3ED5A

The crystal structure of yfnb from bacillus subtilis subsp. subtilis str. 168
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
232
structure length
232
Chain Sequence
MKRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKPNVPEIIPTYEIRKLEELYHILNIENT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YfnB
total genus 85
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3ed5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ed5A01
2R8EA 3ED5A 5AKGA 3W5BA 3KZXA 5AI4A 4EELA 1L8LA 5AK5A 3QUQA 4CE6A 2Q4RA 3AR5A 4NWIA 5ALEA 5AW2A 4BBJA 1ZD4A 3SKYA 5A3QA 3E84A 4B6JA 2EATA 3UMBA 2OBBA 3ONNA 4FFDA 3ZU6A 3ZTYA 3QU9A 4IFTA 5AM0A 2C8LA 3E8MA 5AW1A 1Z4JA 2BDUA 1S2OA 3HYCA 2JGAA 3QU7A 1VJ5A 2R8XA 2IA5A 5AW4A 4QJBA 3SKXA 3VAYA 5AI8A 1RLMA 4AP9A 2MU1A 3SF0A 5ALIA 1MH9A 2I55A 2FPRA 2G1AA 3QU2A 3N1UA 1TJ4A 2WF5A 2CFRA 1N8NA 2R8ZA 4BYGA 3KOOA 5AVXA 2Q4TA 5AM2A 1U2TA 3CZ4A 5ALRA 2O2XA 2FPSA 2WF6A 4I9FA 2GO7A 4GXTA 5ALTA 4BEVA 4PNHA 4UMVA 4YGYA 3PGVA 3MN1A 5AKKA 1O08A 1RMQA 2JAUA 3E81A 3M1YA 3IJ5A 5AVSA 5AKLA 1KYTA 4YIHA 2W11A 1L7PA 3L1UA 1TJ3A 4DW8A 4O8CA 4BX0A 4I9GA 3ZX4A 4Y2XA 3ZUPA 4Y2QA 2FUCA 5ALLA 5ALWA 3QYPA 3AR9A 5AM3A 3J7TA 3ZWDA 1RMYA 2AMYA 1VJRA 4BX3A 2IOFA 2C88A 3CNHA 1ZOLA 1WR8A 2AGVA 5IT0A 4DWOA 5ALJA 2ODAA 1ZJJA 4UARA 1Z88A 3L0YA 4H1WA 3QXGA 1TJ5A 1Q91A 1NF2A 1U7OA 4XE5A 5ALFA 2HOQA 1Z5GA 3K1ZA 2JAOA 3B9BA 2G06A 3KDPA 5ALHA 4Y2PA 4L6CA 4AS2A 1YJ5A 3WGUA 2YN4A 4L6AA 3IRUA 4RETA 4UASA 4DFDA 4EZEA 4Y2RA 5AKZA 3MC1A 3WK8A 5AVQA 2YMLA 3EF1A 1YNSA 2B30A 2OYCA 3L7YA 3WKCA 3KD3A 5ALUA 3R09A 3OCUA 3L8EA 1VFPA 4Y2TA 4UMFA 3R4CA 3S6JA 1NNLA 5AM4A 4NV0A 2YMQA 1WVIA 1RKVA 1RC8A 4UU0A 3NRJA 1ZD5A 3PCTA 2G08A 5ALKA 3L8FA 2P9JA 2PQ0A 1XPJA 1Z4IA 4UMEA 2G80A 2NYVA 3PGLA 4UM7A 3OCVA 2I34A 3AR6A 2FEAA 2EARA 2NO4A 5AI5A 2RAVA 1PW5A 3WK5A 2YY6A 2HI0A 1L8OA 2I6XA 3L1VA 4AS3A 1QQ7A 3OTQA 2HHLA 4CF4A 3DNPA 2VKQA 1Z4LA 5ALGA 2G09A 3UMCA 1LTQA 3QX7A 4XOUA 3E58A 3HLTA 2G0AA 4BNDB 3M9LA 4XQ0A 1NRWA 3W5AA 1YMQA 3ET4A 4CNQA 4RESA 3FM9A 2I33A 3SLRA 4EX6A 4OFZA 3QNMA 2YJ3A 4UM5A 1YS9A 2WM8A 5AW6A 1RRCA 3L0BA 2ZOSA 5AI9A 2HF2A 2HDOA 1L6RA 1Z4MA 2FI1A 5AI6A 3SD7A 3U26A 5IS2A 4BKMA 1QQ5A 5AW5A 3F9RA 3L8HA 1J97A 1IWOA 1RMTA 3FGOA 4F72A 3GYGA 3WKBA 3ZWKA 4KNWA 3RFUA 5AIAA 5AK3A 1Q92A 5ALPA 4Y2JA 2W43A 3I1YA 3ESQA 3NAMA 5AW7A 3W5CA 3BWVA 1FEZA 2QYHA 5AVVA 1CQZA 2WF7A 3R9KA 4NAVA 1Z4PX 4HGNA 3DDHA 4YIKA 3N28A 2AUTA 1Z4NA 1CR6A 1RQLA 2B1QA 1TA0A 2R8YA 4C4TA 3OCXA 3TLMA 5AKXA 3ET5A 5T41A 1EK1A 1X42A 4MUMA 2YBDA 5AVUA 3PDWA 3I6BA 3N8GA 4EEKA 5AVYA 4C4SA 3KC2A 4YCMA 2YJ6A 4UAUA 2IYEA 4Y3UA 5ALXA 3D6JA 3DV9A 4C4RA 4BX2A 1RPZA 4OD0A 3AR4A 2QLTA 1T9ZA 4Y2SA 3WGVA 2PKEA 4HYTA 3B9RA 4YCNA 1U7PA 1RDFA 4J03A 4Y2VA 4KX3A 3AR3A 1ZD2P 4UW9A 1EK2A 3WK4A 1L7MA 2CFSA 3U7FB 2B82A 1U02A 1ZD3A 4HGQA 4EX7A 2ZG6A 4JDPA 4ZEWA 3ZVLA 1RQNA 1XVIA 2B8EA 2O9JA 3ZI4A 3ZW7A 3U7GA 2ZBFA 2FUEA 5ALZA 4DCCA 4IG4A 1K1EA 1RKQA 4KX5A 1T5SA 3NANA 5ALSA 2I7DA 3NALA 2WHEA 3FVVA 1L7OA 2CN1A 4OCZA 3L8GA 2FDRA 3WK9A 3N5KA 2BY4A 3B8EA 5ALDA 3KBBA 4OHFA 2OM6A 3I28A 1JUDA 4KNVA 3NASA 2BDEA 4XPZA 5AKYA 5AKJA 2HO4A 2RB5A 4HAIA 5JJBA 3AR2A 3OCWA 5AM5A 2B8JA 2B1RA 5AW3A 2G07A 2HSZA 5AVWA 5ALYA 3ZX5A 1ZS9A 3QU4A 2NO5A 1TE2A 5ALQA 2Q5EA 3RF6A 4BNDA 5AIBA 2PR7A 2MU2A 3QUTA 3ZVMA 2JAWA 1RLOA 1LVHA 5A3RA 1Z4KA 5ALVA 2X4DA 2P27A 4CF3A 3MPOA 3AR8A 3UM9A 2YJ4A 3A1DA 5AKHA 3IB6A 2RARA 2WFAA 1O03A 4UU1A 3QLEA 4HGRA 4FE3A 4J2TA 1Z4OA 4NABA 3L0CA 2ZBDA 3EPRA 4KYTA 3MMZA 3UMGA 5AVRA 2DQSA 3QUBA 3ZTWA 2C4NA 1QQ6A 3SHQA 2WF8A 1Z5UA 4JB3A 4NFLA 3WK6A 2W4MA 5ALOA 4E88A 2FPXA 2CFTA 4MWOA 2HEGA 5FP0A 5AI0A 3OCYA 3U19A 1QH9A 4ZEXA 2FPWA 4UATA 2YFYA 3OPXA 2C8KA 3L5KA 1ZRMA 2FPUA 4YH1A 2HX1A 5AKEA 4YCLA 2GFHA 4ZEVA 1SWWA 4QQFA 1F5SA 1WPGA 5AHXA 2IOFK 5AICA 2RBKA 3WKEA 1SWVA 2B0CA 4L57A 1U2SA 2GHQA 3AR7A 5AK6A 1N9KA 5AVTA 1XP5A 3NIWA 3FZQA 3WKDA 2YMMA 3QU5A 3OCZA 5E0OA 3FPSA 2P11A 2ZBGA 2IOHA 5AM1A 3EF0A 2P69A 2YJ5A 4UAVA 3DAOA 3ZVNA 1ZRNA 2WF9A 1Z4QA 5AW0A 5AW8A 4GIBA 2HCFA 5ALNA 4UMDA 2GHTA 5AKIA 5AW9A 4KN8A 4Y2YA 1YDFA 1QYIA 2JARA 2ZBEA 3EWIA 2D2VA 2OA0A 3N07A 4EENA 1SU4A 1Y8AA 5ALMA 3NUQA 2HF7A 2I54A 2ZXEA 4FYPA 3A3YA 5A3SA 3QGMA 3U13A 1RLTA 1S8OA 1AQ6A 3SMVA 3WK7A 5IT4A 1L7NA 2MSNA 2GMWA 3A1CA 4Y2UA 3P96A 1T5TA 1J8DA 4G9BA 4BEWA 5AVZA 3QUCA 4F71A 3BA6A 3FPBA 4CF5A 1WZCA 4G63A 3WKAA 3W5DA 3U7HB 1YV9A 3I76A 2YMPA 2EAUA 5AK4A 2AH5A 1RKUA 5AESA 3A1EA 4HGOA 3U7EB 4HGPA 3ESRA 2C9MA
chains in the Genus database with same CATH superfamily
1PF7E 1NV9A 5HGJA 2JH3A 3EXIA 1VQ1A 3KYBA 5BR7A 3PQ8A 5JTTA 1PFQA 1ZC4A 3T5LA 6ABPA 2ZIUA 2J7PA 2DWOA 4GE3A 5H9VA 3F98A 2H1LA 1C9MA 4WZBB 2BR3A 1UF9A 3BJYA 2FWIA 3D3EA 1QX4A 5LN1A 2B34A 3EGDB 4KACA 4KIFA 1WZ2A 2L5YA 4ZD6A 4DG8A 3BGOS 5E6SA 3VSCA 2CUKA 4HG2A 4JP1A 1Z2AA 3AW9A 4NMLA 3MGHA 4G97A 1PQWA 2E55A 5TXGA 3NBAA 4S0XA 5FWDA 3DHWC 5MGNA 4HB2A 3KFLA 4Q1AA 3FCAA 3OKCA 5EKUA 4PGXA 1H8EA 1P1BA 2JLBA 3OEHA 4Q8FA 2P3QA 2ZI7A 5LZ2A 2I3ZA 3WZMA 5AUOB 5LBUA 3ASVA 2QF7A 2Z6QA 6Q21A 3ZV7A 1J2RA 1CIVA 4OI4A 5C9ZA 1FCJA 1XZEA 5EJFA 1MP0A 3KU1A 2VYVD 6PFKA 4PC7A 1P81A 1NW5A 5ADUS 2I55A 1R4NA 1ULUA 1JA1A 3F5QA 2G7MC 2ZVQX 4Q0MA 3ZQ6A 1ODLA 1S01A 1RWWA 4KLIA 1P3Y1 1UBMS 1Y7HA 1NY5A 3B3JA 4FHFA 4R0VA 5EKTA 5DH9A 4EGQA 4NJMA 1BJTA 2G1AA 2CLOB 3MGGA 4L50A 3ONFA 1QSGA 4F4KA 3P7MA 4LHVA 4OJYA 1RZ3A 4MGEA 1DMSA 1F20A 1WHTA 4DL6A 2WWTA 4I4TF 4AG3A 4BYGA 3ACBA 4PN7A 4GOOD 2A9FA 4I2VA 4LCJA 1MEOA 2ZTHA 2CLCX 2XVAA 3H9GA 4BZQA 1KKMA 1QP7A 3LDAA 3A6PC 4YREA 2RGYA 4EUSA 4R7ZA 3OOWA 4PYQA 4D8YA 4N7BA 2JAQA 1M6EX 1T29A 3D5QA 3LRPA 4JYPA 1R4MB 5JUWA 1MNAA 1MO2A 1TQHA 1YOVA 1VG1A 3C97A 1ZUNA 4PLFA 4UMVA 4J3NA 3ZXSA 5JEEA 5AKKA 4LE0A 3AUXA 1T36B 4N0QA 2C4KA 2H2FA 1PJBA 1L7BA 2OCBA 2BKVA 1BGXT 2A9RA 2RGEA 5BOLA 5H7XA 3ETHA 3F71A 2OAGA 1RQGA 2SCUB 4HMQA 4J2HA 2D5LA 2FFRA 4Y2XA 3QE9Y 1EFRD 1XAIA 3ENVA 5B53A 3KJZA 1B23P 2PMCA 1OIVA 4E03A 2JZBB 1DJLA 1Q12A 2IFTA 2WKQA 1J4AA 1GNPA 3WFZA 1RMYA 5EI5A 1MRSA 1GVNB 2OENG 4IDNA 3RAQA 4PQEA 4A6XA 4MRMB 3NGDA 3R5KA 4AK9A 4YUZA 5IXJA 3GDOA 1K89A 3BBPA 3DZGA 3I9V6 8ICVA 1VKHA 3RTGA 2BI8A 1T1SA 1KQQA 4Z7QB 5TPZD 1BSVA 2F1IA 2XVYA 4N82A 4C5AA 1Y1QA 2OVFA 2R1TA 4WT7A 3GAAA 2ZBQA 5CFZA 2KVCA 3OTHA 2Z8XA 4ZRMA 5JXJA 1CCWA 4IRDA 2JCGA 4HLDA 2WNHA 4UBCA 4OYYA 4ZMSA 3C3DA 1P6UA 3I4CA 5CJPA 4MW7A 2Q29A 3ZNOA 1HDZA 2OUKA 2Q5IA 5ALFA 2VA8A 4GI7A 4P4LA 1N0UA 4D8VA 1FFSA 5LZ8A 2XJ9A 3ELDA 5DT9A 2JAOA 2HF8A 3VZSA 4KXLA 4U7CA 1UBUS 1JZSA 1DJOA 2P5TB 5FEUA 2RGCA 3LDUA 1NUPA 4EW2A 5K0GA 3KUKA 2RGBA 3BFXA 1X9XA 5HHIA 4ZZ1A 9ICRA 1F6WA 2QVYX 2ZB2A 4FKZA 4WLFA 1F7UA 5JS1A 5IBQA 4EPWA 3KETA 2C4UA 3LUKA 4I2AA 3TVTA 2ZAGA 5HCUA 2OZKA 3WKCA 2PGAA 4J7CA 1UC9A 2R4TA 2AHRA 1I2MA 2P6MA 1I6MA 4NESA 1V9PA 3S6JA 1SXJE 2PUEA 2G25A 2F8SA 2WSMA 4NFSA 5BWCA 4BLOA 4UU0A 4DCMA 2KIWA 1B26A 1ORIA 2IYSA 2FLWA 2G08A 3DNFA 3I92A 3IXQA 3KLNA 3PSHA 4OTZA 4R1TA 2JBAA 1G8PA 3TS1A 4BNMA 5BMVA 5J40A 1CQJB 2X8BA 1NVVQ 1XPJA 2AG1A 4K6FA 1RAHA 1EGQA 4C06A 5IHPA 4EG8A 2C2XA 4MQ6A 1DC8A 4AYBF 4M9QA 4RVDA 1A6SA 1RXCA 3HB0A 1JKIA 1RSZA 1C80A 3I23A 4MW4A 1FU4A 5E1BA 2NT3A 2ZJZA 4ZCSA 4WBNA 3DV2A 1HEYA 4IRMA 1OX4B 1Y1TA 3CYMA 4KDRA 2A2ZA 3NHRA 1TVEA 4JLKA 4NQZA 2BEVA 3OTQA 1A88A 1Z35A 1ZQSA 1EG2A 4Q7LA 1JA9A 3UH0A 1VBNA 4XX0A 3ZDFA 1EXMA 1PWEA 3OJXA 1NVAA 1I4TD 1N2GA 2ZRFA 1R9NA 4Z4GA 1I0LA 1I24A 2A1UA 1D6JA 2J67A 3RC8A 2DMRA 1RBZA 2BAGA 2IU6A 1ZIXA 3ZTTA 4L2IB 4DOMA 5EHXA 1CUGA 3HLTA 5AO9A 1RYMA 4JOSA 4RPKA 4BJHB 3Q6MA 3RT9A 1Z6XA 5KFYA 2FEMA 1NRWA 3A14A 3ELYA 3DOHA 8ICMA 4X65B 1Y7PA 3EYWA 1BVSA 4CXMA 2VSXA 1II8B 4G85A 5DM2A 3F67A 3BMCA 2C4MA 3TJRA 1JEOA 3BTSA 3E5NA 4EZ9A 2KZMA 5FV4A 3OP1A 2C2MA 1EUDB 4YN3A 4CIDA 2FZGA 2PV7A 3PPYA 3DAPA 3ZK9A 1W88B 4CMAA 4OX9Y 2RGGA 2J3HA 3DMDA 3L0BA 1N2HA 3DMHA 3P32A 4XEUA 1XDZA 1X70A 2EKPA 2Q9AA 4XIYA 1RZVA 3BGDA 4U7HA 5B1IA 2PH1A 2RI0A 4PSVA 4E6EA 1NJFA 1PZMA 1GTL1 2I65A 3FF1A 2DT5A 2J32A 1AKYA 3UWPA 3AJEA 3EGVA 5IIOA 5FOVA 3G6WA 4PZPA 4Y9SA 3KSDO 3MAJA 2Q7XA 2BKAA 1CUBA 2PT5A 2ZR8A 3PNQA 4URYR 5F12A 1NMSA 3BHJA 1R6DA 2WIGA 5D00A 2H6EA 4G26A 1K6EA 1C3OB 4EW1A 2AE1A 3CBGA 4KIJA 1BPEA 4Z9BA 3ZWNA 3T5KA 3ICVA 4PSUA 1D2AA 3LP6A 2NM0A 5GM2A 4EBCA 3OMWA 1CYDA 2NSHA 2O2SA 1N8TA 3LLCA 1ZYUA 1IBKB 3NJRA 2HL6A 4GU5A 3QPAA 3T7AA 3VO2A 1KQ3A 5CFPA 3NAMA 2GCGA 3NH9A 3RR7A 1ZQYA 5J5AA 3MGVA 1XMOB 3KYDA 1GZDA 3AIIA 2H17A 3ISBA 3EULA 1SUDA 2AN5A 4FYMA 4H6WA 4QD3A 1NK8A 3D1LA 4W8GA 3ZHRA 1LD3A 1M76A 1YC5A 5TQ2B 4ITVA 4CM1A 1ZCAA 2AVNA 4NF2A 2Q7OE 2GH1A 3N28A 2P6RA 1U80A 2FSVA 2IDMA 1OYWA 2EBWA 4E2WA 4U7DA 2ROQA 1N5KA 1YTUA 4MKHA 4YWJA 4F8JA 2VBFA 3CPEA 3FB4A 2GXSA 4TT8A 2AX4A 3U7QA 4TYMA 1RHQA 4FD3A 5BVGB 4M9HA 2VH1A 4PTLA 3R8CA 2WTUA 2QB0B 3CLSD 4V1CB 3SV3A 1SZPA 2ZTLA 4FMCB 2R1UA 4MI9A 1R0KA 2VRNA 1JIVA 1P0MA 2OV2A 2ZWMA 3R6TA 4WFJA 4YQZA 3RWMB 5AVYA 5C8YA 3J80A 1FYFA 2VSYA 1GG2A 4WN3A 1O77A 4K1LA 1D5WA 2C83A 4F1KA 2FJPA 1X2IA 3MQFA 1H2HA 4OQQA 4UEQA 2N1RA 1SQ6A 3THSA 3KTDA 4M9XA 2RHGB 1W5BA 2PKEA 3DZIA 4NDZA 5CCDA 1Y7IA 4LVNA 2D5IA 2L18A 3H2JA 1LKYB 4MVJH 2Q2WA 4JR2A 4W6ZA 3ERCA 3ONVA 3GMIA 4IQGA 3HCFA 4DADA 3NEJA 4C05A 1K98A 4IDGA 3LVWA 7ICTA 4L0QA 2XCSB 2IPMA 3EZNA 1THMA 2LUOA 2L82A 1XQWA 2JBAB 3QRWA 3KSAC 2J87A 4FI3C 4JP8A 4IQ8A 4KSYA 4IEIA 4KAJA 4ECYA 4MGKR 5IVIA 1HORA 3TQHA 1KDRA 3UG7A 2J3KA 1R5NA 2IYLD 4MDFA 3RVOA 2HRZA 3KKEA 3UB2A 5IIMA 2QM7A 1CT9A 5EA2A 1Q1GA 3PRYA 5JFOA 3P9ZA 1K1EA 2PD6A 3AHIA 2WG0A 2GBIA 3NANA 3R3VA 5I4CA 1QIIA 4UREA 3QITA 3NALA 3L7OA 4GKVA 3P4UA 2NO6A 4D26A 4RD0A 3IUQA 4ZHQA 2Z58A 4D4GA 3FYHA 3ND9A 3P2EA 3N3BC 1A96A 3HILA 2Q8QA 1CZOA 4ZO7A 1OKKD 2BCRA 3PX2A 4JQZA 3NR2A 1XSLA 4LQDA 2IOQA 1UANA 3E8SA 4QQNA 4DCTA 1C4OA 3CRVA 2A0XA 1JHXA 1HDGO 3BQTA 3EHDA 1EFCA 4I81A 2VF8A 3OCWA 2DKXA 4LMAA 4NK5A 5CEEA 4J9MA 1ZZEA 2ATVA 3RRMA 3OSPA 4LCEA 5CDSA 4YDSA 2V7UA 3GU3A 1QAOA 1S4QA 3P45A 3VFDA 6GPBA 5K99A 2OB2A 4YRIA 3SZLA 2BOVA 3DMPA 3ABSB 4BP9A 4NCXA 4UFNA 4DUGA 1ONPA 1DELA 1O97C 2RJOA 1IZ0A 3BF7A 2H07A 1XTVA 1QRSA 3VU9A 2ZIGA 2JAWA 2QRZA 1JZQA 4O4LF 3TPFA 4BQOA 4EHJA 5JNWA 1WCV1 1N77A 1ZNZA 1A5BB 2EHJA 5E1OA 3RT7A 5C80A 1TA4A 3S4YA 1TB4A 4MFCA 4EJMA 5JAOA 3U7IA 1QUEA 1WQ4A 2OD9A 2TMDA 4IF4A 2QM0A 1PJ3A 5K0EA 3IMGA 2Y67A 5FOWA 5CNIA 4MVJD 1QH1A 4NABA 5HFNA 4NL9A 4BMDA 4BJQA 1N6RA 3IBFA 1VCHA 1N36B 5T6MA 1E5XA 1W49A 2XVXA 2RDJA 3AL0B 2JZCA 4QOGA 2V0GA 4BNNA 3K70D 1GZ6A 4L51A 1G8HA 4DSIA 1PGNA 5JZ9A 2FFJA 4A8JC 2EX4A 3ZD6A 4BMCA 3A0HU 2WJWA 4BUJA 2A1AA 3JPRA 1Z74A 3KSZO 1W44A 2HHWA 3TD6A 4PICA 2ZUDA 3VC1A 2RP5A 3QI7A 4OU4A 2NUTA 1ZU4A 3SZ3A 3ID6C 2HMXA 5BV0A 1XAGA 4EYKA 2HWYA 2AMJA 4IQFA 4LZJA 3IMFA 2JLQA 1CULC 1VP9A 3HCPA 4RQNA 1U7TA 4DJEC 1QOQB 4IQTA 3NHAA 3RC2A 2REOA 2KJ5A 4GC6A 4G07A 1K68A 2EYUA 1VKNA 2IXFA 2R8RA 1NM5C 3HN7A 4QW8A 2JNWA 2UZ1A 2BLNA 2CXOA 4G5QA 3OPYI 4PWYA 1E0AA 3A31A 3FNQA 5IJAA 4DCUA 3PIIA 5JSZB 3TQ1A 1MVLA 1B6RA 5H80A 2FPUA 2O57A 3IAHA 4YH1A 2B4AA 3PW4A 2CHVA 3D2CA 4XA8A 2Z2IA 4KSBA 1VXOA 4M86A 4OHVA 4ZEVA 5C4GB 3KFUF 4L85A 1QVVA 1V26A 3AHEA 4U7FA 3V55A 1NQ5A 2IW1A 2KZ3A 3BVPA 2ZRCA 3A0UA 1YAHA 3MGCA 4GHWA 5WRFA 4ER0A 3IVXA 4F5YA 2EZTA 1KH3A 5HBGA 2YZGA 4L57A 3IEVA 2HRDA 2Q1YA 1JEEA 1PCXA 3QG1A 4X1OA 4B3TB 1E3QA 4NCJA 1GGNA 2Q6VA 1XP5A 4HR7A 4HD8A 5EG5A 3NOVA 3WB2A 3BBLA 1OVGA 1BNPA 4OSEA 3CLSC 5HUQA 5F7XA 3PVZA 3I61A 4UE3S 2J9FB 2QBYB 3F7TA 2BKXA 5GOTA 5AK0A 3HP1A 4F7WA 1J06A 1GNQA 3HI6A 4G0MA 1GZ5A 4AG6A 5TARA 1CUXA 1Z45A 1Y4DE 1XT6A 2ALJA 3K4HA 9LDBA 3TIFA 3NV7A 2Q1SA 1P6XA 1XHEA 2IPXA 3HA2A 3L05A 4ZYXA 5D1HA 5T67A 5J47A 1JNXX 4Q4AB 5BNIA 1MT0A 4DKJA 3K0FB 4TLDA 4WKCA 1PQUA 4EI2A 1YDFA 2WB4A 3SXJA 2JEZA 2YUIA 3EY9A 3UXHA 3A0RB 3SM3A 2WAYA 3R8XA 4XGKA 5A5DA 1VHJA 1IU9A 5ADHA 3UQYS 4QREA 2Z4RA 1ZR2A 4WUTA 4FFOA 5KT5A 3M2PA 3WYDA 2WHPB 1CI4A 2ZXEA 1C9KA 3V8MA 3ISVA 1DXYA 4XUEA 3QVMA 4Q12A 5I7WA 4TXNA 4ZO8A 2HK7A 3RAEC 4KEAA 1CFZA 3LG2A 3LY9A 5F78A 2FRDA 2XCTB 2XSZD 4P3YA 4GPTA 1SQGA 1MAAA 2JI7A 3SMVA 3DG9A 3IEUA 5EFOA 1W36B 1H0HA 3TEMA 5HF6A 4PGGA 2MA1A 4U2CA 3TKLA 4NCKA 1T5TA 1WWUA 4FNGA 1ENYA 2N3ZA 1LB2B 2G9ZA 4FOLA 4NVRA 2W70A 4EABA 3GLGA 3RVLA 4MVJF 4J9UE 4ACOA 2P8SA 1Q0HA 1WSWA 4ENTA 2Y9TA 3K6KA 1I14A 2OHFA 4LVSA 1ES9A 1T9HA 3IJRA 4FDTA 3OEEA 4X63A 3V42A 4C43A 2PCLA 4UTNA 1V1RB 1ZG3A 5AK4A 3PNOA 3VU8A 3AL3A 5G0TA 4Z6FA 3P19A 4FQ7A 4JXKA 2XHEA 4K9MA 2X0IA 3CLTD 1T8PA 4PLZA 4R81A 5LP6B 5J2UA 4BY9E 1XVUA 2QG9A 3LVBA 2G1PA 2Q2NA 2XVMA 4TGLA 1PLKA 1F0NA 1Q57A 4OHMA 1NPDA 5GM1A 3P9XA 3DTYA 2PYIA 2KI5A 3CLUD 4RVSA 2G9NA 1DQPA 1LFDB 3TRJA 5BR4A 4E5YA 2DYKA 1SU6A 5FBZA 5DBAA 3QHQA 3IA2A 3MW8A 1X1BA 3N7RC 3CZ5A 2C5LA 4EVSA 4G1CA 1N6OA 2WU8A 4D7AA 1GNSA 2BJVA 1HTBA 3GJ4A 3HXPA 5A3QA 1T2UA 2EJWA 3UMBA 1UEJA 3FDXA 2VP4A 4RHFA 5JVDF 1XCPA 1G4AE 2GYVA 2WUFA 3A9SA 3ZTYA 3QU9A 3F5DA 3AVUA 3B1VA 4R9RA 4UTRA 1P1IA 2A9JA 3H3XA 4TLEA 5EWMB 5IJ9A 1HNXB 2O2GA 2FRVA 1Q0LA 2C9YA 4MVYA 3QU7A 3HCRA 1GG8A 1GSIA 1I5OA 1VLBA 3CWQA 4WBNF 4MXDA 1ZONA 4X54A 1DCKA 3GFOA 3BS5A 3BE5A 4TTAA 1JW9B 4B0PA 3VKFA 5JDIC 1H85A 1XMSA 4TV9B 1NZPA 3C3CA 3TM4A 2N42A 2JAXA 5C3MA 3I42A 5DTJA 1L6NA 2C99A 3OHSX 4L5YA 3WGVA 1C8VB 1ORWA 2ZB3A 5KFMA 4JN6B 4K28A 4B6EA 3LO8A 1TYAE 2LXNA 5DK4A 1AO0A 3H4DA 2XE8A 3S44A 3QYAA 4AMYA 2X1LA 1BH2A 3UTDA 1QCZA 3OQPA 3C3MA 3PFKA 3P9PA 4DQDA 5DI3B 5I5EA 3H9QA 1BPYA 3D6FA 4K5QA 4H9GA 1L4NA 4GBJA 3IUMA 4RVUA 3MS4A 3F6PA 2GF2A 4QIWC 4RJLA 1GQSA 2DUYA 4HNTA 2CJPA 3HM9A 2QK4A 4K2HA 4P2GA 2Q4TA 4YXWD 4L16A 1U3FA 3FWNA 4P4GA 3T1OA 3RJZA 2R96A 5KG0A 1O95A 4WOJA 2CJWB 3VISA 4B4WA 5I9IA 1XD2B 5LB4A 1N75A 1CTQA 2ZBPA 4FHCA 3E9ZA 4INOA 3ZIAA 4ALMA 4QWDA 1T4MA 1T5OA 3QLUA 1CUYA 4TVOA 2GS9A 3WGZA 4TURA 3D2QA 3HZZA 1EXDA 5E1MA 2MSDB 3RAGA 1I9GA 3TBFA 1GQYA 1NFQA 2AOUB 3SQXA 4KO8A 4PG5A 1OROA 3IVMA 4INPA 2PTHA 3ORQA 1H8HD 2E4WA 3C6ZA 3RO7A 5KFKA 2WAQF 3SI8A 2WSSA 1WB9A 2Z5LA 3V8EA 3ABZA 5CK4A 1G66A 1UZUA 3MA0A 1BQ4A 4WCFC 3UT5B 1ZNQO 3Q7PA 3VO9A 4CEIB 3ZZTA 4F9TA 2GUGA 1K63A 3N2YA 4FOOA 5L1IA 2JHPA 2ZUWA 4KLLA 1CERA 8ICCA 3DLAA 3RRHA 3H11A 1XPRA 5C81A 1PR2A 3AB3A 4UBMA 2AJDA 5FA8A 5F4BA 5CBKA 3KEQA 4LV6A 4AY2A 2QTRA 5KNCH 2N1BA 5FBWB 3NHBA 1J09A 4DBVO 4LZGA 1K97A 2VPWA 3H5IA 1P18A 4BQNA 2XQVA 3KT0A 1R10A 3SSNA 3DO8A 1T34A 1IHDA 3DMRA 1TAUA 2IXBA 2EAPA 4C7JA 4TZ6A 3L0YA 2MUTB 3RPEA 3KQQA 5L3ZA 2ID7A 3NM4A 5EJGA 5BXQC 4JQYA 4WJZA 1KTVA 2TS1A 2ODBA 4N01A 4AN1A 4MIKA 4PZCA 1U7OA 1XUOA 2NXWA 5FTLA 2HOQA 1X7YB 3ZV4A 1XZIA 2F2AB 4YMUA 2XADA 1LV5A 1M1XB 3JZAA 4UTOA 1WA5A 3B9BA 5L1MA 2NPFA 1EXNA 4KL8S 3ZU2A 4EBEA 1S9DA 2B98A 3MRTA 2OQVA 1UBEA 2IP1A 3DE5X 3UAOA 3URMA 3WRYC 5EJAA 3ZLBA 2DLCX 1DOHA 5KO2A 2A5GA 2HMWA 1H1LA 2FLVA 1AQLA 4G0XA 1XRQA 4ZI7A 4LXXA 1ZH8A 1CUEA 3FX2A 1KZHA 5AVQA 4JUFA 4NIMA 5IPFA 1VMDA 1YA8A 3EW7A 2O7NA 4YO8A 2Y1WA 1ZBDA 3OC0A 3R5HA 1PV4A 1I4WA 1PWHA 3VKGA 5DPMA 3GFGA 5BNTA 1U28A 2RHHA 5KKAA 2XYVA 1KQNA 3PIRA 4B7XA 2L19A 2W6OA 3K4PA 4N5HX 1V8BA 4AJ9A 3OQJA 3ROPA 3S27A 4I9NA 2PU7A 2K89A 4DM4A 1PNOA 5IIJA 1ZWKA 4GEGA 4H1VA 4OXXA 2ST1A 2O14A 1NNI1 4X5VA 4JJKA 5EUMA 4FB5A 5JS8A 4XJVA 4CTNA 4Y1RB 5ALKA 2V9WA 3IP3A 4ZO4A 4BWYA 5IHXA 3MGAA 1ISSA 1D2GA 1KKLA 1ZUHA 3KJFA 4IIJB 4KO2S 5JDCC 2HFKA 1HE5A 4G4SO 1DG9A 2NYVA 1UQTA 4KE6A 3Q7QA 4M0PA 4UMEA 1WXDA 1XQXA 1ZD1A 2QT9A 2I34A 3CLHA 3JYOA 3TBHA 4D9GA 4J9PA 1I3OA 4AS1A 3CRQA 4MEJA 5CDYA 4NE9A 2Z09A 3TG8A 2H7YA 3AEZA 3EIQA 4RMGA 4L5AA 4W7HA 3G7SA 3JYQA 3HCDA 4MJLA 1ZQEA 1BNCA 2OORC 3NAZA 4QAQA 2DB3A 4UHEA 3ZE8A 3REGA 2JCYA 3FHJA 1KAMA 2VKQA 5J0OA 1W1IA 4AO6A 1B8NA 1G5QA 4D41A 3K2BA 3G0OA 3T5MA 3NBFA 2D59A 4XFDA 3ZJ4A 1M6VB 4QBGB 4KBGA 4C8LA 4J0EA 3F4KA 3D1JA 4G1VA 1JIHA 2XOKA 1YRQA 3WYBA 3ND5A 4XQ0A 5J2DA 4GZ5A 2LI6A 1IQUA 2RGNA 4EY7A 3FPAA 4YJKA 5MN6A 2ZYIA 5C34B 3JRNA 1KEKA 1FFVA 3GLHB 2ZXUA 3FM9A 4GSKA 5E8RA 4C0WA 3LCMA 3VZCA 4BPRA 2PA3A 3SLRA 4ZOQI 4DSLA 2GETA 3D8NA 3OPYB 4Y9DA 4RD6A 3Q3GE 4FCCA 3SHVA 5FWAA 2GESA 3H18A 5BWNA 3FA2A 3GLHE 1XWLA 1EJ6A 3K0CA 1SBHA 2C0QA 2ZPUA 3IKMB 3T1NA 3U3XA 5K2OA 3M4JA 2QLFA 2RI1A 1BYIA 3UJNA 2EIXA 3NNNA 1Z0IA 2WYUA 2CLLB 2PZFA 2I8LA 4IZIA 3FOZA 3K0AA 1BHQ1 1Z4MA 3I9LA 3UIEA 5IS2A 1U8CB 1NUSA 5L1LA 3U1TA 5IZCA 5MN4A 5P8WA 4AZVA 3BFJA 3L6UA 3T7KA 1SBNE 1OWMA 1V3QE 1DAEA 1RPJA 1V8ZA 1X92A 1HDRA 1Y7LA 2EFDB 4IKOA 4ZK6A 1ESCA 1HL3A 3NW9A 5ES4B 5G0WA 2R0QC 3IIKA 3LECA 5CFMA 4G09A 3RFUA 4DGQA 1NW9B 1HE8B 4P0QB 3I5MA 3IHKA 1WV1A 4CLHA 1K8ZB 1ZQXA 3K5PA 2PIAA 2FLNA 2Z2JA 3FKSA 3OH8A 4A27A 2VSNA 1L5FA 1RPLA 4HXGA 4MHVA 1XN4A 3W5CA 1MMFB 3BWVA 3DDOA 3DP7A 3VYSB 4QDJA 3CF6R 3FOEC 1JEYA 5F9HA 1GM5A 3DXYA 1WP4A 2C3UA 3B60A 3JQ8A 1ZN7A 2H5JA 3HO6A 1Z3IX 1JR3E 2JRZA 4HWKA 3H9BA 1FUYB 2QU8A 5DYNA 2KE7A 2XITA 1TA0A 4F3RA 4LV8B 3HVJA 1NJXA 2A1IA 4F86A 3A28A 4M1TA 1E1MA 1BKYA 1YWGO 2OZPA 4C0BA 3GELA 4M2YA 4J0JA 1THTA 1OTYA 3HLYA 3N2ZB 1Z9BA 4PYRA 4AWXA 3HZRA 3G5UA 1YKGA 3RCBA 4A3SA 4DJDC 1Y8QA 1EK1A 1X42A 3FRJA 4EB6A 4UHKA 3T3IA 4MZDA 4LDRA 2HIAA 2AG0A 2JIRA 1RR6A 3HUTA 3BQ0A 2Z83A 3HWWA 2GM5A 3ADKA 4AO7A 5CEJA 1AKRA 4H08A 4P4PA 3KR2A 4Q7KA 2ECFA 1OH8A 3EGEA 1YCHA 3OA0A 3WL4A 2V7PA 1S0UA 1VHQA 4ARIA 1Y3FE 2HQRA 2WJAA 2XVZA 7REQA 1BKSB 1FUIA 2AOTA 1CJSA 3HDQA 2CUTA 4MITA 4WGGA 3U56A 3JR3A 2ASLA 3FGNA 4CTOA 2DWQA 1DE0A 1X1QA 2WZDA 3VXKA 4LZZA 2CCJA 2WU1A 2ZAMA 1PJAA 3I58A 2BMWA 3AR3A 1MD9A 4LSWA 5F7ZA 1XEWY 2HLDA 3IP1A 1JU3A 4I2DA 1PN3A 4KN5A 3PK0A 1FVFA 2D74A 2GN8A 3L6OO 1T3HA 2V5UA 1K5DA 3B3QA 3QKTA 4P53A 2WKPA 3QLUC 2XAUA 2ZVJA 2GEJA 3R77A 5ED4A 1JDZA 4XLTA 4FMDB 3V7WA 4RA6A 4J3FA 4KWIA 1EP2B 1CFJA 2XDQA 3RKUA 4DDTA 1XXLA 2W9XA 3LFHA 5JLAA 5TMEA 3OQNA 4ZN6A 3JPWA 1B7GO 3TGPA 4Q3LA 3UGKA 2KW5A 4DLYA 1L7OA 4N9QA 4OHPA 2FN3A 4X8MA 3MHPA 2O0KA 3SXUA 4D4MA 1OQAA 4CN9A 3N5KA 1LW7A 4XOIA 4BO9A 3T3NA 3H0MB 3DE4X 3MDAA 3ZOKA 2ZUTA 3DZCA 5JNVA 1N78A 3OO0A 4KQIA 1UK8A 4CQLB 2QXUA 4Q4LA 3C2LA 9ICFA 4WD3A 1YS4A 1A4RA 2PKQO 2VDQB 3KYJB 4RQ0A 1OAOC 1C8BA 1Z17A 4WLEA 4XPZA 5D8DA 3ZGYA 4ZT4A 4QU8A 3HVRA 1SCKA 4RH0A 2Q3LA 4NZPA 5JVDA 4M99A 1EVKA 1BOOA 3AR2A 3O8RA 1IY9A 1B0PA 2PLWA 4KWEA 4TVKA 3K9WA 1M10A 1KY3A 1U4SA 2CZGA 4GFDA 4MA0A 3R5SA 4V0OA 4X92A 3HYSA 3UJ9A 1II8A 3DS8A 3PR1A 1LV8A 3ISDA 3AF2A 3GH1A 5IAGA 5KNDA 3Q7IA 1DQYA 3PQ6A 5IJ0B 1Q16A 3EFHA 3ICWA 2NO9A 3V4LA 1BE6A 3D7RA 3TIIA 3VOAA 2MU2A 4XYBA 1EFAA 4IEFB 4TUYB 3O38A 4S0ZA 1SVWA 1PLJA 2FPIA 2QX4A 3TNFA 5ALVA 4HDMA 4JYAB 3VH4A 2BCEA 1ECWA 3TQSA 2ZEJA 3MBOA 3PRKE 4NBNA 1C7IA 1ZH0A 1P2DA 1R5OA 3CF0A 1U3CA 3K09C 3PNMA 3W3AH 1YGPA 3UM9A 2YJ4A 2WT8A 5KMGB 1JBKA 3C5EA 3W79A 3UICA 5J0TA 3FLAA 3VYVA 4BMSA 3DOEA 2Q0XA 2R7KA 5DI3A 3D8BA 1OGJA 2OD7A 1D2MA 3EPRA 4A10A 2QTLA 3MQ2A 3ZJ5A 3HM2A 4MROA 5GMOA 4UPDA 5BR1A 2W9BA 1ML3A 1HZZA 2FXIA 5KWIA 2EBHX 3EISA 4USAA 4XB1A 2HRQA 2RB4A 3IUJA 1H3FA 5SYAA 3SJAA 1KERA 2C9CA 1V25A 4MPRA 1U2PA 3BB4A 3OHPA 4DV5B 2YHSA 3JVDA 2NRWA 2WYHA 4FDAA 3X2FA 2QY9A 3CX6A 2YXLA 4KPYA 3K6SA 2GO1A 1P4RA 1G64A 1PT5A 2AEFA 2IK8A 2Q2VA 3B12A 3PDCA 4H3VA 3EEIA 4EEZA 1OXVA 3UNXA 4JWNA 3BTOA 1NBIA 1G98A 1T5HX 1JEYB 2PGLA 1PLLA 3CEHA 3DULA 4B9EA 4MDYA 4B3DA 2QTZA 6REQA 3R3SA 4BNWA 1UBRS 3QV1A 5IVKA 4M6WB 4F50A 2ZIXB 2QD2A 4GS5A 4LQ4A 1NT2A 4LJYA 4D0NA 2XY6A 2XNCA 2Q0ZX 1TJYA 5E2AA 4UATA 1E1RA 4LK3A 4PLVA 2C8KA 3IAEA 4MW5A 4Q02A 1Q3HA 3SEQA 3M6LA 2PLFA 4EY6A 1I4DD 4Z3OA 1G63A 3ANXA 4Q1VA 1QP0A 4RJJA 1MZPA 5JCJA 2XW6A 4LVCA 3QPCA 3AFIA 3B13B 1KK1A 2VVTA 3WKEA 3C5VA 4NOLA 2NUAB 2B0CA 2XGPA 5J5VA 2AEMA 3RJTA 3VPGA 3K0AB 4X8OA 2GOYA 2WP8J 4XPIB 4NKRA 1M2EA 4LOJA 1HWYA 2LIVA 1TLFA 4HQKA 1FS5A 3O90A 2D1YA 1KZGB 1NBMD 1M33A 2BSXA 5FTNA 4L5IA 4G23A 1DAPA 1QX3A 3Q1LA 4ZOAA 3W3AD 4BFWA 4DYHA 3PF9A 2R6DA 2OPHA 1ZXIA 1GYPA 4QWEA 2FPMA 1W88A 1KSGA 2ORYA 8ICEA 3O2JA 2WUWE 3WO1A 2V7VA 3EQ9A 5ISMA 3MILA 1NJ5A 5L51A 1JBQA 3B6IA 4AECA 2ANCA 2D13A 2PX2A 4U3JB 3T7DA 4PM4A 4J0QA 2GHTA 3REQA 2CVHA 3TRKA 5HJ7A 3RABA 2HK6A 3GGGA 4ZOHC 1U0EA 3QJ5A 5DW3A 2P9HA 3NNDA 2JH7A 4O4HF 3MOGA 2VDMB 5DB8A 5F1KA 4MQUA 4N1AA 4NH0A 5LCXA 1GNVA 1H0RA 2P0EA 2VDKB 3V2UA 4ABTA 5IKMA 3F78A 3O0FA 5KINB 4FQ5A 4HEA1 1DEAA 3A10A 3WLIA 3M6KA 5AR1A 2KB0A 4D8TA 3E15A 1KR5A 3QGMA 1CU1A 2R79A 1EFVB 2Y1IA 3U13A 1RI5A 2QTTA 4JOQA 3LXMA 1SOVA 1TYDE 1L3TA 2NZWA 3WWCA 4CM9A 1E1DA 4OGWA 3D6AA 5HR7A 8ICTA 4YAIA 2IA6A 2E0IA 2PUJA 4KO1S 5KFHA 4BWVA 4BS9A 3OZDA 3TADC 2E4ZA 5IT4A 4Y6RA 4Z53A 1WCWA 4MVJA 5BR8B 2CLFB 5HQ3B 2VYNA 1M73E 3K6SB 1V5WA 3OEWA 4MKZA 3TOCA 4K9RA 5B58T 3E22B 3TCXB 1JNYA 1XRSB 3EVAA 4E51A 4F71A 5H3CA 1IN7A 2QX7A 1F2DA 4BN0A 2DFPA 2A88A 3JALB 4O4HA 1U1DA 2W0SA 3AKYA 2DHQA 5EP2A 3VKVA 5B6JA 1TRHA 4MW2A 4B9TA 1GU7A 3PW2A 3A6HA 4QDTA 4R9SA 4MP3A 1TKRA 2CE7A 2X0RA 4Q24A 4UBOA 3V1TC 3A1EA 2R8GA 3WYEA 4EDFA 4EPXA 3R40A 2B1JA 1A9TA 2W2LA 3H6GA 4N9WA 4EHHA 4YRSA 2AEEA 2LMRA 1E2NA 2VQSA 1NONA 1YB2A 3M2TA 4JUBA 1XNRB 4U7JA 1BFKA 3IPLA 5F9NA 5DOVA 2JFQA 2QRKA 5E7IA 3VVMA 3KWLA 1HDOA 1RYBA 3VI4B 2ORWA 1NBAA 4O2BF 3KJHA 1E94E 1B6TA 3LHDA 2W03A 3FFWA 2BFCB 1Q50A 4ZZ3A 3BXPA 3DSRA 1KIMA 4JITA 3COSA 3CW2C 4H4EA 1IULA 3IKTA 2NYRA 1L4LA 1CP3A 5IF3A 2P66A 4B6JA 4YXJA 3ZOZA 5KTPA 2XA1A 1QNLA 5KVCA 5E3JA 5B37A 1QGYA 5AOAA 5DLYA 3SDSA 3MBIA 4H3KB 1IJBA 4JVNA 4S1OA 5E8JA 2C84A 3DVAB 1JDPA 1WMAA 4C76A 2IXAA 1HM5A 4EGJA 3CKMA 3Q87B 5J59A 2BQUA 1EZ1A 1MFZA 3DW3X 4WFIA 3ZWXA 1VJ5A 4ALIA 2XXAB 2F76X 2HJGA 5GZ3A 2PBFA 3DBOB 4U2DA 4FKMA 4GXQA 5AW4A 4RVFA 2JBHA 4P83A 1T2EA 1Q17A 2BM9A 3T5HA 1BFDA 3RFCA 3ZJYA 2ZS7A 1B0UA 1GRQA 2Q5OA 9ICIA 3RUAA 1I1OA 2YXPX 4Z7OB 5GAJA 1CUJA 4HDKA 4ZQBA 2ZZNA 1DRJA 4HADA 1GKUB 1KJNA 2W6NA 2QOEA 5HIKA 5E3HA 2EEPA 2V9ZA 1Q8KA 2YFKA 2C2ZA 4DBZA 3ICOA 1RAFA 2HHJA 5ES3A 2H0AA 3D6HA 4LS3A 4R9NA 5I9LA 2YV5A 5DF1A 5L3VA 2XE7A 4GXJA 3SC3A 3T5GA 3NHPA 4H7KA 5A06A 1FIUA 4ED0A 3JU3A 5IASA 2XNDA 4PNPA 4OHZA 4LDAA 2Q5QA 5EXSA 3WZ2A 2KTQA 1LNSA 1VSTA 1WEHA 2F62A 1ZQZA 4KKXB 1N4AA 4TZKA 4CCYA 1RQXA 1YBVA 1NNUA 2QRQA 3HE3A 3JYHA 121PA 4I55B 3OETA 2G4CA 5AP9A 2A3RA 1N5MA 4LXGA 1JTFA 4IIHA 2DKFA 2NW6A 4YQFA 3JQ9C 3MZ0A 3R6GA 2GAJA 2V4ZA 3KQVA 1SCBA 2QTNA 3MN1A 9ABPA 1K4MA 1SY7A 3M1YA 1EX1A 1M6HA 1EGMB 1L5VA 4I4CA 3LQ2A 5AKLA 2JIZD 3RSCA 1XJ0A 3WGNA 2Q3DA 2R62A 3IB3A 3K6JA 4O8CA 3T15A 1PGPA 3KLOA 3PFFA 4FGWA 4E1BA 3FMFA 4YJ3A 3M9NB 2QXYA 4E5MA 3VZQA 3D8TA 1UOEA 3UO8B 4JFAA 1RIIA 4IC9A 2AS0A 3N2KB 2LM4A 4UVIA 2W9CB 3ZWVA 1JDNA 7ICHA 1UFVA 1J2TA 4NNOA 5CM9C 3FKSD 1KRPA 4OJOA 3I62A 4IYRA 1HGXA 3QE2A 2EKDA 3HY4A 2W42A 1OA1A 1KYIA 2VLBA 3MJ4A 4GEKA 3PJDA 5F35A 5BPFA 2IOFA 1F12A 4A2QA 1V95A 2HA0A 3ZQUA 3CG0A 3RK1A 4ZQHA 4FW8A 4DWOA 1GKYA 1ORDA 5EKSA 2CYBA 2YZMA 1VB3A 2ODAA 3MF4A 3GFSA 2XUZA 4NU0A 4MV9A 4FBTA 3RF7A 2C5FA 1MN8A 1J1ZA 1N2CE 2A6PA 3M5WA 3EMBA 3ILXA 2VNAA 2RHCA 4Q4HB 1X8LA 2VN8A 3AINA 3O83A 2R6AA 3PSPA 4KLDA 2XKKA 2ZXIA 1KFTA 1BVYF 1P5FA 3FSJX 5EFZA 4KB5A 2DQNB 5IT5A 4B8YA 4MI3A 3K0KA 3EFOB 4IJ6A 3KB8A 4JLAA 3TZKA 3W05A 4PZNA 3WZLA 4FLFA 2UVUA 1QMGA 3UAZA 3X1YA 3UENA 3QPWA 4YMWA 2PXIA 3ZZUA 1DTEA 4UHJA 3D2SA 3BGVA 3P9SA 4PG8A 3OJSA 1OCEA 1C20A 5I8WA 1UXOA 1AURA 4MPPA 4WI1A 1MIHA 1GZ4A 2FGKA 1DQZA 4BQIA 4G1BA 5LMZA 3INYA 3VNUA 1MVNA 4OJQA 4MUIA 1SJ9A 4YXFA 5CDUA 3V00A 2OR3A 1EQAA 1P4GA 3TMKA 5KX5A 4B0OA 5LSAA 4LKOA 4BXOA 1IOWA 1M66A 3R24A 4RVNA 1W2WB 4XIGS 3L8FA 2OB1A 1G0NA 1NVUQ 3L5OA 3QHPA 3LVRE 1Z4IA 2JH9A 2YOFA 5F9MA 4C6SA 3FHTA 2BIFA 7ADHA 3CRMA 10MHA 2AZXA 4J16A 1YZUA 1ZQAA 3EOBI 2X2OA 2R7AA 1QUFA 1HNNA 3LK6A 3L9WA 4KQFA 1PW5A 1E7YA 4PVDA 1AKNA 1U0LA 2O2EA 3BXFA 2VF7A 3OOEA 3OX1A 4TROA 3RB8A 5KCZA 2QRUA 4HY3A 3PDIA 4MYTA 2C92A 1QANA 3TE6A 4EGAA 4W5QA 1WQ3A 3LKBA 3H8MA 4M76B 3HDGA 4IOJA 7ABPA 2CNBA 4CDGA 1MC5A 2NSDA 1IQRA 2YASA 3DNPA 4OQMA 3AKZA 4V03A 2CZCA 3ND8A 4K9NA 2UXCB 1SBTA 5G2OA 2HMTA 5BXYA 3ZGNA 1DWOA 4KMRA 5IMSA 3BS7A 3UWOA 1L7XA 1U9CA 2WZQA 4JP5A 2D4HA 3VHXB 3H7IA 1OWPA 1IN8A 1SC4A 1UQRA 1BG6A 2GA9A 2HNAA 4D5EA 3HSKA 1NAIA 1NBWB 4CNQA 2ZSEA 1VE7A 3ETEA 4ZDWA 3R7WB 1BXGA 2AFVA 2QJOA 3SCZA 3PIDA 1ECCA 4K40A 4NZ9A 2QS9A 3WLLA 3NPAA 2J9RA 3ENQA 4AT1A 2UUOA 4X44A 4RTPA 3K1YA 4EA8A 1KVUA 5EJ9A 3GBPA 5IAJA 4LJ7A 3Q85A 5JQGF 1U11A 2B2XA 3CRXA 2ABWA 1C7YA 3BIJA 3HFRA 1H94A 4N8EA 4YACA 4DE5A 5CD1A 2VANA 2FN9A 2Y71A 3I1FA 5I4KA 3N0TA 2X8JA 1KORA 1NSFA 3F3KA 3QH4A 2K8CB 1LDBA 1KQOA 3E9YA 5D1NA 3EFEA 3EZGA 4EATA 1L5WA 3IAM6 5G02A 1W9MA 3KYIB 1OZAA 2HLDD 3KQSA 4QG7A 1IMJA 2DQZA 2DQKA 5MFPA 3G9UA 3NO4A 8LDHA 3SLKA 5A62A 3TDMA 2WE8A 2YQZA 2Z2KA 4DPLA 4R9VA 3UBMA 1AOXA 2RJ3A 4ZEOA 1Y6GA 3DUFB 4KK4A 1W59A 4FN4A 5EZSA 4OKSA 3ZVKA 1LBHA 2FSPA 1G8GA 4N40A 4RNDB 5TZVA 3H2KA 4OO3A 4AJPA 3IP6A 4Y2JA 1X1SA 3IQEA 4FN5A 3WICA 1C8KA 4BVJA 1FMJA 2QG6A 1HKHA 1FLDA 4RFSB 5JYDA 5L9XA 1XG5A 2ZI5A 5HVNA 1Z26A 4F6RB 1ML4A 4B2LA 3RFFA 1LJ8A 1TM2A 3RH6A 1JHAA 4DA0A 3DDHA 2XGGA 2WD7A 1OX4A 1OI3A 1G7RA 1I5RA 3SQIA 4B9AA 1E7RA 1Z15A 2HVHA 3BHMA 2FEPA 3A1FA 3GZTB 5EJEA 3AU2A 1P80A 2BJWA 3R5FA 4XAQA 2O07A 4RJIA 3EZ5A 1CJBA 2OFPA 4CUKA 4XVCA 5KUTA 4XUCA 1NVXQ 3TAHA 4JB8A 5EKXA 1WBBA 3N53A 3PUXA 2G76A 4LXUA 2DVMA 4ARAA 3N86A 5A4KA 1CZHA 1G7TA 4PYKA 4ZVUA 4AZ3A 2R6HA 3K9GA 4YDHB 1R6AA 4EG1A 3I6BA 3A6GA 5JZBA 5GIOE 1PSDA 4C0LA 4CI9A 1Q7GA 4BRSA 3LFUA 4OXIA 3PGKA 3NHYA 5KG4A 2NOAA 3BUSA 5A0VA 3CKKA 3GROA 5CDHA 2FQYA 3HABA 3MTEA 3VGJA 3W7BA 3ZNNA 3QXJA 4PIPA 1JMVA 1WF3A 1FDTA 4A82A 1O8BA 5LXTB 2WD9A 2ACKA 2PRZA 2WE7A 5EVCA 1NVWQ 3NIGB 5K4HA 1RDFA 1Y3AA 4J03A 3VNSA 2VUUA 3GP5A 4G5FA 4O1IA 4IJ5A 3P9NA 3RJIA 1ZQRA 2GGSA 3MTIA 3UGQA 1ZGGA 4UW9A 3PP8A 1MXFA 1KI8A 4U9HS 3DL4A 4QT0A 2TMKA 5LUBA 1ISFA 3HPOA 3V6KA 1FNMA 1XTUA 1ZICA 3PL5A 3VYWA 1Q6ZA 2RIPA 3X2SA 4CMEC 3EXIB 5HKBA 3OMLA 1NLZA 7ICNA 1S76D 2OG1A 2ZSIA 4BAZA 3K0EA 2H11A 5FCDA 3I73A 1RYHA 1SB8A 2PDAA 5T8KA 3VNRA 3LDGA 1HF3A 1KKXA 5AXCA 5GOZA 1GD1O 4WNAA 3AL0C 1M3SA 3PUJA 2YWBA 2ZBFA 1XF9A 5EIEA 5ALZA 1BCRB 4GE0A 3OFNA 1OI2A 2BFAA 4KX5A 5A0TA 3HCOA 3PPIA 4D9KA 2WHEA 4C4PA 1KC3A 1OLUB 2BT4A 2FPOA 3K96A 4IMRA 2JIMA 1WB5A 1L4BA 3L8GA 1W0CA 5ECWA 3TB4A 3O2SB 3ZW8A 3F4BA 4B3XA 2H3ZA 1DBRA 3ZKAA 5CXUA 4IVPA 4LRQA 3E03A 5FRDA 3RF9A 2FRXA 5B3KA 5KTSA 4H6XA 5ENZA 1UOQA 3EG5A 4NCHA 2YVLA 1CJMA 1K5HA 1HX7A 1CUUA 1A7UA 3UY4A 1E5VA 1B1CA 3U49A 4MWBA 1N5XA 8ICYA 1V6CA 3LSYA 1P2FA 2RHDA 3NONA 3RBZA 4K3VA 2B1RA 1FK8A 5AW3A 1A1VA 4B32A 1ZGHA 1EIZA 1LZLA 2HDNB 1GSAA 2YZKA 3ZX5A 1OXMA 4L2IA 3VR2A 1TE2A 5ALQA 2XCPA 5BV1A 1SVMA 2H48A 5TVKA 2PR7A 1F6DA 3DOFA 1S0NA 1FP4B 4V3BA 5JZOA 4I4LA 2GUWA 4IQ4A 4O0LA 1Q1BA 2HA6A 1RS0A 1A9QA 2XUPA 1CQWA 1OGYA 4OQYA 5CLFA 1VFNA 3O75A 1GT6A 3PZPA 2ZGVA 1MAHA 1D03A 2R87A 3LBHA 1R0LA 3NHJA 3HPQA 3MUOA 4PXYA 2XBMA 1KJ9A 2ZIWB 4HVLA 1ZN8A 2A1JB 2SKEA 1AA9A 4PAWA 5EP3A 2KSOB 4IXNA 1ZA2A 2X41A 4X62B 2BMFA 1OC4A 1W35A 2GI4A 2X5NA 4IS3A 4M0KA 4MRAA 3W2FA 1T6YA 4K9PA 3DTVD 1P7ZA 4FLEA 5DGIA 1I33A 1S2LA 1E2KA 1CY4A 2CF6A 5JAHA 2FWNA 1M74A 5HHHA 2QRLA 3RBEA 3F2BA 1YQGA 4D3FA 1XWWA 3JAKA 2NUPA 3L7KA 5B36A 1O5TA 3CVVA 1IJFA 1CQXA 2VQDA 1A8SA 7ICMA 2CCGA 1RBMA 1CUDA 1R50A 2VLIA 3GI1A 2BF4A 3MG9A 4FFBA 5LYYA 1U1EA 3I45A 5J4YA 2XTMA 3PXCX 4KPUA 2W8BB 1XMQB 3ILYA 1CHNA 1SXJD 4QXOA 5JYCA 3U44A 3PYMA 4AF6A 1ZITA 2E8OA 2FU5C 2J6IA 4XSVA 3LNCA 3RIEA 1EUQA 3AK4A 5HS4A 3PY8A 4EECA 3MVEA 1MHTA 1DRVA 3ELWA 3AUUA 3I0NA 4BYMA 4CV0A 4KFSA 1ACLA 4G37A 4RA9A 4BP8A 4F1JA 1VJTA 5L3RA 2D6FC 2CSUA 3HCEA 4CNBA 3HK2A 1IZ7A 3GPDG 1G20E 1JG4A 4RAOA 3ESCA 4HKTA 2CVZA 1DEOA 1ZRMA 1IE3A 2F3RA 4OIFA 4DY4A 4XVUA 3BEDA 4ZCMA 3OLQA 1GR0A 1NRJB 4ARBA 3FTNA 4KK3A 3G5LA 2BFFB 2AZTA 2YRWA 4FWBA 4IX9A 2OCAA 4U00A 5DE3A 1QO0D 4ZQGA 4WY8A 5KCMA 2ZJ3A 1H5QA 2B8NA 2AMVA 2IKSA 3ANSA 2N9UA 5EINA 1TXGA 2FSFA 3T3MB 4X1IA 3GLIB 1SWVA 4L73A 5BRAA 8ICWA 4B17A 1YB4A 3H4TA 4B3IA 2BTQB 4DZRA 3CX4A 1VDMA 2R1TB 5DGXA 3WR5A 3U4MA 3X3HA 3G89A 4CLEA 2PFGA 6LDHA 2ECKA 4GPIB 3FAZA 1HYEA 1QFYA 5CWRA 1Y3HA 3GAFA 4MQLA 3RV3A 2BBWA 1E1QA 2V7QD 4LJSA 1WE2A 5TJHA 1O89A 1P2SA 3DE2X 1O6ZA 4Y7DA 3SICE 3UJ6A 1JDUA 2R7NA 1YDGA 2IHKA 1PK7A 2WAAA 3NKFA 1ID8A 3PTAA 5DGDA 4YJGB 1GPH1 2ES4A 3BHNA 1JE1A 1CWUA 1RM5A 3UA3A 2W6MA 5DNYB 2H0QA 3L3BA 5FTKA 1HLFA 5IARA 1TUIA 4G2NA 2JARA 1UKCA 2BFEB 2PYZA 3DBHB 3FE2A 4XQGA 4CF7A 1H4QA 3ZDEA 4MUNA 3COJA 2WSYB 2NXJA 1KJZA 2R48A 1NQXA 4HGYA 4QVIA 3I04M 5IABA 4IR1A 2AJTA 2I22A 4TWBA 3AB8A 9ICPA 2WOJA 4BO4A 5LOVA 1MW8X 1O9HA 1V3UA 3BAFA 3U1BA 1GZ7A 2HOIA 1FDRA 5K3DA 1N5RA 2B69A 1SVOA 1R4MA 1XQYA 5I7FA 1E1NA 5K05A 3Q8SB 1NIJA 2W2KB 2F9LA 2XQIA 3QUAA 4JLWA 3IURA 2OFOA 3KT6A 1L2TA 1GAEO 2LYBA 4IDOA 4WESA 4C4YA 3NRBA 4Y2UA 2BR5A 1IONA 3K1JA 4Y6OA 4QWAA 5D85A 2UYCA 5FX2A 3STHA 1J9GA 1ZQIA 1POXA 2AFHE 1ENZA 4PPGA 4RADA 4LYDA 5AHWA 3QVVA 1ZCZA 2C7RA 3WKAA 2XECA 2YS7A 4OAOA 4BKOA 2XGMA 1PRYA 4JMLA 2F59A 5F7JA 1KZ1A 2EAUA 3E48A 3TZCA 3FD8A 3X1KA 3WFJA 1YRAA 2ESRA 4JX9A 2R00A 3U7EB 2EP8A 1YIOA 2X3UA 2O8FA 3WWPA 2WNIA 2Q6TA 4XGIA 5GINE 4RH3A 3UJ7A 4DFPA 4K87A 4BUCA 4R8SA 3KAKA 2JH8A 2MUTA 3HTXA 1YBFA 3CXUA 3TZQA 4B7UA 1HEUA 4K46A 4GOKA 3ZHYA 5A5EA 3DXXA 1PK3A 1XZLA 4HJRA 1G19A 4BFZA 1AH2A 4DARA 4I1RA 1DBPA 1Y89A 2AW5A 1IK4A 1X86B 2VOEA 1G7SA 2ASVA 2GEUA 4MQEA 3TTXA 2V6BA 5IILA 3V2HA 3A3PA 3WP0A 4EHFA 3A2MA 1J1IA 3EGIA 2L69A 3BDPA 1L3IA 2ZWIA 2O23A 3QJGA 2ERYA 4LBZA 2O3RA 4MULA 4RHEA 4AXXA 1D0SA 1GUDA 1GXSB 4GPEA 1QOZA 4A73A 5KTOA 2PJRA 2D3DA 1G16A 1ZMOA 3AJDA 4XYGA 4FUTA 1RG6A 1FYEA 1P6QA 5IDXA 1JSCA 3MTQA 5DX1A 5BRNA 1K7CA 1BWPA 5AVKA 5BWMA 1C1HA 4QIHA 3C1YA 1KEZA 1ZQCA 1UM9A 1WRBA 2QENA 2DKZA 3N2NA 4R8LA 1E60A 4KXQA 5BQPA 5KIAA 1NX9A 2QX6A 1RLIA 2HH9A 5C8VA 4EHBA 3DXZA 4IXWA 4KJXA 4MS1B 4A6EA 4AP9A 5J43A 2VQ6A 3CRZA 3PHCA 3ADBA 1XPUA 4MRSA 2DQ4A 2HO5A 2YWCA 1GGMA 1EEXB 4GD3Q 1KU6A 2C8VA 5J2TF 3RASA 3AVTA 5HR5A 5HF5A 3GFFA 4DLSA 2XQJA 3I1IA 2FLKA 4JELA 4JGGA 4TV8F 3QU2A 5JJCA 2UAGA 2A30A 3UK7A 3B82A 4EPVA 2FHPA 3OTIA 3SC6A 4A8EA 1GRCA 3SC2B 2PXCA 2X76A 4JVLA 5T14A 4XM2A 4EPYA 2FZ4A 1FP7A 1VYHA 3OD1A 5A4DA 5IAAA 1PR5A 5EIFA 3FCYA 3EZYA 1U2TA 4JJEA 3CZ4A 8ICUA 3O8QA 2G77B 5ALRA 1W5SA 3OLZA 4URUR 1YQTA 3VUFA 2EWMA 2QARA 3RS5A 4FE7A 5F5LA 1CETA 1G6OA 3SJZA 4GXTA 5DFAA 3AUKA 2HSJA 1YFJA 1O95D 3BJRA 2C5EA 2PZBA 2Q9CA 3AJRA 2MIIA 4MMZB 2O1EA 3OZUA 4BIMA 1DV1A 3H0CA 5FBLB 1L7PA 1WWVA 1YL5A 5HRAA 2LZ0A 3S2FA 1DXHA 3IHQB 4HDMB 1L4FA 1HY3A 2P7HA 3TI7A 3AEQA 2YYYA 1XBTA 1S02A 1BU8A 4QUJA 3ZWWA 4KNYA 3REQB 4BIIA 4BCBA 3E2EA 1D8LA 1Z73A 5DLEA 3GJ7A 3QMMA 3ZI7A 3V1NA 3FCUB 3NH6A 5EXEA 3DO6A 3JSAA 4FOPA 2Q99A 1SO8A 4ZYLA 1STOA 2JAHA 5IAEA 4IG9A 5LPNA 1WM1A 3HJGA 4DIOA 1U1GA 3FOAA 5AJYA 4D9EA 2LCQA 4BE9A 4ZT3A 2JV3A 2FWMX 2X58A 4I99A 1ECJA 2FLPA 4E1AA 5JO9A 2OBMA 2CDBA 5ALJA 3OSNA 4TQRA 4HVAA 1GFZA 3ORHA 1COWA 4FHDA 4B82A 3VMFA 2JXJA 3C74A 2H31A 9ICXA 2A0YA 1V8FA 2PD3A 2F00A 2VWHA 3F74A 1FU7A 1GKIA 3EB9A 4YMIA 2OV1A 4W1QA 1WU8A 1D8BA 2J9ZB 1FB5A 1VLMA 2R4QA 1Z3CA 3GDHA 4I2JA 1PV1A 3GLRA 4K05A 3EVNA 4RMJA 1FZTA 2Z9DA 1DFIA 1NA5A 3CF4A 4G5SA 1ULAA 3KUXA 1E6KA 2C95A 2QP9X 3NETA 4Z6DA 2ALZA 1JMKC 2BHLA 2J4DA 1DV2A 3WQRA 3QKRA 4C7KA 1TK8A 4UNSA 2SBTA 2JH1A 1CJTC 4YRKA 4UASA 3WSWA 2BFNA 3AKCA 2XVTA 4E31A 4F60A 4HEA6 4CTJA 2E48A 1Y5MA 4NBVA 1QG4A 4PGHA 1O96A 5ECDA 5EJ8A 3GEDA 1BTOA 1CVIA 1KEPA 1DB3A 1KEWA 2J4CA 5KG1A 1ZWLA 1KKUA 3HB4X 3T3DA 1XCJA 4EA9A 4D9BA 1Z07A 1V97A 1T4GA 2FW0A 4UXHA 1T1JA 1M1ZA 1Y37A 2LE0A 3F6CA 3L0ZA 1X74A 4AXBA 2G6TA 4YECA 1G60A 4E30A 3OU7A 5JD4A 3VU9B 4MCHA 3QFSA 4QWBA 2AZMA 4JEUA 2Y6VA 3PHGA 5IZ4A 1IUKA 1U7XA 4LZAA 4Q16A 1Q0PA 1LQTA 3SYKA 2HT6A 2PT6A 4BUGA 3W34A 1JHOA 2WD7B 2X2FA 4DYVA 2YVKA 3DWEX 2VHUA 4MHSA 2WM3A 1YZQA 1OU4A 2PGIA 2Q50A 2DHEA 1VJDA 1KE2A 4ESVA 3EHEA 4X9XA 1OH7A 2YZ7A 1Z36A 3EC7A 4OOEA 4EMSA 2CV0A 2QARB 3OAAD 2OK8A 4IVQA 4IDEA 2W2PA 4UQGA 3HX0A 4O0MA 2N75A 4OHBA 3LBAA 4Q3KA 3WK5A 1FJXA 2ZRJA 3TDKA 2PMZF 1K5OA 1RM3A 4KMUA 1AVTA 2BZGA 2J5KA 2OOKA 3SS7X 3TN7A 2DWPA 4GP6A 4ZCIA 1X7XB 4X66B 2VXCA 4XR9A 3H8SA 1JR3D 1USIA 1L5HB 1SIOA 2DF8A 2O6HA 3AZOA 3PFCA 1N2IA 4GX1A 5DYIA 4AWAA 5MGBA 5FFFA 1ODSA 2FSIA 4DSJA 1DUVG 3QWBA 5CR9A 2HWXA 2W7TA 1HUQA 2CWWA 4B79A 4KRFA 2AG6A 1WCYA 4RD3A 2AUNA 4ED2A 4F4XA 1YZ3A 3TMAA 4P33A 2VQ3A 4BNDB 2PSFA 5I7SA 3L4PA 2Z5VA 3MPUA 5JADA 1I7LA 2VDNB 3WISA 3MFHA 3AL2A 1QK5A 3TADA 1US8B 2E6UX 2R1VA 5EEHA 4DVGA 4CRWB 4BRZA 3KDAA 1RXSA 1NJ6A 2A0UA 2ADOA 3IMEA 1JECA 1GZ3A 2GPAA 3QPDA 4FYVA 4L8LA 4QYMA 4TRMA 1DJMA 2JCVA 3ZK8A 1SD5A 1L8XA 4MUYA 1ZQ9A 1DAFA 4NMXB 4BRUA 2AGPA 3GUYA 2BSQA 1U2QA 1I36A 3T7SA 3V1YA 4DEVA 1U7DA 4J4BA 3QTTA 4F2HA 4G01B 5J2UF 3TNDA 2HDOA 1WUYA 2GYWA 4HZGA 5KHLB 3TSAA 2I7CA 3UJCA 1I2DA 5AUQA 5KWEA 4CL8A 1EJ2A 3DAYA 5EIXA 3S7ZA 4FFNA 4RCYA 1JPNA 3N7AA 1XTTA 2KJQA 3GJRA 4JLMA 5KAFU 2ONJA 4N3NA 1SIWA 1TEZA 5IT9A 4M1SA 4KZPA 1AZLA 5CB4A 1AMOA 2ISQA 3P5SA 3AVWA 3MRXA 4WOCA 1HT3A 1TYBE 1AKQA 2C2HA 3E27A 4QL3A 1SBCA 4D02A 4ZO9A 4C7OB 1FIQA 1MUUA 1UJBA 1E3JA 1KZYC 1T2FA 5JZVA 1N9ZA 3SSAA 5AW7A 3VHQA 4DRXA 1P29A 3GJQA 2HW8A 1U2GC 5F3DA 4DLLA 1QTQA 3OZWA 5HFAA 3Q8WA 1ADJA 5F5NA 1SQFA 1J21A 1NP3A 1KVRA 1U4OA 1AN9A 1UXIA 3PDHA 4N4AA 3HBAA 1GARA 2G0NA 3TD9A 4HGNA 4DJJA 5LA6B 4RPHA 4FOTA 4X84A 1T8EA 4OH7A 3W8EA 1CR6A 3IEPA 5H81A 3OQIA 2OK7A 3Q3HA 3RVJA 3BMCB 4M37A 2ZT5A 4ZVSA 4JX8A 2AI1A 3UZUA 4PNZA 5JS6A 3H2GA 3ET5A 1AS3A 2NRTA 2JL1A 2PS1A 2Q46A 3G9TA 3GXOA 3MT7A 1X9SA 1HOTA 4R6XA 4YYEA 3PE3A 3PGA1 2PJDA 3FNIA 3M70A 4NBLA 5K7SA 3QPVA 4RTKA 3C43A 1A71A 1NMEA 1YO6A 4RZQA 4RDXA 3N8GA 4TWIA 1KZ6A 1B16A 1O94A 3UXPA 2Q3HA 1RWQA 2AR9A 4G0UA 1E5QA 1I6KA 1J23A 1N61A 2VH5R 4XX0B 4U2FA 5ALXA 4C4RA 1DKLA 3I9FA 1TMOA 4HAZA 4BLRA 3HT3A 3RJEA 4DQRA 4RQBA 3LAWA 4XD2A 3U37A 1TVCA 1M8FA 1RAEA 2Y3IA 1KH2A 5A3JA 2IBTA 2YQEA 3M7DA 1F9EA 2IPLA 2J5RA 4WEQA 2RKBA 3VPAA 2FUNB 2PUTA 5TX7A 4WZZA 2Q5FA 4KGZA 1Q44A 4Q00A 2WMNB 4B35A 3X1XA 3FKJA 3BQMB 1YC2A 2JVIA 3N05A 4XSHA 2GEVA 5J0RA 1TK3A 5F98A 1W93A 4KQCA 4J90A 3U7FB 3T9BA 1U02A 4I2CA 1JSZA 2QAGB 4MUJA 4PAQA 4B44A 1ZW6A 5HDQA 1GPMA 1A77A 1O97D 1YZFA 3S5UA 3MWDA 4N5NA 4EX7A 1SUIA 4R01A 3DMTA 3IHTA 4MV0A 4XWGA 4F4CA 3FDZB 1GT91 2B8EA 2XF2A 3UAVA 1W52X 2JIQA 2QD5A 3OIVA 5CRIA 4ISBA 3BKWA 2GCNA 4OXNA 4OJ5A 2B78A 4FBLA 2Q28A 2OQRA 2PUHA 3KO8A 4KJZA 4LPKA 4NYJQ 4M9JA 1W9HA 4S2UA 2P35A 1M7GA 5E4TA 3THYA 1T5LA 1X6JA 4OHFA 2BZFA 1FW8A 1Q0SA 1Y3DE 1SD1A 3M4ZA 5DHQA 2C00A 3U4CA 1JIKA 4CEJB 3TX6A 4M0CA 3BH0A 2PXXA 5LDDC 1Q2UA 2JJ1D 3NWPA 2WSBA 5HIJA 4OSOA 1H2FA 4CCHA 1ECLA 1M0SA 4LDQA 5HF8A 2AQ0A 5D7BA 4MR7B 4DILA 3M9OB 1YFLA 4B48A 5I7EA 3JZDA 3IDZA 4RT2A 3K53A 3UJBA 1U8UA 5I7HA 3ETRA 2P62A 1JRPA 2R6GA 3MYRA 2LW7A 1CXZA 3CUUA 3NATA 3MERA 4R8MA 3C39A 1H22A 1M67A 1YHZA 2ZBVA 1DUIA 1EP9A 2WWIA 3BD6A 1H3EA 1TYEB 4UDNA 2GCPA 5ESWA 4KUHA 3JQGA 1RLOA 1GIAA 1CVLA 2KN7A 1F8FA 2EZ9A 1HRDA 5BVGA 5DLDA 3CEPB 1PDVA 3DLTA 4EPTA 4LUCA 2JLWA 1G7CA 2VFAA 5IM4A 2OYYA 5DLFA 1RRVA 2VJCA 1QSSA 1SKMA 2GM9A 4ND7A 4RK0A 3C8DA 4ED8A 2HQBA 2JJQA 2G5CA 4IWYA 4KXUA 4V0KA 5M3BA 3LCUA 1E3SA 3K4GA 1NZBA 1CHDA 1R6UA 2WWXA 2C2RA 2X23A 1JVNA 3BFVA 3C24A 1KAHA 2R44A 5LQJA 1RWPA 4D6XA 1IQ0A 2EG9A 4N7RA 2DPXA 4HEJA 4JB3A 1X7XA 5DWQA 3TQQA 1NTRA 4XZ3A 5HM8A 2ZI3A 1MQ3A 4D0RA 3UXNA 3BQ7A 1LLQA 2VZ0A 3P9KA 3E9MA 4HQRA 4KAFA 2W8ZA 1AN0A 3GD7A 1QK4A 3L46A 5KC9A 1RD4A 3GLSA 1U0BB 1X7ZA 2C9BA 4EB0A 1O3YA 2NQ2C 3WLRA 4ZCTA 1R9GA 2BFEA 4PZ9A 4YP3A 5EE1A 5ECGC 3AO0B 3MEQA 1DX4A 3BWBA 3CZCA 4V0MA 2QPAA 3H2ZA 4EB8A 4BUZA 2GRUA 2QPTA 4ETIA 5HE9A 4ZI2A 2O2JA 2NTNA 1UIMA 3S2IA 3TK1A 1WXGA 1N7IA 3WNZA 3RBDA 4UAJA 5B3JA 4UOQA 1YT3A 4C0AC 2ZULA 3X1MA 2HMVA 4IAOA 4MLDA 3OZRA 2QI9F 4MRPA 4QDUA 2Z5GA 1VRVA 3GQBB 2GHRA 2PAFA 3EVZA 1Z6GA 2QQFA 1QS0B 3PA8A 2RAUA 3HYLA 1EFLA 3PI7A 1V37A 1JDTA 2PFKA 2R1ZA 4F5PA 2JI8A 3N0XA 2YL2A 3P26A 3NS7A 5HZMA 4M9RA 3TRHA 2HBKA 5GQSA 3O8OA 3LBIA 2PBZA 3FWHA 2VXBA 5KNDH 5ICFA 1FNDA 3DBIA 3GFTA 4NBUA 5E6SB 2YX8A 3K4QA 3L77A 1SQSA 4M9GA 5KG7A 1QGZA 1E3WB 2GLEA 1MV8A 4ITRC 2P9EA 4MW9A 3V8VA 2WJVA 3RHTA 3CZPA 1LC3A 1D0VA 1NV8A 1QHHB 3EF0A 3QUSA 4Z9AA 3OIDA 3OU6A 4N7JA 2OV3A 3N2KA 5DN9A 4E6PA 4GFJA 1ZUIA 2VAVA 3DAOA 3VVLA 3EPJA 4QYTA 1N6IA 2D4AA 2OBXA 4DXHA 1LK0A 4TRJA 1ZDMA 3E9RA 5LXTA 2K4HA 4FEYA 5M04A 2FX2A 4QSHA 2WFLB 3ADCA 4PYJA 5NLLA 5DGCA 3V1MA 1X15A 2QMYA 3B0YA 4FNMA 3W1VA 2F3NA 2VTBA 1WXXA 3E4DA 2XB2A 4GR5A 1GHTA 1A9XA 4PLPA 1O95C 2CCKA 2A5JA 4L4YA 3IHLA 4ED9A 3NS1A 4E7OA 3NOOA 4KQWA 1RQRA 3H83A 3N07A 4ARZA 5EJ7A 5G0VA 3ZE7A 3D3JA 1CQJA 4D6PA 1GQQA 1TTQB 1B4DA 2LR0A 1N1EA 3AJAA 4F38A 4NPHA 1CF4A 4ZMRA 3EQ2A 1DMRA 1DWPA 5BW6B 1Z7EA 2PKCA 4JJ4A 4OB7A 3SQLA 4OYHA 2II6A 4UM9D 4IKPA 1BE0A 4CUJA 5JHHB 5J29A 1XWIA 3CVUA 3U6BA 3KWFA 3EZ7A 5BN4B 3AHCA 2E89A 4QRDA 1EZZA 2XUJA 2AC2A 3LWZA 4FHGA 2MSNA 4JJZA 1GUBA 3TL2A 1BVHA 1AXRA 1L3SA 3OE1A 3P96A 3TTVA 1WMSA 7YASA 1R16A 3HEBA 5JJKA 4G9BA 2VJPA 3F6BX 4ALJA 3MD9A 3EEFA 3VR5A 3QFFA 2NU6A 3RUHA 4EZBA 4UHBA 1BW9A 3PC8A 1CRLA 1T3QA 4ZOLA 1PV2A 1YV9A 2XSZA 1S4MA 3K16A 5LDHA 4IJMA 5EE0A 4EFLA 4LRSB 2JEOA 3EXG1 4JQCA 5A04A 1YD7A 2F6RA 5KNDD 1QBGA 3LKZA 4QODA 4R84A 3IIMA 3OCCA 1N5WA 2V7TA 3M1LA 2P1DA 5CLGA 3TAPA 3W4IA 3KALA 3PFWO 4PZ0A 3BK2A 3OT5A 4GOXA 1KMHA 1LUAA 4ZT6A 1CZKA 1LS1A 2GKOA 3RRXA 4C1BA 4CQMD 1TM5E 1XPOA 1T6NA 4HVCA 3PR2B 1A4UA 3KZ1E 3WLOA 1COKA 4O2LA 2FZWA 3BF8A 4G4SP 4Q9KA 2NSYA 1IXYA 2VS1A 3N39C 3BKXA 3GJ5A 3GCGA 4DSFA 4B83A 1DOZA 3B3AA 3OFJA 5HX7A 5ERGB 2W22A 3ZXUB 4KO4S 3SSMA 1ZQNA 2I62A 3QWIA 3ZWBA 2HMSA 4GOLD 5E6RB 5KYUA 4BZXA 1YQDA 2K4MA 3ZWMA 2H9AA 9ICWA 2P4EA 2IUYA 4J9RA 2MMCA 5HJ2A 3HP4A 3KB1A 5M7EA 4FFDA 4N3AA 5U4QA 3RRBA 5JQWA 4A6DA 3EVBA 1F48A 4H4CA 1WJGA 3IQDB 4IFTA 3C1AA 3E8MA 4GC9A 1XJCA 1CS0B 1DARA 3K7EA 4N03A 4XGNA 3VDRA 3W77A 1MORA 1FTSA 3HN6A 3K1AA 4YT8A 4X20A 1ETUA 1E3EA 1MX9A 4G36A 1E2QA 2WUGA 3N8HA 3MK31 4BJ1A 4XYLA 1IUPA 2DH6A 4PCVA 7ICIA 2FR0A 2I8CA 4L9RA 1SBIA 4PYMA 4N3GA 3PVXA 1NKTA 3SKXA 3IR7A 3ISCA 2P2DA 2E8PA 1QMPA 2B6HA 3UB4A 5EZQA 1ZUD1 3V9PA 3MJRA 3S99A 4KGDA 3NHMA 3HA7A 3RSLA 4E08A 4I3HA 5DDIP 4TZTA 5E9QA 2VZ8A 2C4TA 4BLPA 1RJWA 4W9NA 5DLPA 5KVAA 4KI7A 2PJZA 1M2KA 1Q21A 3JQGB 3HRIA 1QYWA 4ZJUA 3H2IA 5LQCA 5CIYA 1G21A 2AFRA 5IXYA 1X6VA 4ZCLA 3JVEA 3DPIA 5K3EA 1L7QA 5JE8A 2HCBA 1P31A 5F1YA 5EJ5A 3TAUA 3QVUA 1U0NA 5HBRA 4YRDA 1HYQA 1J0BA 4MIEA 4UD6A 3TCNA 3TTWA 3R5TA 3PQFA 1SCQA 1YF3A 1QFZA 4P4SA 1CW2B 1FTQA 4TXHA 1TYCA 3DMGA 4NYMR 3WIUA 4UOZA 3L9XA 4RK7A 2EZXA 4ZARA 1DPFA 2IGTA 5BN5A 1H9AA 4C8NA 1MG0A 3DTVB 3LOQA 3MMSA 3KKQA 2OKGA 2ZIFA 2OVBA 1M6VA 3L1UA 4RS3A 1KOJA 4O3SA 4QPJC 4XCQA 3THXB 2KHZA 3TFWA 1EE1A 4K9OA 2QD1A 5EIHA 2IZ1A 4YMLA 4LVUA 1NKCA 4ECZA 2EGHA 4J1TA 1MRZA 1RQPA 5BSKA 1QK3A 3WBBA 1Z0ZA 5C4MA 1G5TA 1P3DA 1DAOA 3KR1A 3U4DA 4BGVA 3IEIA 4FJ0A 5KT3A 3CX8A 3LP5A 1YRWA 4LJ5A 5K3FB 3PFNA 5IIKA 5IX8A 3NMUF 3OZVA 2Y1XA 2QTFA 2EKLA 5B30A 1KAOA 4GI1A 4NG5A 4O29A 5KAIU 3WLAA 1D0IA 1P2GA 2L42A 3M34A 1AKUA 4RY8A 5TRTA 2WVHA 5FBRB 2FKNA 4NLGA 4MDHA 3IFSA 5EWJB 2YX1A 1YB5A 1ADFA 3WHKA 1QRTA 3KJNA 3V6LA 4A15A 3I2FA 3S1AA 1P4SA 4ZVPA 2PZ8A 1GU0A 5ARDA 2X8JB 4Y8VA 1VMEA 3CY6A 4KYVA 3RSGA 3C5CA 2R8PA 4GT1A 5EHZA 5JCZA 2C77A 5IG2A 2G3YA 5KQPA 3IDAA 5JO0A 3V4RA 3CXRA 5JDCA 3UQ2A 4RH1A 3TEFA 1BCSB 1L5YA 1WAMA 3VTAA 4EDHA 3R9WA 3EXHB 3A9TA 3NHKA 3U5ZB 3DR5A 1DNPA 4KQXA 2CDNA 2EV9A 1E9FA 1JZTA 1ZJ4A 4DMRA 5ITVA 2XTJA 3KZCA 4W8HA 1DIRA 3PXXA 4CGZA 2QLMA 4X3OA 4KR0A 3IRUA 1H8HA 2V8BA 3K8ZA 2J6SA 1TC1A 4FGSA 1N6LA 1P44A 1S0OA 1WXIA 2B5WA 2WLSA 4HFNA 1UINA 3NEYA 4ECXA 4KGVA 4ARSA 3NHLA 3KVOA 3DEHA 2ODGA 2OGWA 3MC1A 2NSJA 3TXYA 1J24A 3AVPA 3WDKA 4LZNA 5CDFE 5IULC 4C21A 1UM9B 3S7TA 4EY5A 2HHXA 3NHZA 4JC5A 5H1YA 4Z4EA 3V6MA 2Z1MA 3AI2A 2EGUA 2IF2A 1M1NA 1DQRA 2ECQA 4L3VA 4IUYA 3MOIA 4Q9IA 5ELLA 3UJHA 2GTIA 4TUYA 1BGVA 2KS6A 2Q62A 4C8OA 1E9BA 2DWCA 2GB4A 1Q19A 1TGVA 2BI4A 3BJEA 1P39A 3E5RA 3T1VA 3OJLA 2RHFA 4GI3A 2AQ4A 4KBYA 4BPBA 1IDOA 3KR9A 1AHHA 2J0VA 5LA6A 5F51A 2IUSA 3RNOA 1OYOA 1FFHA 1XP8A 3E23A 3H7AA 3NHUA 4CVNA 2AGOA 3GLVA 5BWLA 3ZBQA 2DUUA 3VKHA 3GK3A 1W4ZA 1KO4A 1QWOA 3K0CC 1NOMA 3TSZA 4AY5A 4YT4A 2MAXA 3U0BA 9ICAA 3TW8A 1NX6A 1V5EA 4OQXA 2PE5A 1PNQA 4Q9AA 4C20A 4D98A 4MS4B 2NUBA 3BT7A 5AI5A 2RAVA 1JR6A 2EDCA 5BURA 4JMUA 1U7UA 4LOAA 2WC1A 4XIIA 5FL3A 2FMTA 4GGPA 2GVNA 5FLYA 4L7QA 4NARA 1RYRA 1WPXA 2A19A 1KK3A 1E2JA 1P19A 3N2EA 3LY5A 1G3IA 1PJRA 4YN4A 3PKZA 2B5VA 5F64A 5HRUA 3F9IA 1T6BY 4QJ3A 4BU1A 3ZZ1A 5JNTA 2Y1LA 3CG4A 3RYFB 3N70A 1GA6A 1MOZA 4LISA 4M0FA 4RQUA 3AEYA 3JQDA 2G8LA 2P9GA 2G0AA 3CLKA 3NG1A 1QC5A 2HM7A 3EG9A 3M9LA 4EJ6A 2O6KA 1QE5A 3LHKA 2AJCA 4TT3A 4C2UA 5ILGA 1U0HC 3QIVA 5DXFA 2B4KA 4KYUA 3DKKA 4TSFD 3R6LA 3GVIA 4L4XA 2DXIA 1TCAA 4QULA 3MJFA 3HEAA 3T7TA 1E2IA 4UM5A 1BD4A 1LPAB 2D7CA 1Z2PX 3F90A 4PANA 3P9RA 2UVPA 1LLUA 2PRKA 3Q88A 4HDNA 5K0FA 2PX4A 2UUBB 1Y63A 3UCFA 2QRPA 3IRVA 1XWFA 1M6WA 3QPUA 3KTAB 2FMIA 4MK4A 4DVJA 1DKRA 2I7XA 3PC8C 3ZGLA 1XNQB