3ED7A

Replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
289
structure length
284
Chain Sequence
LXXXXPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replacement of Val3 in human thymidylate synthase affects its kinetic properties and intracellular stability .
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Homo sapiens
total genus 79
structure length 284
sequence length 289
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3ed7A00
1TYSA 1VZEA 1TVWA 1BSPA 4XSCA 4GEVA 1B02A 2OIPA 4O1UA 3NRRA 4PSGA 4EZ8A 2G8DA 3EDWX 3CLBA 4Q0DA 1EVGA 3IK1A 3KJSA 4KY8A 4DQ1A 3C06A 3IX6A 1BKOA 4Q0EA 1KZJA 1ZPRA 3GH2X 3H9KA 3JSUA 3EGYX 2TDMA 4FOAA 3HJ3A 1TVUA 3INVA 1JG0A 3BNZA 1VZBA 1F4DA 4XSEA 3ED7A 1BO7A 1NJEA 4DPDA 1RTSA 2FTQA 2G89A 1TSMA 3EF9A 3HBBA 1BO8A 3N5GA 2TSCA 1KZIA 3EJLA 1F28A 1FFLA 1JUTA 3GH0A 3N5EB 1NJAA 4IQQA 4F2VA 1TSYA 1EVFA 5WRNA 2AAZA 4EINA 4O1XD 1SYNA 1BDUA 1TSVA 1B5DA 4EILA 1J3JC 2TDDA 4UP1A 1BP6A 3K2HA 5FCTA 1VZAA 1JU6A 2RD8B 4IQBA 1AN5A 5BY6A 1TSXA 4EB4A 3EHIX 1TSLA 5HS3A 1JMGA 3B5BA 3BHLA 4GD7A 1THYA 4G2OX 1HW3A 2BBQA 1VZCA 3DL6A 3BFIA 5H39A 3UM5A 1TRGA 1F4EA 1QQQA 3DG8C 1NJCA 4ISKA 3UWLA 3N5EA 3V8HA 3BGXA 4KNZA 2ONBA 1LCEA 4FOXA 1AOBA 3IHIA 4XSDA 3C0AA 5J7WA 1TLCA 2G86A 3EAWX 1AIQA 1JUJA 1TLSA 2FTOX 1EV8A 2H2QA 3KGBA 1BP0A 1J3IC 2A9WA 2TSRA 3IRNA 1BIDA 4H1IA 1HZWA 1B49A 1F4BA 3EBUA 1TSDA 4H0UA 4KYAA 1DNAA 4O7UA 1EV5A 1BQ1A 2G8XA 1LCAA 1HW4A 3IK0A 1DDUA 1JMFA 5H38A 1J3KC 4FGTA 1TDUA 1TDAA 3UM8A 1F4CA 3IJZA 1TJSA 1TSNA 1TDBA 3GG5A 1TISA 2RDAA 4FQSA 1F4GA 2G8AA 1TDCA 2KCEA 1JMHA 4ISWA 3QJ7A 3OB7A 3IROA 2RD8A 4TMSA 1JMIA 1VZDA 1I00A 2VETA 4H0RA 4KPWA 4JEFA 1QZFA 1NJBA 4DP3A 3UM6A 1KCEA 1NCEA 3HB8A 3BHRA 5H3AA 3CL9A 4GYHA 3I3RA 1AJMA 1LCBA 1B5EA 3BZ0A 3BYXA 3QGTA 4KY4A 3TMSA 3QG2A 1BJGA 1F4FA 4IRRA 3DL5A 1BKPA 1YPVA 1AXWA 1NJDA 3DGAC 1JTQA 3B9HA 4E5OA 3IRMA 1SEJA 3UWLB 1FWMA 1BQ2A 4G6WX 1BSFA 1CI7A 1BPJA 1JTUA 2FTNA 4DPHA 3KJRA 1TVVA 4FOGA 4LRRA 2VF0A 4E28A 4ECKA 4O1XA 1TSZA 1TSWA 1HVYA
chains in the Genus database with same CATH superfamily
1TYSA 1VZEA 1TVWA 1BSPA 4XSCA 4GEVA 1B02A 2OIPA 4O1UA 3NRRA 4PSGA 4EZ8A 2G8DA 3EDWX 3CLBA 4Q0DA 1EVGA 3IK1A 3KJSA 4KY8A 4DQ1A 3C06A 3IX6A 1BKOA 4Q0EA 1KZJA 1ZPRA 3GH2X 3H9KA 3JSUA 3EGYX 2TDMA 4FOAA 3HJ3A 1TVUA 3INVA 1JG0A 3BNZA 1VZBA 1F4DA 4XSEA 3ED7A 1BO7A 1NJEA 4DPDA 1RTSA 2FTQA 2G89A 1TSMA 3EF9A 3HBBA 1BO8A 3N5GA 2TSCA 1KZIA 3EJLA 1F28A 1FFLA 1JUTA 3GH0A 3N5EB 1NJAA 4IQQA 4F2VA 1TSYA 1EVFA 5WRNA 2AAZA 4EINA 4O1XD 1SYNA 1BDUA 1TSVA 1B5DA 4EILA 1J3JC 2TDDA 4UP1A 1BP6A 3K2HA 5FCTA 1VZAA 1JU6A 2RD8B 4IQBA 1AN5A 5BY6A 1TSXA 4EB4A 3EHIX 1TSLA 5HS3A 1JMGA 3B5BA 3BHLA 4GD7A 1THYA 4G2OX 1HW3A 2BBQA 1VZCA 3DL6A 3BFIA 5H39A 3UM5A 1TRGA 1F4EA 1QQQA 3DG8C 1NJCA 4ISKA 3UWLA 3N5EA 3V8HA 3BGXA 4KNZA 2ONBA 1LCEA 4FOXA 1AOBA 3IHIA 4XSDA 3C0AA 5J7WA 1TLCA 2G86A 3EAWX 1AIQA 1JUJA 1TLSA 2FTOX 1EV8A 2H2QA 3KGBA 1BP0A 1J3IC 2A9WA 2TSRA 3IRNA 1BIDA 4H1IA 1HZWA 1B49A 1F4BA 3EBUA 1TSDA 4H0UA 4KYAA 1DNAA 4O7UA 1EV5A 1BQ1A 2G8XA 1LCAA 1HW4A 3IK0A 1DDUA 1JMFA 5H38A 1J3KC 4FGTA 1TDUA 1TDAA 3UM8A 1F4CA 3IJZA 1TJSA 1TSNA 1TDBA 3GG5A 1TISA 2RDAA 4FQSA 1F4GA 2G8AA 1TDCA 2KCEA 1JMHA 4ISWA 3QJ7A 3OB7A 3IROA 2RD8A 4TMSA 1JMIA 1VZDA 1I00A 2VETA 4H0RA 4KPWA 4JEFA 1QZFA 1NJBA 4DP3A 3UM6A 1KCEA 1NCEA 3HB8A 3BHRA 5H3AA 3CL9A 4GYHA 3I3RA 1AJMA 1LCBA 1B5EA 3BZ0A 3BYXA 3QGTA 4KY4A 3TMSA 3QG2A 1BJGA 1F4FA 4IRRA 3DL5A 1BKPA 1YPVA 1AXWA 1NJDA 3DGAC 1JTQA 3B9HA 4E5OA 3IRMA 1SEJA 3UWLB 1FWMA 1BQ2A 4G6WX 1BSFA 1CI7A 1BPJA 1JTUA 2FTNA 4DPHA 3KJRA 1TVVA 4FOGA 4LRRA 2VF0A 4E28A 4ECKA 4O1XA 1TSZA 1TSWA 1HVYA
chains in the Genus database with same CATH topology
1TYSA 1VZEA 1TVWA 1BSPA 4XSCA 4GEVA 1B02A 2OIPA 4O1UA 3NRRA 4PSGA 4EZ8A 2G8DA 3EDWX 3CLBA 4Q0DA 1EVGA 3IK1A 3KJSA 4KY8A 4DQ1A 3C06A 3IX6A 1BKOA 4Q0EA 1KZJA 1ZPRA 3GH2X 3H9KA 3JSUA 3EGYX 2TDMA 4FOAA 3HJ3A 1TVUA 3INVA 1JG0A 3BNZA 1VZBA 1F4DA 4XSEA 3ED7A 1BO7A 1NJEA 4DPDA 1RTSA 2FTQA 2G89A 1TSMA 3EF9A 3HBBA 1BO8A 3N5GA 2TSCA 1KZIA 3EJLA 1F28A 1FFLA 1JUTA 3GH0A 3N5EB 1NJAA 4IQQA 4F2VA 1TSYA 1EVFA 5WRNA 2AAZA 4EINA 4O1XD 1SYNA 1BDUA 1TSVA 1B5DA 4EILA 1J3JC 2TDDA 4UP1A 1BP6A 3K2HA 5FCTA 1VZAA 1JU6A 2RD8B 4IQBA 1AN5A 5BY6A 1TSXA 4EB4A 3EHIX 1TSLA 5HS3A 1JMGA 3B5BA 3BHLA 4GD7A 1THYA 4G2OX 1HW3A 2BBQA 1VZCA 3DL6A 3BFIA 5H39A 3UM5A 1TRGA 1F4EA 1QQQA 3DG8C 1NJCA 4ISKA 3UWLA 3N5EA 3V8HA 3BGXA 4KNZA 2ONBA 1LCEA 4FOXA 1AOBA 3IHIA 4XSDA 3C0AA 5J7WA 1TLCA 2G86A 3EAWX 1AIQA 1JUJA 1TLSA 2FTOX 1EV8A 2H2QA 3KGBA 1BP0A 1J3IC 2A9WA 2TSRA 3IRNA 1BIDA 4H1IA 1HZWA 1B49A 1F4BA 3EBUA 1TSDA 4H0UA 4KYAA 1DNAA 4O7UA 1EV5A 1BQ1A 2G8XA 1LCAA 1HW4A 3IK0A 1DDUA 1JMFA 5H38A 1J3KC 4FGTA 1TDUA 1TDAA 3UM8A 1F4CA 3IJZA 1TJSA 1TSNA 1TDBA 3GG5A 1TISA 2RDAA 4FQSA 1F4GA 2G8AA 1TDCA 2KCEA 1JMHA 4ISWA 3QJ7A 3OB7A 3IROA 2RD8A 4TMSA 1JMIA 1VZDA 1I00A 2VETA 4H0RA 4KPWA 4JEFA 1QZFA 1NJBA 4DP3A 3UM6A 1KCEA 1NCEA 3HB8A 3BHRA 5H3AA 3CL9A 4GYHA 3I3RA 1AJMA 1LCBA 1B5EA 3BZ0A 3BYXA 3QGTA 4KY4A 3TMSA 3QG2A 1BJGA 1F4FA 4IRRA 3DL5A 1BKPA 1YPVA 1AXWA 1NJDA 3DGAC 1JTQA 3B9HA 4E5OA 3IRMA 1SEJA 3UWLB 1FWMA 1BQ2A 4G6WX 1BSFA 1CI7A 1BPJA 1JTUA 2FTNA 4DPHA 3KJRA 1TVVA 4FOGA 4LRRA 2VF0A 4E28A 4ECKA 4O1XA 1TSZA 1TSWA 1HVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYS A;  1VZE A;  1TVW A;  1BSP A;  4XSC A;  4GEV A;  1B02 A;  2OIP A;  4O1U A;  3NRR A;  4PSG A;  4EZ8 A;  2G8D A;  3EDW X;  3CLB A;  4Q0D A;  1EVG A;  3IK1 A;  3KJS A;  4KY8 A;  4DQ1 A;  3C06 A;  3IX6 A;  1BKO A;  4Q0E A;  1KZJ A;  1ZPR A;  3GH2 X;  3H9K A;  3JSU A;  3EGY X;  2TDM A;  4FOA A;  3HJ3 A;  1TVU A;  3INV A;  1JG0 A;  3BNZ A;  1VZB A;  1F4D A;  4XSE A;  3ED7 A;  1BO7 A;  1NJE A;  4DPD A;  1RTS A;  2FTQ A;  2G89 A;  1TSM A;  3EF9 A;  3HBB A;  1BO8 A;  3N5G A;  2TSC A;  1KZI A;  3EJL A;  1F28 A;  1FFL A;  1JUT A;  3GH0 A;  3N5E B;  1NJA A;  4IQQ A;  4F2V A;  1TSY A;  1EVF A;  5WRN A;  2AAZ A;  4EIN A;  4O1X D;  1SYN A;  1BDU A;  1TSV A;  1B5D A;  4EIL A;  1J3J C;  2TDD A;  4UP1 A;  1BP6 A;  3K2H A;  5FCT A;  1VZA A;  1JU6 A;  2RD8 B;  4IQB A;  1AN5 A;  5BY6 A;  1TSX A;  4EB4 A;  3EHI X;  1TSL A;  5HS3 A;  1JMG A;  3B5B A;  3BHL A;  4GD7 A;  1THY A;  4G2O X;  1HW3 A;  2BBQ A;  1VZC A;  3DL6 A;  3BFI A;  5H39 A;  3UM5 A;  1TRG A;  1F4E A;  1QQQ A;  3DG8 C;  1NJC A;  4ISK A;  3UWL A;  3N5E A;  3V8H A;  3BGX A;  4KNZ A;  2ONB A;  1LCE A;  4FOX A;  1AOB A;  3IHI A;  4XSD A;  3C0A A;  5J7W A;  1TLC A;  2G86 A;  3EAW X;  1AIQ A;  1JUJ A;  1TLS A;  2FTO X;  1EV8 A;  2H2Q A;  3KGB A;  1BP0 A;  1J3I C;  2A9W A;  2TSR A;  3IRN A;  1BID A;  4H1I A;  1HZW A;  1B49 A;  1F4B A;  3EBU A;  1TSD A;  4H0U A;  4KYA A;  1DNA A;  4O7U A;  1EV5 A;  1BQ1 A;  2G8X A;  1LCA A;  1HW4 A;  3IK0 A;  1DDU A;  1JMF A;  5H38 A;  1J3K C;  4FGT A;  1TDU A;  1TDA A;  3UM8 A;  1F4C A;  3IJZ A;  1TJS A;  1TSN A;  1TDB A;  3GG5 A;  1TIS A;  2RDA A;  4FQS A;  1F4G A;  2G8A A;  1TDC A;  2KCE A;  1JMH A;  4ISW A;  3QJ7 A;  3OB7 A;  3IRO A;  2RD8 A;  4TMS A;  1JMI A;  1VZD A;  1I00 A;  2VET A;  4H0R A;  4KPW A;  4JEF A;  1QZF A;  1NJB A;  4DP3 A;  3UM6 A;  1KCE A;  1NCE A;  3HB8 A;  3BHR A;  5H3A A;  3CL9 A;  4GYH A;  3I3R A;  1AJM A;  1LCB A;  1B5E A;  3BZ0 A;  3BYX A;  3QGT A;  4KY4 A;  3TMS A;  3QG2 A;  1BJG A;  1F4F A;  4IRR A;  3DL5 A;  1BKP A;  1YPV A;  1AXW A;  1NJD A;  3DGA C;  1JTQ A;  3B9H A;  4E5O A;  3IRM A;  1SEJ A;  3UWL B;  1FWM A;  1BQ2 A;  4G6W X;  1BSF A;  1CI7 A;  1BPJ A;  1JTU A;  2FTN A;  4DPH A;  3KJR A;  1TVV A;  4FOG A;  4LRR A;  2VF0 A;  4E28 A;  4ECK A;  4O1X A;  1TSZ A;  1TSW A;  1HVY A; 
#chains in the Genus database with same CATH topology
 1TYS A;  1VZE A;  1TVW A;  1BSP A;  4XSC A;  4GEV A;  1B02 A;  2OIP A;  4O1U A;  3NRR A;  4PSG A;  4EZ8 A;  2G8D A;  3EDW X;  3CLB A;  4Q0D A;  1EVG A;  3IK1 A;  3KJS A;  4KY8 A;  4DQ1 A;  3C06 A;  3IX6 A;  1BKO A;  4Q0E A;  1KZJ A;  1ZPR A;  3GH2 X;  3H9K A;  3JSU A;  3EGY X;  2TDM A;  4FOA A;  3HJ3 A;  1TVU A;  3INV A;  1JG0 A;  3BNZ A;  1VZB A;  1F4D A;  4XSE A;  3ED7 A;  1BO7 A;  1NJE A;  4DPD A;  1RTS A;  2FTQ A;  2G89 A;  1TSM A;  3EF9 A;  3HBB A;  1BO8 A;  3N5G A;  2TSC A;  1KZI A;  3EJL A;  1F28 A;  1FFL A;  1JUT A;  3GH0 A;  3N5E B;  1NJA A;  4IQQ A;  4F2V A;  1TSY A;  1EVF A;  5WRN A;  2AAZ A;  4EIN A;  4O1X D;  1SYN A;  1BDU A;  1TSV A;  1B5D A;  4EIL A;  1J3J C;  2TDD A;  4UP1 A;  1BP6 A;  3K2H A;  5FCT A;  1VZA A;  1JU6 A;  2RD8 B;  4IQB A;  1AN5 A;  5BY6 A;  1TSX A;  4EB4 A;  3EHI X;  1TSL A;  5HS3 A;  1JMG A;  3B5B A;  3BHL A;  4GD7 A;  1THY A;  4G2O X;  1HW3 A;  2BBQ A;  1VZC A;  3DL6 A;  3BFI A;  5H39 A;  3UM5 A;  1TRG A;  1F4E A;  1QQQ A;  3DG8 C;  1NJC A;  4ISK A;  3UWL A;  3N5E A;  3V8H A;  3BGX A;  4KNZ A;  2ONB A;  1LCE A;  4FOX A;  1AOB A;  3IHI A;  4XSD A;  3C0A A;  5J7W A;  1TLC A;  2G86 A;  3EAW X;  1AIQ A;  1JUJ A;  1TLS A;  2FTO X;  1EV8 A;  2H2Q A;  3KGB A;  1BP0 A;  1J3I C;  2A9W A;  2TSR A;  3IRN A;  1BID A;  4H1I A;  1HZW A;  1B49 A;  1F4B A;  3EBU A;  1TSD A;  4H0U A;  4KYA A;  1DNA A;  4O7U A;  1EV5 A;  1BQ1 A;  2G8X A;  1LCA A;  1HW4 A;  3IK0 A;  1DDU A;  1JMF A;  5H38 A;  1J3K C;  4FGT A;  1TDU A;  1TDA A;  3UM8 A;  1F4C A;  3IJZ A;  1TJS A;  1TSN A;  1TDB A;  3GG5 A;  1TIS A;  2RDA A;  4FQS A;  1F4G A;  2G8A A;  1TDC A;  2KCE A;  1JMH A;  4ISW A;  3QJ7 A;  3OB7 A;  3IRO A;  2RD8 A;  4TMS A;  1JMI A;  1VZD A;  1I00 A;  2VET A;  4H0R A;  4KPW A;  4JEF A;  1QZF A;  1NJB A;  4DP3 A;  3UM6 A;  1KCE A;  1NCE A;  3HB8 A;  3BHR A;  5H3A A;  3CL9 A;  4GYH A;  3I3R A;  1AJM A;  1LCB A;  1B5E A;  3BZ0 A;  3BYX A;  3QGT A;  4KY4 A;  3TMS A;  3QG2 A;  1BJG A;  1F4F A;  4IRR A;  3DL5 A;  1BKP A;  1YPV A;  1AXW A;  1NJD A;  3DGA C;  1JTQ A;  3B9H A;  4E5O A;  3IRM A;  1SEJ A;  3UWL B;  1FWM A;  1BQ2 A;  4G6W X;  1BSF A;  1CI7 A;  1BPJ A;  1JTU A;  2FTN A;  4DPH A;  3KJR A;  1TVV A;  4FOG A;  4LRR A;  2VF0 A;  4E28 A;  4ECK A;  4O1X A;  1TSZ A;  1TSW A;  1HVY A; 
#chains in the Genus database with same CATH homology
 1TYS A;  1VZE A;  1TVW A;  1BSP A;  4XSC A;  4GEV A;  1B02 A;  2OIP A;  4O1U A;  3NRR A;  4PSG A;  4EZ8 A;  2G8D A;  3EDW X;  3CLB A;  4Q0D A;  1EVG A;  3IK1 A;  3KJS A;  4KY8 A;  4DQ1 A;  3C06 A;  3IX6 A;  1BKO A;  4Q0E A;  1KZJ A;  1ZPR A;  3GH2 X;  3H9K A;  3JSU A;  3EGY X;  2TDM A;  4FOA A;  3HJ3 A;  1TVU A;  3INV A;  1JG0 A;  3BNZ A;  1VZB A;  1F4D A;  4XSE A;  3ED7 A;  1BO7 A;  1NJE A;  4DPD A;  1RTS A;  2FTQ A;  2G89 A;  1TSM A;  3EF9 A;  3HBB A;  1BO8 A;  3N5G A;  2TSC A;  1KZI A;  3EJL A;  1F28 A;  1FFL A;  1JUT A;  3GH0 A;  3N5E B;  1NJA A;  4IQQ A;  4F2V A;  1TSY A;  1EVF A;  5WRN A;  2AAZ A;  4EIN A;  4O1X D;  1SYN A;  1BDU A;  1TSV A;  1B5D A;  4EIL A;  1J3J C;  2TDD A;  4UP1 A;  1BP6 A;  3K2H A;  5FCT A;  1VZA A;  1JU6 A;  2RD8 B;  4IQB A;  1AN5 A;  5BY6 A;  1TSX A;  4EB4 A;  3EHI X;  1TSL A;  5HS3 A;  1JMG A;  3B5B A;  3BHL A;  4GD7 A;  1THY A;  4G2O X;  1HW3 A;  2BBQ A;  1VZC A;  3DL6 A;  3BFI A;  5H39 A;  3UM5 A;  1TRG A;  1F4E A;  1QQQ A;  3DG8 C;  1NJC A;  4ISK A;  3UWL A;  3N5E A;  3V8H A;  3BGX A;  4KNZ A;  2ONB A;  1LCE A;  4FOX A;  1AOB A;  3IHI A;  4XSD A;  3C0A A;  5J7W A;  1TLC A;  2G86 A;  3EAW X;  1AIQ A;  1JUJ A;  1TLS A;  2FTO X;  1EV8 A;  2H2Q A;  3KGB A;  1BP0 A;  1J3I C;  2A9W A;  2TSR A;  3IRN A;  1BID A;  4H1I A;  1HZW A;  1B49 A;  1F4B A;  3EBU A;  1TSD A;  4H0U A;  4KYA A;  1DNA A;  4O7U A;  1EV5 A;  1BQ1 A;  2G8X A;  1LCA A;  1HW4 A;  3IK0 A;  1DDU A;  1JMF A;  5H38 A;  1J3K C;  4FGT A;  1TDU A;  1TDA A;  3UM8 A;  1F4C A;  3IJZ A;  1TJS A;  1TSN A;  1TDB A;  3GG5 A;  1TIS A;  2RDA A;  4FQS A;  1F4G A;  2G8A A;  1TDC A;  2KCE A;  1JMH A;  4ISW A;  3QJ7 A;  3OB7 A;  3IRO A;  2RD8 A;  4TMS A;  1JMI A;  1VZD A;  1I00 A;  2VET A;  4H0R A;  4KPW A;  4JEF A;  1QZF A;  1NJB A;  4DP3 A;  3UM6 A;  1KCE A;  1NCE A;  3HB8 A;  3BHR A;  5H3A A;  3CL9 A;  4GYH A;  3I3R A;  1AJM A;  1LCB A;  1B5E A;  3BZ0 A;  3BYX A;  3QGT A;  4KY4 A;  3TMS A;  3QG2 A;  1BJG A;  1F4F A;  4IRR A;  3DL5 A;  1BKP A;  1YPV A;  1AXW A;  1NJD A;  3DGA C;  1JTQ A;  3B9H A;  4E5O A;  3IRM A;  1SEJ A;  3UWL B;  1FWM A;  1BQ2 A;  4G6W X;  1BSF A;  1CI7 A;  1BPJ A;  1JTU A;  2FTN A;  4DPH A;  3KJR A;  1TVV A;  4FOG A;  4LRR A;  2VF0 A;  4E28 A;  4ECK A;  4O1X A;  1TSZ A;  1TSW A;  1HVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...