3ED5A

The crystal structure of yfnb from bacillus subtilis subsp. subtilis str. 168
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
232
structure length
232
Chain Sequence
MKRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKPNVPEIIPTYEIRKLEELYHILNIENT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YfnB
total genus 85
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3ed5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ed5A01
3F9RA 4UARA 3N1UA 1O03A 4UMFA 2NO5A 4XPZA 2P27A 3WK4A 2I54A 3PGLA 1RMQA 2JAWA 4DWOA 2GHQA 4JDPA 2CFTA 4FFDA 3N5KA 1TA0A 3ZX5A 1RPZA 5AKEA 5AW1A 5ALSA 1Q92A 4YH1A 3SLRA 4IG4A 3DDHA 1WR8A 1N9KA 4EX6A 1VJRA 4L57A 4BX2A 2HCFA 3P96A 4J2TA 1Z4NA 2PKEA 5AM3A 2C8KA 1Z4IA 3E84A 5AESA 4UU0A 4Y3UA 2MU1A 3DNPA 5AVVA 3ZWKA 3SKXA 1QH9A 3KOOA 3QUTA 4BBJA 5IT0A 5AKKA 1QYIA 2I55A 3KBBA 3WKAA 1ZJJA 3OCVA 4Y2JA 2HO4A 5AIAA 3L1VA 3UMCA 5AM5A 2EAUA 4DW8A 3OTQA 2W4MA 2RAVA 5AW4A 1RLOA 3I1YA 2YFYA 1EK2A 3U7EB 2GO7A 2BY4A 1L8LA 3NRJA 2C9MA 2AGVA 5ALXA 4NAVA 2PR7A 2C8LA 3B8EA 1RKVA 5AKJA 4CF5A 5ALRA 2HI0A 5AHXA 5ALPA 4G63A 2WF8A 4OD0A 5ALJA 5AM1A 1NNLA 2W11A 3D6JA 3KDPA 3AR8A 4F72A 3FPBA 5A3RA 2YN4A 2PQ0A 2WF5A 1T5SA 3WGVA 5AVRA 5AVYA 1YNSA 4BEVA 3TLMA 3QGMA 3WKDA 2AUTA 1QQ7A 1Z5UA 2JAOA 3ZVLA 2YJ5A 4BEWA 2B1QA 2G80A 2IOHA 3ONNA 2YY6A 4Y2YA 2MSNA 1LTQA 4EZEA 4HGNA 1Z4MA 3FM9A 3MMZA 4CNQA 4RETA 3L8GA 4GIBA 4HGQA 3EWIA 3L7YA 2G08A 1YJ5A 3WK8A 3BA6A 4FYPA 3WKCA 3QYPA 1T5TA 3HYCA 1U02A 5FP0A 4L6CA 1L6RA 1Y8AA 3AR2A 4J03A 4XOUA 4HAIA 3A1DA 2WFAA 3N28A 3OCUA 1ZD3A 5AI9A 3QU4A 4UASA 3L1UA 3AR6A 3FGOA 3NANA 3AR7A 2MU2A 1ZRNA 2HOQA 3QUQA 2HHLA 3QU9A 4YCMA 1Z88A 2HSZA 5ALNA 2IOFA 2FUEA 3WK7A 3ZUPA 3U7GA 3A3YA 1RMTA 5AW0A 1SU4A 1Z4KA 2C88A 2GMWA 3WK6A 3I6BA 4UMEA 2B8JA 5AK4A 3SF0A 1S2OA 4JB3A 2HX1A 1RMYA 2Q5EA 2BDEA 4YIHA 1Z5GA 3ESQA 1NF2A 3FVVA 5AW7A 3QUBA 3ET4A 2NYVA 3AR9A 4XE5A 3W5AA 1QQ6A 5AKIA 4PNHA 1TE2A 2QLTA 4Y2TA 1MH9A 2OYCA 2I34A 4L6AA 3NIWA 3E58A 5ALIA 2B0CA 4QQFA 3E81A 1ZRMA 3M1YA 4YCLA 3HLTA 4UAUA 2YMPA 1Z4LA 4AP9A 5AICA 2YJ3A 2WF9A 2OA0A 2YMQA 5AI4A 3L8EA 1CR6A 3BWVA 5AW6A 2ZBFA 5ALQA 5ALWA 2R8XA 4I9GA 1RKQA 4HGPA 3SHQA 1Z4JA 3QU7A 2AMYA 2ODAA 3SKYA 2O9JA 2RB5A 3EPRA 3AR3A 5IS2A 4Y2SA 4CF4A 1J8DA 2HF7A 2FPSA 1TJ4A 1YS9A 3I28A 3FZQA 3NALA 1VJ5A 3RFUA 4UAVA 3NUQA 2OBBA 4HGRA 3L5KA 2Q4TA 5ALYA 3ET5A 1X42A 4ZEWA 4QJBA 4BNDA 3S6JA 3MPOA 2QYHA 2R8EA 3NASA 4GXTA 4E88A 1XP5A 5AVXA 4CF3A 2YJ4A 1U2TA 4Y2UA 3EF0A 5ALGA 1L8OA 1L7PA 5ALDA 2IOFK 2P9JA 1ZD5A 2WHEA 1IWOA 5AK3A 2WM8A 5AW3A 4C4RA 2IYEA 3OCXA 1U7OA 2G09A 4NABA 2WF7A 2B1RA 2RARA 4EX7A 2I6XA 3U26A 5ALEA 2GHTA 4IFTA 2W43A 1T9ZA 2FUCA 3IB6A 5AVUA 3DV9A 3A1CA 3ZWDA 1YMQA 3A1EA 2HEGA 5AI8A 5ALFA 3PGVA 3MN1A 4NV0A 3SMVA 3ZW7A 3CNHA 2VKQA 5E0OA 4MUMA 1QQ5A 1NRWA 1RC8A 5ALUA 2I7DA 2R8ZA 5AI6A 5ALZA 1Z4QA 3B9RA 3N07A 3ED5A 3WKEA 1SWWA 3WGUA 1L7OA 3EF1A 5ALMA 3SD7A 3UMBA 2ZG6A 2AH5A 1LVHA 4Y2PA 2D2VA 5ALKA 4BYGA 3OCYA 2G1AA 2BDUA 3ZU6A 3QX7A 3M9LA 4FE3A 2HF2A 2CN1A 2FPUA 4UW9A 1L7MA 1WPGA 4NWIA 2B82A 1FEZA 4KNWA 4KNVA 4MWOA 2FI1A 3OCWA 1RLTA 3KC2A 1J97A 2ZBDA 3ZVNA 4DCCA 1VFPA 3L8HA 4KX5A 5AKZA 3PDWA 3QXGA 3GYGA 5IT4A 3MC1A 2O2XA 5AVQA 2IA5A 1YDFA 2YBDA 4Y2VA 1JUDA 3U7HB 5AVTA 1L7NA 3K1ZA 4KN8A 1PW5A 4OCZA 3N8GA 5JJBA 2ZBGA 3OCZA 2X4DA 3R4CA 3QLEA 1TJ5A 3ZTWA 4O8CA 1U2SA 3VAYA 2YJ6A 4CE6A 3QUCA 2B30A 3PCTA 4G9BA 1RQLA 4BNDB 3L0YA 2WF6A 3OPXA 4KX3A 2I33A 1Z4OA 4I9FA 4UM5A 5AI5A 1K1EA 3NAMA 3ZI4A 2YMMA 1RDFA 1AQ6A 4Y2XA 2FPXA 5AKGA 2CFSA 5ALLA 2G07A 2OM6A 4UMDA 4HGOA 2B8EA 5ALOA 5AKYA 3RF6A 1ZD4A 4NFLA 4UATA 5AI0A 1N8NA 3ESRA 3AR5A 3UMGA 2FDRA 4AS3A 1XPJA 2EATA 3WKBA 1TJ3A 4YGYA 4YCNA 4KYTA 2EARA 2CFRA 4RESA 4YIKA 3W5CA 3UM9A 5AW8A 4OFZA 2R8YA 3L8FA 3ZVMA 5AM0A 4DFDA 2JARA 3R09A 1ZOLA 5ALTA 5AKLA 4BX0A 2ZXEA 5A3SA 4AS2A 4EELA 4UM7A 5AVZA 4C4SA 4BX3A 3U19A 5ALVA 1U7PA 1YV9A 3L0BA 1XVIA 1SWVA 3CZ4A 3QU5A 2FEAA 3FPSA 4C4TA 5AKXA 4EENA 2P11A 4B6JA 1RQNA 2HDOA 3WK5A 2ZBEA 5AIBA 2FPRA 3AR4A 4XQ0A 2FPWA 1WZCA 1CQZA 4EEKA 2JGAA 5AVSA 4HYTA 3ZX4A 3DAOA 4BKMA 1F5SA 4Y2QA 3U13A 4Y2RA 2NO4A 3W5BA 2G06A 2ZOSA 5AM4A 4ZEVA 3B9BA 5AVWA 2C4NA 3IJ5A 2YMLA 1RLMA 4ZEXA 2GFHA 1Q91A 3QU2A 4F71A 2JAUA 1RKUA 3IRUA 3I76A 5ALHA 5AK6A 1ZD2P 3QNMA 2RBKA 3U7FB 1EK1A 1KYTA 4H1WA 4OHFA 3W5DA 1Z4PX 3J7TA 3ZTYA 3KZXA 5AW9A 1WVIA 1S8OA 2Q4RA 5AKHA 5AW2A 5AK5A 5AM2A 3L0CA 3KD3A 5AW5A 2G0AA 4UU1A 2DQSA 2P69A 3E8MA 5T41A 5A3QA 3WK9A 1O08A 3R9KA 1ZS9A 4UMVA 1RRCA
chains in the Genus database with same CATH superfamily
4HN4B 1XLTA 1IUNA 8ICEA 1TZMA 3IP5A 1G6OA 2Q3CA 5CLIA 3PMNA 3ACBA 1UXIA 3N1UA 4G81A 4II7A 1PJBA 2QT1A 3LXXA 1QHXA 2Q2NA 3W05A 5BW5A 1RJ9A 4F5OA 3B1WA 3CZCA 1ESCA 1P77A 4HPWA 2XUFA 4IVRA 4R41A 1RMQA 4HXEB 1O6CA 3S2YA 1B8UA 1R27A 2GHQA 2QD4A 3AL2A 3WXBA 3ZS8A 4E12A 5J4HA 3GT4A 3PE3A 4FDLA 3RAQA 4CJXA 1MO5A 4B3GA 3LSYA 2QL6A 5JI3E 3MTDA 1NP7A 1MEJA 4C7YA 3UK7A 1VPWA 3COPA 2OD2A 2WSBA 2PMWB 3M6MD 1JA0A 3LE8A 4YH1A 2C58A 3MTBA 2FGJA 3BXPA 3HP4A 4BXOA 4RY8A 1ZYQA 1BXGB 1T9GS 1L1FA 3H18A 3AQEA 1Q3UA 1D0VA 4GXNA 2QE6A 3BEOA 2HXSA 3GLHE 1H2EA 2QMOA 2Q41A 3ZD8A 1T6NA 2OGZA 4LPKA 5AK0A 4F9GA 4KLMA 4LJ6A 3PC2A 1JA1A 2Y93A 2QRGA 1E2GA 2YIMA 4FHCA 2PKEA 2XXBA 4DXDA 1KK1A 2GAOA 4HDAA 1N0HA 4C89A 5DLFA 1AS0A 4WJKB 3THRA 5A9SB 2CXNA 2YWBA 2A9PA 2B2CA 3VSAA 4B09A 2VSFA 1Z8DA 3HFGA 3QEMA 1JU4A 3TW6A 2MSWA 2VANA 4TS1A 4CPDA 4Q45A 1K7CA 3QVUA 3DNPA 3IT0A 3ZCXA 2P62A 5IJXA 2DBYA 4TXJA 1KO4A 1Y6JA 4FZJA 1AA6A 3QPVA 4XGNA 4QT4A 1CQJA 2EEZA 3KTQA 1UK7A 2K89A 1VBKA 3WKAA 1EM8A 1KIFA 3LT1A 3PD7A 4J0IA 5EKXA 1HR0B 1QWOA 2PZLA 4FB5A 1U9JA 3T3OA 2JLQA 3FZNA 4HAVA 1Z56C 3LP6A 4HJRA 2YZ7A 1HORA 1M7HA 3G89A 3FUCA 1KETA 1L4GA 1YL6A 2HSGA 2PEZA 2VHVA 1ABEA 3F5QA 4G0ZA 1JIUA 1IN7A 4KN6A 5CP8A 1Z3CA 3GROA 1SRRA 3SPXA 4JYPA 4LRTB 1SXPA 2Q3HA 4MPJA 1JSCA 3DFIA 4F9TA 4ZVUA 4GR5A 5JD6A 1UDRA 1VP9A 2IU0A 3M2TA 3RH0A 4L5JA 2C9MA 1JYSA 3K9LA 3NOQA 3DKVA 4KLJA 1DO0A 1E63A 1EM8B 2AEFA 2AXEA 1FFBA 1YA8A 2N1BA 3G0DA 2XDWA 3GGGA 3TIGA 4YDRA 3TMYA 3HKEB 4FPXA 3F3SA 5IABA 4DV7B 1UZLA 1TQ6A 3AFMA 2BPOA 2E1FA 1ADBA 5GONF 4QTUB 1DKUA 3OJOA 4JQCA 2BEVB 3K9HA 1HETA 5LYJF 1SXJB 2W2VA 3O7MA 1ZD8A 3KYCB 1X6IA 5I7FA 4JUZA 1PGQA 2P6PA 4FYJA 5GZ6A 1T5SA 4R1PA 2RHCA 3PVSA 4RA6B 3I04A 4UVGA 1E9VA 2OG2A 4WK0B 5COQA 5EP3A 4C7BA 2ODEA 1MB3A 2VP9A 1LPSA 1S97A 4FMBB 3MT0A 1GY8A 3ZVLA 4LJYA 1PRYA 2B1QA 4ENSA 2C3YA 2FH5B 2WT9A 4DV4B 4AICA 1LFAA 3GGJA 1RJDA 1PEAA 1WUYA 2REQA 3GRZA 1LPOA 2WVJA 3DYBA 3G88A 4L5CA 4NH4A 4QW8A 4NS4A 4X44A 1OYVA 4C0KA 4M6WB 2LKYA 4L85A 1ODTC 1EMDA 5ESWA 1G60A 2QM8A 3BHNA 5BSEA 2OCGA 3FHTA 1YQGA 2Z7JA 1N8SA 3P8ZA 2QJOA 1EGAA 1I80A 3LPAA 4DIUA 1O58A 5DB6A 4FR2A 4G26A 4R64A 5JLAA 4EB6A 1TQ4A 1JMSA 1XXLA 1T26A 2DE0X 2EYUA 2QQEA 2Z3ZA 2AXTU 2GCNA 3UTCA 1HRDA 4I55B 3VISA 3WMRA 3N7TA 2IS2A 4WUTA 3GXOA 3PD1A 2IHNA 3LVFO 4JWMA 4QOHA 3EG9A 2ERYA 4M0LA 2ZI3A 1INLA 1MQ9A 1UJCA 4YLGA 4S1WA 1AN9A 1JQ5A 3CIFA 3GJZA 4UXJA 4Z7OB 4TKLA 3ZK9A 4XLTA 4RIHA 2AEJA 2V98A 1SR8A 1A4XA 2GEFA 3CC8A 2D0PB 4MDYA 5DGCA 4LSZA 1TKRA 2WKWA 4OX9Y 1FSPA 3HEMA 2KG5A 3OE1A 2H29A 1PGJA 3D3JA 3AR6A 3DBHA 4OJTA 5HCUA 1WZNA 2ZJAA 4QA9A 1R8QA 1L4UA 1QC5B 1L5HA 4DCPA 4MWGA 1BWSA 2H4ZA 2PGAA 1CY6A 5CU7A 3L3FX 1B74A 5KNCA 4EQ6A 4ZHSA 3OZDA 3ANYB 3Q7RA 2IOFA 4FEGA 4PZCA 3FCEA 5I8PA 4G07A 4L6IA 2VPTA 4M98A 5ICMA 4RIFA 5DISB 5CITA 4YNBA 2H4FA 5T8KC 1ZN2A 1UP4A 2HK9A 3UGQA 1PSWA 4L9RA 1I7QB 2I2XB 5CFNA 3G85A 1IBCA 2GN6A 4REMA 4O4JF 4TL7A 4A27A 2J6TA 2BKVA 1CRQA 1XF9A 5CIQA 4JXKA 4BYMA 1NVVR 3A9VA 2VL7A 4R9UC 4YIHA 3RVSA 3TNJA 3KFUF 1A0OA 1NF2A 1ONSA 2XAAA 4MGZR 4DLVA 1E2LA 1RPJA 2J3LA 4W1PA 4DA6A 4IIVA 2HCRA 4OMDA 1EAYA 4QOIA 1RHJA 1PV4A 3ASVA 1Q57A 2I6FA 1T24A 3G8AA 2ZP1A 3HP7A 4HFJA 2VF4X 5FAKA 1HDOA 3E81A 4QYIA 3HCOA 4QWMA 4BJ3A 2C29D 4YCLA 2FFHA 2ZYVX 1V41E 1VSTA 3K1AA 4N5HX 5LP1A 4I2BA 5CVDA 1OF1A 2VPZA 3AW8A 2HRQA 9ICKA 1GDTA 3WZLA 4KO4S 1E6KA 2PO5A 3UJDA 1L7QA 4KUEA 3OJUA 4R1MA 5EHZA 1Z2CA 1OI7A 1ZUNA 1E2PA 2XKJE 2ZZKA 2NSYA 5FQNA 4HNGA 5TQ2B 4ARSA 4LF8B 1J00A 1N75A 2YMQA 2XF2A 3EDRA 2PBLA 4RD1A 4BKOA 3B48A 2ONYA 3LVRE 1T5HX 3FZGA 2QLLA 1S6YA 2ORED 2PZ8A 3O4FA 2CC2A 2VHEA 4W5JA 3W6UA 4C76A 3X1WA 3ZW9A 3PO4A 3KXPA 1TDJA 4EUSA 2JK1A 3E2IA 4BZWA 4KR2A 4KQHA 1N48A 2MIIA 2ZIAA 2IV7A 4AYXA 3C2QA 4RBNA 1KVRA 4RABA 1K3TA 2V7TA 4HV4A 3D0OA 4WJLA 2V1XA 4CYMA 2H3EA 5DBOA 2PQ6A 2WNIA 5F4BA 4EKEA 1P7DA 3SE0A 4KIUA 2AN9A 3N05A 3GFGA 4HCJA 5DI9A 1YH3A 1N9GA 1XUOA 1Z6ZA 4UPVA 2QXUA 3IV7A 5AW0A 1D4AA 4KLRA 3ZIDA 3U4QB 1M2NA 1NVTA 3TTXA 1QM5A 1ZNQO 1XP5A 2XBLA 4ZVVA 4BAUA 1JEEA 3ROMA 1YCHA 3AKZA 2W7TA 2XVTA 1HOTA 1TVMA 3DEZA 1GNRA 1SPXA 4HYEA 2O2HA 2PZJA 4OBEA 2BGUA 2P9JA 1NXTA 5K0EA 2NXWA 2NVUB 5LQMA 3GNQA 2GLTA 4PPYA 5JVDF 5KDOA 3SR6A 5FEMA 1PJTA 3U1VA 5FTWA 2P3OA 2O8FA 1LKYB 1VBFA 2E6UX 2NZWA 1S3SA 2F2TA 2PSDA 2EQYA 4BVAA 4KLTA 1R0SA 4CZ2A 1G17A 2GETA 3B2NA 5L3SA 2H1HA 3PNYA 1OT5A 2H1CA 4EO9A 3M7DA 3IDQA 3QE0A 2HQ1A 4ZOLA 1HUQA 1QGOA 1LBSA 3GWZA 5K6AA 4MICA 1RHRA 3I5UA 4DE5A 1U0HC 3F0TA 5AVUA 4UHCA 1CJBA 2C2BA 3UJ7A 3ZDZB 5CRXA 4PPXA 4IR7A 2EZ8A 3WIVA 5AI8A 1NE2A 1XEWX 3KOYA 2VG8A 3JR3A 2XUIA 5B7QA 4G0MA 5K0TA 1G2OA 3DFUA 1SIWA 5E0OA 3TAUA 4D2IA 1IM4A 1EXWA 2G72A 3LQ2A 4MUMA 5ULLA 1E4EA 1NRWA 2ODBA 3LF1A 5ALUA 1EX7A 2NPFA 3UZUA 2NWQA 1ULAA 3ESDA 2BYTA 1RYRA 4TLLB 1KDZA 1L7DA 1Z4QA 4JMUA 3GCZA 3NJ4A 2Z8XA 3I39X 3KDSE 4L07A 1KH1A 3IKJA 4D4IA 4RHFA 2E5FA 3WWPA 2Y1KA 3C7CB 3REQB 3KZIU 2G76A 3UMBA 1DGQA 3PNCA 3IAUA 1F38A 4CRWB 2AH5A 3C1YA 4IDCA 2B37A 3TMKA 4AF7A 4EEXA 1WCIA 1A8QA 1QDEA 5K1ZA 2L82A 2ON6A 1U80A 3OHBA 3E48A 3I9JA 4IVPA 3S8YA 3CRZA 2F43A 5HHIA 2ECPA 2G1UA 5DMHA 1H1LA 4OHXA 4QJ3A 1KGSA 2J87A 4KOEC 1JG1A 1S0UA 5IASA 1E6UA 2XT9A 2Q2QA 1HPLA 4D5GA 3IUPA 3ELWA 3OZBA 1LI7A 4F2RA 1TZCA 3C15C 3UH0A 1A9QA 1RAIA 2Q9AA 4CCYB 1NVWQ 4LYHA 3CW9A 4P36A 3TK1A 4FUQA 3ZJVA 1T2NA 3CVWA 3VC7A 1L5HB 3GA0A 1J97A 4NYIR 1LLFA 3ZVNA 2VJOA 4HX9A 1XAGA 2O7SA 4JJAA 4ABTA 1GKIA 1W5BA 4YUYA 3IKMB 1PR1A 2HWXA 4PYRA 1RPLA 1VCOA 3CF0A 4GSKA 1QF9A 3H2KA 4Y9UA 5KWJA 2JLVA 5IU6A 2IA5A 3AESB 3CZMA 4ZYWA 1W7AA 1EEHA 3EVZA 5JAIA 1SKAA 1BO6A 3C41J 3PL5A 1U5BB 2HJHA 2VDUE 3SZLA 4UOEA 3CH5A 3F2IA 4AJKA 4EM6A 4UHEA 4H3VA 3QY9A 1F0PA 2XV1A 2ZQZA 5L53A 3LX5A 1O5TA 3C5CA 1NP3A 4R0VA 1UEXC 1T6ZA 5FUYA 3AL0C 1VKJA 3ZK7A 4BB9A 4H17A 1C8LA 1Z47A 1RD4A 2JZOA 2VJLA 4R9VA 5DHFA 3WMEA 4P7GA 4OHOA 1D2HA 4N8DA 5FFMA 5KCMA 3HJRA 2QROA 2B30A 2GAAA 4G9BA 4FXPA 4MFCA 4I55A 3WL5A 4YI3A 1PZFA 1KMHA 3VR3D 4JKIA 2RHOA 1NWHA 1OV4A 3E0FA 4HXGA 1II0A 3ZNQA 2EP5A 5HJ2A 4UHHA 3PD0A 2QUKA 2QL5A 4FWIB 2C2RA 1CS0B 4P4SA 2I33A 4KQMA 4NPCA 1CSEE 3LNTA 1DVRA 1T7PA 3HT3A 5KYGA 4TMKA 3WDLA 4RK0A 3ER8A 1BTOA 2XB4A 4O4JB 4TSKA 2YMMA 4UJ3A 2DBQA 1EE1A 2JEOA 1SGWA 3E7DA 3AIIA 1ZVQA 1NNI1 2ZTDA 3NT4A 4QWBA 2Z5FA 2AQHA 4NH0A 5LWQA 4X24A 1YRWA 1T1GA 2G07A 2O5RA 3QOFA 4RQ7A 1E98A 1T0UA 4PZEA 3R7AA 4B0PA 2Q1XA 1KAHA 4C4YA 5MN5A 1C3VA 2KSOA 4KLLA 4KC0A 1T5OA 5CVVA 4QZBA 2XT6A 2IH5A 2V9ZA 3FIUA 4B5KA 4Y6RA 4ESOA 3I45A 2VN8A 5AKYA 1EVQA 3I01A 4TV8A 4ZP1A 5TIIA 4D8XA 1FP4B 5ER6A 3OSZA 6CHYA 1V7QA 2FKNA 4L50A 4UATA 4O4JA 5CUQA 5LYYA 3I5AA 3A9RA 4PN3A 4JYZA 4HP8A 2QN8A 2XXJA 2J9XB 4NDZA 4WOCA 4AS3A 1XPJA 2V7EA 1JI7A 3N58A 1VDZA 1QORA 3WMFA 4RO0A 4AY4A 1GEEA 5A4AA 4DFKA 3SVTA 2XMBA 4HSEA 2ZTUA 3WNZA 4OA5A 5JLJA 4D26A 2IX9A 3OZ7A 3V8EA 4Y67A 4QL3A 4GEKA 3BVPA 4GF5A 3IM1A 2QTBA 1XK6A 5IAJA 3P97A 4ZU1X 1ZH8A 2OTCA 2O59A 1ZSNA 4XR9A 2ZRBA 4EGSA 3R09A 1M2GA 4RU9A 1Q0SA 4F8RA 1T5IA 2HO5A 3A1UA 3DWGA 4C3OB 5DRYA 2NSDA 2D4AA 5DXFA 4Q6BA 1P61B 3EGXB 1U0FA 2C4WA 3M82A 4ACAA 4DLPA 3DTVA 5B3JA 1JMKC 4QWEA 1NPDA 1QV9A 3TJZA 1L3TA 1VMIA 1PV1A 3DOUA 3G2IA 5JAMA 4OGWA 1G1MA 5L1IA 5BR1A 3TB6A 1Z7EA 5D84A 2ZJ5A 3FTEA 1EWYA 3F78A 3NBYC 4QGSA 2WFMA 1LXCA 1GGNA 2C59A 2B4YA 3A25A 3ABSB 3B6EA 3A3PA 1AA9A 3NT5A 3OEWA 3FOZA 2JBHA 3OU7A 3ZXUB 1DAIA 1NBWB 2DGDA 4PLCA 1R3UA 2Y0SF 1ZINA 3N6XA 4OJLA 1BXGA 1JNXX 2C7GA 1LA2A 1U1CA 2VJDA 3EFOA 4ND6A 3TDKA 5KFKA 2FMKA 2R85A 4EEKA 2AZTA 3Q8SB 5FLEX 2LM1A 3LCUA 3CX8A 4HYTA 5A1TA 1PDVA 3RUDA 1LBIA 4DMLA 2C61A 3USCS 4EGFA 3OT4A 1F5SA 4IIUA 1N8KA 1U1EA 4UOQA 1BA2A 3VDXA 1VJ0A 1ICIA 4XVUA 4ZYVA 2EZ4A 4F92B 2QAGA 1M2OB 1ZFNA 2IUSA 1DTWA 4XWAA 5AM4A 5FO1A 2IEBA 5A4MS 2HGSA 3QIVA 4JI4B 4BGVA 1XZBA 1R4NA 4V38A 2YVLA 2LM4A 1V3UA 2XX3A 3T7RA 2JDIA 4USAA 2R1TB 1I51A 4IIJB 5JSKA 4PEVA 4UE3S 5B3KA 1WCLA 1CEQA 2DPYA 2VI5A 4UBMA 5EFOA 4WK2B 2JCBA 3S2FA 3LCRA 5ALHA 2G6TA 1DEKA 4KO8A 3EGWA 4LF5B 4FHEA 2ATEA 1E9SA 1HA3A 3A28A 3AG6A 4HQNA 2ZWPA 4IUYA 1NK0A 4YN3A 4PJ0U 2HNBA 4GECA 2ZAGA 3VH4A 2BTEA 2ZUUA 3IULA 1JJVA 4Q4LA 4PX2A 3QF7A 3DBVO 1C7QA 1HURA 2ZRIA 4N01A 3VZBA 2VP2A 4DUPA 2FHPA 5CVJA 4LFBB 4WE3A 2DFLA 1NV8A 3GJSA 1EJ6A 2DQSA 3T0FA 2WA2A 8ICBA 2D0OB 2UKDA 3A11A 4RTOA 1I24A 5HX7A 3RJHA 3LYSA 9ICJA 1W5FA 2G0TA 3C87A 1QX4A 3M6KA 3OLZA 4V0NA 1NDQA 5E3JA 4U3JA 2CNDA 5FX2A 3A6PC 2CMFA 4TVKA 4W9NC 5E0KB 2XMZA 3SQWA 1TK2A 1B6TA 3CF6R 2BGGA 4JCCA 3K2QA 1J8QA 2WJIA 4L4XA 1FNNA 1H05A 2TYSB 5E1OA 3CZPA 5KX5B 2D0IA 3L06A 4LC9A 4ZU6X 4EFDA 4WV3A 4ARZA 3G2JA 4QHTA 1R00A 2QW0X 1CUBA 4MKHA 1FL9A 4MPDA 4P4TA 3X44A 3K0CA 1LRJA 3AI3A 4DQ0A 4H4CA 1I7LA 1TA0A 5CFMA 2ZYTX 1A69A 1P91A 4GBGA 3DHEA 2JFGA 2OORA 1FU7A 4Y0VA 4E21A 5F3XB 1SUFA 1Q0ZA 3I1FA 1W5AA 5FTJA 2BGKA 3IDFA 1CQIA 3B20A 1SEVA 2ZJ2A 2EHJA 5EL0A 3EPHA 1T4CA 4AN1A 1YKSA 1NI5A 2HU5A 4EY3A 4K6MA 4BRSA 1P1FA 3KYJB 1HNNA 2EP7A 2AFRA 2FWPA 4HMOA 2AQ4A 2B3TA 2QA5A 3FHLA 4LDJA 2PLAA 4YACA 4HLCA 1GP2A 1M6EX 2JH1A 2YVQA 4ZQBA 1I2MA 5CA1F 3ANXA 1UM9A 5C52B 5JU5A 4QOEA 5IIJA 1ZVVA 5DGAA 3KAPA 2W71A 1ZUWA 3OU6A 2UAGA 3R23A 4IIFA 1E5DA 2I6QA 2YINC 3C5WP 3LD9A 4V2UA 1JPJA 2EGHA 2C2HA 1SC1A 4FYHA 1DT3A 1JQBA 2VCEA 1TYBE 1I3NA 1ZESA 2H2DA 1Z0KA 1H38A 3PUKA 621PA 2GF0A 5EJ5A 3OPMA 3WIDA 4AROA 5K01A 1CJSA 4R2IA 4L02A 3ZJYA 2A0KA 3E23A 1V6SA 2GVDC 4Z0NA 3TCNA 4Y2JA 2Y92A 3JARB 4P7FA 5F2OA 2HO4A 2Q1WA 1CLUA 4CEHA 4I2NA 2XNJA 2ZWIA 4F86A 4JV5B 4P0TA 2FFRA 4LSWA 2J33A 3C5EA 3M1LA 1APBA 2J3HA 3RGWS 1YI8A 4NKRA 2Q3MA 1I7SB 3ZWBA 3IESA 4EDHA 3UUFA 3OZEA 2N0SA 2FPIA 2YYSA 1YQ9A 3B1JA 3I9MA 3EYWA 4ZC1A 2P9HA 2UDPA 3KUCA 4JVMA 1WCNA 3ZHUA 1QTIA 1YVEI 1IAVA 1XN1A 2P6MA 1M2WA 2AN1A 3B5EA 2YWEA 3EE6A 2P0AA 1VC2A 4M53A 4RK7A 3UCXA 5EINA 1PR0A 3GFKB 2FK7A 5B5EU 2JAHA 1OXJA 1UBSB 1GITA 1S4MA 1WSWA 4CDGA 1RKVA 3DM9B 2YL2A 1C7YA 1XCJA 3Q2IA 2O0KA 3QELB 2FN9A 4O1MA 3SVLA 4YVFA 2NO1A 1DIBA 1P5RA 4RKWA 1PZEA 1Q5PA 2B7CA 3O84A 5BY2A 1DSSG 1K2VN 2SECE 1IUOA 5GVRA 2QDKA 3AB8A 1ULZA 1Z0ZA 3MUOA 3U4CA 3VYWA 1HLDA 3GQCA 1VE1A 2P77A 5ICSA 1HNZB 4J8PA 1Q12A 3TLMA 4PINA 5IDQA 3T5TA 2NP6A 3BGDA 1M3SA 3IAS1 1U3UA 5KYUA 4ND8A 1U7XA 2UZ0A 5HTKA 3HRDD 4MOWA 4RW0A 1EU1A 2VT7A 3PWKA 2FZLA 3CG4A 3MCUA 5CHYA 1P45A 4HNHA 2B36A 5GOTA 1LV7A 2FZWA 2O8VA 3QOWA 5ITZB 2MSNA 4X7BA 3WV4A 4BDTA 3S28A 1OXBB 1AM4D 2FZ4A 1NM5C 3K1RB 3HABA 5DQIA 3KYCA 4D6PA 4XRGA 4RFSA 4UB8U 5JSZA 2G17A 3PTZA 3PQ7A 1ORRA 4TOIA 2KHZA 2Z3WA 5EE1A 4OXKA 4RETA 3TLGA 5HIKA 1HT1E 4IJKA 3KXIA 3FOAA 2ODNA 3HNOA 4XFJA 2ID9A 3BWXA 3BA6A 1UWKA 3QVTA 4TUYA 3RG8A 3VR2D 3K6JA 2O4UX 5DI3B 4UJ5A 4ZA2A 3VBCA 4WDRA 3P9ZA 1XLTC 3FSRA 3HYCA 3F5EA 5IJ0B 4DR3B 1KPIA 1PFGA 2ZVQX 5BMVF 4K6CA 3OEHD 2V0NA 4WBNF 2DFNA 4FGJA 4F5YA 5IC4A 1EYZA 4MQEA 3UHJA 3ALRA 4Z7QB 1DBPA 3N97B 4Q1EA 2YXNA 1XTZA 3OCUA 3ZGNA 3L7IA 4YD2A 4DLLA 4M9GA 2C07A 1XI2A 5HA5A 4XB1A 3OAAA 4DQVA 3CVUA 1CXZA 4NLKA 1I3KA 4TWRA 1HTBA 1YBHA 5BNFA 3PNVA 3QE2A 5IRCD 2R751 3UHFA 1L9KA 3WWDA 3R8CA 4URVR 4TWIA 2HSZA 4ZCIA 3J81A 1I14A 3JALB 5A71A 5KC9A 3U7GA 3FC4A 3IPRA 2H4JA 2NPIA 4GGOA 3E5NA 2HU7A 3ELUA 4E7OA 1IK4A 4U7PB 2HPZA 3RTGA 4CEJB 1XN4A 2G5TA 4BAZA 4DIMA 5JQGA 1O9HA 3AHGA 5EIBD 4AUMA 4PO1A 3KB1A 3SF0A 3K70D 2PX3A 3H2JA 3R6WA 4R7ZA 4PM4A 4E09A 1CTQA 4OJNA 3QLTA 1V5GA 1X6JA 3C4QA 4HH4A 4U3JB 4X00A 2QWXA 3LA6A 3TVTA 1KY5A 2K2QB 3DFKA 3WRVA 4PZOA 2WNSA 3TQCA 2QI9F 2LRHA 2I3AA 3LQFA 4BP1A 3TG2A 4KXQA 3HJUA 4WZBA 3ZWWA 5DNCA 2BL4A 2ASJA 1Y3BE 4CU5A 4MQFB 5LYJA 1UJBA 4QQFA 4CQMA 3K70B 1CERA 4LKRA 1E1QA 3LKZA 3MW8A 5FULA 1OIXA 2NV2B 3C85A 4FNOA 3D3NA 1R0BA 1Z75A 2DWUA 2H08A 4P4NA 4TTJA 4K88A 2I80A 3WGZA 2VSYA 1LLDA 1P0MA 1RQPA 3N76A 3LBHA 5FR2A 1WLSA 4P7JA 1GPLA 1ZN7A 3ZJUA 1ACMA 1G64A 2O0JA 2YOFA 4B43A 2LDBA 4JN6B 5H9VA 4GE3A 2LDXA 3ETLA 2G70A 3U0VA 3VR2A 4CLDA 5KX5F 4BCCA 1GCGA 3ABOB 4J3FA 4Q43A 2Z1DA 3Q5EA 1Z4JA 1SB9A 2AMYA 3FHJA 3NTOA 5AD1A 1Z16A 3H4VA 4IG9A 3R7WB 4CF4A 4JGGA 4HAXA 3SI7A 3C5VA 2VNIA 2JZBA 3P94A 2BT4A 7ICUA 3CVJA 4IINA 1F0MA 1WUHS 3GAMA 4JJ4A 3V2UA 1GXSA 1VJ5A 1P29A 2NV3A 2A1JB 4R63A 5D85A 4ZAZA 3ZHSA 1BCSA 1DV1A 1V96A 2H8GA 3HBLA 2D62A 3OAAD 4RQ1A 2QM3A 4K0RA 8ICOA 5JCXA 1UPHA 2VJ5A 1VIDA 2PHZA 3O8OA 3KHSA 2COUA 2Q9UA 1LS1A 1GNSA 2I1QA 2AX3A 2PRIA 2OR3A 3TZKA 2ZB7A 4AY6A 3SOZA 2ATLA 3NTLA 2QP4A 4YJ3A 3EPLA 5J2DA 2HKIA 2MAXA 3KYDA 4MULA 1WYGA 1E5QA 1K8QA 1KSFX 1G5FA 2QMQA 3GY0A 3RSFA 3SIRA 1HEKA 1D1TA 1SZPA 1TK8A 1Q7BA 5ICFA 3DG9A 1XXHB 2DL0A 3B52X 2PKWA 5TXGA 3AILA 2H18A 2QXYA 1P2SA 2CXSA 3SS8A 5FOTA 3IX7A 4ASUD 1JX4A 1DRJA 1YAJA 3PW2A 1UXOA 1WMFA 4JV1A 2DMRA 3E18A 3LDHA 4QNMA 3FMFA 5ECYA 5C5IA 1K98A 4PAMA 2BFEB 2B69A 1QFZA 2W8ZA 1WNFA 3H9EO 4RH0A 1H8ED 5K5EA 2F1OA 3HJAA 3M3DA 8ICXA 5KJCA 3SYTA 4A73A 3VSCA 1ECPA 3V55A 1T0BA 4TTQA 4IFTA 4CLOA 1P33A 1RC1A 3KHGA 1T9ZA 2PY6A 2XZTA 3BSFA 3L7AA 4RQUA 4GC6A 3P4XA 3UYLA 4Q7QA 2V6JA 3NATA 1V95A 3B85A 4DYDA 2QZ9A 3IV9A 4QDUA 1OCEA 3BRWD 4Q16A 5CX4A 4GR4A 4JYMA 4YAUA 2PL5A 1WWKA 5A7GA 1ZCAA 3C6QA 2KV2A 4FFBA 2XIDA 5F5XA 3GRKA 5EEGA 4D3YA 1QE5A 4O59O 2YJGA 4YRRA 3AEKB 3CZQA 1RTTA 5KFAA 2D1YA 4BGIA 5C35A 5KNDH 1NJSA 1R6DA 5CR0A 3DAFA 4YMVA 4NCIA 1QHEA 2KVSA 3HB4X 4FBUA 4WASA 4DSOA 4E3WA 3IVAA 9ICUA 5JMTA 2ZXUA 4JODA 3RT7A 2ZYDA 3TAQA 4B3XA 1KL7A 1JMYA 1JDZA 1O3YA 5GTHU 4JEHA 2WE7A 1DRVA 4NYIQ 4CM6A 4EJSA 3ZCRA 4LOJA 5CNKA 2C4UA 4C3VA 1A97A 1R6UA 3C4JA 4IXWA 3TLGB 4RV9A 1OXXK 5JV5A 1IXRC 1TVKA 2WVHA 3M3HA 4MJXA 1XD9A 2A0FA 3K0AB 2QSZA 5B58T 4RTNA 4O5KA 4W7HA 1H2HA 1VA4A 1DAHA 1UQTA 2B20A 3EMKA 3K1JA 3UH1A 4M8SA 3OKPA 2HADA 3D4NA 8MHTA 2PGNA 2HA5A 4HDKB 1ED1A 3RBDA 1T5LA 2V7VA 2WFLB 1N1EA 3W5JA 1KYVA 3IIEA 3MMSA 5EMJA 1UXGA 5C1DA 5HUHA 2PANA 4NX2A 5L6LB 3V80A 3DDZX 1KMNA 5KNDA 3KRTA 3CLUD 2ZM5A 3G9UA 1TEVA 2AYZA 3D02A 1OA0A 3V3TA 3VNSA 1BDJA 4UVDA 1B6RA 2ZJOA 3FX2A 1KYWA 3MT8A 4G0QA 3THWB 3CFYA 1I0ZA 2QR3A 1SM4A 3KBOA 3NC1C 3JPRA 5C81A 5HQ3A 4DMCA 4Q1DA 2ZB8A 1ZVJA 3BF7A 3PQ5A 1FTSA 2WP8J 4MAMA 1FMCA 2R6GA 2ISPA 4AULA 2IHJA 4NNOA 2LNDA 2VHUA 3EVTA 1PS9A 3ID6C 3KDAA 3LECA 4X71A 4BRUA 4QKQA 4X65B 2FUNB 2GD6A 3EGOA 4ODIA 4MQ5A 3MC1A 1XZCA 2ZWOA 4FDMA 4C1BA 1H8EA 5I4KA 1X1QA 1YQTA 3N7UA 2Y68A 4ITVA 1VHTA 1EK5A 1ZQKA 1M2HA 1DARA 4BQOA 3CRRA 4EHBA 1YOBA 4B31A 5AVTA 4OKSA 1DG1G 2GD1O 1FRFS 4XFKA 3QLVA 1EQUA 5CJ7A 1TB4A 1NYQA 4OCZA 3Q8MA 4LMAA 3N8GA 2B2XA 3BAFA 1ZL0A 3ETDA 4UUQA 4B6FA 1F8FA 1HYQA 4EO4A 1TJ5A 5JJBA 3ZTWA 4PZYA 3R5SA 1DDIA 2WNHA 3JVDA 2FZCA 4J0QA 1BGWA 4QVGA 4AJIA 1KMCA 4CE6A 3KEGA 4U0JA 5B1SA 1OUQA 1KTIA 1J5XA 1GUDA 1ZUHA 1RQLA 4G1VA 4PTLA 2CRXA 4CIYA 1N5DA 2VEOA 1Z22A 1D4ZA 1Z8NA 3MOGA 4W5QA 5KQRA 4FQ8A 4JAVC 5DNEA 9ICQA 3H2BA 1G38A 4F2PA 4I9FA 4MUEA 4G8JA 1VE3A 4F9FA 2GWSA 1FDRA 3GLRA 4YAJA 5KFMA 2MYNA 5JSYA 3UUEA 4EKIA 1FPQA 4V39A 1HK7A 2L5YA 1W5TA 1QGYA 1Y4ZA 2OWEA 1W1WA 3DEEA 2G25A 1QVWA 4JIGA 4ZU3A 4JI6B 1KQFA 2YX8A 1TF5A 1MT0A 1GSAA 2WAAA 5HIMA 3WICA 2IYNA 3D5TA 3CS3A 4X93A 1RT9A 4QXPA 3WS7A 1L4BA 2WU8A 4PZLA 5EZSA 3AUYA 4UBNA 3HK2A 2C2DA 3P45A 4GP7A 4CEIB 3EYZA 1M34B 1UZMA 1NYLA 5ALOA 4FYMA 4DR1B 3ZJTA 3S1SA 2VSNA 5A03A 2Q27A 3BJIC 2FR8A 2HCTA 1HL3A 2OV4A 4HRAA 4MPTA 3VUFA 4XUSA 2B4AA 4F91B 1HEYA 2WU4A 1DJOA 5EEHA 4BWMA 1E9AA 5KG0A 1QANA 2W2XA 3GA5A 3OBBA 1KK2A 2Z4SA 3R3YA 4WKPA 4Z4CA 4Z4FA 3WL3A 3JTEA 4LX8A 1VG0B 8ICLA 4MIOA 4GLJA 3OLXA 4QUDA 4DXHA 2FMUA 2GPBA 2YTZA 3AF0A 3IVGA 9LDBA 2QD3A 4Z3DA 4IQUA 1NPTO 2CXHA 4RM2A 1P1KA 4ENUA 1EUZA 3GGPA 4O2AA 4XYBA 5KSWB 1KWKA 3A2MA 3W3AH 1TLTA 4LXHA 3QTTA 3M6AA 9ICWA 2YQEA 4YUXA 5KQLA 1IY1A 3HJNA 1YIDA 4Z7JA 4NXZA 4J1QA 4E07A 5EP2A 1DZIA 3IP9A 2AVNA 1QJ4A 3CLRC 4B5LA 2DERA 3TF5A 4AJ1A 2QU7A 3PJRA 1XPRA 3CWZA 4WZBE 4FMCF 2FN3A 2P2YA 1A5BB 4JA2A 4AF8A 1Q7EA 1PFVA 3HCCA 1DDGA 2JGJA 2W7PA 8ICFA 1ORVA 1Z0JA 3FNEA 3WTBA 2BKUA 4C7XA 3WB0A 1U0LA 4LRQA 3RUFA 3ZY6A 1M2KA 2A35A 1CCWA 1XU4A 1VKZA 1ADGA 3GW8A 3D3QA 5AP9A 3BCUA 1IQUA 1QG0A 1UPAA 2BZ0A 5K8VA 1YJCA 5FWYA 4V2IA 5BV8A 1F48A 3U1TA 3K9FC 3JAKB 1YU6A 2DWOA 2HWWA 3MCTA 4HWTA 4WAUA 1E79D 5IM5A 5LL6P 5EKUA 5KQSA 5KU7A 1ZICA 3R3HA 3UG7A 4JEMA 3T5GA 1UBNA 2OT3B 5JZMA 2W48A 3RFXA 2MYUA 4M1OA 5FWAA 4F2HA 5HMLA 1KDRA 3U31A 2YN0A 2X2EA 3SC2B 4DOCA 5JATA 1IHOA 1SIOA 2CNBA 1T1RA 3HGMA 4QU0A 1PJAA 2ECOA 1K6JA 1THMA 3AFGA 5DTIA 1FMTA 2HMSA 2PKXA 3FFBA 3HWSA 2O8CA 3INNA 1T2UA 1ZR4A 2OPBA 4EG6A 3MINB 1GG5A 1EK1A 2X8JB 1W2WB 2OXOA 3DP9A 3J7TA 2EDAA 3LLMA 3NX4A 2OZPA 1EDZA 2VBIA 2Q4RA 1E58A 1BJKA 3HXLA 5JCOC 3VZDA 2GB4A 5HUJA 4LXXA 1J8MF 4FUTA 2BPFA 5L4LA 3D6HA 3NBQA 1X7HA 2TMGA 3EGXA 1O08A 1PJQA 9GPBA 3IA7A 3TL6A 3IPLA 1M34E 3ZHQA 7MDHA 2H3FA 2VWQA 4ISBA 5CDYA 1B14A 5DLPA 4K9DA 1T9BA 2B6HA 1MB9A 3SOPA 3FWKA 4DSZA 1TEZA 3V7FA 1Y48E 3PSFA 5HG0A 5LBUA 1U31A 1YZHA 4UBOA 4L2IB 3OLYA 4MQBA 4WX2B 5LIPA 3AB7A 3PFHA 2P27A 4UDXX 1N8TA 2BF4A 3R0ZA 5EAIA 4YR9A 2AMFA 1XTKA 5HNKA 1QZTA 4IKPA 3AFHA 2NU8B 5KTRA 1EDBA 2PT6A 3H9UA 3LH5A 3WSTA 5LBIA 2FFJA 3KFVA 2VSOA 4AG5A 4C5CA 4Z1OA 3H40A 1DQPA 1JVNA 1GPKA 3LT2A 1FSFA 1V2GA 3JPOA 2A7QA 2C9DA 2QB0B 3HO6A 3FF4A 2CEAA 4E6PA 4H0CA 1BE0A 1Q0RA 3B6JA 4JJ6A 4BGDA 1R0YA 2PZFA 4GI7A 3N7RC 4I8XA 3OLQA 3FPHA 5L3SB 4GM0A 4PGXA 1XTJA 5KFYA 3EBOA 3ZBUA 4CI0B 3EZXA 3JQDA 4N48A 1FFYA 2QN2A 4MV1A 4QJ5A 2ZVDA 1OFIA 2O07A 3MJHA 2VNJA 4X1YA 4ZZ3A 5THQA 5J2TA 1XTUA 4Q05A 4KRGA 1N5MA 2QUBA 3VGPA 4ZALA 1RRVA 1XEXA 3MM4A 1AHHA 4GYYA 5H0IA 1Z2OX 5ICGA 1QH9A 3A2KA 2FMXA 1OW5A 4G25A 4ETIA 2XCSB 1UDBA 4AY3A 2C2WA 2WVGA 3QFFA 4DSKA 1KZGB 1RLUA 5H83A 4YRLA 3UXHA 3FYUB 1ETUA 1Y63A 2GBLA 1AUVA 1CG6A 1HYGA 4ED7A 2ZITA 1J0EA 5E9AA 3W79A 1FDIA 4WECA 1GCUA 3KU4A 1VLVA 3VSDA 3W9YA 5FKJA 3CLRD 4H3KB 1D2AA 2H9YA 5PGMA 1QU2A 2I78A 3II6X 4MMYB 1EK2A 1YZGA 4GYJA 1B0UA 5J2JA 4OMUA 1SKBA 3L46A 3OHAA 2B94A 2ZPUA 4I9HA 2GEVA 4OP3A 3VTAA 4INZA 2ENWA 2I8CA 3WRYC 4JX8A 1S2IA 1YDEA 2FW1A 4K9SA 5EWMA 3FXAA 5K8IA 2PTGA 2Z6UA 2GZDA 3P9CA 4B4WA 5AKJA 1XNGA 2WJHA 2AHOB 5KG3A 3DZ8A 4OYHA 1V9SA 3RTCA 1ZQFA 4LI3X 3PSIA 2EZTA 3KP1A 4ED1A 1VKOA 3I83A 3O7WA 4FMDF 4RSMA 1OXSC 1QS0B 3OECA 3C4VA 3HJBA 4B79A 4BLOA 4OD0A 1QPZA 2G5GX 2P9CA 3PUXA 1UXKA 1E1LA 4G1EB 1KARA 1JTEA 4RADA 2GZ1A 2WUEA 5DX1A 3IVXA 4ZAGA 5IC6A 3RC1A 1QDLB 1AZLA 4C7ZA 4HY3A 3IAFA 4BEVA 3QGMA 1S2MA 5J29A 1XRLA 2OHVA 4H4DA 1DC8A 3D7KA 2HXYA 1M0WA 3JQGB 4DAOA 4GSYA 2GM9A 4QYXA 4YMLA 5EIFA 4FZNA 3BQ0A 4TUPA 2G80A 2H2IA 3ONNA 1H6CA 2IXBA 2NYAA 3LFHA 2BFDA 1C5KA 1OWLA 2PWZA 3GJRA 4XIYA 3Q8KA 1GO2A 2NOAA 1LTQA 4D4HA 3AHIA 2RI6A 5DWDA 1JG7A 3PP8A 5C8YF 3B5IA 1PJRA 4YXMA 4KQ6A 3AJEA 5J40A 5BWOA 5JFOA 4ZYYA 1ITZA 2XUQA 3DLPX 4EA6A 1Q1GA 3NV7A 5HDQA 4DCGA 3NHPA 1JLSA 2ZAYA 2ZRGA 1UBMS 3DBHB 3K94A 1L7VC 1XQWA 3OBIA 1AGPA 4C2AA 2Y1XA 5EHGA 4ZARA 5BYJA 3TZEA 1NXQA 4OXQA 4BWJA 4OVKA 3WLSA 4LS3A 4WBSA 1H85A 3C3JA 1PR2A 2C2MA 4WEQA 4ZREA 2W00A 4ZHQB 1WM1A 1IBSA 3UEOA 4PZUA 1C0IA 4B9EA 4GQIA 5DSXA 3I23A 4EYOA 4OTZA 3ND5A 1KY3A 2O19A 1OUMA 3JW8A 4HNVA 5IUJC 4PFQA 3C6YA 2A1JA 1NRJB 2FW7A 1J1ZA 3AFNA 3AR2A 2BR4A 3G2MA 4XOUA 3T9DA 3VVBA 1FE8A 5B1YA 1DEAA 4JP3A 4RFSB 4RUKA 5CRIA 2XGGA 2VZ9A 3RNLA 4FN4A 4M9SA 2NV6A 1NHGA 4GPAA 3G2PA 2YICA 2DUMA 4OIMA 3NRZA 1SIBE 4EITA 1GGFA 4C0BA 5K8UA 1UDWA 4B3FX 2AC7A 1OTYA 1ISGA 4MVJA 2LCFA 2FZGA 2NO0A 4UHDA 3U39A 3HJFA 2CXOA 1PLJA 3NT2A 2XMDA 2NZYA 1L5RA 3LUPA 3PGXA 1V71A 3OKFA 1NZDA 1USIA 2ACEA 2PRSA 2QX6A 4BO0A 3E9EA 1BYIA 1Z2NX 3PJFA 1HO3A 3ZD7A 1MOSA 2BI4A 1F0KA 2TECE 3GJ6A 4I5GA 3QVGB 3JQ9C 5IW8A 3MAAC 4G9GA 1RJFA 4GC9A 3TNFA 2VTKA 3UJHA 3BGSA 2APJA 7ICNA 3EZGA 1NIPA 1CQJB 1KI6B 4YRTA 3E15A 1RYHA 5DNYB 1I4EB 3FSGD 3S68A 4OQXA 2XCPA 3W5AA 1DKLA 4ALLA 3FPGA 4N8EA 1N36B 2ZRLA 1E77A 1TPYA 1YHYA 2Y1FA 2Z57A 1Z2DA 2OYCA 1NNSA 4JELA 4ENWA 1SCBA 1IN1A 5G41A 1UAGA 1E1KA 4BC1A 1GFZA 4AQYB 1VLMA 4KLCA 2CNKA 1ZQLA 1E1QD 1W36C 2XHEA 4PBRA 5ITZA 1E0SA 1E8DA 1WDLA 1J5EB 1E4EB 3AQ4A 3V7WA 2O57A 3B9PA 1WSBA 2W6ZA 2ONKA 3D43A 5DVZA 4ECQA 2O05A 3I4CA 2YJ3A 4N12A 4RKRA 3GRVA 1SXJC 3IELA 4IQTA 4LDNA 4P8RA 3A1SA 3IO3A 1NK6A 3L6RA 2X0JA 4YBZA 4E2WA 1NNEA 3DHVA 2WAQF 4BRZA 1Q74A 2JGFA 3NKVA 5J0OA 5FLKA 3KQLA 1C9EA 2V58A 5KG6A 5LQUA 3AR3A 5B3JC 3C3KA 1XAJA 1W2HA 3GC6A 1W44A 1WF6A 2BMJA 1N2EA 1KC3A 3RFUA 3U4MA 1G8FA 1RZVA 1HBJA 2FUG6 4HN2A 4B6PA 3GLFE 2A14A 3DNFA 5JAQA 1WG8A 2V6FA 1YI1A 1MEEA 1E1NA 2BKLA 2I8AA 2MSDB 4FFVA 4B9UA 5GY7A 1E8NA 3VNQA 1IBLB 3MBYA 1KIMA 1JZQA 1UUFA 1XB2A 2JI6A 5GJCA 3S99A 1WB6A 3SYLA 4N8SA 2EWVA 4GXTA 1YE3A 4J4HA 2Z8YA 1VMEA 3DMGA 1ZOIA 2UZ1A 2QTMA 2A94A 4FINA 3N2ZB 5F12A 2FSHA 3NHLA 1O6BA 5F64A 2VDVE 4MLCA 5EQFA 3T35A 2W03A 1KI4A 4L0MA 4PHCA 3VKUA 4CBVA 1Z0AA 4Q39A 3PC4A 5B5SA 2I2DA 3OCXA 2Z1MA 1H1DA 3TADA 1U7OA 1VI6A 3HADA 2RB4A 3FNHA 3JZIA 4KKXB 4QIHA 4V0OA 4DJTA 2PWBA 2WAMA 5J2KA 4MYRA 3NDPA 1R8SA 2C7OA 4HDMB 2XCLA 2RBGA 1Z0UA 3QFTA 4MRVA 4AWAA 2F9LA 1XPOA 1MQ2A 3AW9A 1L5QA 3Q10A 5AVJA 1YMQA 2PT5A 3UC5A 3ZWDA 4DM7A 3PGVA 1Z37A 3CONA 1ZQNA 1P1BA 1B3BA 1TT5B 1VOTA 3AEUB 1NR1A 2ZYRA 3H16A 5LP6B 4KO1S 4NESA 2BBSA 1KBZA 1SIUA 4JL8A 2I7XA 2N3ZA 3VHQA 5JUWA 3HBMA 3EQ6A 3FYUA 3UKJA 1Z5WA 2JH7A 5EE9A 2X4GA 4I29A 3N07A 1XTIA 2YYYA 4LOLA 1E5LA 1LY1A 1Q11A 1X9SA 1M6VA 1L7OA 5DEOA 1VTKA 3K32A 1OFUA 3EULA 2XYRA 2AWNA 2PWYA 3PUWA 4E5VA 3BH6A 4LGMA 4BEBA 1N25A 3C1AA 1TT5A 2JCSA 1FUKA 3FGZA 3RU2A 1DJMA 1NHWA 3C6MA 2B98A 2ZRAA 2E7ZA 3QRWA 1N5XA 1DCMA 3VR5H 1FYDA 4XD7A 4EY8A 4HC4A 1FZQA 3NW9A 3X2SA 4XJVA 2PS9A 5IC5A 2QBYA 2QTRA 2I99A 1ESNA 3CLKA 4H31A 4WESB 3P0IA 5EMKA 1CUGA 3G2KA 3HXPA 5LZ2A 3NAGA 5IVKA 1RYFA 1F9AA 4I8IA 1T1SA 4P2HA 4LA4A 2HF2A 4ECAA 1WTCA 5C2JB 2ZZNA 2O8BB 1H66A 4HB3A 3DBIA 4ROSA 3TW0A 4XYGA 4EI2A 4UNRA 4QQNA 1Z82A 2AYYA 2B8NA 2Z9DA 3THOA 3N0XA 3DVAB 2ZS9A 3AUTA 4WFKA 1PHPA 2QMHA 3KXLA 4LWPA 5DHRA 4KDCA 4KXXA 1BNOA 1C0EA 3V1NA 3IAAA 3U40A 1GPDG 4FHFA 1IXYA 4TLAA 2IEGA 2KP7A 1TCVA 1ZQ1C 2RGXA 3HKCA 3TO5A 1J2YA 1RRGA 2FX3A 3HJGA 2GDZA 4UDNA 1MRZA 5DHAA 1VB3A 3FTQA 2MJLA 3TZHA 4JHLA 2J6UA 3E3AA 4FGWA 4M0KA 3BZKA 5ELMA 1TCCA 1NK4A 1YK1A 4EFKA 2Q6KA 4NE7A 3H9BA 5REQA 1P31A 2F67A 3PNKA 2EQAA 2V59A 3HL0A 4XPIA 3U7HB 2Q07A 2EAOA 2I2AA 2WPNA 2Q29A 2O3TA 2OCEA 3QVGA 4YHBA 2ETXA 4B2YA 2CF5A 3KLMX 1D4FA 3OQJA 4MR8B 3FHCB 4BMDA 3ABZA 3I34X 3RRYA 1KJ9A 4YP5A 3I92A 3KSMA 4M47A 1VKRA 3HO1A 2PAFA 4I5IA 2PG3A 9ATCA 3W2TA 1U4NA 5BXQC 1FU4A 3QOXA 4YRQA 1YS6A 1ZD1A 2I22A 1A77A 2RGBA 3PCTA 4UCQA 1WQ3A 4X8MA 4EOGA 2ZIVB 2F59A 3AVUA 1JTFA 2HC9A 5B53A 1UBTS 1IM2A 1VLHA 1WPRA 2DSNA 1CQPA 2DQKA 2O2YA 3CPJB 4WZAA 3RAPR 5MN4A 1B26A 1B1AA 1IQ0A 4C4XA 4HR7A 3IP8A 4R2HA 3GPLA 2D74A 3CVVA 3GI1A 1S89A 1Y5RA 4NLLA 3HG7A 3QEAZ 1L6IA 1ZUNB 5TQ2A 3LYHA 5J59A 2WJJA 4PZZA 1M1XB 4OGKA 1EPUA 3W8EA 2J85A 1W4CA 1AHNA 4BECA 4UTOA 3QHQA 4GMKA 4QLAA 3UK2A 1RXYA 1U99A 1BPXA 1EQ2A 5JYBA 2JCXA 2CFSA 3ETHA 3OFVA 3QVOA 2XB8A 5CYOA 3ZDQA 1XLWA 4R0NA 1G18A 5BOLA 2QUIA 4BAGA 3LCCA 3QE3A 2A78A 5GOZA 3ZD6A 4EHDA 4D43A 3RRMA 4DL9A 2ERCA 5SV2A 2PZKA 1HSOA 2YZKA 3AVOA 4FZMA 2VWHA 2B9EA 2AN5A 5M29A 5HTOA 4IIDA 3DZHA 3O0FA 1RYSA 1F8GA 2ODQA 2Q5OA 3IKLA 1T4BA 4PO9A 1SU8A 2FQWA 4GL4A 4NIMA 5LA6A 1TCUA 5B7NA 4ND3A 3FY4A 4YUVA 3PPXA 4YR0A 3AR5A 1Y8QB 1H2FA 1HG0A 1MX5A 1Y1TA 2ZK7A 3GEHA 1EH5A 5I8WA 3WYEA 2K60A 3I8SA 1SXJE 1Y3HA 1O94C 1E9RA 3AHDA 1M6VB 3GQVA 3K0EA 3PK0A 4WGGA 2PJRA 2PMDA 2QE7A 3WIEA 4NR0A 5E2AA 3W1EA 4MUJA 4D9CA 3IBSA 4BX0A 1OIWA 2DFKB 4IR1A 1J8YF 2CUTA 1ZQWA 1NJXA 1JLKA 1PQWA 1K63A 3X0DA 4ARBA 4YUZA 3AGQA 2CPRA 3A1VA 4KTVE 1JFFA 1QMPA 4NENB 4PTYA 3D6NB 1KS2A 2PEYA 2EKDA 4KTQA 4PQYA 2Z98A 5F21A 4C06A 2ZR9A 4KHPB 3WO1A 3JPWA 4EW6A 4C8LA 1XL0A 3FPSA 4MAAA 1RPNA 1WUIS 4KLQA 1ZWKA 3PV0A 2P11A 5DDIP 4IXTA 5EUBA 4AG6A 7ICTA 4XWKA 3HC7A 1I9GA 4NCHA 1VCIA 1J0DA 5J0XA 1VPDA 2FKAA 1NR7A 3BREA 5AMXA 3D7SA 1R4MB 3BQNB 4R1TA 3RIXA 4JOBA 4Q1BA 2X42A 4G0VA 4OM7A 5IZCC 5B1HA 1T4GA 4FR5A 4TX1A 2BMDA 2A88A 1IJEA 2OUKA 3OH8A 5E7IA 1U6KA 2C5SA 2P41A 5AVSA 3ZX4A 2OK7A 3RROA 4JMLA 1MOZA 3OSNA 1Q1BA 2CLDX 2XE7A 3ACCA 4BMCA 4DC9A 3JYHA 3ND7A 3SS7X 3V46A 1FUIA 2X23A 1MG5A 3D2CA 1XHEA 2P9YA 4JI8B 5ESRA 3LWLA 3OF3A 4EJMA 2VUTA 3RSGA 4ZO8A 2HWKA 4C8MA 2CXTA 3T61A 4QIWC 3PXGA 4HLDA 2XCRB 3BK1A 4M1ZA 3TLKA 1AG9A 1GUZA 3HH8A 4BGEA 3WLLA 2JD1A 4N0EA 1E1MA 1L5FA 1HFWA 2H1IA 4WLNA 1QHHB 3IT2A 3WNBA 5J2EA 2GEDA 2GPTA 3NC0C 4JIMA 2UZ3A 4U7GA 3F5FA 2HIHA 2VP5A 5A4FS 1TK9A 5KO2A 5FBKA 3QNMA 1OZ0A 1QYXA 2PIDA 5B4TA 5M5BA 2DUYA 3P2OA 2XUKA 4C0ZA 2A0WA 3KZXA 1LQUA 1KYIA 1Z12A 4QUGA 4TVOA 4B4VA 2UUBB 2VDWB 3NYQA 4H1HA 3CGWA 2Y9MB 3FNRA 2VNKA 3K15A 3MWJA 5ERYA 1X0VA 1JWAB 1COWD 2JIQA 2XE6A 3IQFA 4RYDA 5K0FA 5KAFU 2OP0A 2W6QA 1W87A 3GUUA 4MTCA 4R8KA 3LP5A 1BCRA 2R1VA 5DYTA 1OU4A 3OWOA 4BFUA 5JW6A 3A3KA 2FLWA 4RUCA 2KLHA 4QPCA 2GSDA 1U0OC 4U5QA 5EWMB 3W8FA 4EHNA 2O7RA 2VHXA 1UFKA 3VVCA 4B32A 4KXWA 1L4KA 3INTA 2I9GA 5FFFA 4YJ2B 3KS9A 3AH8A 2FEWB 2Y0DA 1O03A 4YJGA 4IQGA 1G2QA 3CWQA 2PGOA 4IHJA 4KQ9A 4WFJA 2GN0A 4K1XA 2NO5A 1BD4A 2CXXA 3PPVA 4MH0R 1DKPA 4P83A 4UMFA 2R7KA 4UUNA 3T7AA 3UCEA 4BX8A 4DJ5X 1A0PA 1VQ1A 5D5PA 3BMXA 1QGDA 2X13A 3M4ZA 1BGVA 4OQEA 5L7TA 3PA6A 4O3MA 1F60A 3GEPA 1Z0DA 4RCZA 4LY3A 4ERNA 2EF0A 4HF7A 4PGGA 3AF3A 2P4QA 4OHYA 2HEIA 4RQ4A 4JK1A 1S2LA 2Q2WA 4TMVA 1UMKA 2N1RA 3JWJA 3TJMA 3JQFA 5EN4A 4MARA 4RZRA 1BW9B 4C7OB 1MO3A 3L82B 4NK4A 3MILA 1JHYA 1Y1PA 2HT6A 5FFNA 2JIOA 2HCFA 5AXCA 4DCOA 5D7BA 3THYA 1A8UA 4DQRA 2X5XA 3N6VA 1RYDA 4QUJA 1KC1A 4J6FA 4IYRA 4ETWA 1Z4NA 5BN4A 4BE7B 5IYZA 2RDIA 4KQXA 5AM3A 1SZJG 2BI8A 4TRRA 1QVZA 2GYVA 1FTWA 3KSDO 3U4DA 2V4RA 1XYYA 3L49A 1N34B 2YV5A 4XUEA 3TR5A 2GA9A 1M5UA 2DUUA 3Q7TA 5HKAA 5KIAA 4YHHB 1XSPA 1IPHA 1JEQA 1N2IA 4NHEA 1KHTA 3SC2A 5IXJA 4HX2A 1KEKA 1UZAA 1N1DA 2EL9A 3Q85A 2RJ3A 3EQZA 3QMWA 3BMQB 4U00A 1CZNA 2L2QA 4IO0A 4BBJA 1W0JD 4YECA 4HUTA 5FBWB 2B7BA 3GEIA 1V16A 3KBBA 4YV2A 5D1NA 4U6NA 1JG4A 1PG5A 7AT1A 4C8NA 1P4GA 3LO5A 4RTRA 2WVAA 7ICKA 4GOJA 2KVCA 3KEMA 1U8YA 4LV5B 5B1DA 4G0WA 4NXMB 4KWEA 4DS5A 1RM3A 1ZHHA 2XOXA 7ICOA 4QFMA 3WWOA 1KPGA 3WDKA 1G5TA 2R9VA 3NKLA 4W6ZA 2HK7A 2QQGA 4WK4B 5JC8A 1H9BA 4M88A 4IGKA 2ZVPX 3DFZA 3HDGA 4TZKA 2IBSA 2PX2A 1Y9EA 5IBQA 1DIHA 2XJ9A 2QE7D 1SVIA 7ICLA 3NVKI 2MSKA 3PDCA 1KFSA 4IO1A 4ECTA 2CZGA 2FPGB 2P0EA 3SQMA 1J24A 2PT7A 1LK0A 2WT4A 4MYSA 4FGUA 2VUHB 1Q0LA 4H1VA 4ZPJA 1U04A 1DTSA 5KFJA 2XNKA 1CDZA 2QTVB 1L2TA 3PX2A 3K0FA 4QAQA 2HDHA 1GTRA 4LHXA 1X8LA 4D0SA 1R15A 1FNMA 1M2OA 2VUSA 2HLDA 2QAJA 2VSXA 4IJMA 3BA1A 4PANA 4XLLA 4LZOA 3EYAA 2CD9A 5CX1B 3CZ9A 1Q2XA 2R6CA 4X84A 1XEWY 5AVRA 4TQ9A 1A3CA 1E0KA 5U9CA 2ID7A 4YRNA 4BJQA 1G8SA 4INOA 4L28A 5HKOA 1W25A 2J3QA 5J2FA 5AJYA 3SDZA 4E0BA 1MBZA 4K40A 4B2LA 4QVIA 3OOHA 2YY6A 1M5RA 1A9SA 3BULA 5JRTA 4P5PA 1MNAA 3KPWA 4QZ8A 3SAFA 1SKQA 1P1IA 3G68A 4PF1A 1KZ7B 2PN1A 1ILEA 3T3GA 1C3XA 2G9RA 3BE8A 3EJ6A 3I8OA 1AMUA 2RCYA 1KW4A 1P8AA 2PMFA 2BF7A 4ECZA 1VL5A 3CU5A 1SKWA 3ELBA 3R7SA 1WETA 2QRPA 3W5SA 4Q1CA 4IL6U 3BXEA 3RTBA 2G08A 1DUSA 1NG9A 1NI4B 3MCWA 2QARA 3WOHA 2WTUA 1BQEA 4IP0A 1LQTA 5K7SA 3GQBB 1OLXA 2ZEJA 3MA0A 4NBRA 3NVWA 3JD0A 2FB9A 2W2KB 1GJRA 2GCPA 4F06A 2PFNA 2C7PA 3ZV3A 5L9XA 4XVQA 1O9BA 4OJQA 2FEOA 4EY5A 1S8NA 2C99A 2AD1A 3EXG1 4P33A 2ZCJA 4KJXA 4F3KA 2RK6A 3GBSA 1KYXA 1DUVG 1OWOA 3ITDA 1C3OB 3NRBA 2C98A 4QBGB 5TS3A 3V8BA 5B30A 1T3TA 2ATCA 3VX4A 2QIPA 3ZOZA 3RD5A 4EG8A 2Y71A 1XZGA 5MFZA 2RQ5A 4BJ1A 5J43A 3E61A 2XQJA 2Y8EA 5L51A 2ZIGA 1GGMA 1XKXA 4GVXA 3BPSA 3MTJA 4WH0A 5IH7A 1R64A 3QU9A 5KVSA 1VSUA 3DL0A 3OC0A 1Y1LA 4RULA 1XTVA 4WKCA 5DBCA 5JZ9A 3D4IA 1SXJA 2OL4A 5B37A 1GRCA 3HZOA 5JXIA 4RACA 1Q20A 2ZIWB 1C9YA 4OK6A 1MW8X 3C48A 2J48A 4NNPA 3TQRA 5AYVA 2O0MA 3FNBA 4BNWA 4BWYA 3NIGB 3HGTA 5CJPA 4HTFB 3KQMA 4MZDA 4A03A 1QU3A 3D4PA 2A84A 3DKIA 4LNUA 4R8VA 5F4ZA 5F7ZA 3FRJA 3T4UA 1PO7A 2KJ8A 1JG3A 1Q6ZA 3CUEF 3MS4A 5IYZB 1V43A 3LDGA 2H07A 1ZU4A 2IC5A 5DW3A 3SK0A 3L6OO 4HDNA 3AR9A 4K46A 3MMXA 3UICA 3VI3B 1KI7A 3QXHA 5IJAA 2HBYA 1CS0A 5C8VA 2O50A 3M4JA 1M1ZA 1CUSA 1EQAA 1RI5A 3E58A 1HV8A 1I4TD 3HZRA 1W29A 3K9BA 5FNVA 1L5WA 1SGGA 3WLAA 3G7NA 4ER5A 5F23A 4KVFA 1JJFA 3UJPA 2F8LA 3RHZA 3C3DA 4CW7A 3LPCA 2OYRA 2EQBA 3PQEA 4HL6A 1XDZA 1NKSA 5DO9A 2IEZA 1E1RA 2Q5HA 4BMVA 3NP9A 4EG5A 1V48A 1XIVA 1HDCA 3I30X 4I14A 4M54A 4UFPA 2CJWB 3F74A 2D06A 2WW8A 5L3VA 5CLLA 2GNOA 3U7JA 1SVNA 2FEPA 721PA 5ALWA 5LDGA 1OH8A 1GGHA 5HXAA 1G4UR 4O3PA 1B2LA 4PRLA 1N2JA 1GZ5A 3ZKWA 3F96A 3K0AA 3N75A 3UWDA 3CH4B 2FPSA 2RAUA 3HY4A 4RMIA 4Z2AA 5HOQA 2O3RA 1YO6A 2JEFA 2NN3C 1LLCA 5EHNA 2VC2B 2W0SA 2QN3A 3AKDA 2KJ5A 4M7RA 3GT0A 4YYEA 3SZRA 2WTMA 2O8EA 3NBFA 4IQ8A 4FD3A 1ZMRA 3IUMA 4RDXA 2RSLA 4YV7A 4MLZA 1W34A 4H6VA 3KX2A 4S2UA 1ZM9A 2Z95A 2H5XA 1T36A 3VHXB 1RAFA 2JIZA 1NQAO 3JD3A 4WZAB 2I87A 3GZ4A 4ALNA 5I3ZA 4QECA 4EUHA 1S02A 4G1UC 4P58A 4OLBA 5A6VA 5FI3A 2XXAB 1X1BA 4ID9A 2D00A 2D7DA 3WL4A 2XAUA 5LLTA 2WB4A 1PK9A 3OZVA 4YROA 5GAJA 2YHUA 1BW9A 1NR5A 2JFWA 3M9XA 5EIXA 2DKNA 2HPHA 3GRPA 3MXTA 4MI3A 2B1RA 1GDDA 4H7PA 2QSJA 4J4BA 1U0SY 2W2KA 1GU7A 3AZQA 5THKA 3GT7A 1X1RA 3KZKA 3FCAA 1M0EA 1ZH4A 3PQFA 2CJFA 4JASB 1QPBA 3G6XA 1M7BA 2QB1A 1MSWD 2CHEA 4FD2A 4MS1B 4A8HA 2PE5A 1F7VA 5CTJA 2HTFA 1X7WB 2PFGA 2E1PA 3A1CA 3DT8A 4K9PA 3A1EA 4MGHA 3U7RA 4AW9A 1ST2A 1TTQB 1VLBA 4NV0A 1T25A 2HEGA 4P4GA 4RHEA 4TZ0A 1HT3A 1R0WA 2BBTA 3A2NA 2EZ9A 4GKBA 2R6AA 3WGQA 2J45A 4XB2A 4FOPA 3IHQB 4C3ZA 1YQEA 5KG4A 2OILA 4RVUA 4HDKA 4LK3A 5CBPA 1IV8A 4R1NA 1XO1A 1VYTA 5L3QB 1V5FA 2XWSA 1BIFA 2W37A 3CUVA 3KKQA 1UPCA 5EWLA 3SEFA 1YUNA 4TL9A 4CLEA 2UVWA 4DY6A 1JEYA 1DINA 1XNHA 5TNXA 2FR0A 1E1RD 1N2XA 3EFEA 3OY2A 4R66A 5K0ZA 2Z56A 4IDAA 1MFZA 4GZLA 5KOJA 4ZRMA 5BN3B 5KBYA 3CRQA 4XIGS 1LQ2A 4H4EA 4EZBA 3V6KA 4CLRA 4LSGA 4MW1A 4LUCA 3LQQA 4QZAA 3PNQA 3OKAA 3BL6A 2AZMA 4PLYA 1AQUA 1DKRA 3BWBA 1XQ9A 2IHVA 3BH0A 3L4PA 1LBTA 1UT6A 3BOSA 3GN1A 4MV0A 4QDJA 5J5VA 3T7SA 4AJPA 2ASLA 1QLNA 5H3HA 1OBVA 3CT6A 2DFDA 3JQAA 4CM4A 5BWMA 3KE8A 4A3SA 1CV2A 4ELTA 2EJCA 1M7GA 4TKVB 2H1OA 1YAHA 2PA3A 3O3OB 2JB9A 4LHZA 1SKYB 1E3QA 5D3MB 5JG7A 3LOQA 1JJBA 3ADPA 2CN1A 4PSVA 5KJEA 5CT6A 1NBOA 1U94A 4KGZA 1A8PA 5FL7D 3KOUA 2D2IA 4KSCA 4DR4B 2VDMB 2J3JA 3F8SA 3GYBA 3GLVA 3DD5A 2KM1A 1G2PA 2XRFA 2H3ZA 4IRMA 3DV0B 2KZMA 3LQ1A 4LFCB 3V72A 1KDTA 1GZ7A 3LBAA 2WYVA 1NM5A 2ABWA 3PDWA 1XTTA 4LF9B 2HY7A 4TWZA 1MX3A 4M0UA 2XNHA 7ICQA 1II8A 1YRHA 1YCFA 2XVAA 4X20A 2J67A 4EMUA 1YRLA 2WUGA 3HB0A 1UK8A 5FXMA 1PZGA 1HUOA 3KB6A 3L79A 3UKOA 1Q46A 3IN5A 5JS8A 3UV3A 2HYIC 3DZGA 3K1ZA 4Z1MD 1TJYA 3K53A 1OGJA 2E4WA 4UUOA 1FQJA 1U2DC 1VMDA 3PQ4A 1W94A 3LVBA 5D5QA 1O5OA 3KT8A 4TWJA 3R4CA 4ZCPA 1W6RA 3AC0A 1NW7A 3GT3A 4HWOA 1U2SA 4BV8A 1BH6A 2YJ6A 2P2CA 1IB0A 4HOYA 1OI2A 3VO9A 2BJHA 3FDFA 2A3RA 5FUWA 4BBPA 3AUJB 9ICIA 2QRUA 1OROA 3NTVA 1OGYA 4ED3A 2I6UA 4U7HA 3N0VA 1I5OA 4JVOA 4ZPXA 1T1IA 1K86A 2BGWA 3UY4A 4CF6A 1JHPA 4ZRDA 4UM5A 3FOCA 1EG7A 4MDFA 1NUAA 1F6WA 4UZFA 4I3FA 1EVLA 3T5JA 3QKUA 4UUMA 5DP1A 4FYIA 3O2NA 3K9NA 2R68A 3D4LA 5EHXA 3P4UA 1Y3CE 2VXBA 2D5IA 3TM4A 5J2TF 4IHJB 1M10A 3HEBA 1P75A 1QV6A 2EJWA 4GXRA 4J0DA 3G5TA 4DF3A 1I3LA 5CB6A 3FKJA 2FG7C 2KKPA 4HGOA 3TRKA 2QQFA 3I2JA 3OQ6A 3UPQA 3Q15C 1YQXA 2ZW9A 4I4IA 4O6VA 5DM2A 5KKNB 1KEUA 3PC6A 3RYTC 2XQGA 3ZQ4A 2FLLA 1QZXA 3AFIA 4AJEA 2JIZD 2CUNA 4DJDC 4YRBA 4Q5IA 1Z38A 3T1TA 1MOQA 3USZA 3TQTA 1SC9A 3LT0A 4YAOA 1A2BA 1CNFA 1GL9B 1T2DA 2O7NA 2G04A 2Q3DA 3N8DA 1T4DA 4LC1A 2WP0A 2PVSA 4RESA 4FZ5A 3DL7A 3PE4A 2CVQA 5EYPB 3PHIA 4MQ6A 3ZG6A 4E30A 1QWSA 1JPNA 4M4SA 1FXSA 4M9CA 4PLZA 3B36A 1QAMA 4FHGA 1DPFA 3KKKA 4MB2A 5HCNA 4I1YA 4RQTA 3TDMA 1ZOLA 3ZVMA 1Y4DE 1ZZEA 2J07A 3ZDBA 3T7TA 3S7ZA 4J9LA 1D6NA 4B6OA 4AXXA 2I29A 5DNAA 1D4OA 5BNZA 2IDMA 4LTDA 4Z4QA 3BIWA 3ICQB 1PS8A 3H3JA 3IQWA 1N60A 2YDYA 1FP7A 1SWVA 1HSZA 4GX1A 1UFRA 4IGAA 3QKWA 1I01A 5AR1A 3TVDA 1J2RA 5EJFA 4DJEC 3W77A 1IH8A 4KXMA 5AKXA 1K0FA 3H87A 4MROA 1SOUA 5FOXA 4IPTA 2E37A 4YJDA 1G42A 5KAIU 2GEJA 2XVMA 3H4MA 2QTCA 1QRTA 3R9XB 4UB5A 1NXWA 1KFBB 3CSUA 3O8QA 5KNBD 1TIKA 4PG4A 4R8MA 1Z06A 3F49S 3HRIA 4Z86A 6YASA 4EYHB 4DTCA 1D2GA 3Q11A 2QM7A 3R0QA 2W6MA 3BMNB 3BL8A 1YHZA 1U8ZA 5J2BA 3V6JA 3R7NA 4I2JA 4KN7A 3CRXA 2YHAA 3F6EX 3IXMA 2Q5FA 2QPTA 5DDYA 1PI3A 2WJYA 2Y6VA 3O9VA 3S2SA 3A14A 3CCCA 3D1VA 1I94B 4ED8A 4AX4A 2HK6A 5JFGA 2ZOSA 2H5EA 1F0NA 1FLDA 3FNGA 1H1TA 2ZXFA 4BOYA 1LF5A 4CG3A 4Y0NA 1T91A 2Z2XA 1XJWA 1VPTA 1M2FA 2O1XA 2PLWA 4G5XA 5TMDA 1ZRHA 2W6ID 4COOA 3DUFA 5A5DA 1SKUA 5DGXA 4BMPB 3BJEA 1WB9A 5EI5A 1XROA 3VAZA 4CKBB 2WWTA 2W8KA 4LYGA 1QCYA 4UHFA 2WWHA 4IWXA 3RWOA 1T9KA 5D3MA 1Z4PX 3HCDA 2JH9A 3ZTYA 1WXQA 2VHJA 3AMVA 3AINA 3ZZ1A 4DG9A 2FSVA 1DEOA 1LI4A 1U1GA 3L0CA 3JZAA 5KKAA 1KN5A 2X9LA 1Z7WA 4UMVA 4AZWA 1WMDA 1SVUA 4CM8A 4PR0A 4N9WA 1HDEA 1AKVA 5BXYA 2Y2UA 3DHYA 1SB8A 1G5QA 5HILA 3T4PA 1R5OA 2Q0QA 3HU3A 1S5LU 4DCVA 3C43A 5CVEA 3TQQA 2QZZA 2AHOA 1A2QA 2ZU0C 1LDEA 3LNCA 4C7JA 5ETJA 2W2TA 2PU5A 4UTRA 2WYHA 2R8IA 1QK5A 5DPMA 5JTTA 1JEYB 2PBFA 1JNYA 1ZDMA 1K97A 2WHXA 3FAZA 3SJAA 5LU8A 2HJGA 1ECLA 3I1IA 1C8VB 4K1LA 4DWOA 2MSEB 2G9VA 2Z58A 3ODPA 1D07A 4KMRA 4DY4A 4HRVA 2V4UA 3OG9A 2AF4C 2MYPA 3HS3A 3L01A 1YRQA 2I2WA 4FDAA 5SZIA 4EP1A 2GILA 3T38A 1NZJA 3AVQA 4RLSA 3H5VA 4M9JA 2GRUA 3E7XA 3GWGA 2Y99A 3G0HA 4C05A 3L4JA 3WMWA 3I72A 2LYAA 2MSLA 4N47A 2ZATA 2VHWA 1QK3A 4W5OA 3ADDA 4EX6A 1U3GA 4UEQA 3DGEC 2FWAA 2XMGA 1OZAA 3IRVA 3IT3A 1ACLA 3VZRA 3NHBA 3O4IA 3G8BA 3GVIA 1RWWA 3R2JA 4AURA 1OH7A 1DAPA 2OV1A 2NTJA 3L07A 4HNRA 2VF5X 4KAAA 4P38A 5F9FA 3PGA1 1PK7A 1RXCA 3BHJA 4RMGA 1YQDA 3I5XA 3VX3A 5GJBA 3AIKA 2J8ZA 1W4LA 2IY9A 2YHIA 2TMKA 5U1PA 5CNMA 2KEYA 1D9ZA 5T4HA 4IY1A 2NX2A 1RWNA 2I4MA 2V7UA 5AVVA 5LZ4A 2LD4A 3P9IA 3KOOA 3VPGA 2J9GA 3MJEA 4OHPA 4PHFA 2WUFA 4B9MA 3K0CC 1HFEL 4C87A 8ICRA 4TQGA 1ML4A 2CGEA 3AXTA 1SULA 4GM1A 3LKBA 1GZ6A 1Y5NA 3L4BA 4IQ4A 4JC4A 4CIAA 3UMCA 3VU9B 1SHUX 1ZNWA 1DQNA 4X6LA 4UAYA 4QXAA 3G1UA 1VLLA 2WMDA 2AEEA 2C5FA 2EFGA 3RS7A 4DQLA 1HDYA 3KALA 3VKFA 4L4RA 4DA8A 1O0BA 1FRZA 1LZKA 3AP2A 1NRXA 1TKCA 2ZJBA 4MRNA 4IV5A 2K5UA 3TR6A 4BNIA 1QP4A 2BY4A 2CVHA 2CDAA 5CA0B 1E0DA 4JH0A 3GPIA 2IYVA 4IZOA 4UCXA 1FTQA 1EFPA 2W2QA 3KFLA 3R0VA 1KL9A 3SEQA 3AGPA 1QFMA 4KOAA 4CM7A 2Y1EA 3VSEA 4MXDA 2LCIA 4ENVA 1PJSA 3GARA 4MS3A 3E9NA 3C23A 4QGBA 2IWHA 5KNCD 2AJQA 4JUIA 1YZVA 1W4BA 1EESA 2FSSA 1QONA 2IQIA 2Y27A 4J9OA 3ZKWB 3DL4A 2RHDA 3RTAA 3ST7A 1FX0A 1AKMA 1CUIA 4JJ7A 1I7PA 3VJRA 4R68A 2YN4A 3A0BU 2IIBA 5TF4A 3PGJA 4PW0A 3GCWA 2J30A 2ONCA 4G5QA 4Q9HA 2ZT5A 3GJ5A 4F3RA 2XADA 3ASUA 1I1OA 3P2KA 4IGEA 4OLHA 2RJNA 3WNQA 1QO0A 1Z5PA 5CNIA 3IR7A 1UXJA 1SL2A 3YASA 5KYWB 4HXFB 4Y2YA 2REBA 2V5UA 2FJ6A 3CY6A 4Y6QA 3DP7A 4DWJA 4URUR 1LBQA 1OR8A 4BDPA 1EWRA 1GZVA 2VF2A 4WCDA 5DTMA 2CLEB 2EDUA 1C0LA 2P91A 2HD4A 2OSBA 4DA0A 1WF3A 5I3CA 5DF1A 2IDKA 2E55A 3MTIA 2RGRA 4Q4HB 5KNDD 3BMQA 1TC2A 4OJMX 1L4HA 2XUPA 4GIBA 3ZCVA 2QVXX 3D6TB 1YJ5A 5JPCA 2GLEA 1UPTA 5TGTA 1R9JA 3D8TA 4BFXA 2GJ8A 4O4HF 3PYMA 5KTNA 1DGSA 1DKNA 1J49A 1O95C 1ZK4A 3TTWA 3JPTA 1ZQVA 3QTLA 4A8TA 1Y7PA 1PYGA 1TYEB 4L6CA 1PVVA 4MP8A 3HTXA 1NKTA 1TQHA 2BZFA 1FYEA 2B35A 3QWBA 4X6YA 1YCDA 3IBCA 4KLEA 1IG6A 4TTVA 1I6MA 4U0KA 3KHRA 4TXNA 5K6AC 5HKKD 3H75A 2P8SA 4UASA 3FKSA 3OPYB 5F9HA 1CVLA 3LYUA 4GPZA 3FMIA 2EFEB 3EPIA 1QHFA 5JEDA 2ZJYA 1H42A 5IDXA 2G9QA 3TW8A 4DKXA 1NMYA 5A62A 4G5YA 1GKYA 4PXYA 4QPDA 4DHEA 2MWMA 5FBVB 4I6EA 5EY5B 4J0KA 4XJTA 3WQHA 3WB2A 4MRMA 3I6BA 3IUSA 2NTNA 1MAAA 5CEJA 1S76D 5JXHA 5BVHB 3MT7A 3EGCA 1KJJA 2NYRA 5C46F 2ZSIA 4DKJA 1TA9A 1FDWA 1RM6C 3KKNA 2HX1A 3UV7A 3OPYA 4C7KA 2K8CB 1HT0A 8ICVA 1BFKA 2WWIA 2YN2A 1O8BA 3CNBA 4ZOEA 5TSDA 3ZDXB 3PX0A 2AJDA 1Y1SA 1SUBA 1FYFA 1PKEA 3BSWA 2CMKA 2YBEA 4JROA 4LRXA 2YXBA 2ZE7A 3L6DA 4YBRA 2YB4A 1QQ6A 2G6BA 3CB2A 3I8XA 4KH1A 1QCKA 5ES4B 1JAYA 2C4TA 5LCXA 3RS3A 4DLUA 3NIWA 1JQKA 5EHQA 1ZK2A 4WLVA 3RR2A 1Z26A 4QQKA 4YXWD 3D2SA 1HC7A 1YKFA 1YRAA 1E20A 4A92A 1I3OA 3QENA 5BR7A 2YKGA 2CSXA 3M1YA 4GKJB 2P65A 1TA4A 3ZQKA 3UXNA 4JI1B 4CR6A 3HLTA 4LE0A 4UAUA 1QV7A 2PLRA 4H2DA 4MI6A 1WW2A 2GBFA 2VUIB 3RB4A 1Z4LA 3V2HA 3WG9A 1WMEA 3RGGA 4F4CA 2WF9A 5J3JA 5AUOB 3GZNA 3FROA 4M46A 1OWPA 1WHSA 1XBTA 3L8EA 1XRPA 5DM70 4L4UA 3SFVA 3UK6A 3KKMA 4K86A 4I9GA 2GR9A 4QDZA 4ZAVA 4Z4HA 3D0QA 2M0NA 2HHVA 2R18A 1MEOA 1UJ4A 2Z2IA 2RB5A 2VRNA 1CRLA 4YT2A 4IJ6A 1C3OA