU1A 2GILA 3TQFA 3VMMA 3GX1A 4GVLA 1QBGA 4IDCA 4WLUA 3CW9A 3E9ZA 3CW2C 2DHCA 3FKJA 3LGSA 2YDXA 3NYWA 1L8OA 1A2OA 3K9LA 3GQBB 4NYMR 4OP1A 2D5IA 3WG9A 1D9XA 3T1HB 3A1DA 1C7YA 1B6RA 1TA9A 2BGTA 3D7SA 2EBWA 3F6SA 3GFRA 3KXIA 5J0QA 4K7JA 1TV9A 4MA0A 3LL4A 3IILA 1JTEA 1TQ8A 1HE3A 1P62B 2I6TA 1V95A 1VRCA 3SZMA 2DF4B 1Z8FA 1QIDA 3UV7A 1PNVA 3TE6A 4ER3A 1ONNA 3KB1A 2XUJA 3OZ7A 3Q0TA 3T5DA 2LDBA 2PGDA 5E9QA 3L43A 4V0OA 1SOUA 3RROA 2NOAA 3PCXA 4RHUA 3VTFA 3E0FA 5BSEA 3Q7IA 4CR6A 1NDHA 1VIDA 5LUBA 4K03A 2R62A 1E4VA 3H1GA 4MV6A 1L8LA 4M1YA 1YNSA 2QW8A 2Q6VA 1A27A 6REQA 3R8CA 5C5JA 3UUGA 4QNMA 4AO8A 2C5SA 5CNJA 4I3FA 3FMOB 3WFZA 3HU2A 1RMTA 2VTDA 1FSPA 4JJ8A 1XD8A 2IXAA 1IWPB 4M46A 4RY8A 3T5TA 1U5AA 2GCOA 3T3HA 4JBYA 5DCLA 1EVYA 3R8FA 1YQUA 1DWPA 5FFFA 5M34A 3PC7A 2EXXA 2VAMA 4OJNA 3CX3A 4RQ1A 3H18A 1KYQA 4GGOA 4OU5A 4AZVA 5IYZB 5JWRA 3BQ2A 3CVUA 1JT9A 4Q02A 4D4GA 2OV8A 4V03A 2IZ1A 2ZRLA 2FPOA 1CR6A 3W9BA 4UEWA 5BRJA 4UC0A 1KFBB 2O8NA 4ACBA 4QUJA 4R2MA 4TQ9A 1M2KA 1PDOA 2FUEA 1C8VB 2F3QA 2Z1MA 2QYOA 3DUWA 3C3KA 4WCFB 1QV9A 5KJ1A 4PGXA 1TRHA 4J29A 4KQKA 1FP2A 2XT9A 4A5SA 3RARA 3ZHQA 1FRNA 4HWOA 5LP6F 1C0PA 1ONPA 3LQ2A 4KDEA 5A06A 5KT5A 4QKQA 1NVUQ 4D92A 3JATA 5IJ9B 3U2QA 3A6PC 3D4BA 3MQ4A 3MB8A 4Q7LA 2HGSA 1L5NA 1U8ZA 4C0LA 1KU6A 2B37A 3A6GA 1RJFA 2A30A 3AI2A 3RU3A 4CI9A 1OX4B 1PJQA 3S68A 2I3BA 1RHMA 2ZJ8A 2GK3A 2MSCB 2YYZA 3EPRA 3GJ7A 4HYQA 5J63A 2ATIA 5E7MA 4AWBA 2XDYA 1IZYA 3DVSX 3BE8A 2VHYA 2DFTA 3E61A 4GMKA 1NPDA 3R77A 4K3UA 3LSYA 4CM6A 2UUAB 2CFOA 3OPYB 4EAAA 2CNWA 1CY6A 2G06A 1JKIA 5J2AA 2ZJYA 3GVHA 4DCMA 4OXRA 4RF5A 3TXYA 5A4AA 4CM1A 2O23A 1TLTA 4CKBB 1SUDA 3ZG6A 4X95A 1E58A 4KFSA 1CS4C 5K3OA 1TA0A 3LWDA 2QPLA 3DEIA 3E9EA 1J2MA 1DAGA 2AGQA 1KI9A 1TYCA 1QP0A 3QSGA 3FDZB 1H9AA 3AXTA 2ORYA 3V3KA 4C1BA 4LHYA 1OXTA 5LA6B 1KHHA 1UDXA 1Z3IX 4EYSA 1TIKA 4L57A 5B7PA 1YKGA 3G5MA 3KHKA 5EE5B 3T12A 4WOBA 1JEYA 1SQSA 5F35A 4JITA 3HP6A 5JU6A 2RI0A 2C07A 3LX5A 1YZTA 3IUQA 3DAYA 3ZY6A 3ANYB 3D6AA 3A32A 3A6FA 3CZMA 2PUAA 1GDTA 3VH2A 2J1LA 2QPOA 4PQGA 2P6NA 4A10A 2V3VA 3EFOB 3TKLA 1CQJA 2Z8XA 4QFDA 4EI9A 1Z0KA 2X2EA 4V0LA 3QBEA 4UZFA 3ZD7A 4PNEA 1YRAA 3GFQA 3E18A 3RYFB 4MUEA 5EN4A 3QI7A 1ADJA 3VKUA 2RE8A 5GADl 4GC6A 2Z83A 4P4OA 2W93A 2WMOB 2HA6A 2ZVDA 5LZ7A 1NK5A 1LH0A 1JWLA 4MUKA 2VBGA 3PF9A 3JZMA 4E5UA 2N1BA 3HVUA 4LOKA 1ZM7A 4GPD1 4EG8A 5CDSA 3C2KA 4H4EA 5K5EA 1FZTA 5CFLA 3CZ5A 4RD2A 4OQLA 5CFZA 5HW0A 1PQWA 3WK7A 4G9BA 4FCTA 3HYSA 4W1PA 1NZDA 1Q2UA 1Z4JA 4IFIA 2FLWA 2YNMC 5JSYA 3QPCA 3NIBA 4ZV4A 3VOSA 1PGQA 5AHWA 5JNSA 4DHWA 4PHEA 1ZUNA 1L7RA 2IIPA 3RQSA 5BWOA 1E20A 3JPSA 2RK6A 3O4HA 4UNSA 4JMPA 3QYPA 4NBSA 2QAGB 4MCHA 5EKTA 4CUZA 5DBCA 3C8MA 2EGGA 3H1EA 2UXBB 3ZPXA 3ZY2A 2ZJ7A 3KLMX 3I2HA 4F04A 4CIBA 2RGBA 4E5YA 5HKKD 1YZNA 2XGSA 3PDHA 3QITA 1IAVA 1QG2A 1ZJMA 1BX1A 4ZOEA 3TR5A 2I65A 3VV2A 3S40A 4DWJA 3VC1A 4TLDA 3CUTA 2HHAA 3QJGA 4DNXA 1RIFA 3CH4B 2JH3A 1NW3A 2WEKA 4OA5A 5HM8A 3HGQA 4AS3A 3AM9A 1TMGE 1DIAA 4EDFA 5L4NA 1QGOA 4ZOHC 1JB9A 1JFFA 1T9GR 1SVUA 1FTWA 3KQVA 2HRZA 2J3LA 3GEDA 3B7PA 4L27A 3ZWNA 3GFTA 4OHZA 4JVSB 3A3KA 3RO7A 4WASA 2Z09A 1PSDA 1R6BX 3PU6A 2WNSA 3NG1A 1G60A 1DKNA 4YQWA 3RRJA 2QRJA 2HA4A 5A1JA 1I36A 1Q83A 1QVZA 2B20A 4WMLA 4XDZA 2XE8A 1UBSB 4BQIA 1BDBA 1ZSYA 4H08A 1I3OA 3ZZ0A 2VZ0A 3G9TA 3R20A 2WJZB 4R84A 1DHRA 1YRWA 2AI3A 4DL2A 4R2IA 1Q46A 4W8HA 5FHRA 3RRGA 3RIHA 4Q3DA 1X9WA 4WZAE 2WW8A 3QHPA 3SI8A 2UVWA 1RPNA 1SOMA 1V8OA 3HRKA 3DKPA 4DQPA 2O2IA 4OU4A 1TVEA 3EVTA 4BIMA 4I2HA 4K9DA 5C4MA 1UFOA 4KGZA 3RBVA 5J3JA 1N2OA 4MQEA 2R6R1 2R6FA 5TMBA 1BHSA 3THWB 1MABA 3HUDA 4P08A 1Z0SA 2FFJA 3BGOS 3N2LA 3W3ZB 3MHPA 3BQ7A 2WJWA 4E5DA 3CBQA 3JR7A 5ALGA 2XKBA 4W5JA 1P45A 4NXZA 2ZYUX 2XJ9A 4RYLA 3UWKA 3ZY5A 3IBSA 9ICXA 5DASA 3GA7A 3L1UA 2Z6UA 4F4WA 1I4LD 2W55A 1P1JA 3K15A 4FI3F 4NKRA 1OMOA 4NOMA 1OREA 5C80A 3M6FA 4MYDA 1OROA 1V2GA 3OA2A 5CMLA 5DULA 1CT9A 1XVIA 2EQYA 3LO8A 5KMGA 5DYTA 4JUBA 3KFLA 2IOFK 5DYYA 4KLLA 1PJRA 5CITA 3AKYA 3H9EO 5L40A 4DCUA 1Z4OA 2H5LA 1EXVA 4GI2A 1QDLB 4ZEVA 3H4BA 2YTUA 1ABEA 3MGVA 4CR7A 3QA3E 1F2DA 1M1ZA 1SCBA 3DNMA 2XGOA 1XD2B 2VP0A 1UQUA 2DMRA 4EEKA 1Z9BA 2J46A 5JMTA 1LEHA 4IOKA 2RIRA 5G02A 5CT8A 5ALMA 4YIKA 4DJEC 1WBBA 5I7WA 5JIBA 4PHDA 7ICFA 1SG6A 4HH3C 3PW2A 4NBWA 4DHEA 1CIJA 2NZJA 5FDFA 3TK1A 4PWZA 1CZLA 4IDGA 2XYHA 3UH0A 1FPQA 1JJVA 2O2EA 3VZCA 2WUFA 3L46A 4AQDA 4QQ8A 4XVRA 4P84A 4DCJA 2VYFA 3CP8A 2COUA 3P2MA 4NESA 2X8BA 5FOXA 1CVLA 1GJRA 1RYBA 3GEHA 4FXOA 1WXQA 1V1MB 2BFDB 2CJWA 3ZVNA 3S7ZA 4MGZR 1EM8B 2E37A 2XNJA 3BMCA 4EZIA 2ZUCA 3RWBA 2AHRA 1HOXA 3NETA 5DO9A 5FD8A 3WIUA 2BGKA 5KFQA 1W5FA 1YULA 4ZU1X 1J06A 4LMPA 2DQNB 2XZPA 4TYYA 4NBVA 5EIBC 4B3SB 3PICA 1KQNA 4IYJA 3RSHA 5H4GA 4DR3B 1EA5A 4ZHQF 5DNVA 3N2ZB 3IUMA 2KKVA 3C5WP 3MWLA 4X41A 3RWOA 1A76A 4ZD6A 4TXMA 2HBJA 4JI5B 5K0ZA 3W6OA 2YFHA 1Y8ZA 3VFDA 5HZKA 4KOEC 4DLSA 3AHCA 4XSHA 1RAGA 1Z18A 1Z37A 4TQRA 1J2TA 2CHGA 2P3OA 3G68A 1R4MB 3GROA 1O9HA 2XH8A 2VDKB 3B51X 2W6OA 1QV7A 4WLEA 5EIHA 2KJ9A 2WIFA 4CV1A 4TTIA 5LDHA 2PMZC 2O8DA 4AYBC 3RVMA 1ZQJA 4U7CA 3DOFA 3LGXA 5K1ZA 2ZAGA 3W04A 4AB1A 2QQFA 5JZSA 4HS9A 2AX3A 3KP1A 1K97A 3DDWA 1Z47A 2Z2ZA 1D8LA 1IN6A 1USIA 1G20B 2KWIA 1I2ZA 1NJ6A 7ICJA 2SKEA 4MROA 4N82A 1NN3A 4UE3S 9ICQA 5B30A 3FMVA 5DFAA 1MHTA 3K9FC 3ZJ5A 2B7CA 1O87A 2PVSA 1TKRA 4U2BA 3PO4A 4ECUA 4PC6A 5E8RA 2JW5A 3V8BA 1U0GA 3CPJB 4ZMBA 5B66U 2GGSA 4LJ7A 3EZXA 1XTRA 3ENWA 4DLYA 5JYDA 2AOTB 4ZQEA 1WXFA 2JFXA 3HGTA 3JALA 2X58A 4Q3NA 2C2XA 3TNYA 2W9BB 1G17A 4DC9A 1T6ZA 2ZUUA 5IIOA 1GRCA 3OLWA 5K3CA 5HCIA 3M2PA 2J3DA 2VK4A 1H9CA 3E8SA 3LBHA 3FSRA 1KK1A 4YCBA 4GFJA 4MV8A 4CM5A 4EFMA 3H84A 1SCIA 4L4SA 3ROMA 1SB9A 4CF3A 4RZ3A 3MJDA 3DEAA 2OV4A 3SBOA 1UXHA 5KFWA 1OJ7A 4ZVQA 2J0VA 1AGRA 3DWFA 3F8WA 2ACKA 3M83A 3PNCA 4DTCA 1IAQA 4I9UA 2B9VA 3NATA 2O1EA 5KG6A 5JWHA 2G04A 1C9NA 4O9MA 4MX8A 3NS1A 1FJHA 3M6LA 4EI2A 4GBJA 4TWIA 2WI8A 5DRTA 3WNBA 3VVLA 2G9NA 1Q77A 2CDRA 2JVJA 4ZQGA 2ZBEA 4M0KA 1Y1RA 4KBGA 5C1PA 2I7XA 3DFKA 1JJFA 1UP6A 4UBJA 2VVTA 4FEAA 1IBLB 2G6BA 3R24A 1D04A 1EX9A 1P9RA 1L7QA 2D1SA 3K0FB 1N25A 2I4OA 3KPUA 4NI5A 5DXAA 3UMBA 1F0KA 3WGHA 1QTQA 3T4XA 3A6EA 4G8BA 4JNCA 1EZZA 2QRZA 4K9NA 5BSMA 3TLKA 3F6YA 4L7VA 3PC6A 4M1OA 4EB6A 2H52A 4JHXA 2PQMA 4HUQB 4ZQIA 2FW7A 4CV2A 1GOTA 1HYHA 3FSGD 4HBGA 3WVNA 1RJDA 1RAAA 1OXXK 5KYUB 5DBOA 4KR3A 5EWFA 1NW9B 3BJIC 1KSHA 2CB9A 3QPVA 4JUAA 4C0SA 5ICCA 2IZ0A 4YRTA 3IPRA 3X1KA 5JC1A 3RC1A 4N7JA 4OQXA 4GGPA 2DFDA 2OBLA 1MT3A 3FKSD 3HKBA 3S2GA 2ID7A 4DA9A 3KETA 1N62A 4AJ4A 1Z33A 1UPXA 1HDEA 2FV8A 3R7SA 3D6HA 4E7PA 3JWHA 2NZWA 3TLYA 4E88A 1XA3A 1SQ5A 3F47A 3O8OB 4ZVPA 3OIDA 2VG8A 2ASJA 2IC5A 4PFQA 1HH4A 4RK0A 5IAKA 1AO0A 1FJGB 5KFEA 2VT3A 5DNWA 4F1JA 5JBNA 2ZYTX 4ZYUA 2X7XA 2D6FC 2G17A 2J0UB 3RJJA 1JW9B 1NT2A 2X23A 2XNDD 1FTNA 3A4YA 4MS1A 4YBZA 4YRRA 1VPTA 4KWHA 1TTTA 1T2VA 1ADCA 2HDHA 4Q15A 4E5SA 3IA7A 4WGFA 3SJ7A 5EE1A 1TJPB 3OWHA 4R8UA 4O3NA 2WYVA 4L78A 1P2GA 5KVVA 2H17A 1GAXA 3QX8A 2AEMA 2CXTA 1PAUA 2AOVA 2R751 3B70A 1I2BA 1RRFA 2ZSBA 1EZ1A 1ESCA 3TPFA 1I10A 1ZQ1A 2HCBA 4IRXA 4OB7A 2FPIB 4XFDA 3HR8A 5KZMB 2EIHA 2PQ2A 3KYDB 2ZIEA 4C0JA 2D0OB 4C14A 9ICJA 1GTVA 2GRJA 3A4IA 2VT2A 3HO6A 3L8ZA 4OJMX 5BV0A 1D1TA 1JB1A 2AMVA 2MOKA 2H1LA 4RMGA 4BUCA 4IZHA 1X9SA 1FXWA 2RH4A 5KT2A 3QPBA 1G4UR 2HNKA 4COKA 1UBCA 4XTRA 1QX4A 3JYLA 2VP5A 4TVOA 1ZZEA 3C98A 2ECPA 3ESRA 1SURA 2R8RA 1EFAA 5D84A 3ZGYA 2VBIA 4IP0A 4CJXA 4OYRA 1NW7A 1XA4A 3SFVA 3PXBA 3VH1A 2BHNA 3LIIA 3TOVA 2Q6OA 1UM9A 1PK7A 5G1OA 2R6JA 1MO2A 1LGYA 2BJWA 3GMSA 5KNBD 4BXOB