3ED5A

The crystal structure of yfnb from bacillus subtilis subsp. subtilis str. 168
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
232
structure length
232
Chain Sequence
MKRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKPNVPEIIPTYEIRKLEELYHILNIENT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YfnB
publication title The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 85
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3ed5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ed5A01
2WF6A 4KNWA 3ZTYA 3FPBA 2NO5A 3L0BA 3U26A 5ALPA 2B1QA 3AR6A 5ALDA 2X4DA 4GXTA 4PNHA 1MH9A 5ALZA 5ALJA 1RDFA 2HX1A 4KX5A 4Y2XA 4CF3A 3DAOA 5AKEA 2Q4RA 4Y2PA 4JB3A 2FPUA 3R4CA 1L7OA 1ZS9A 4BNDB 5AI5A 3E81A 4RETA 4YCLA 3A1DA 5AVQA 3N8GA 1ZD3A 4C4TA 4UATA 1Q92A 3WK6A 3WK4A 5AK3A 3QU4A 3U7HB 3SKXA 1FEZA 2I34A 3L1VA 2B8EA 5AI9A 4Y2TA 3DNPA 5AVYA 2WHEA 1RKUA 1RKVA 3L8HA 4EENA 2W11A 4I9FA 3SMVA 3UMGA 3J7TA 2C4NA 3OCYA 2BDEA 3MC1A 3QUQA 3MN1A 1RPZA 2FUEA 3I76A 4DFDA 2C8KA 3S6JA 1L7PA 4KNVA 4BEVA 3AR9A 3DDHA 1N8NA 3U7EB 2W43A 4G9BA 4BX0A 3KBBA 1TJ4A 4B6JA 2G1AA 2HCFA 3ZU6A 2ZOSA 3QYPA 2YJ3A 2ZG6A 2VKQA 4RESA 1QQ6A 5AKLA 3OPXA 3W5AA 1ZD4A 2WF5A 3ZUPA 5ALOA 5AM5A 4YCMA 3ZTWA 1T5SA 2CFTA 3FVVA 4DCCA 1LTQA 3U13A 2PQ0A 2HO4A 3ZVLA 2JGAA 3SKYA 3FZQA 3KD3A 1ZRMA 4L6AA 1Z4JA 2OA0A 5AVTA 2O9JA 4O8CA 4H1WA 5ALXA 5AW5A 4KX3A 2DQSA 5AI0A 4F71A 2JAOA 1T9ZA 2HF7A 3ED5A 3W5BA 1RC8A 1LVHA 5ALHA 2MU1A 3L8GA 5A3SA 2IOHA 5ALRA 3OTQA 1Z4NA 1RKQA 5AW7A 1ZRNA 3K1ZA 4QQFA 3WGUA 3SF0A 4XQ0A 2JAWA 4Y2SA 5AM3A 4XE5A 4BBJA 5AIBA 4KYTA 1WVIA 5ALVA 2NO4A 5AKZA 3N28A 4BX2A 1RQLA 2QYHA 5ALMA 5AVZA 3QUTA 1T5TA 3NUQA 3WK9A 4CF4A 3PCTA 5T41A 2I55A 4J2TA 4OD0A 2B1RA 5AIAA 3ZVNA 2RAVA 2AUTA 5AK4A 2YMLA 2FI1A 2FDRA 3E8MA 3WGVA 3EF1A 5AVSA 3BWVA 4YH1A 2GHQA 3OCUA 2W4MA 2PKEA 2CN1A 2WM8A 4JDPA 4BKMA 3L8FA 3A3YA 1ZD5A 1YMQA 4L6CA 5ALYA 5AICA 4XPZA 3ZX4A 1VJRA 1U02A 5IT4A 4Y2UA 5ALWA 1EK2A 3NRJA 1XVIA 4HAIA 3DV9A 1J8DA 4FYPA 5ALNA 1WZCA 4OHFA 2YY6A 4ZEWA 1YS9A 4HGPA 2B8JA 2HEGA 5AM0A 1RLOA 5ALUA 3ZW7A 2ZBGA 3ET4A 2AGVA 1Z4IA 3L1UA 3BA6A 4KN8A 3NASA 3NIWA 5ALGA 2C9MA 3AR8A 1WPGA 2HDOA 4HGQA 1U2TA 2GHTA 3A1EA 4BYGA 4UM7A 2GO7A 5AVRA 2IYEA 1J97A 4UAVA 1Q91A 4YGYA 1Z4PX 2EAUA 1ZD2P 3PGVA 3AR4A 3EPRA 3IB6A 1XP5A 2MU2A 3ESQA 5A3RA 1RMTA 5AW9A 5AKHA 2P9JA 3B8EA 4C4SA 2BDUA 2FPSA 3EWIA 1F5SA 1EK1A 3OCVA 2I6XA 2P69A 3ZWDA 3R9KA 3M9LA 4FE3A 1PW5A 1NRWA 5AKJA 1L7NA 5ALLA 4YCNA 1RLTA 4Y2QA 3PDWA 5IS2A 3KOOA 3MMZA 3WK8A 1TJ3A 1NF2A 5AKKA 4Y3UA 3U19A 4QJBA 5AKGA 5AW4A 3UMBA 2G0AA 3RF6A 1RLMA 2G80A 1SWWA 3QNMA 1IWOA 1XPJA 3R09A 1Z88A 2R8YA 4UMVA 1ZOLA 4UMFA 1Z4LA 2P27A 2RBKA 5AK6A 3QU2A 3P96A 2FEAA 2YFYA 1TJ5A 3L5KA 2JAUA 3AR5A 1WR8A 2I54A 4YIHA 4BEWA 1TE2A 3SHQA 3WKBA 5ALIA 2P11A 3ZI4A 2PR7A 5AM1A 3QUCA 1O08A 2B30A 4J03A 3NANA 4DW8A 3QGMA 2YMPA 4MWOA 1YV9A 4NWIA 2I7DA 1QQ7A 3SLRA 5AKIA 2FPWA 3WKCA 3GYGA 4OCZA 4NABA 4BX3A 5AI4A 5AKYA 2RB5A 3N5KA 2CFSA 5AI6A 1YDFA 1RRCA 5ALQA 2HSZA 2ZBDA 5ALFA 1Z4QA 3QLEA 1Z4OA 1KYTA 5ALTA 5AI8A 3HLTA 5AW1A 1U2SA 1YJ5A 2JARA 1VFPA 5IT0A 3L7YA 2OM6A 2B82A 3WKAA 2WF9A 3AR2A 2ODAA 4UU1A 2NYVA 2ZBEA 1JUDA 4Y2VA 4EEKA 2G06A 3ONNA 3I28A 1Z5GA 1QYIA 2R8ZA 2YBDA 3B9BA 3ZX5A 2WF8A 3WKEA 3CZ4A 3W5CA 2QLTA 3SD7A 3OCZA 3I6BA 2HOQA 5AW6A 3HYCA 2EARA 4AS2A 3VAYA 4MUMA 1Y8AA 2HHLA 4L57A 2IA5A 5JJBA 5AM4A 3QU7A 3E58A 4HGOA 5AW8A 3L0YA 5AK5A 3QUBA 4UASA 4OFZA 5AVWA 1S2OA 3CNHA 4FFDA 3TLMA 5AW3A 2WF7A 1YNSA 1SU4A 3U7FB 1L8LA 2IOFA 4CF5A 1CR6A 2AMYA 3ZWKA 4CNQA 4NFLA 1CQZA 4UW9A 3PGLA 2G08A 4NV0A 1NNLA 5AVUA 2G07A 3WK5A 2FPXA 3OCWA 2FUCA 3F9RA 5ALSA 3L8EA 4HGNA 3EF0A 1SWVA 4EX7A 2ZBFA 3L0CA 2OYCA 3QU9A 4ZEVA 4YIKA 3QX7A 3W5DA 2O2XA 1L7MA 4Y2JA 2C8LA 3AR7A 5FP0A 4EZEA 3WK7A 3IRUA 4IFTA 2R8XA 1QH9A 2OBBA 1QQ5A 1RMYA 2R8EA 1Z4KA 3FPSA 3WKDA 2YJ4A 4IG4A 2B0CA 1Z5UA 3NALA 5AW0A 2Q5EA 4HYTA 5A3QA 5AM2A 2D2VA 3ET5A 2FPRA 5E0OA 4UAUA 2GFHA 3IJ5A 3A1CA 4UM5A 2HI0A 1U7PA 3MPOA 2C88A 2YN4A 5ALKA 3M1YA 4HGRA 4Y2RA 1N9KA 4DWOA 3E84A 2Q4TA 4G63A 3OCXA 2MSNA 3QXGA 3UM9A 4AP9A 3RFUA 2I33A 1L8OA 3KZXA 3N07A 3ZVMA 4BNDA 5AVVA 4UMDA 5ALEA 4AS3A 3KC2A 4EELA 2GMWA 2CFRA 1O03A 3I1YA 3UMCA 3QU5A 3N1UA 1RQNA 1K1EA 2RARA 5AW2A 2IOFK 2EATA 2ZXEA 3AR3A 1RMQA 4GIBA 1AQ6A 4E88A 4UMEA 4ZEXA 1L6RA 3D6JA 1X42A 4Y2YA 3FM9A 4I9GA 4XOUA 1VJ5A 5AKXA 3B9RA 1ZJJA 4UARA 1Z4MA 2YMQA 3U7GA 4C4RA 4F72A 2YMMA 3NAMA 3ESRA 2WFAA 5AHXA 1U7OA 1S8OA 5AVXA 2HF2A 1TA0A 2AH5A 3FGOA 3KDPA 2BY4A 4UU0A 2G09A 4CE6A 5AESA 2YJ6A 4EX6A 4NAVA 2YJ5A
chains in the Genus database with same CATH superfamily
2JLSA 1RXEA 3RS3A 3D8TA 4HH0A 1RJGA 3DF7A 3L40A 4O29A 1NJ1A 4RQ3A 4M8LA 3OEWA 1M2KA 3HA5A 1DARA 3TTTA 5EFOA 5J2BA 4UB5A 2B9VA 2PV7A 5DTJA 2FP4B 1UPHA 1T10A 5DB4A 3BERA 3R4VA 5KDLA 3B3GA 1J2NA 4AF6A 3AP3A 3P2MA 3YASA 2VHJA 1MD9A 2X0DA 4ED1A 4KNVA 3RYIB 4NXZA 3DHYA 2JIOA 5A6VA 2PKRA 3BRWA 3FCOA 3F4KA 3A6DA 2CD7A 1XLWA 5GZ3A 2DF4B 3NFRA 1XQ1A 3PXUA 4QAQA 5CDYA 1X6VA 2F4VB 3LZDA 1I4LD 1ZAYA 3FZEA 3LDFA 1NYQA 5ICGA 5AP9A 5IAAA 2DL0A 4EHJA 5TE9A 3W90A 1T4MA 3G8CA 5I7EA 5KT2A 3LXRA 5CAEB 5BPHA 3FYUC 2P68A 4UJ5A 2EAPA 1TO6A 1EIZA 4XRRA 1RP1A 1AHPA 1P6UA 1CRLA 3A0UA 4Y1EA 5DHSA 4GLXA 3O4JA 4E31A 3N8DA 3ICOA 5CK5A 2CYCA 4ZVNA 1UP4A 3WL5A 1NR5A 2ATLA 1C3OB 2GPWA 4US8A 2RGRA 2PLRA 1IHYA 5SY4A 1V1RB 3CQ9A 2MSWA 1Z06A 2N1MA 4QDZA 4S04A 5DNEA 4FW9A 2IQ5A 3RRBA 1E1CB 1NKVA 3VUEA 2AGVA 3IERA 1COKA 4ED9A 3NI2A 4I2DA 4BMDA 3KB8A 3AVXA 3H7IA 5DN9A 1JROA 2A5LA 1GGFA 2YN0A 4CRXA 2AVNA 4N65A 2VHXA 3VZRA 5T67A 4JXZA 3D2SA 1G3IA 1F2UA 5IZCC 2MU2A 1GL7A 1NM5A 2UDPA 4BBZA 1B8PA 2OXFA 1F4LA 5ALLA 2LD4A 1F2DA 2ZUWA 2CT8A 4BS9A 2IHTA 2NO0A 2EKLA 1WIWA 4YXJA 4XIJA 1VL0A 4FFVA 1NF3A 3WY9A 4E30A 1CUDA 4V2UA 4MVJD 2BGMA 4NAUA 1ESMA 4O5AA 5M3BA 2FMHA 1DXYA 4YRJA 2AJBA 3VPHA 2OXEA 4QWAA 5DB8A 2X13A 1GTMA 2EFGA 3DTVA 4EVSA 4W99A 4ENSA 3EC1A 1X0XA 4KDFA 3G13A 3WBFA 1EWTA 5DYYA 4DC9A 2WF9A 4O1MA 1NNUA 3E2IA 1JLLB 1BDJA 5L1KA 2UUCB 4M88A 3OZDA 3L6RA 5IJ9A 3IVAA 5UKDA 3I6BA 2DCMA 1PNTA 5BOVA 2PRYA 4Q1DA 4B45A 2Q21A 1V71A 2X5NA 2CHEA 5T8KC 3D1LA 1PD1A 2FQ1A 3W8DA 1U7TA 1BE1A 3NJ8A 1SOMA 1LA2A 3IBYA 2QB0A 2I76A 3ZY4A 1NUSA 3Q6MA 3U4IA 3RFXA 3M6XA 3IOCA 1XBTA 5KNCA 1N5IA 1FS5A 3AR7A 5JO0A 3V6KA 2IHUA 4CV0A 2XQGA 3AO0B 3Q8LA 2W2MA 1RXWA 3W1EA 3HBAA 4QYMA 4Z1OA 3A1CA 3SICE 1NJ5A 2C88A 4EHHA 2YN4A 1P0IA 1O94C 1HLGA 4JC8A 2PFSA 1R12A 1ZL0A 4HAOA 3DB2A 4KLEA 4O3NA 4QU9A 1KC3A 3IURA 4LOAA 3HXMA 3VR3A 2PSSA 4D6PA 4RFSB 3ROFA 3NYRA 3ZY2A 4BP3A 4KIFA 4FMPA 3DM5A 1HBJA 4MITA 4M8KA 5DCUA 1Y1KE 4BAUA 1RYBA 5E6RB 4PHGA 1CQJB 4KXWA 3ANXA 2G09A 2NLOA 3S68A 5AESA 4R8LA 2CLKB 4EX6A 1BIFA 1OLSA 4Q3AA 1JHRA 4BO7A 3TK1A 4M9LA 3KOMA 3KQUA 1F8UA 3BWXA 2X4DA 4KQ2A 3WRXA 5JEEA 5JROA 4D81A 4U3JA 5B36A 1X38A 3WYCA 5DBCA 4DV4B 3S1AA 3V7JA 1ZM9A 3DBHA 1OH5A 4JZYA 3MJEA 4RACA 5KYUA 1OUMA 2A9VA 5KX5A 4YRAA 4EI2A 2JI8A 2XKAA 2Q1UA 3U61B 1OGJA 2FUNB 2I3AA 2VPQA 3ZZNA 4JX9A 3LFTA 5GONB 2V9PA 3RLFA 4B7AA 1XTSA 2PY6A 1RWKA 2BKEA 1YA6A 1PUJA 1UCFA 1A2BA 3FDXA 3ZWBA 3ZQ4A 3M9XA 3V1NA 1NOJA 4I08A 2ZSBA 2HMTA 4RZRA 1NLYA 2AFIA 2XE8A 2OBYA 5I9TA 3VPDA 3FZQA 4LZGA 5FV7A 1F0MA 3MELA 4B17A 2E3TA 3QLUC 5BWMA 1XO0A 2JH1A 1GRCA 3GCWA 3HN7A 2Y1DA 1NZJA 4DAOA 1HOXA 3BSFA 4DQPA 3FTDA 3D8RA 4L9AA 1QIMA 3TTSA 4KMOB 1VHLA 3OZIA 2GZSA 2O8DB 3RAEC 5CD9A 3LLUA 3U6BA 1GN8A 4BXOA 2Q4DA 1KDVA 2CXSA 4AJ4A 3NAQA 3KQQA 5IJXA 3N74A 2JLVA 5BR4A 2VA9A 1O6FA 3WWZA 5IM5A 1RP7A 1YI1A 2GOLA 2GEVA 3RSHA 4CM6A 2Q6LA 1SGWA 2GAAA 2RH5A 2Y0BA 5B1EA 3DVAB 5KPJA 1Z19A 2B8JA 2VF7A 1JLSA 4UCFA 1YB1A 1WMFA 1MO5A 2CLDX 3T0FA 3J81A 3RH4A 3CE9A 3N9IA 3T06B 1GRNA 1JSLA 1HTBA 1A71A 5I9LA 3MILA 4GBGA 2JXJA 3NIBA 1NC3A 4LGYA 1ODJA 3A6FA 1QHHA 4D74A 2C4VA 2BCVA 1R8SA 4GMGA 4A8JB 3QFSA 2FR1A 5IC5A 1OXVA 3L82B 2ZWAA 1N3LA 3LVVA 4NG4A 2DKOA 4PX5A 3W8FA 5ITWA 4MIEA 3Q1LA 1SWWA 2O7QA 1ULUA 2I8LA 1EE2A 2XWSA 2J3HA 1DGQA 2WJ4A 2OHVA 1KEKA 3IELA 3WGIA 3WLPA 4QNMA 3DEIA 2OFPA 4OGWA 4Q1VA 1DGSA 2C31A 2HCTA 4NI5A 4MUIA 3CGWA 3A9CA 1QMGA 3RU9A 3ZU2A 3TADC 3PIIA 3RKSA 2WILA 2CEKA 5IMSA 2PZJA 2G5CA 2J5QA 3OJEA 2ZBDA 4FEGA 2VNSA 1XKTA 2QX9A 4M21A 4LE1A 2HBRA 2R751 2AQKA 4OH1A 3RFFA 4N4AA 3ZX5A 5EQJB 1C9NA 3TDMA 2W9BB 3MPUA 3ENQA 3A9VA 3DE4X 3L7OA 4WL0A 3UQZA 1UAGA 4Z49A 1P4AA 3V8PA 1WNFA 4MW4A 4UQGA 3SNKA 2EJTA 5A06A 2ZJ5A 1DX4A 2HSDA 1DRJA 3OCWA 1PEYA 2FE9A 2JFWA 3GAAA 2OCYC 1AZLA 3WIOA 4KUEA 3W5DA 2JDID 2W4IA 4L0QA 5FTKA 4IMPA 3DM9B 4GKKB 1NNI1 2Y2UA 2H3EA 4LV6A 3ESDA 1AA9A 2Q6KA 5BT9A 1CPYA 5JRJA 5GZ6A 4HLNA 4RA9A 2D2IA 3S3TA 4NLCA 3CJTA 1OX5A 1WU7A 3QPVA 3K8QA 3PR3A 1ZJZA 2D1RA 3D59A 2YZKA 4YXFA 4L2IB 5D5PA 2RBGA 4WA7A 2C29D 2DXIA 4DG9A 3QEJA 4I4CA 1VL1A 16PKA 4I2HA 4IICA 1ZL2A 2VJPA 1Z16A 1K92A 4L78A 3W5HA 3ESRA 5JLJA 1W4AA 4D3DA 2YVAA 4Y6OA 3O4FA 4LNUA 3MQFA 3W1VA 4MX8A 1L5WA 4B3BA 9ATCA 2HWXA 4J7AA 3D3WA 3FPBA 3R7BA 1Q14A 1RWMA 3NVVA 3SJZA 3REOA 3AIIA 2F1RA 1JHPA 4EBFA 4B7CA 1D6SA 2E8PA 2VA8A 4FR5A 2ON6A 3IFSA 4PG4A 4KB5A 5DYIA 1R8XA 4PLZA 3GT3A 2CDNA 5DE3A 3NWEA 3SQWA 3M1AA 1V9SA 1KQ3A 3AY3A 4R2KA 3IIJA 4HRAA 3CE6A 1XA0A 3M3DA 1OE0A 3BA1A 3OLWA 4Q39A 3E03A 4J4BA 1NQVA 5K2OA 3KJEA 2WA2A 4FHFA 2EW2A 5JJIA 1G4UR 4LY9A 3NBQA 3QKRB 2VXOA 3HADA 3NYIA 4YJFA 3L6EA 3L6CA 4I0WB 3GJRA 1SUBA 3TL6A 1RRKA 1EVZA 3E9MA 3UV7A 4F5DA 4Y0VA 5KTRA 2BGTA 5HRAA 1T2VA 3R8XA 1Z15A 1BNOA 3BKWA 1XEXB 1WG8A 1R0YA 4HTFA 4J16C 2IHYA 5JU5A 3SS7X 4PZEA 4ZT7A 3RAPR 1OTXA 1FRNA 2O8CA 4PHHA 3VU1A 5ECGC 3EF1A 3JVEA 5JPIA 4PQFA 4MARA 5EE5B 5ENZA 4HNUA 5H82A 4UVGA 3LIIA 1MJGM 3FPFA 2P6UA 1QFXA 2Q0QA 4OG2A 3IT2A 4BVAA 2O7RA 3NETA 4QXRA 1WBJB 2WAQF 5ALUA 2VBIA 1NONA 3TFQA 2WMYA 3SX0A 4IHJF 5HEKA 4N40A 3D1JA 3FYUA 1PJ4A 2N0SA 4YJGB 3RC1A 4N01A 4WN9B 1Z75A 3TLGB 4IIJA 4HDAA 3FR7A 5BNTA 2JKVA 2E4XA 4JD5A 4C0KA 1XVVA 3M5DA 2JVKA 5K6AC 3G5LA 4JJ7A 3GEDA 3P32A 4Y1FA 1J4AA 1XD9A 3PJDA 1H0SA 3EWIA 3TLXA 2I9GA 1ZYQA 1GNQA 2V5UA 2C22A 3PHLA 3QF4B 4ER3A 1RXYA 5P21A 4JOQA 4AJNA 1QS0B 1Z4LA 2H3QA 3BAZA 2WZQA 1OI3A 2YW2A 5B7PA 5FOSA 1IBLB 2VDUE 1XMXA 2HHUA 3MR5A 3DHNA 3OQ1A 1TVMA 4J6EA 1NW3A 5IZCA 1N6PA 1IPFA 1ZQGA 4Y1GA 3D4IA 3P45A 4NWIA 1P1JA 1F1JA 1HNZB 5T5QA 3IC5A 3JD2A 3GA5A 1VB3A 3CLHA 3ISJA 3ZZUA 1MDBA 3VU8A 4DE5A 3F6CA 1R4NB 1TTPB 4B43A 1XMPA 2BH9A 2OC4A 3ID6C 1QIFA 1P62B 221PA 1VGVA 4R81A 2NU8A 4RZ2A 5C32A 3WQBA 2A4MA 2VTVA 3L07A 5EMHA 2PXIA 3MB8A 1IJFA 1NDQA 2H4FA 4OFZA 5ANRB 5CBKA 4BX9C 5KOHB 2WYVA 3CUVA 3HCRA 3U3OA 1JG3A 6ADHA 1PL8A 4HAYA 3LAWA 4PQEA 2OWOA 3IPLA 3GRYA 4RCZA 4RIFA 3KPWA 4P92A 3L0CA 4HVTA 1E32A 3ADPA 3ZZTA 3DBRB 4B9EA 2GZDA 1NVTA 1W0KA 3RWOA 3OCCA 3CIOA 5ITZA 1RYRA 4HYTA 4UBJA 2DUYA 5E0OA 5KTTA 4J9KA 1V43A 2NAFA 4MR9B 5KFTA 5FKJA 5T8KA 2IHVA 2G8NA 1HZJA 4QGSA 5AVVA 4HLCA 3OAAD 2J0UB 4UHDA 7ICRA 1BOOA 1NY6A 4K86A 2AZMA 5CYGA 3QPAA 1BROA 1S01A 2WTUA 2ZXEA 1PS8A 2LE0A 1U8XX 4OB6A 3IMKA 1SG0A 2R68A 4PRZA 2JEOA 5ILGA 1PG0A 5AKXA 1R66A 1EU1A 4KSBA 3O4RA 2NP7A 3EXHB 1F14A 3GLRA 4C0HA 3PGXA 1O94A 3E61A 4BZZA 1PFYA 2QTCA 1LBSA 3SYLA 2GK4A 2PGIA 3KYCA 4MWGA 3M4XA 3REFA 2FX5A 1SHLA 4J1NA 4RTMA 2CYBA 2YV3A 1LNZA 1MO6A 3OLCX 1N9ZA 1E2GA 1LBHA 4WXHA 4EM6A 2VDNB 2V0GA 3N2IA 3QEAZ 3RB0A 2Z04A 2PWAA 4BQNA 1I51A 4UQPA 1VMKA 1MQ3A 3MK31 4P4SB 4GOOD 3AERA 4BEVA 3SX2A 3U09A 3KT6A 1Q84A 3JPRA 2GZMA 2HAEA 4GQBA 2AG5A 4PSAA 2HH9A 4YP0A 3L8DA 2NUPB 2RHBA 2ATXA 4KQWA 4BIIA 5LFAA 4WZAA 2QUAA 1Z0AA 3SEFA 3K5WA 5J43A 1M72A 5BUZA 4FIDA 1SKYE 2HJHA 4WNAA 4XGNA 3A0HU 1TT7A 1A95A 2HJRA 5HJEA 4XIFA 4AIIA 1TEXA 1AUPA 4DIDA 2P9TA 3CA8A 1T5TA 1TDJA 1E2UA 3DCIA 1Q0QA 1PBNA 5LIRA 2Q3FA 5DG8A 4QULA 4PZCA 4P4PA 3TGWA 2G6BA 3TI9A 5CJJA 4V0OA 2ZB7A 3QLUA 1KO4A 1P2VA 2AQHA 1V95A 1ODKA 5LMNB 4P84A 1RLOA 1OD6A 4FMDB 1E79D 2I78A 4ZGWA 3OF5A 1MLDA 4UD2A 2XQFA 2WIAA 3O7WA 4W82A 1SD1A 4FPXA 5DMHA 4YALA 2HRCA 1QTMA 4ND4A 5C0YA 5HR7A 2AC4A 1H3NA 3GT7A 1RYZA 4XX0B 3IDAA 5K0LA 3WGMA 1QLNA 3UUEA 1QJCA 1OX6A 3THWA 4KWEA 1FFAA 4MVJI 3W4JA 2G0AA 4IR7A 1XWWA 4QVKA 2QG6A 4O3RA 1ISRA 1JQBA 2WRZA 1IWOA 1KZYC 2DPGA 5B6JA 4X94A 4MR7B 4DYVA 2FJPA 5BYKA 4BE9A 1WF6A 3FGPA 2J8ZA 4LFCB 5A9TA 2DPMA 3GLKA 4BVLA 3HL4A 4AWAA 1EJ0A 4IWXA 5BQFA 3L8CA 4IV8A 2QRGA 2FG7C 3OLXA 4QUJA 4LBWA 2ZANA 1XZKA 1G98A 2F9MA 1JYEA 4A0RA 4XSGA 3JWGA 4WDRA 5ALQA 4M1SA 3HYSA 3DZ8A 2EU8A 2OILA 1XVTA 3E3NA 3RRHA 4C0AC 2E18A 1UPUA 2H8GA 3CLRC 4MLCA 1R6TA 1UJMA 2PKXA 3KPUA 1MV8A 1BFUA 4G0UA 3VNSA 3UUWA 1H38A 4U6PA 1XJWA 3P0HA 5BWOA 2CLFB 3TQCA 4IGKA 5DPMA 4RVGA 1G0OA 3TADA 5FOVA 3NOVA 1GN9A 1E3WB 5DM70 1CQZA 2MDTA 5CB6A 4RPGA 3BHNA 2VP5A 4UHHA 2GYUA 2NU9B 4NPAA 5FLYA 1LPBB 3JASA 3PFFA 2C96A 2VJAA 1VCOA 1TK2A 1CHDA 4GI7A 5CR9A 1RQPA 2SECE 5KYYA 3UQYS 4ZICA 4L4SA 1AV7A 3MT8A 3UAYA 1BTOA 2G4VA 2L69A 1YZGA 3ZVMA 2X9NA 3VR2D 4EZBA 1MF7A 1XXHA 1WXXA 5LXTF 1SCAA 4UU8A 1F4VA 1RI4A 1L3TA 4ZVKA 2GPTA 4QBFA 3OA2A 2XNKA 3VC1A 1S2GA 3QKTA 3ZHSA 9ICAA 2GUWA 4RJLA 5BQOA 4AKEA 3PFWO 3EVDA 3HI4A 4QYWA 1F06A 1NVMB 1XU9A 2M1ZA 3MR6A 4JWTA 3UFXB 2PT9A 2JZBA 2IEAA 4I8IA 3ZWCA 3RF7A 4XM1A 5DT2A 3UUFA 1U7DA 4G0YA 1OAKA 3OLZA 3PNKA 1NWHA 3IAHA 2ZJ7A 2K6GA 1VMIA 2C7QA 3R7DA 3GG2A 1NOMA 3QMVA 4TMKA 4O08A 4URUR 2J9FA 1BD4A 4QDKA 3VGPA 3HYNA 1NHGA 1OUQA 4YUVA 3IO3A 1M0WA 2MYPA 1A82A 2PBFA 2VDMB 4D46A 1QIJA 4TN1A 5HTKA 3M6KA 4D7AA 3KTFA 3QXJA 5A0TA 1LTQA 1QH1A 3A05A 1XZFA 4IS2A 1L1FA 4TLCA 3KD3A 3MS2A 1IU9A 1L5RA 5JAQA 2EKDA 3KXIA 2XY5A 1LVHA 4HB4A 4E09A 1E9SA 1EEXB 1YU6A 1B1AA 3AU9A 4L5BA 4RKFA 2H54A 3KBOA 4Y2SA 2FSPA 5DOZA 3QVXA 3DO5A 2Q29A 5LD2B 3FG9A 1I32A 3GR6A 2GYYA 3AJ8A 4H0CA 2H18A 3FC4A 3C7DB 3OTGA 4OQDA 4P4LA 2PJDA 1N0IA 2A94A 2B3TA 2IU4A 4ER7A 4DSLA 1W35A 4KN6A 1WP4A 4Y1RB 5E4TA 1U4OA 4DZTA 5ELLA 2GCPA 4J16A 3Q2OA 4EUKA 3KWLA 4ZAZA 4IC9A 2IUTA 1JPUA 1RBMA 1I9GA 5CGQB 3UH0A 1T9AA 5DWVA 2OV1A 3K0SA 4HGQA 1T6XA 4PWZA 4F4DA 3HP6A 1Q1BA 1BKDR 1GZSA 4DUPA 5KCMA 3PLNA 1OA0A 2ZJBA 3EPRA 2HWYA 2BM1A 3FSEA 4KL8S 1SM4A 5CUQA 3CRZA 4EB3A 5FL7D 4YMHA 3IHWA 3I6ZA 3EE6A 1UAAA 2IV2X 1O89A 5E3IA 2X4IA 1PVQA 4B40A 5HUQA 3LPCA 3R7FA 2AUMA 2YKGA 3O95A 2H52A 5ICSA 5BPFA 3WKBA 1U80A 3IE2A 2WWVD 5M7EA 3N58A 3ZHCA 5K6AA 4ND1A 3IKVA 3UC5A 1YO6A 4M76B 1ISJA 1M2HA 4AMGA 1Z5WA 3HKZC 4YRFA 1ZUWA 2II6A 3TR6A 2LGJA 3VX3A 5IABA 1HX7A 5JS8A 3ML1A 1MEJA 3PRKE 3QNUA 2D0DA 3BD7A 1II8B 4GZ6A 3KAQA 3LVRE 5TQ0B 4Z4CA 2X4LA 3F9CA 4QEZA 3ITDA 3N8NA 4BZQA 1P19A 4FBMA 3KSBC 5BV0A 3RCBA 2QRJA 1GV0A 1JHVA 2DMRA 5B3KA 4L15A 4PQRA 4OQXA 2XW6A 2V5VA 3PUYA 3AVTA 1QLJA 3KVVA 1JKFA 3RNOA 4CMAA 4U00A 4OQLA 1X6JA 5JQGB 3Q88A 2HREA 4UTPA 2Z8ZA 4JN6B 2Z09A 4EK9A 4ZQGA 4FGKA 1X15A 3ANYB 1F3OA 4BJ1A 4WKCA 3FDFA 5DLYA 3W2FA 1YF3A 3EZLA 1HG0A 1SU6A 3EGXB 5F76A 4IDNA 1J42A 2XCUA 4CL2A 3ZD9A 1I5RA 4JUBA 1ECGA 1SOWA 2ODEA 1SU7A 3VOTA 1WY5A 4Z5XA 1V8DA 4LOIA 1BXGB 4XXHA 4BX9A 4UMDA 4BDPA 1ITZA 5CRIA 3I1YA 1BHJA 5MGNA 1D7OA 4DV3B 4BNWA 5JH7F 1A4XA 3UV6A 2GHIA 3RVBA 3ER8A 2A35A 4BMNA 3KJQA 4Z4EA 2CNWA 2CNLA 5LQRA 1P2BA 1YZHA 3A1WA 3JRWA 1E64A 4PAOA 4C04A 2WJZB 4DR1B 4EARA 4DBLC 4YRDA 4RTOA 1ZHFA 4KTTE 1T91A 2YFQA 3QUSA 1L4HA 2XZTA 3SAFA 4X62B 4AXBA 5AKEA 5H59A 3KHRA 5AQEA 4R8MA 3B53X 4PTZA 4HZUB 2GETA 1NLUA 2H9YA 2FLKA 4Z0NA 4GMFA 2DE0X 2GJKA 2B83A 4BRUA 3GEEA 4QZHA 2Q1XA 2A1UA 2NZJA 3BD9A 1ESDA 4ZCQA 1Z6PA 1PSDA 1M8KA 1TJNA 5TMPA 3U3KA 2FG6C 3AF3A 8ICSA 2ZOSA 1QE0A 3F4LA 3F5MA 1YQXA 3VR4D 4MDEA 4ID3A 1KOLA 4I8XA 3DD5A 4KXUA 2BZ1A 4ZZ2A 3H1AA 1SKBA 1V5WA 2QMYA 3PDIA 4H6WA 3T0GA 1UM8A 4C3VA 3BGOS 1Y1TA 2KFNA 1BWQA 1WQ4A 1EFVA 2AXQA 4LRXA 4JL8A 5T41A 3ROTA 1YHZA 1KPIA 2MTBA 1O6CA 2O5CA 5FOUA 3HBMA 3K32A 1S10A 1JU4A 1TUGA 4RNCA 4D96A 4MMYB 1CF9A 5G1OA 1Q0RA 3MCWA 2CXOA 2IVZA 4CPDA 2ZIVA 2WI8A 3A3NA 1NC1A 4Q45A 2J9YB 4MWEA 5K1ZA 1XMQB 5CDGA 1J9GA 1B6GA 2GXUA 1SKQA 1P17A 1T9CA 1GZHB 4QZCA 5M2QA 2PN1A 3V55A 2GVDC 1QHSA 2D0PB 1ECJA 3T9EA 3E0FA 4XFJA 2J6HA 1K7EB 2QPTA 2HOFA 4IOKA 2X0RA 5LZ9A 1M2EA 3WGLA 2OR3A 3OZWA 3OTHA 2IDZA 3JCZA 4UHEA 2PUWA 3AYZB 1A9PA 3ABIA 2XGGA 3LX5A 1NVBA 5KAIU 1D8BA 1JTVA 3EXFA 4PAWA 2DJ5A 3IQHX 1SXPA 4QJBA 3NPAA 4N3GA 1IBSA 1X7WA 3T7IA 7ICLA 2SKEA 2EX4A 5ABPA 1VCIA 3ZE9A 3IVMA 4LPKA 4JBWA 3IQIX 4FHDA 4EI8A 5EJ4A 3TMAA 3IS3A 1O08A 4CU2A 2VJLA 5KT3A 2O57A 1E69A 2W3RA 3UMSA 1C80A 2LPEA 2I7DA 5IAJA 4LV5B 4Z3DA 2I6QA 4RMJA 3GEPA 1GNVA 2AEFA 2LCQA 3KV3O 3ZE8A 3SEIA 9ICXA 5K51A 4ZDKA 1WZUA 2V45A 3U7QB 2CHQA 3RAQA 1BVUA 5KNDH 1ZOPA 2V7EA 3AR2A 4F3TA 2NRWA 4Q66C 3MGGA 4DCVA 2X76A 3R9XB 1X9HA 3RVLA 1G4AE 3TQTA 4RO0A 4DNQA 3AILA 5KFDA 1C2YA 4TTTS 1IC6A 1UFVA 3VNAA 3P20A 4P0QB 1HE5A 1RWXA 4PRLA 4ZI3A 2GR9A 4NFLA 4EL0A 1NNLA 5TVKA 3P9NA 5TX7A 1FP1D 4DMLA 1GG5A 4E33A 4WKPA 1L5FA 1HT0A 2PZEA 4RF3A 5KVAA 3ASVA 5D6OA 2K8BB 2F8MA 3Q7RA 3KS9A 2AMVA 3T5DA 2BGLA 2QVBA 3IQZA 1BPXA 1Y1LA 3B1YA 3C3MA 1G55A 4JNCA 4B81A 3SQDA 4WBNF 1Y9EA 1P3Y1 3HYTA 5A4JA 2Z2IA 1SIUA 2PUHA 5A5FA 2PGNA 1KO5A 4KIGA 3DMHA 3MBIA 2I7XA 4Q21A 3R0ZA 1YS4A 4NAHA 3WZ2A 5K01A 1JDNA 5DNDA 3VKVA 4ZVLA 3ETJA 4MW1A 4RJTA 2YMQA 2RK6A 1KN5A 5AHXA 2IZZA 2PO5A 3LBYA 4FKMA 1UF9A 2VH1A 5LUBA 4D8VA 2GEKA 4GICA 4X8HA 3BHMA 1LRKA 2B1QA 3AR6A 4K28A 3RU2A 5L1MA 3A06A 5IVDA 3B6JA 4WN3A 3WBBA 1BXRA 1ZS9A 3RF9A 4YROA 2I80A 4OV6B 3ZW9A 2XA1A 3G6YA 3TACB 4AY2A 3TQ1A 3TD2A 2BI7A 2PUJA 1QWSA 1F6DA 1W19A 1LLDA 5HVNA 4C3OB 2G77B 2FUEA 3PFGA 4XVRA 1Z5VA 5DXAA 3D3KA 1JFRA 3K96A 3RFAA 2KQUA 3I0MA 4F45A 4UUMA 4EZ9A 5HKKA 4M1YA 2ZUEA 3CLUD 4TLAA 4WNIA 1J2RA 1P8JA 1L4EA 4K2AA 2AEMA 4YLEA 4QGHA 3JRNA 4XEUA 3B1KA 2CK3A 1NFRA 2F43B 3H13A 2VZLA 1ZM7A 2YHBA 1T2EA 3WXBA 2DPHA 3LUPA 5BT8A 2GAOA 1H6DA 4CMJA 4BFZA 2BTOA 5BMOA 3CMCO 1XQ6A 1XWIA 1PK9A 3MTQA 4MR8A 5AIAA 1T2AA 3NORA 1GCUA 3EPKA 5JT1A 5LZ2A 3E8MA 5KG3A 5K0NA 3A28A 3K0BA 3VDQA 1Q22A 2ODQA 2DRIA 4IPTA 3W1WA 3DOEA 1EQ2A 5KX5F 2CN1A 2CL6X 4PQGA 5NLLA 1K8ZB 4ARUA 1Z37A 3FNIA 5DHQA 3ZS9A 3WO1A 1UC4B 3QZ8A 1IEQA 2FLVA 3TB6A 2VOJA 3FKSA 3V4LA 4ECRA 1UKCA 4Q16A 3O8RA 2ONCA 2A88A 5GIOE 2XB4A 1KYZA 4N8SA 2EKQA 2Q8QA 1FNBA 2QUZA 3U4HA 1GZ7A 2QE7D 4LDPA 1MVNA 4A10A 5EWLA 4JJAA 4BPRA 4RVSA 1UMCA 3EPIA 1W2WB 3O9ZA 3V1UA 5AKHA 3B8EA 4AZVA 5C3MA 3OQJA 1GKUB 4KOEC 1YZFA 2FUKA 1NF2A 4IX9A 3CEPB 2NG1A 3T5MA 3J80A 3AB8A 1B8UA 3QE2A 1M2VA 1E6UA 3QU2A 2PH1A 4NJMB 1OXTA 2LNDA 3PYLA 4QTTB 1EP3B 4FYHA 4UBLA 5TT0A 4ZGBA 1LPAB 1VBKA 2OL4A 2W6MA 2QSUA 2NUAA 4HLUC 3BQTA 1JQDA 3JATB 2APJA 1N1GA 4PZOA 5C8YA 3FTPA 5TT1A 5KC9A 1ORIA 2C5AA 1QFYA 4MQEA 5KPDA 3G5MA 4GPAA 1ZVQA 1PJTA 4O4LB 2XAAA 4W9NC 3ZXXA 3ORHA 1CQPA 1SVIA 3PNSA 1I6WA 4B1FA 4UU1A 2BEUA 3PFCA 5B3JC 3NHAA 4WLNA 3DJFA 4G81A 3THYA 1Y9JA 5L3SB 2XBLA 4ZO6A 1GLGA 1U3FA 1RLUA 3H5LA 4EKNB 4DSIA 1CXZA 2JGDA 3JRXA 1NP3A 4WRRA 1TZMA 4D82A 1IOVA 1GTJ1 2E9SA 4TTPA 2QI9C 3MBKA 2OPBA 3RC3A 3P2IA 2ZTSA 5L9AA 3O31A 2BGRA 3DDOA 1W5EA 3WHLA 2Z58A 5EWMB 3VMMA 5JEDA 2Q5JA 3U62A 1SD2A 1QHEA 2YS6A 2X8BA 1TEHA 2VPPA 4ZH4A 5GTDA 2Z6AA 1XHFA 4TYMA 5JLAA 2E6KA 1AUQA 1Y82A 4DZRA 4MWBA 1JILA 4KQCA 3L7KA 1J21A 4GLBA 3RS7A 4TV9B 3A11A 5L4NA 3HT3A 1C7JA 3ZCVA 4II3A 4C4PA 4XWOA 3PE6A 2X7HA 3L84A 3A4YA 1I14A 2I4LA 1T0IA 1MTOA 4B4VA 2X2EA 2H5JA 3RBAA 2JGKA 4IHQA 2JFXA 1K98A 3BF7A 4KJZA 2ZT6A 4FFBA 4CWAA 2ZYGA 2MUTB 2XUJA 4G37A 1U0OC 1T6YA 2H51A 5HHHA 1VTKA 4O4IA 1Z25A 2VYVA 3LQ2A 3DAOA 2DFDA 4RC9A 2R87A 1RT9A 2JHCA 2VP2A 4AICA 5BNWA 1D1PA 1WHTA 3HVHA 1Z56C 5LN1A 1F44A 1KGSA 1P31A 3U44B 4CW7A 2M98A 3KHTA 1B4FA 1ZJNA 3MC1A 3V2UA 1JU9A 4KDRA 3KKZA 4UFNA 3Q3VA 1BMFA 4DTCA 1NHWA 2FEOA 1X3SA 2H8KA 2E1PA 1I7NA 1WE2A 2P9QA 3KQPA 3QTBA 4XYMA 4ZOAA 1ZSYA 4ZPJA 4GZLA 3K7EA 4UAGA 1S0UA 1GITA 3LWMA 5CFLA 3TFWA 4FE4A 1E9EA 1DAKA 1F51E 4C01A 2V54A 4FGUA 3V1TC 1JEQB 1E60A 3FSGD 1VMDA 4W9RA 3ND5A 2IJGX 5CITA 2KSOA 3AIMA 1QQBA 4QQFA 3SF0A 3K15A 1EH5A 4KN9S 4NXMB 1R8QA 4D8TA 1ZGGA 1AQLA 4N6GA 2YMLA 4LGMA 3WV4A 2ZYAA 1XZMA 2D1QA 1YQ9A 3EUFA 1PSWA 1HYEA 2RJOA 10MHA 5KNDA 8ICFA 1CJKC 3ZK8A 3G6KA 4Y2UA 4MFAA 13PKA 5DTMA 5EWGA 2Y93A 3K72B 3X1KA 1V38A 2GJAA 1CVRA 3AFIA 3NB0A 5G5GA 1XN4A 2FMIA 1G9SA 5E7MA 2RHWA 4M22A 3RYFA 5LM3A 3JS5A 1T3LA 1G8AA 3UVEA 3BFVA 4IKEA 5A4KA 5DT9A 1VBMA 2WVHA 1VHJA 4UTXA 5J0RA 1NBAA 1IG3A 4PPYA 4UXIA 5JD5A 3C1YA 3HJAA 3QWFA 5KZMB 3U60B 1ORRA 3M6WA 5J5CA 4NULA 3P19A 4G0PA 4NYIQ 2X42A 3W7VA 4RH0A 1IM4A 1KSFX 2CVOA 1MJHA 2ES6A 2VHWA 1NKSA 1EUCA 1ZP6A 5EHQA 1Z88A 4KO1S 5I7SA 4AO6A 3GCXA 4KLDA 4JSRA 1VYUA 1TT5A 4PXSA 2EAMA 4B6RA 4RVNA 3PGKA 3H75A 4ANFA 4NBKA 1GCOA 2OG2A 3H0MB 4QPJC 2RAUA 2BR0A 2J67A 1L4NA 4EYOA 1Q15A 4UZFA 1V6AA 2W9AA 1S77D 1DDOA 4EVQA 3LFUA 4ZOEA 5JSFA 4LTNA 1HL7A 7MHTA 2XUQA 5AKYA 3FCUB 1KVRA 4J6FA 4ZCLA 3TLBA 2B7LA 3R75A 4KIJA 3M9NB 3GOQA 3NRCA 3RBVA 4ZU3A 4J1SA 3TOSA 5EY5B 2YR0A 4BGEA 1SKRA 5FWYA 1G5RA 5KOIA 4U2KA 2JI6A 4FOSA 3HVIA 3LVQE 1H4TA 3B3AA 2GILA 4B4KA 5HF8A 3VVBA 1OASA 3GA7A 5IKOA 3I2JA 4FFDA 1MR3F 3TLMA 4RQ2A 5DKFA 2ZT5A 1XZGA 1ULTA 4CG2A 4J2OA 4AN4A 2F6RA 4Z6FA 5JI3E 3SK0A 2TECE 3O1JC 2VQSA 2G83A 3BWMA 2IYWA 4D3SA 2P2GA 1CRPA 4W1QA 1OYOA 3HX0A 4U6SA 1WZNA 3WP0A 4DCNA 4F5RA 4KQXA 1Z5UA 1AE1A 2XNJA 3G82C 4FZ5A 5A1JA 5AUPB 2JNWA 5JJKA 1Q11A 4HD8A 3MG9A 1JXAA 2ATVA 1P6XA 1WMSA 3KZXA 2XUDA 3TKLA 1T1IA 3ETHA 1YS7A 5KVSA 3OJOA 4L7VA 2PA3A 2I3DA 1MABB 1LLFA 3Q15C 4W5TA 5EYPB 5FRDA 3DFFA 2FK8A 4WFJA 1WS6A 3X44A 1H5QA 1KZGB 5KJFA 1NPDA 4R83A 4AIRA 3FZNA 3PQ8A 1A0PA 5AVJA 4J76A 2IY8A 2XKBA 1BDIA 1KJJA 4QBHA 4KWCA 1ZUNB 4FJ2A 4KQJA 4D6XA 4IP0A 5BO5A 4CKWA 1XSPA 1GZ6A 1TAGA 1FP7A 1SKMA 5FUQA 3D3QA 2V6MA 2FDCA 3QJ5A 2CLOB 4ENUA 1TM3E 4ABTA 1R0KA 4XVUA 1ZQKA 1QRTA 3UMGA 2NGRA 4FGJA 4WPGA 4J3JA 4XCQA 2HADA 4XIYA 4MK4A 2QPAA 3EZFA 3IKJA 1P5JA 2RK3A 3QW4B 1OAOC 2C95A 3IH5A 1ZQJA 3AEZA 4KSYA 3INTA 1UK9A 4P4UA 4B83A 2Y27A 1A8HA 4WERA 4RA6B 3L7JA 2AXPA 3A1TA 1M76A 2QD2A 3RTGA 3IULA 4J9LA 2D5CA 2C7RA 8GPBA 2V96A 1U90A 3I09A 1C20A 4NJOA 4HTAA 5EGSA 4NLGA 1JZTA 2VJMA 3F7OA 4WADA 2VTDA 5AOAA 3C98A 4BX2A 4I1IA 2ADMA 2QYHA 2G3YA 3C97A 4CV3A 3O92A 2DG2A 1WBBA 3T41A 5F5LA 3DCYA 3C2MA 3BS4A 1R6DA 2QENA 3VPXA 2C3MA 3AEVA 4ROTA 1L4LA 3UXYA 3IBCA 1UOQA 4GGPA 4PLGA 4D4JA 1KTQA 4EATA 5DTQA 1K5HA 4EYKA 2BHSA 1I5OA 4E0BA 3BA6A 1FFGA 5FI0B 5D5HA 4DV5B 2G1JA 2E55A 1K5PA 4QYIB 5C2JB 2CB0A 7ICSA 2GNOA 5A5GA 4PO9A 1LTKA 3IB6A 3B2QA 2PKWA 2PTGA 4Q8EA 3GDOA 2VFAA 1JKJA 1US8A 4IRUB 3CRMA 1QHYA 1S8FA 2PFKA 4G25A 4I28A 4WFIA 1POXA 4LY3A 4AJOA 1ZEJA 3QEOA 1OXKB 3H9UA 2IYNA 1B15A 4AJ1A 3WMWA 3O2SB 3W3AH 1S3GA 3U0VA 3FSJX 4YDRA 5LBUA 1KK1A 4O25A 2GN4A 3I5MA 2C9BA 4ROSA 1XVAA 2XF2A 5BR1A 3QG5A 2Z08A 1R15A 1BC5A 2X1HA 2XB2A 1IH8A 1NQUA 1ZXBA 1U94A 4X91A 3V7FA 3VDNB 1WXQA 1NOIA 3DLBA 4GT1A 3KDSE 1ZXXA 3BIWA 2VF2A 4ZV9A 5HWSA 2PQ6A 1QRUA 4XGIA 4AKHA 2Y77A 4NDAA 3CH4B 3TTWA 5JFGA 1NBMD 4HLUA 3NDRA 4B9AA 2BEWA 3IP4B 3N59A 1N4AA 2P3OA 4N7MA 2FPKA 4IGIA 1FX1A 5CXUA 3UUGA 1JDUA 4TUYA 4KWHA 2C98A 4W9NA 2I03A 1JR3A 3TJRA 1THTA 3QX7A 1G6Q1 4C7BA 5B3JA 1UJNA 2IY7A 5I4BA 4PTYA 4B74A 4NJ8A 1EDEA 4GMHA 3HRDD 1NSTA 1HQDA 4EPTA 1L8AA 3K31A 2Q4TA 5CB8A 1FFXB 4IIVA 4OKSA 5BNFA 1U6IA 4CIVA 1D2MA 3O9MA 4JASB 4I4IA 3MJ4A 4MVJM 1YIDA 3HJGA 1ZMRA 1ZQWA 2CNNA 3ZCXA 2DQNB 2PYIA 4CQLB 1CW2B 3CG0A 4A26A 2WPDD 3JPQA 1KDHA 5IIKA 3SJUA 5JBIA 3L6UA 4KGXA 3NVKI 3H87A 4FCWA 3W6ZA 4PZZA 5G1NA 4PY2A 4US2R 1X7DA 4L3VA 1T0PA 2R2AA 2IHJA 4NMMA 3WGJA 2E4WA 3SLKA 3LXUX 2Y4OA 4KDCA 1ZN9A 5ALZA 4Q3KA 4JA0A 4L73A 3ZHOA 1ZNYA 5T7BA 4D3XA 2C94A 2YWCA 1U8CB 4ZYLA 5DHPA 2QL6A 5DNYB 3V6HA 3QFHA 3TSWA 5D6NA 4F84A 4V3BA 3TNDA 3P9KA 3LI2A 2AIRA 5ICCA 2WJWA 4PHTA 1N0HA 2HKIA 1QTNA 1T4CB 3ONFA 2YJNA 4MV5A 3BBPA 2WU8A 1MIHA 3QHPA 4NM1A 2ZRBA 4FOPA 2DY1A 4J0EA 4X6LA 2IX9A 3GRKA 4M1WA 4Y18A 5LUAA 1KI7A 5BVGB 3PWKA 2AC2A 4ECSA 1REQB 3CX7A 3P27A 4OAPA 2O8FA 4UJ3A 2Y0DA 4IOLA 2JAWA 1WCIA 3OSPA 3N28A 1H4SA 3ULKA 1IPEA 4EFDA 3WYAA 4J2TA 1EHIA 5K8IA 2QZ9A 4RV5A 2MR6A 2LI6A 2PK3A 4FINA 5EPEA 3VDRA 2WC1A 2EEPA 5CFPA 3LO8A 3LG2A 2XRMA 1LY1A 1GPBA 3RRFA 4DF4A 3M7IA 1PWHA 1AV6A 1N75A 1P1CA 1AMOA 3K9QO 2EZUA 5BSGA 1JFTA 1S9FA 2HA5A 3DT8A 2BGIA 3BMNA 3PI6A 4WZZA 4AO8A 2O0KA 3KDAA 4RIHA 4YJ3F 5D49A 2O7VA 4YGYA 5CX4A 1FDTA 1FU7A 3RIGA 3BQ2A 5JZOA 4NS1A 1V8PA 2QVYX 2Y71A 4YT8A 4XWTA 3A6EA 1W4LA 3KQLA 4TS3A 3GNQA 3AZQA 3R2JA 4Q1CA 4DSNA 1OWOA 2JFGA 4Z9XA 2PX2A 1QF7A 2K5UA 3W04A 2R7MA 1ZXLA 3I9V1 2JFNA 4HY3A 3R3UA 1H2EA 1U2EA 2UYQA 2CE2X 4WZBA 3SZ3A 2I8AA 1P2TA 4CFSA 4KMRA 3IALA 4BEWA 5BW4A 2ZITA 5LMUB 3Q41A 4B09A 3ZCUA 3CWCA 1PQPA 2QN1A 2GN0A 2RGUA 3ZJUA 1PZHA 2BP7A 1GDHA 3ONWA 3RRNA 5I7RA 3JY6A 1FLNA 4KI0A 3ZDQA 4MWOA 1USVA 1F0NA 3OOJA 4TKUA 1R4MA 1YR2A 1GCAA 2WM3A 1JEOA 3VHLB 1ZLXA 2QLJA 2OQVA 2O59A 1LKYA 4L08A 2IHMA 1RXUA 3FBTA 5DNCA 1CUKA 4ELUA 3LFHA 3OZTA 2VJKA 3JWEA 3BPSA 1OLUA 2EFCB 4LJXA 5CCEA 5CA0B 1BG6A 1JFVA 1TA9A 4YCXA 4NBVA 3M49A 1E6MA 2POQX 1ZESA 4WJZA 1FQJA 5ARDA 3SKVA 2JJYA 3SBDA 2DKFA 2J6SA 4US1R 1Z00A 2YOHA 4ZO7A 4TVBA 2C8LA 3GBVA 3GLGB 2G5PA 4EZEA 9ICBA 1QH9A 4GPTA 2AQIA 4KK4A 4UQLA 1ATZA 3ZDCA 3WJ7A 3NJ4A 2D2VA 4WTOA 3RUDA 5ALKA 3DWGA 3DKKA 3HA7A 4Z3OA 5CA1A 4ZYVA 4NYMQ 4OSPA 2MCFA 4H3HB 1GL9B 4Y2GA 2VNIA 1KMHB 2JIRA 3F8SA 4NP6A 4EABA 4IVRA 1UIMA 4NF2A 4EW2A 3VH3A 1IWPB 4CI0B 2Q49A 3W6PA 4A82A 4ABYA 3VYVA 1RPNA 1WNTA 3IV6A 3S2EA 4BDTA 5K0ZA 4C2AA 3JWHA 3WNCA 1KS9A 4FSDA 3A6PC 1OXUA 2EDAA 2JCYA 2OCGA 2Z2ZA 4LW8A 4QUAA 2PWZA 1U3WA 4IUDS 1P7WA 1ZQHA 3FHCB 5LSAA 4NU5A 3OFSA 1X9SA 5L40A 2H0RA 2B35A 1XSNA 2I2FA 4C89A 4YR9A 2AE2A 3L7AA 3T95A 3R24A 3ZGYA 3RT9A 4KIUA 4XR9A 3DL2A 3IAM6 2NADA 1R9GA 1R9JA 4MGZR 1XAJA 5EIBD 1A88A 3R44A 4ZD6A 3SQOA 1INLA 5FOWA 3E15A 4ZAWA 2QRQA 3CLKA 1Y3IA 3TL2A 4M54A 2YIDA 4LRQA 3C39A 1XX6A 2DUMA 3ZTWA 2PLWA 4H60A 3U13A 2PRZA 1LZLA 3U48A 2PX8A 3KX2A 3TPFA 3MWEA 1MIOB 1E9RA 3W3AA 4IJVA 3IDOA 1VRVA 3ST7A 5DU2A 1V2HE 2IITA 3FYDA 3MLEA 2IXTA 2E3JA 4IH9A 3ZIAD 1D8AA 3C1OA 1H8HA 4GG1A 1OAOA 3BIOA 1G2PA 2LV8A 4M1MA 2F3NA 4H9GA 3V1KA 4DSFA 4XAQA 2VT6A 2WDZA 3ESYA 4U7TB 2MRLA 2YXDA 4RGBA 3M7DA 1FFYA 1DS6A 1ZMOA 2PKEA 2RGXA 3IDZA 3WMRA 1RQ7A 3LLSA 1R16A 1S6YA 3DT9A 2W8KA 3CZAA 4ENTA 1DOHA 3JYNA 4C6TA 1N0VC 2HDNB 4JXKA 3DAHA 2UYHA 2R1TA 1X7GA 1M8JA 1LLCA 4R8SA 1GFZA 3CLSD 3NS7A 5T14A 4N76A 3RUAA 4CM8B 1U4SA 3LLVA 5CM9C 3ZS8A 3KTOA 1O96A 4E13A 3NYQA 5CDFA 1ATIA 3V7NA 3I2KA 3GO4A 4U7HA 4QW8A 1ORVA 2H4JA 4BQRA 1B8VA 2G5IB 1ZH8A 2QRHA 2VSNA 3PG5A 4C21A 5JHHB 3AQFA 3K5PA 4YTEA 1E7YA 2P69A 1P4JA 1SC3A 2R66A 5CT6A 3ROGA 2IZ6A 5I4CA 1R0BA 4MW9A 2VN8A 4DWJA 1WO8A 4BAZA 3TNYA 4TXLA 2OKCA 1XPJA 3ITEA 4U0KA 2P27A 3PX0A 5I3ZA 4PPQA 4IQ0A 2Z4RA 1DLIA 3THVA 4Q48A 3W5SA 3H4TA 4PG7A 4FSXA 2CXRA 1ZA1A 4IQVA 3N0WA 4AJJA 1PT7A 4DIBA 5K0SA 5J2GA 1Y1PA 2CKMA 4V3CA 1JE0A 3T3FA 1P9OA 2HJWA 4L8LA 2XNSA 4PX9A 3KUDA 2AYZA 2BMDA 3VGJA 3T3MB 1CUEA 1OC2A 4IQFA 3MABA 4AVYA 2NACA 1S5LU 4NBRA 3EEYA 1PLJA 5KG7A 2AFRA 3SC3A 3V32A 2YBDA 2FW9A 2OO7A 2WQZA 3WTCA 2P6OA 4WCFC 2XE6A 1CVIA 2UZ0A 1O9HA 2L17A 4PIPA 5I7AA 3AG6A 3HBLA 1WVGA 4Q4CA 5E2AA 2R18A 3ZU5A 2B7CA 2BHLA 4DL2A 2QW8A 4K1XA 1EVEA 3L4PA 1ZNXA 5EINA 2GF0A 3PHBE 1XQXA 3SPXA 2GBLC 4NONA 3ZU3A 1EAYA 4IH1A 2HTFA 5A4IS 1FJGB 1PI3A 2A9JA 3H1BA 2NPIA 3RB8A 4YCDA 1TNDA 2HT6A 4C0XA 2AOXA 2CNDA 1B3RA 4UB2A 2D06A 3H65A 3CZ9A 4K9OA 1U0LA 3P9SA 3IKMB 4YK7A 5L3QA 5JDCC 4BWVA 2AS0A 4ITVA 4ESOA 4MQBA 1ZVKA 1HY3A 5G0WA 3CZPA 4YP5A 3GXOA 4QICA 1FDUA 2KWIA 2RD2A 2YJ6A 3QW2A 4L16A 2HCJB 5M34A 2I1WA 5KDDA 4ZTUB 2G40A 2IUYA 5ECDA 3AEKA 3K1TA 1HE2A 4WY8A 4YMIA 2OYYA 7ICVA 2UYYA 3TBHA 5LZ5A 3WWPA 1URJA 1G20A 3LLCA 1ZVMA 2JR5A 3RVSA 1RZRD 5LQKA 3DOUA 3G2PA 4GMKA 5ERGB 1H8EA 4OATA 1NG9A 3WLKX 1LC0A 3QXSA 2HHAA 3NTXA 4C8NA 2W37A 5LOVB 5DBAA 3T5LA 1CJTC 4R66A 1N6NA 4TKVB 1PYOA 1QIHA 3AK4A 1UMDA 3VC2A 3PXAA 4EPVA 2AG8A 1QE5A 1AQNA 5D2CA 4RQ5A 5KNBD 5J0SA 3MR2A 1GZ3A 4W5HA 3GJ0A 2VPWA 3WWEA 4XDHA 1WCNA 3USCS 3BK7A 1BXKA 2ZSIA 4ELVA 3FZYA 4ZK2A 4EQ6B 2RI1A 4IDDA 1CR2A 1QDLB 1DC3A 5AHKA 4YAGA 4RULA 2ZTMA 4RZIA 1W4RA 1RQRA 3F3MA 2YCLA 4OXYA 2NW6A 1NLFA 3OOHA 3KOUA 5J2UB 2NWQA 5CT5A 4GX0A 1PFKA 4Q7QA 4MULA 5AM3A 1RC1A 2DGDA 1SG6A 3EQZA 1B26A 1IJBA 1FRQA 4QOEA 2RI6A 3UENA 3GDWA 3GOHA 1LFAA 2R6DA 1RCFA 3ZYZA 3MWGA 1ES9A 2EANA 1DQSA 3KKKA 1JECA 4DUZB 5J1SB 1WCXA 3AJRA 3HWTA 2F2TA 3SYTA 3EGOA 4QPNA 3DEFA 4ARZB 3C6QA 3DAPA 2PUAA 5PGMA 4CLEA 1Z12A 1CC1S 3UWSA 4ZEWA 1YS9A 4RK7A 4CETA 1H2RS 2V6FA 3OEHA 4Q4HB 5HJ2A 2ZU6A 5TQ2B 4NR0A 3RROA 1A7AA 1JR6A 4ZAYA 2M6SA 3CKYA 1H6CA 4ZU6X 1UDXA 2ZYSA 5A71A 3EIXA 3VOSA 5U1PA 2E89A 3KUUA 5A3RA 1EWRA 4DA8A 2WMOB 1VLMA 4MV3A 1LI4A 4G4SP 3OFNA 3SY8A 4F96A 2JVJA 3NTLA 3WK8A 3S28A 4OHXA 3RF6A 4RZSA 2FSFA 1V45E 2G71A 5E79U 5K8LA 2FVYA 1JIVA 2Z98A 2X8JA 1RD4A 2DETA 4K5QA 5JMTA 2QARB 1RXIA 2VBFA 2ZSEA 1BU8A 3BHIA 1YFJA 3CN7A 4R1TA 2B20A 3NT2A 2Q99A 4KOAA 4Q43A 2W5UA 2Q8NA 5DTRA 2B99A 2ZKLA 4N5LA 3ZJVA 3OZCA 2CNBA 3PD1A 1CBUA 1M34A 3D8HA 3T94A 1A5ZA 2FOXA 3QLEA 3O2NA 2PGJA 3MW8A 4F1JA 5AW1A 3CNOA 5KT7A 3RSOA 4IJUA 4RD1A 2VJDA 5CM2Z 3UK2A 4PH5A 5F3XB 3FY4A 4HWGA 3WJAA 3NKLA 5CEHA 4ZQEA 2ZSJA 3PVZA 2NV0A 2Z83A 4KW7A 3OM0A 3HCAA 1G6HA 2F17A 1QNLA 4G26A 2IP2A 4HGOA 1JEEA 2PUTA 2ZS8A 2BMWA 4DS3A 2CJWB 4NEHB 3UOGA 3TAQA 2LBOA 4ITRC 3TL3A 1ZGBA 2QGNA 1DT5A 3SZMA 3BB3A 1VCNA 2XVAA 3GBPA 5H4GA 4JQZA 5HK8A 1RMYA 3C43A 3TMKA 4M7PA 5DN6A 3A4IA 5C8YF 4JYZA 3OFVA 3I53A 5HSGA 2AFVA 1VE3A 1XTTA 3CBGA 1TMYA 1WP9A 3ZDFA 2MSNA 1PJQA 1G2OA 2DBZA 1L9XA 4F92B 4ZVOA 4QU5A 3NO4A 2E87A 1ISSA 3UYKA 1KY3A 1W44A 5HA5A 2AD5A 3JAWB 2GSWA 1BJKA 3DZBA 3TEFA 3H4DA 4L8VA 1MMFB 5FBVB 3MGHA 3KFXA 4DLTA 2Y99A 3OSNA 3TOVA 3CEMA 3LXMA 2PT6A 2XYVA 4NU0A 3PBKA 2PTHA 1UK6A 3NAGA 3TQQA 1FYDA 3HNOA 1GKLA 1LF0A 4S1PA 9ICEA 1QSLA 3EVBA 3BD6A 4ND8A 2V0CA 1PVVA 2E0IA 3RJIA 1A4RA 1LRLA 3HCBA 2ZYVX 4P81A 4B6SA 1LBTA 3TE7A 1XDZA 2C77A 1CE8B 2XXAB 2KEYA 4HAUA 5LJIA 1YIAA 1Q74A 1FJHA 5LLTA 4QDJA 5EPUA 1T3TA 2E8NA 4B3GA 3OZSA 1QVVA 4H6XA 3EVEA 3SNHA 5HR6A 5KFJA 2UVVA 4YAKA 3CT6A 3GFFA 2YINC 4MS3A 3SMQA 1SVOA 3IEPA 4IRDA 4RD3A 1S2NA 4ZYZA 3L8GA 3GEGA 1PVPA 3P0FA 4O4IF 5HK9A 3B3FA 4QWWA 2I65A 4WX2B 1TADA 2JVIA 1OZHA 5K3EA 4QTZA 4FD2A 3LYSA 4MRRA 4DLWA 5AVSA 3D6NB 5BW5A 2A4KA 1M5RA 1B6TA 4YT5A 4BKMA 2R5WA 1OPXA 4II7A 5ALYA 4QTXA 5TJ9A 4RMIA 3EOBI 2REXB 3QJGA 1G4HA 3NV9A 1ZA2A 3K0FB 5LC1A 2B0JA 3DFIA 3I9NA 3ANLA 3MT7A 3UNXA 1V7PC 4CM4A 1S8NA 3AJ9A 3M4YA 2H5LA 4I2FA 3IQDB 1ENOA 5HTOA 2NNWB 1RXCA 1J97A 2A0FA 3P2EA 4FW8A 1T36A 2DF8A 1EM8B 1ZR4A 3AR4A 2OCKA 1J8QA 1YVUA 3F2BA 4IF6A 3L92A 5FTWA 4C7VA 2WB2A 4PX3A 2IPXA 4U7JA 4B9MA 2IFTA 1FMTA 3LKVA 4OXNA 3OU2A 1QP0A 1XA4A 2WVJA 1JJVA 5IAOA 5TF4A 2C4UA 1E77A 4CV2A 4F46A 1PYGA 3D2CA 2G36A 3F5DA 5B55A 5D84A 4MVJE 3K35A 5B2EA 2XEXA 5KYKA 4IDQA 2RGDA 3DR5A 4LCEA 1WDTA 4TRMA 2QRKA 2OG1A 3QELA 2IRWA 3T35A 1CT9A 3TE6A 2SICE 2ZIUA 1VPVA 4KP7A 5I4IA 4HEQA 1LJUA 2B36A 1GOTA 2XUOA 4M0EA 1Y5IA 4EEKA 2NU7B 4CV1A 1F0PA 3GPIA 5EE1A 4IEEA 1RQXA 5B4UA 3BRCA 3KKPA 1WYGA 4KR3A 1U1DA 5LYJB 4XB2A 1VFNA 4MUMA 3NIGB 3ISDA 2RHMA 5AK5A 2F3QA 1OTYA 5DNVA 2MAXA 4F4ZA 4KE8A 1ZQDA 1P1FA 3QP9A 1ZIOA 3R6WA 3O2QB 1ADYA 1E7RA 3COSA 3JTMA 2FPXA 2E4ZA 2BD0A 3F9RA 4IIBA 4YWHA 3B0XA 3KQOA 5THXA 2FV8A 4FO6A 2VWQA 4DIKA 3P9IA 4NNOA 5E3JA 3IESA 3WK7A 1V3TA 5J2HA 3BDPA 4YASA 5E7JA 5LQMA 2VUUA 2KHVA 4LA4A 2COEA 5K0EA 4WCFA 1T2DA 1UZMA 5EUMA 4DNFA 4DC0A 4N7RA 3MT9A 3LK6A 2AX3A 1GUYA 1XDWA 3CCBA 1G5IA 1JWAB 2B6HA 2QLBA 4YR7A 2A3RA 5JPCA 3NX4A 1L5QA 1N7IA 4PLYA 1R0SA 1W4ZA 4JEMA 1YAHA 4R65A 1OYVA 3EXEA 3G3EA 3G59A 3PUIA 5CVUA 5DBIA 3V8BA 2GBLA 4YACA 4R51A 4PHEA 1IBKB 2RP5A 2C2KA 4HAWA 5DM60 4PN7A 3LUKA 3TQOA 1TKCA 2OXTA 1BGXT 4BUGA 3IR7A 2J85A 2PZGA 5JCJD 1KEWA 2YQ4A 4YI5A 4B84A 5IILA 2O1EA 1K0FA 2P8SA 4H0NA 4Y2XA 3DL0A 5I5GA 1X87A 3WNQA 5JDCA 1Q0SA 1GNRA 3LW7A 3RUPA 4K05A 3UJAA 3JVIA 4Y2TA 1Q77A 3EIWA 4L5IA 2HHCA 4U2GA 4L85A 3CZ5A 4BKQA 1R4AA 5AJVB 5H5JA 4YDHB 1NRXA 4TLBA 3K94A 2OV6A 4R1LA 1RAHA 2UXDB 4URFA 3MTBA 4IIFA 3SKYA 2OD7A 3TZCA 2O9JA 4H1WA 1XTUA 1ABFA 3H9QA 4FTWA 3EDOA 4NCKA 3PPVA 1W49A 3OZBA 2MA1A 4MRVA 3ZE2B 3UT5A 4LFBB 1Z4NA 5LWHA 1LSUA 5BSHA 2XNDD 2PKYX 1GARA 4H7IA 4XSVA 1E9FA 3EYWA 1NL3A 2KIVA 3KHSA 4P5DA 4UNQA 3TJZA 1XD2B 2RCYA 1G16A 1CQIA 4NCNA 2PGOA 3D8SA 5IK2D 3BQNB 4UXJA 1IUPA 1TVKB 3GGCA 4ECAA 1PGPA 4MYTA 1SXEA 5T3UA 4GPIB 1LXCA 2XT0A 1KR5A 1U0TA 1XK7A 5DXJA 2VH5R 4Z51A 1KHHA 3QX9A 2IX3A 2QVGA 1GNLA 3OZEA 1CUHA 1K63A 4FR2A 4DUGA 2RHHA 4YAWA 4DF8A 8ICJA 1BX0A 5CHGA 1OBHA 3NP7A 4Z0TA 1JMSA 5FOTA 2QT0A 1NXXA 4ECQA 1FX0A 1XRRA 1YT5A 5AVRA 4LJLA 4PYMA 3I9OA 3MBYA 3PF9A 1SRRA 1ICIA 3R5KA 4NENA 1V35A 5EZ6B 3I30X 4F6CA 3CNNA 2WSSA 2IW3A 3BTUA 1HH4A 4HMOA 5BP7A 2WYWA 4MWTA 1PW5A 1KO7A 4PONA 3VRHA 2LZ0A 2O23A 3UMBA 1NASA 3EG9B 3G2OA 3F5QA 2RI0A 3HKDB 1SL0A 1Q46A 1E3QA 2GJ8A 5G0SA 1B6SA 1Q16A 3QVOA 2UYCA 4EB6A 1UBNA 4X63A 1W36C 4TTAA 1Y1RA 3ZXYA 2IYYA 4D02A 4B3IA 3N7UA 3OJSA 1WD7A 4USAA 5TLSA 2RHTA 4RTPA 3MERA 3PC3A 2FVXA 1BYUA 3E4CA 3QA3E 1X2IA 2KIWA 3UT6A 4MKRA 3LX4A 1N5OX 1BX3A 1I2MA 3AG5A 3DLTA 3DG9A 5FIUA 2PD4A 4DL3A 2FPOA 5IX8A 1VLHA 2UZAA 3V1LA 4KN4A 2X1MA 4MP8A 5FUXA 3M6LA 2C2HA 2VAVA 2AHOA 2J41A 1H93A 3L46A 2VHTA 1HQCA 1KVQA 1K89A 4UDXX 1UANA 2IA5A 1EGAA 1AKMA 2GCOB 1MB3A 2ZYUX 4RQNA 1QGUB 4V2IA 2R44A 4Y6RA 2I1QA 1ZD8A 4LJ9A 3U37A 1IYZA 3A6ZA 2IYFA 3JYLA 5CW2A 1H9BA 2VDQB 2JBHA 4OJQA 2Y1IA 4P8RA 4A23A 2J3MA 5DLQC 1EX7A 4IUYA 2QYOA 4POAA 3DKVA 3VI4B 1I94B 1WUHS 5HRUA 2C0QA 2F4NA 5FTLA 4LXHA 2V7XA 3AZOA 1SBIA 5T6BA 2R7KA 3IIMA 1KKUA 2YJ4A 4XD2A 4B3RB 3RK0A 2NVUB 5E8JA 2XYPA 4MEXA 4FT2A 4B3SB 3G2QA 5HIIA 3AUXA 1O5IA 5JTUA 5TGZA 2OECA 2CHUA 1CJBA 1BE0A 4LF8B 3MINB 2BLLA 3OE7D 4X45A 1DX9A 3IG8A 3Q9LA 2GAIA 2KZMA 1KYYA 1SBHA 2JK1A 1FCJA 5DYTA 4FMBB 1R4ZA 1M1XB 1LH0A 2V5AA 3G6XA 4JJFA 4ZVUA 4AAYA 1DQZA 2RAPA 4KKVA 3HKEA 5DIZA 5JNVA 2P5TB 5TMBA 3ES9A 3HJFA 4J0KA 5BR8B 3IVXA 1FU8A 1S9DA 3BGSA 5B1YA 4I46A 2W0MA 4YQFA 4P33A 5EKDA 1YC2A 1U3DA 4NM2A 2ZRMA 4CDNA 4AUMA 2QQ0A 4DREA 3KOYA 4Z4HA 3QQ5A 2RGNC 3UCEA 2HHQA 3VHXB 3GJYA 2AOUA 2ZYTX 1E1NA 4AMVA 3LHDA 5BVHA 3RIXA 3G8AA 4N0PA 3EXIB 1PG2A 5A62A 1OT3A 2FTKE 2IC5A 2OZPA 4WZ6A 4FLMA 3F4BA 4R1MA 1A27A 4UUQA 3WL4A 4G1BA 4YO7A 2ISPA 3O3NB 2WY2D 3TCXB 4G0OA 4GYJA 4XEHA 3UJ8A 1X7XB 2XNCA 5K8JB 3W06A 3GX1A 1L3IA 4RHFA 2EW1A 4XQGA 2XH8A 5A6SB 1P77A 1X2EA 2UZ3A 2YV1A 5BPCA 2VRNA 1Y42X 3GLUA 5A4MS 2GK6A 3DLHA 5K0FA 3PDJA 2CV0A 1IN7A 3PA6A 3FTNA 4S35A 4O5OA 4W5RA 1VQ1A 4E2WA 2E4VA 5JMWA 3GLFB 1TLTA 3IDSA 4NZYA 4ED2A 4KVAA 2QY9A 5SYAA 1N32B 2JLCA 2BFBA 2XCSB 3M4JA 4TWJA 4IIJF 2A1IA 3Q3EA 4ESEA 3DMDA 1XJ0A 2YL2A 1N3IA 3D6MA 4AYTA 2XUPA 4QJ4A 4OO1J 1G7SA 4EQZA 1CDDA 5C8DA 3LHKA 4H1VA 3FFBA 1IQPA 9LDTA 1WZEA 2QDKA 3N8KA 3PGA1 4BZXA 4CUKA 2EFJA 2IXAA 3IXLA 3A1EA 3GFKB 2P1RA 5GGYA 2QB5A 1TO2E 1DQYA 3AT1A 3FIUA 3DBOB 1QSSA 5CP8A 2A9OA 5HRCA 3ZU4A 4PLFA 1PEKE 5CT9A 1CUBA 4N49A 3NNDA 2JFYA 3G0GA 3A6KA 3NHSA 3VKHA 2ERCA 2ZTUA 1QJ4A 3G2HA 4Y3UA 1ECPA 1UC8A 2FX3A 3CXUA 3R5TA 4K03A 3R09A 3HSSA 2HQSA 1UXKA 4HNVA 3D54D 1N8SA 2VDJA 1AKVA 1AKQA 1SZCA 2QT9A 4S05A 1O77A 1A97A 5LBTA 5CP2A 1O1YA 4ADSG 5D5QA 3H99A 1U3VA 5HCNA 1I4OA 1B0ZA 1ZZEA 2N1RA 2IYSA 3I52A 3AM4A 4JP3A 5JISA 1L5ZA 3B89A 2CLCX 1UXHA 2ZM5A 4EVRA 1ZJ4A 3GPLA 2KP7A 4X92A 5JD4A 1E3DA 2HSZA 3VZPA 3T3OA 2G88A 5ILOA 1FMLA 3F74A 4FFMA 3NUGA 5GADl 4CM9D 1SBNE 2G06A 2JJMA 5JPDA 1DX6A 5BUCA 4HYEA 1FZTA 5HGJA 4DPMA 1ZFNA 3BXOA 2ZJ6A 3L0YA 3KOXA 3LQKA 1OWLA 4AG6A 1N33B 1RI5A 1N2EA 5FHQA 4D43A 1PBTA 3BEOA 1Z1BA 1N9GA 1ZI6A 3LL4A 1GVNB 4GRDA 3HJNA 1KP2A 1GHTA 2FLWA 3RGGA 1GILA 1I2ZA 5KFZA 1WF3A 1XLUA 3WKDA 5DHTA 3LUAA 3IUMA 3NC0C 4AJIA 1GVHA 2I62A 3SYZA 2I1LA 3KLBA 1F48A 4MW6A 1SIOA 3FH0A 2O7NA 3D7NA 1QH8A 2Q6IA 1LDMA 4K9DA 1PDVA 2JC3A 3JAKB 3BMCB 2FPIB 5AJYA 3U5ZB 3H8VA 4E5VA 2DLCX 2AHRA 4Z9AA 3G23A 3EMVA 4FOTA 1L7EA 2UVUA 3GGPA 3SR4A 3T4XA 2HMVA 1WXWA 3KR9A 4MQMA 4LYHA 2W8BA 1IXKA 4PPGA 4E08A 4FOLA 2VP6A 4OU5A 2PRKA 2CLLB 2P9CA 3IKTA 4RH3A 2C54A 2D3DA 3QVWA 2VHVA 4DCOA 8ICIA 4CF7A 4F1KA 3RAXA 3LQ1A 1V4VA 1OGYA 4I4NA 5JSUA 2X3UA 2HYDA 1DAHA 4BPBA 4QOSA 1EFKA 2XCOA 5I9IA 5CA1F 2BDEA 1O9BA 4P4GA 4TQ9A 1QDEA 4TTJA 1QU3A 1FSSA 4TZKA 7ICGA 3DLCA 2FAXA 5A7FA 3OUTA 2Q6OA 3IP1A 3OOSA 4ZO4A 1QHFA 3TCKA 4AYXA 1G21A 1QRSA 2DQZA 1Z68A 2FMKA 4HUQA 1BJRE 3D2BA 4DWVA 1GAWA 4H16A 4C22A 4M1QA 1BHSA 2GA8A 3FB1A 2C2EA 5CCDA 1EDDA 5CPBA 1DAIA 3AKYA 2J0EA 1USGA 3EEFA 3LWDA 4ZQBA 1TIPA 5DKWA 3W05A 2GASA 1RCTE 2WM9B 2XTAA 3TGLA 4Y6PA 3GLQA 1F60A 2BQUA 5CB4B 1UMBB 3NBMA 4TXMA 2F1HA 1OFVA 2ZIZA 1U02A 4DWWA 4OSOA 1P39A 2IDKA 9GPBA 2QSJA 2NVBA 2CJYA 1WETA 4FYPA 1MHPA 2PS1A 1DXSA 1GXSA 4NHOA 4GEKA 3VA7A 4CGZA 3QPUA 3MMSA 4KRXA 5EMNA 1VJTA 5G0VA 1NVDA 1U2TA 3U4GA 2AEEA 2CUKA 2LMRA 1KI8A 5E4JA 3ZGNA 3ICVA 1Z4PX 2GZ2A 1T3QA 4B6PA 4FHZA 1V1MA 1KZ6A 5JDIC 3F6SA 2CUNA 4YHBA 3SAJA 1M0EA 3ZKWA 2HBQA 2DOKA 3L0ZA 1YKGA 3UXHA 3LX8A 4KLHA 1K5GA 3T6KA 1DJMA 3VJMA 4GR5A 3RSSA 1VE9A 4F9EA 1XZHA 3NC4A 1KGDA 4JA2A 3UAOA 1DEXA 4LXUA 1UPFA 2G72A 2DR2A 4EBEA 1JVBA 4RDCA 1SKSA 3AKEA 4ONEA 1QQ7A 1PL6A 4S1NA 5EKUA 2GD2A 3MOGA 3L79A 4TUSA 3D3NA 1PR1A 2ZSHA 4EGFA 1GG9A 4K9QA 3WLJA 8ICAA 3TQRA 2EJVA 1WW2A 4NJEA 2HIHA 3Q40A 2JHGA 1T9GS 4J2HA 4LYYA 2WF8A 5J0OA 2F7SA 4D8UA 1CIJA 4EHFA 3OWOA 3AZPA 1ZJMA 3GP3A 1MQSA 3JPWA 3DWEX 5F4ZA 2ZI4A 3V8MA 1L3SA 3KTQA 2KI5A 5KVCA 1SIWA 3ZCTA 2W98A 3BZKA 2PX4A 3GLHB 2RHLA 2QTGA 3E27A 3KKAC 4HRVA 1CETA 1ODTC 1HE8B 3EOAI 4DDTA 1RVDA 1OC4A 4UPDA 3NLLA 2DPYA 3CGGA 4M36A 3L93A 3RHTA 3ICCA 1WY7A 4JUIA 2IUSA 2WJ6A 2H7CA 5AW0A 2WIBA 1NMYA 1YHNA 1J1UA 2ILVA 4QM7A 2ZJAA 3LECA 1MA7A 3PNQA 1R00A 4G97A 4JV2A 1D6JA 1ULAA 4TWIA 1Z6GA 2CFRA 3GMSA 1R8YA 4JVOA 4MGHA 3RYCA 5JAZA 1QGYA 1N6LA 5F9MA 2AOVA 1L6RA 4KWIA 3RRXA 1Q2XA 3IPRA 1QBGA 4OB7A 4B8WA 4BVFA 4QXPA 4D0SA 3SDSA 5FWDA 4YRIA 2HF2A 2VL7A 4GPZA 4V0QA 5JSZB 4IDPA 1NVGA 1I3CA 4BQIA 4N18A 4R7ZA 3RH5A 1Z2EA 2ZROA 1HDOA 5ALPA 4ENQA 4ARCA 1P7CA 3Q10A 2PXXA 1T3NA 1GKKA 1W6UA 4NLLA 5D46A 4JHXA 1NYLA 2E4YA 4G5YA 1JDJA 4OAQA 4FNAA 4A3SA 2BLNA 4Z3KA 2MIIA 1ZRHA 2FPPA 2AUNA 4DHEA 4CIBA 4XPIB 4F2SA 5GAJA 3DNMA 4MJ3A 1KMNA 2IZ5A 3LC2O 1F7UA 1JEAA 4W1PA 5FJIA 4UBKA 2A9QA 3CW8X 3ZUPA 4YRGA 4Z4GA 1R5OA 1GKYA 5EQTA 2A84A 4C4OA 3HB5X 5ALXA 2FPGA 4QZ8A 2FB9A 2RGNA 3FD8A 3HWSA 4PC1A 4TL8A 3JARA 3SVLA 3DOCA 3NCHA 4HQ6A 4C0JA 4BNYA 1Z6AA 2PBZA 4R2WA 3VNBA 4ESVA 1UPAA 5JD6A 3T9BA 4NZZA 3CUUA 2PGDA 1MPTA 4HN4B 4X64B 4RVDA 3GLGE 5KYTA 5SZIA 4R3NA 2MINB 1YOVB 3OJWA 2AA3A 3W9YA 3GH1A 4X1YB 3DD1A 2BFDB 4AQDA 4F3CA 3FTCA 3NVYA 1NLZA 2PJUA 4HAIA 4NKRA 2HEGA 3IAXA 3QYAA 2GXAA 4X71A 3L1UA 5J4YA 4FMCB 4ARSA 3O26A 1ZQYA 1PN3A 1U1CA 5IKPA 2G5TA 4DCTA 4UM7A 3X1XA 1XTZA 1K08A 2A0WA 2XGOA 3MUEA 3SX4A 3ITNA 5FPKA 1V96A 4MCJA 3CF0A 2EZYA 4AN1A 4BCDA 5EXEA 1JH8A 2FK7A 1CF2O 3UHOA 3AEQA 1AQUA 3A31A 4AO7A 2Z8YA 1PK3A 5FLXA 2EGGA 1M7HA 3VISA 1U45A 1FSPA 5LB2A 7ICKA 4CEIB 2ZYRA 5B3LA 4LMRA 3E82A 3AF4A 4LZJA 3NPMA 2O8EB 2I4OA 3G79A 8ICKA 4MYDA 4PFSA 3KLPX 5F98A 4OI2A 2JRCA 3PEFA 3ROKA 1U2ZA 1J06A 4RJIA 4QTUB 5TPZA 4OQMA 3C1TA 4TMVA 3N5KA 5DLPA 1Q0TA 2QL7A 4LY0A 1N2CB 4JUZA 4L4UA 3KV1A 3JZIA 2E5FA 2FRVA 1YBHA 1XEFA 1E1QA 3B6KA 5HF5A 5EHZA 2VPTA 2IP4A 3EYAA 5KQGA 1EUDA 4H2DA 3U3ZA 1E6LA 4J94A 4JJ8A 4MPJA 1S2OA 2VKTA 1Z17A 4YGXB 3HDQA 5GTHU 4I2VA 2BFCB 4HDSB 4GS5A 4ALNA 3U4QB 5J0YA 1DEAA 4RNMA 4NLNA 2YZMA 2HFJA 1K8RA 2ZXHA 2PSHA 2XOEA 1MG0A 1JKIA 4CLOA 2GDJA 2WJYA 2C1EA 2BCJQ 2DQYA 4DIEA 1KOJA 3DV0B 4M99A 4C6RA 3P26A 2FMFA 2RJ3A 5KFBA 3QZUA 1EGHA 1WQ1R 3KUKA 1Y3CE 3FVQA 3C45A 3QKSA 4GX2A 5FAXA 3T1QA 1K8QA 3GFVA 4J7XA 1YD7A 3L9WA 1EFAA 3B6MA 4DM7A 2YMMA 2Q5CA 3VU9A 4PZNA 3SIXA 4GLJA 3V00A 3I5AA 3IUSA 4ZV4A 2DJIA 2QM7A 4BNTA 4MV0A 1MORA 3WIEA 2KS6A 3G7NA 4XM0A 5LA6A 2R48A 1ANKA 2RDJA 2G5GX 1XAGA 5KFNA 1IK6A 4A9AA 4K9NA 4JI5B 2QLMA 4AZ3B 4BNDB 2ZI9A 1M7GA 4RETA 4EB8A 3BZCA 4FGSA 2RSLA 4RTJA 2IP1A 3UJNA 2Q2QA 2X23A 1MH1A 4LRWA 3KSRA 3VJLA 1JMYA 4MS1A 3OG9A 2DP4E 5B7GA 2EDUA 2XMZA 4ICAA 4XJXA 2ACKA 1J20A 4BVEA 1ZCAA 1V7CA 1UCVA 4Q5IA 4A6XA 4Q37A 4GLLA 3LYLA 4EYIB 2D1FA 2HU7A 2GBFA 3SE7A 3L2OB 3A4NA 2R1ZA 4HPWA 3ZXIA 4YJKA 4FP9A 3MRSA 2XCLA 3JQAA 4I19A 1YK1A 3FAZA 2RDIA 1YVRA 3NKVA 5BRJA 1PO7A 3K73O 2HBMA 2I1VB 3X1MA 4V0RA 4RHCA 1JXOA 5GJBA 4EG7A 1JR2A 1XNGA 1SHTX 3GRFA 4LXYA 1WXEA 3VPBA 3SHFA 3KYJB 5BWCA 1L7BA 1MOSA 4URWR 2FLNA 3UOWA 3D5QA 1AQYA 2WKQA 3I8XA 5KYNA 2ASJA 4NV1A 2W6ID 1TPZA 1E8DA 4Y67A 4R0NA 1YVPA 3PHCA 2ZIWA 1TKAA 2G9VA 5KFEA 4JX8A 2JFFA 1YE8A 5FUMA 4L6CA 5FBQB 4YRTA 1PR3A 3WWYA 3RC2A 4KJXA 5DZSA 2ASVA 1U8FO 4AQ7A 5CJPA 5HIKA 2YOGA 3NGDA 1TCUA 2EFHB 5ENVA 2ZCUA 3NOQA 4CG0A 4MKFA 1E1DA 1N60A 2J7PA 2R11A 1WCV1 4BECA 3O3MB 4ZO9A 3JALB 3K0EA 1VDVA 1Z0JA 1KFCB 4HX2A 4YXMA 2R1VA 4A1FA 1X8JA 5FR1A 3K9WA 1PDWA 1NN1A 2Z8XA 2OB2A 4JWMA 1X6IA 1YR6A 4ED7A 1A98A 2UZ1B 4NQZA 5F7OA 1E1RD 4RLHA 3KQNA 1SV0C 2KFZA 1BCRB 1T2FA 4J7UA 1SC6A 3A3OA 4YMWA 3SYKA 1X66A 2K2QB 3L02A 3AUOA 2HIAA 3WAKA 4V1CI 2DUWA