3EDRA

The crystal structure of caspase-7 in complex with acetyl-ldesd-cho
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
b'YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
total genus 47
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edrA00
3KJFA 4EHNA 4EHAA 1GFWA 2HBZA 2QL9A 2XYGA 2CNNA 4QU8A 2H5IA 4JJEA 3V4OA 5IAGA 2XZTA 3H11A 2H65A 4JJ8A 4QU9A 4EJFA 4I1PA 3E4CA 5IC6A 3IBCA 2CNKA 3NS7A 4EHFA 1RHRA 1SHJA 4JR2A 3H13A 1JXQA 1F9EA 2FP3A 4FGUA 4JQZA 4NBNA 4QUGA 5I9TA 4D3YA 4HQRA 3R5KA 4N7JA 4N5DA 3D6HA 1F1JA 2H48A 1M72A 2AR9A 4FEAA 4QUEA 2C2KA 3P45A 3R7NA 1PAUA 4NOKA 2CDRA 3UO8B 2J33A 5IARA 1RHQA 2C2OA 3R5JA 3S8EA 2QLBA 4PS0A 1PYOA 2QLJA 4N6NA 1KMCA 2CNLA 4QUDA 2J31A 2WDPA 4PRZA 2H4WA 1K86A 4QTXA 1RHUA 4ZVRA 2H5JA 4D3ZA 1ICEA 2Y0BA 4QUJA 4N6GA 4JQYA 5I9BA 4DCOA 3BIJA 2CJYA 5K20A 4QUAA 3GJSA 4FDLA 3SIRA 2C2MA 4QTYA 4N7MA 4M9RA 4NOLA 4PS1A 1NMQA 4JR1A 2HBRA 5IBPA 2FQQA 2NN3C 2Y1LA 1RHKA 4AWAA 5IAJA 5IBRA 3KJQA 5LUBA 3NR2A 3IBFA 3SIPA 1RWVA 3K7EA 4DCPA 4ZVTA 3PD1A 4ZVSA 1GQFA 4QU5A 1QDUA 5LU8A 2C1EA 4DCJA 1NMSA 5IAEA 4QULA 4ZVQA 1NW9B 3QNWA 3V3KA 1RWKA 3NKFA 4JR0A 1RHJA 3H0EA 3GJRA 4QUIA 5JFTA 2XZDA 4JJ7A 2K7ZA 2XYPA 3PD0A 3S70A 1QTNA 4IEFB 5IC4A 3DEJA 1RWOA 4FXOA 1CVRA 3D6FA 3R6LA 5IABA 2CNOA 4NBKA 5LU9A 1I51A 4QUHA 3R7BA 2HBYA 3V6LA 4D3XA 2CJXA 4EHKA 3P4UA 4HVAA 2QLFA 3H11B 4AW9A 5IASA 1RWNA 4LSZA 3DEHA 1K88A 5H0IA 1I4EB 4NOJA 3KJNA 1RE1A 4IYRA 1I3OA 3ITNA 3DEKA 2H4YA 1BMQA 3H1PA 4I1RA 3DEIA 5IAKA 4EHLA 3GJQA 5IBCA 1RWPA 4NOMA 5IANA 2FUNB 1IBCA 3UOAB 1RHMA 3EDQA 4ZVOA 4HQ0A 2C2ZA 4PRYA 3V4LA 1QX3A 3GJTA 1RWMA 4QU0A 4EHDA 2J32A 2DKOA 3V6MA 2HBQA 1SC4A 1RWXA 3R7SA 4AWBA 3V55A 1NMEA 2H51A 1SC1A 1SC3A 3EDRA 3RJMA 5LUAA 1SHLA 3OD5A 4QUBA 1RWWA 3R6GA 2P2CA 4JB8A 2XYHA 4EHHA 2J30A 4NBLA 3PCXA 2H54A 1CP3A 4ZVPA 3D6MA 4N6OA 2QL7A 2QL5A 4ZVUA 1I4OA
chains in the Genus database with same CATH superfamily
1JA0A 5JAPA 2PUBA 4I19A 1E64A 4G4IA 5CCEA 2Z9DA 5K2OA 4JVLA 4UUOA 1SHZA 3GUYA 4RSMA 2K5UA 3ENNA 5F9HA 4H15A 2FSVA 3U9SA 4K88A 3O8RA 3DBRA 4D56A 5JMWA 4ZDWA 1MMFB 1K8RA 1OV6A 2EKBA 3C7KA 4FGUA 4IDGA 4OFZA 4X1IB 2C5SA 1Q1EA 1M76A 1VCIA 2Z95A 4I1UA 4KI7A 4YJKA 3TEFA 4CM3A 1WPQA 3E3AA 3WNVA 1XVUA 1QGYA 4CKYA 4A1OA 1JR6A 1RYNA 2IV3A 4MJ7A 3A6GA 1G7TA 2RGNA 1CR6A 4BMSA 4YS6A 4JMLA 3OQJA 4OIFA 4EITA 2JG3A 3BF7A 1UFOA 1YKGA 3FI0A 2II6A 1F2TA 1Z5VA 4HB4A 5HG0A 1YE3A 3A3OA 3JWGA 4UHBA 4ZO6A 1CJUC 1F0KA 1SWVA 5DIFA 2Q3CA 5EZ6B 3V1MA 1C7QA 4Q34A 4UKDA 3UMRA 4X0EA 4G5SA 1ZKMA 3TKAA 3J81k 2IY8A 1KEEA 1ETUA 2WPDA 1IATA 2QSZA 5DH9A 3ZLVA 4OQZA 1U2EA 1DBPA 1ZH0A 2JI8A 3NFYA 4E11A 3AUSA 3GCGA 1EDZA 2FSGA 1U7TA 1HSOA 5IBRA 1R4MA 2QLMA 1LPOA 3VYSB 4D81A 1KVSA 2B4QA 1J20A 2B1QA 1C9NA 4DEXA 1EVZA 3K0CC 3BN3A 3PITA 4JOCA 3WBJA 5KREA 4NECA 2DGDA 3MGKA 4BYMA 2ROQA 4OQYA 5LU8A 2IU0A 3FZNA 3LVRE 4F7DA 1BG6A 4A4DA 3OIDA 4DCJA 2QW8A 3CE9A 4ALKA 4KQ9A 2PUTA 5F9FA 2IY7A 3BA1A 1QIMA 3X43A 2OWDA 3I58A 4FJ0A 4TMFA 1V7QA 1S6YA 3PLAE 2BKEA 1O95D 1T1EA 5FQOA 1UP7A 3IKTA 4JUCA 3N6VA 4DR1B 4GKKB 2HCFA 1O5TA 4ZXPA 1Z4NA 4B3IA 4AS2A 4TKMA 4ZP1A 3LDAA 1A27A 1LLUA 4YUXA 4L95C 5E9JA 7YASA 2V5VA 3O6VA 1CRLA 1N7GA 2HQ1A 4AMUA 1ATIA 3RYCB 1Y6FA 1T26A 2EJWA 3GLUA 1GYQA 1B3BA 4X8MA 2OXFA 3K0FB 2HIMA 1SB9A 4S35A 5E8JA 2ACEA 1EHCA 2V8BA 4ZA2A 4BV3A 5LIRA 4QDTA 1GU1A 4TT3A 4BP8A 1Y9EA 2BZ1A 1DKRA 2VHQA 5F9MA 5TB5A 2E55A 4EY3A 3QYJA 1S3IA 3M9LA 1VE6A 3I09A 2JFBA 4MKIA 2ZLBA 5DP2A 4ON9A 4F38A 2NYUA 1P4RA 2ZB3A 1YOBA 2FPOA 2MU1A 1I2DA 3I34X 5I7VA 3U4DA 4D82A 2IH2A 1NYTA 5EERA 4DKJA 2YHBA 2EDAA 2QRKA 2PMDA 3LT1A 4JIGA 3A1FA 4NPHA 1XEWX 5DBFA 1K63A 5J5AA 2WFLA 1W35A 3WC4A 1MX9A 2JDIA 1D1PA 1FNDA 2R5WA 1NIJA 3PLNA 5F23A 1HTTA 3GCZA 4JJZA 2JFNA 3CG0A 4JUIA 4QBGB 4Z99A 2QL6A 3WY9A 5JY6A 1TXGA 2IPOA 1JHRA 1EWYA 4C4TA 3E4CA 1O8BA 2HRZA 5LM3A 2I8AA 3PGXA 4BQIA 3ZDBA 3OC0A 1RHRA 3E18A 4GKAA 3RFFA 2EF0A 2KYRA 4YHBA 2DFLA 2CNDA 3MTGA 3DO6A 3PQDA 1W34A 2ODPA 3N8HA 5HCIA 5JV5A 1RR6A 1UMCA 2C77A 4P7BA 3ZQUA 3DM5A 1X38A 3ZKAA 1VYVA 4R6WA 3EXIB 4GPIB 4M54A 2E6KA 1Z29A 2Y1OA 1RXYA 3QV1A 3S8EA 1W7AA 1ODFA 1Z7GA 1JEDA 3N0VA 5KOHB 4H59A 1KMCA 2B4AA 2CNLA 3G6WA 4J0EA 1ZONA 1Z5NA 2H2FA 3M1YA 3E9MA 4JL5A 2XB9A 1BXRA 1KJNA 4J1TC 5EPEA 2RG7A 1DC6A 3H2SA 4DQLA 4EB3A 1VI2A 2FN8A 4W5QA 4YAIA 1YD7A 1NR1A 4DCOA 4COKA 4K28A 5P8WA 5YASA 3TRIA 3KE8A 3SIRA 3NWPA 1OVGA 4H17A 2GBLC 3PNVA 1WMAA 1BQ3A 3MILA 1Z82A 2ZQYA 1VKZA 2AXQA 5BV8A 2ZVJA 3L4EA 4LYYA 3Q8WA 3ZDDA 2VFAA 3AEQB 2VQEB 1E3SA 1OI3A 5HILA 2X86A 2FY8A 2WWGA 4CNQA 1NVDA 1BWPA 1I3KA 5H80A 1E9RA 1VSUA 3NGLA 1PKEA 4YA6A 1NOIA 3A58B 1MNQA 5C4GB 1AKTA 5E1OA 1OB5A 4F3CA 2MSKA 1ACMA 4BHTA 1A5ZA 5LR6A 1PL0A 3M8KA 3KCQA 5AW4A 4O2BF 1IDOA 3K0FA 5FWAA 5BYBA 3ZCPA 2PX2A 1DXQA 3WGLA 4C3OB 3ETHA 4Y2GA 3SSAA 5B7PA 4KXMA 5HOQA 3VJKA 3O4HA 2K7FA 2Y4NA 4R5MA 1OXKB 1YNOA 2K4MA 3ZDZB 1W6UA 3R7LA 5THQA 2Y66A 4BJHB 1FJXA 2J3IA 3K0AA 2EARA 2Q3LA 2FUG1 2Z3ZA 3GUHA 3HVUA 2VDLB 4HK4A 3OE1A 2HF2A 1I10A 3M81A 3QKSA 4NCHA 5KINB 3PI7A 1E6MA 4G0OA 1MVOA 4MRSA 5AK4A 4BN4A 2ZRCA 1MJGA 1XZPA 3P2KA 3DBRB 3Q0IA 4HSGA 2EXXA 3BWEA 5GOZA 2YVUA 3FUUA 4E2ZA 3LCJA 1NE2A 1XPJA 3N53A 4H35A 4NJMA 1JU9A 3U7FB 1QCDA 4L76A 2NTEA 5AUQA 1A9ZA 3TL3A 3NWBA 1OU0A 1CUUA 1R0KA 2BR4A 5KSPA 3T9EA 5E2AA 4LZWA 2QN6A 4XW2A 1D5CA 4DA8A 5KWSA 5J2UF 1YB4A 2P2ZA 4LYFA 2VHWA 3HCWA 3ZX5A 4D0LB 1CXZA 4FFSA 5JH7F 1L4GA 2QD3A 3N2ZB 3C3JA 4JB3A 4RGYA 3RVDA 4B1FA 4C0BA 4YMWA 1H93A 1OXMA 4AG3A 4DZZA 5IX8A 4U5QA 5CB6A 1DJQA 4B8WA 3M6AA 4RTOA 1X19A 1BA3A 1SUBA 1ZDMA 2G80A 3E3OA 1HDIA 1UCFA 3FYUC 4I3FA 4UEKA 4X8LA 3RI3A 1Q7RA 2R4UA 2IEBA 2QZJA 2EP7A 3HJAA 4PAGA 1VGQA 4DCSA 3W8EA 3C6BA 4Y2SA 4D02A 3KWFA 3B85A 1UDAA 3O5AA 1KVUA 2X41A 4OGLA 5EXSA 4EJ0A 2W6QA 5DGDA 4NKRA 1M2OB 1UDCA 4ZAVA 3OEHD 5C51B 1D04A 1E69A 1GADO 4B7CA 1GAWA 2VA9A 2HL6A 2ODTX 4YWJA 4PXAA 1Q1ZA 5J9FA 4E21A 4QT4A 4Z6KA 5B3JA 1Q1GA 3MWJA 2BE7A 3ESQA 1SU4A 3SNKA 1WG8A 3OCUA 1ZZEA 1RYEA 1VKHA 3MMXA 2GWHA 1QYXA 2FP4A 2FA9A 3P94A 3W5JA 1WE2A 3KYDA 3OFSA 4R7ZA 2DSNA 1JE1A 4P98A 1R10A 5AI6A 3HSYA 4JLKA 2SECE 5CX1A 5CBKA 1CE8A 4MUEA 1LDMA 4IJMA 1KZ1A 5KSOA 2C82A 1YZ3A 1WUJS 3AOGA 2VK2A 3AU8A 4MQLA 1YS1X 6YASA 2MOKA 4QBFA 1R6TA 1XZFA 3IUQA 2HRBA 3PCRB 4QQRA 4TTVA 3BXFA 1ISPA 1MQ9A 3UENA 3BIJA 3OTWA 1N6KA 2VNIA 2NG1A 2EX1A 4R1PA 4IKOA 2O3JA 1WNFA 3RC7A 2HHCA 3LUFA 3RF6A 3EGVA 2F55A 2SBTA 3OQNA 2O8CB 4QPDA 4Z9YA 7ABPA 3IVGA 2B2XA 1UAYA 3PFBA 3T15A 4PZ9A 1FW8A 1EH5A 2WVGA 2F9MA 1T2EA 2HWXA 2PV0A 1LDYA 1GPWB 3LXRA 4GXQA 1KEZA 2J7PD 2YHAA 3GDFA 1E1YA 3OZGA 4GPBA 2IWRA 3IQFA 4RIFA 5CCDA 1NW8A 3FCAA 3RSFA 1E32A 2ODEA 5BUZA 4JLUA 1KH1A 3F9IA 3EIFA 1N1GA 3HU5A 1XC7A 3WLHA 3A6ZA 4FFWA 2NO6A 4RJTA 5H4HA 3T3DA 5AW0A 3IEMA 2VJKA 5D3KA 1U7HA 4JBWA 4DF3A 3KD2A 3EAGA 3V3KA 4KBGA 1GCAA 5DI9A 2W4QA 3ROFA 2R7LA 2EF1A 2YXNA 4JA2A 1QUFA 4M87A 3SC4A 1QP8A 2RAFA 3I45A 3CRRA 3UT5A 3KOZA 5ALMA 5D6OA 3W1VA 3Q6NA 5ALWA 2WFLB 4QKQA 4GT1A 2PT6A 1YZNA 3NI2A 4IDOA 4OAOA 3DOEA 1VCHA 3FWPA 2JGIA 5KX5F 4G85A 2CWWA 3R6DA 4LK3A 3V7FA 5AHXA 4CV0A 2O23A 5B7GA 2R7AA 1J2JA 3RASA 4UXIA 3SM3A 5ITSA 4I1RA 3F5QA 2FGKA 4JBGA 4JJGA 1WHTA 4AULA 4MVWA 1V5WA 1C50A 1TCAA 2ACWA 4HLDA 4DCCA 4EW2A 1SJ9A 3M5WA 1J90A 1RHMA 5E1DA 5FLEX 5DULA 4DLAA 2HF8A 4CYMA 4OK6A 2H4JA 2HO5A 3F3KA 5IVPA 1N2ZA 5IXYA 2G76A 5COQA 3IPLA 3UC5A 2XNSA 2W98A 3PT5A 1XUOA 3FPGA 4UM8B 5JLAA 4YCMA 1YV9A 2LUOA 3QTTA 3OUZA 3VKUA 2NMVA 2WJVA 2BZGA 1TL7C 3RS9A 1PDWA 3EC1A 3MTEA 1F3OA 1PLJA 4PYRA 2IZOA 3HDVA 4KAXA 3QU5A 4N6OA 4FMPA 1CFJA 4Y1RA 4LRUA 4JWTA 3UB2A 1JHVA 2PN1A 2AG8A 2YHIA 3B70A 3PPWA 4MUNA 3LC1O 3O3CA 1SHUX 5DHSA 4C5CA 3QSGA 4OA5A 3CZAA 4YYZA 1NWHA 1T0PA 3ANTA 1N8NA 4D96A 4IHKA 4BNHA 1O97C 3JTMA 2FWMX 2QTRA 2FPPA 1M1YB 4CQNA 4MCIA 4OKSA 2GUWA 2QM0A 2NZJA 2SHKA 4FFBB 1U7DA 1HI9A 1QUEA 5JTUA 5EIXA 4FNGA 4KBFA 3FF4A 5EZQA 1NQVA 4HLQB 4W82A 3A1SA 5EIFA 2HDHA 2IDMA 3GQBA 4RPJA 5ILQA 2GESA 2NVUB 2FWNA 3I3SR 4RA9B 2XV1A 1BAPA 1L7EA 4D41A 4TWZA 4YJ3A 3G0DA 2OG2A 2QSYA 1A5TA 1P3Y1 3NVDA 4LMAA 4PANA 3VX3A 5HFNA 3GF4A 3MJFA 4M46A 3NTOA 5ESXA 1P7YA 3PGMA 4O5AA 1CY4A 4ZD6A 1G38A 2IYQA 3MWGA 3PD7A 3O8OB 4UVEA 3OJEA 1FQOA 1SUEA 3CUTA 4G89A 5DHAA 4A36A 4FDMA 2GN4A 2FEXA 4QXQA 4ZHSA 4DJFC 2BMJA 2FSHA 1KC1A 3GGSA 2EG9A 4CL2A 3S2UA 1JSXA 4A2CA 4ND4A 3GZTB 1G20B 5B1SA 3ZJ4A 3OQIB 4MICA 3QSYA 2J9FA 4M8IA 1Y7HA 4Q7JB 5BSTA 3HDQA 1APBA 3RK1A 3K2IA 4L78A 4BZZA 1ZIXA 4IDBA 2OXRA 3ORHA 4EFDA 4Z4GA 5A0TA 3ONEA 1LGYA 2YDYA 1QQBA 4B7ZA 1ONBA 1ZIYA 4CEHA 3GMSA 2J0UB 5L3SA 5B3AA 3ZG6A 2SNIE 4ZWNA 3PG5A 4RWZA 2ANCA 3AF2A 2CXNA 5TQ0A 1VPDA 2FMFA 5BSEA 1UXKA 1NR5A 1ISIA 1B73A 3PXUA 5KYWB 1IEXA 2BW0A 1Z0SA 3KYCA 4ZREA 1K89A 3L7MA 4AY4A 1QRRA 2GDJA 1YS6A 2DFKB 4JKIA 4D9JA 2CE7A 3DNMA 3Q11A 1DUIA 1TQ6A 4AJ2A 1TKAA 1CYEA 3AF1A 3G9TA 4MHTA 5EAIA 4M7WA 4Q9NA 3H86A 1YHYA 3CNOA 1XEXA 4YMTA 3RS2A 3VO2A 4C76A 2CXQA 3UMVA 1TW3A 3ZE0B 5IABA 2EKQA 1INLA 1U6IA 1EVQA 1CNFA 1Y37A 4TL6A 5JJKA 2ZFUA 1TQ4A 2HU2A 1E3QA 3GIWA 1YJXA 4RV9A 4WV3A 5D5HA 2H1VA 4ZQGA 1CU1A 4DUGA 4YJFB 2QUJA 4O2RA 4OGWA 2QE6A 1QZ3A 2NVBA 2O7SA 2CBGA 4PXYA 4WEQA 1USWA 5DT9A 4FFVA 5JS2A 3LAWA 2QX6A 2QAGC 2JCSA 2KI5A 4HWPA 1NMXA 1XDBA 2X58A 4RZQA 4YRSA 5IAOA 5JZMA 3BGOS 3KDPA 1VCOA 1ZP6A 2YIMA 4KQKA 4A2PA 3TMYA 3P9PA 4JN6B 3TLZA 4A5SA 3EEOA 3CG4A 5EQFA 3C8HA 1W1UA 1NC1A 2X6TA 2W2LA 3RYTC 1BVUA 3KB2A 5D6NA 3IPRA 1PG5A 1YQQA 4ZVMA 1UBEA 2IYRA 3N0WA 1Y9JA 3Q3VA 3WIUA 1Q0QA 1HR0B 2V9PA 2W93A 3WXBA 2C83A 2A94A 2AXPA 1ODCA 4IJ6A 2Q0SA 2RBGA 1PLLA 3QY0A 2HF7A 2I78A 2ZRLA 2E2WA 5AVQA 5KNDA 2X3YA 1SNYA 1LTKA 821PA 3VR5H 1N3LA 2XWSA 1LH0A 4IOLA 1ADGA 3TINA 3VHXB 1CY1A 4ND5A 4N01A 5AHRA 3K32A 2DKFA 1C14A 3Q7IA 1NLMA 2UYQA 3O3OB 2G07A 3EMVA 3OEHA 1SU7A 1PZEA 1QVWA 4NARA 4D45A 2H5EA 1A04A 1XRMA 4MIEA 2JEYA 2G04A 2LCIA 2V7VA 4TM7A 1RRKA 2CMDA 4W5OA 4K6FA 5LA6B 4G8BA 4LSMA 2JAUA 1RYBA 1JWAB 1N34B 3BERA 1CRZA 4JEIA 4TWJA 2IELA 4C2UA 1UDWA 4ZKDA 3RJ5A 2AEEA 4QJBA 3NH9A 3UV7A 4PU0A 1NXWA 4DYHA 1TU4A 2C3YA 2FEWB 5TC4A 4HKTA 3FJ1A 1VPWA 4FS3A 3OT4A 3NBXX 4IM7A 5FD8A 4EO4A 4W5JA 1CTQA 3WHLA 1BXRB 1MHTA 1ND5A 2C2BA 1FRNA 4R6XA 2ECPA 1ST2A 3FSJX 3WLAA 1HL7A 1VXRA 3E9RA 3P9KA 4NOLA 2J08A 4N5HX 5ERYA 2ZYTX 5FR2A 3KOYA 5G4KA 3VVLA 3DTVD 3EMDA 1G8FA 1RAHA 1E5DA 3OQOA 4QL3A 4AYXA 4W7SA 1OIWA 3W8RA 2PNJA 1BWSA 1D4OA 5C0OE 2B9EA 3QEAZ 3KALA 2J4DA 3F4KA 3FWNA 3M33A 1CEQA 1YONA 1UPBA 3FWHA 1HKUA 1VA5A 4ZAGA 2WD7B 4FB4A 1ORIA 2WKQA 3FKJA 5FORA 2GEBA 2V65A 4ZCQA 5IW8A 1PTJA 1S2DA 2R8PA 3SJBA 5K3BA 3AOEA 2Z4RA 4G8CA 4WOJA 3TH5A 4B09A 3HB5X 2HCJB 1CCWA 1FDOA 3FDXA 2Q62A 4GWGA 2B69A 4J1NA 4L6CA 1US8B 4OQEA 2FUKA 4QFCA 1WOMA 4UHDA 1RYYA 2PMKA 1A3CA 4B6PA 2IQ5A 4KGDA 3UK0A 3V8BA 4MROA 2A9PA 4YJGA 1SC6A 3LECA 1B7GO 4MSUA 4JI2B 1HDRA 2C04A 3C7AA 4QNRA 1VC2A 1VL1A 2WIKA 2ZE7A 4DPKA 2PUAA 3CCFA 1JFFB 5FBKA 2XZLA 2ZTVA 5EJAA 3MG9A 3FY4A 3JD3A 4TTTS 4X00A 2A78A 4YRQA 5H0IA 1I4EB 1U0JA 3AI3A 4ZYTA 2R6FA 4KQ6A 2VDQB 2YTZA 3H9QA 2PGOA 3SHOA 2GVZC 5CPFA 1LX6A 3JZDA 2Q9BA 1XYVA 4LZNA 4Z2YA 1OD6A 4AMBA 4TRMA 3AFGA 1N33B 1ZXXA 3E7PA 4QGBA 5FBWB 4XUDA 4EA6A 5BV0A 1BXGB 4QIHA 4URVR 2WIFA 3DMTC 3GELA 1RYFA 2QTCA 1O6CA 1QHXA 1Z2EA 5I7OA 3BSWA 3TMKA 1R9NA 2IP2A 3PPXA 2RH9B 5DWDA 4ASUA 1HE4A 1XZCA 2JK1A 1GDDA 4QJIA 3S1AA 2VATA 1Q3TA 4ZOLB 4F5WA 3JAKA 2PS1A 4UMVA 3CUKA 3PHGA 3WLEA 4QGAA 5FEUA 2PVPA 2YIVX 3CEPB 5F77A 3FDJA 3CSUA 3E7FA 1I4OA 3TIIA 4TN1A 1V1MA 4Y2JA 3TLEA 4P4LA 5BORA 1Y6JA 1XZLA 1E1CB 3AR9A 2IXFA 2EU8A 4MUIA 3HCBA 3U6BA 2DHCA 2WYHA 5BW5A 2DPXA 3A6KA 4MOWA 2GYWA 2R86A 1T4CA 3QLVC 1QE0A 4W9RA 1C1XA 4PZLA 3C70A 1IG3A 3FJYA 1M3SA 3CRZA 3CSSA 5IXJA 1D03A 3UJ9A 3LPAA 3PWTA 3BXGA 2OO7A 2BEUA 4KDCA 3B1ZA 1UPUA 4NK5A 4R3UC 5AMXA 4AJPA 1KC3A 4JEUA 1LLFA 1QAOA 5IMSA 2FP4B 3OZEA 3ORSA 4UAJA 4PNEA 4MVXA 2BDEA 4GXRA 5GOTA 4MWSA 2OORC 1RJWA 2PWZA 1NVFA 5K99A 1U6JA 1MV5A 2CFIA 1XELA 5F2OA 4K9PA 3FR7A 1W1IA 3MAAC 1ZGCA 1Q20A 4G5QA 4D0NA 4DM7A 2DU8A 4RDXA 2C1XA 2TYSB 3D0QA 4XJXA 3P2YA 1WUHS 2HJSA 5F3RA 2H2DA 4ESEA 3KOXA 1USUA 1GFSA 4CHGA 3GYGA 5LN1A 3WGYA 3D0OA 4UHKA 3ILYA 2O54A 3ZZMA 3KOWA 1KXZA 3DAFA 5TT1A 3UA3A 4NHOA 4ETMA 1BMDA 3ELUA 4L08A 2NU9B 4ZVNA 4ZZ0A 4G2NA 2VUUA 2J09A 2B83A 2Q1TA 3C0KA 5TGTA 4TL7A 2PGLA 4UBKA 4YIHA 3JQGA 3TNFA 4HFRA 3BDAA 4QPNA 3LWNA 1D09A 4RQBA 3FRHA 4MUMA 3KZCA 4NNOA 3STUA 3C43A 5TGZA 1UMCB 2C54A 4HADA 4V0QA 2DQSA 1EMDA 2R96A 2VKQA 4YJDA 4DR2B 2QYTA 4JR0A 1IXYA 1JSLA 1W49A 3IH5A 2E4AA 3CEHA 1Z75A 2VDVE 4ACBA 2UXBB 1EB8A 3A3NA 1SC9A 1COWA 4JNKA 6AT1A 2W2PA 3UJCA 2V1UA 1L4KA 4GSYA 4BO7A 4QJ5A 5ALGA 4KRYA 3DL0A 3ZBPA 2G9RA 4U7DA 4BJ3A 1NJ5A 4BFLA 4KRFA 3PGVA 4GM0A 4RE6A 1FPMA 4LW8A 2GN2A 2Z2ZA 1OBCA 1B15A 3GRZA 5T64A 2Y2UA 4B43A 5JAIA 4BJ6A 4GGOA 13PKA 1T5TA 4A8PA 5J2TF 2J7KA 1QK3A 3N87A 1H8HA 5B4VA 1X7DA 2JBHA 2AZDA 5IUKC 1HT2E 3K6SA 3ZY3A 1E5XA 4S0ZA 4PO9A 1E6LA 1KO7A 4O02B 2NU8B 1G21E 2GSWA 1MW8X 4Y2HA 3BZUA 1WJGA 3ZJVA 2BHTA 2B4TO 1D4ZA 1QYDA 1UXJA 2R4TA 1F60A 2VJNA 3IEUA 2E9SA 2V5AA 3L02A 4XB6B 4ID9A 1JEYB 2J32A 1XMJA 4HG2A 4ZCLA 4D43A 3JQAB 3U7HB 4CM5A 4DDVA 4Z3OA 3S2GA 1TU3A 4MXDA 1UQRA 4IV5A 2PS3A 3AMVA 2H1CA 4IIUA 4ND8A 4OSPA 4PGFA 3SEAA 5IYZB 4G5XA 1E4YA 2VRCD 3Q41A 4B7XA 2NV0A 2Q27A 1MABB 1G3RA 2WLSA 3AM3A 3V46A 4IH1A 1NVVR 2ZITA 4ICIA 3F98A 4MGHA 1JR3A 3PU6A 1YCDA 3VRHA 2WHPA 2QUHA 2VPIA 3DMDA 3MERA 3E2PA 4K6MA 4UZFA 3GCDA 4B6RA 4BJ5A 1Y4ZA 1WDWB 4E1AA 1BGXT 5BV7A 2A5GA 5ICMA 3DE6X 1I33A 3UBMA 5A9SA 5AVJA 3UWSA 5AW7A 1DIGA 1CY0A 1RDFA 3QKRB 2H65A 3DFIA 5JY1A 1LU9A 3Q40A 5FI0B 3LXUX 1YR6A 1UBHS 3DQQA 1Q0PA 1GILA 2GM9A 2XWBF 3K96A 4NLLA 3F97A 4BB6A 1AGRA 1EQ2A 1TK9A 4RHUA 1J39A 4I4IA 2AKYA 2ZBPA 3KSMA 3TRJA 4EW6A 3RSLA 3AUAA 5EHGA 4JXXA 4KUEA 5TXGA 2FPIA 3IR7A 2YZMA 3MTIA 5AW9A 3THYA 4F0JA 2JL1A 5DM2A 4F21A 4HP8A 5SYAA 2FEOA 2QYHA 2P5SA 3DXYA 5AW3A 4LJSA 1BQ4A 3S2YA 1DX6A 2V6IA 3I37X 4BNIA 2XDQA 1T9KA 1XXHB 1ZMXA 4D9HA 2PQ0A 2RHDA 5BOVA 3ZHTA 2H16A 2IA5A 3NOQA 2XUPA 3CT4A 4FT4A 1I24A 2BCJQ 4EY8A 3DE1X 2V0CA 3RRMA 2WMNB 3QXSA 2EBFX 1A76A 3N6RA 1MENA 5HYVA 1F0YA 4LDNA 4QTYA 4JYPA 2ORED 1UBFA 4F3NA 2EIHA 5ISMA 1DC5A 4M9CA 3WFZA 2C9ZA 1IOZA 1HBJA 1KI2A 1JG1A 1O57A 1OX6A 2G82A 4L8GA 5EY5B 2WDZA 4HQKA 1AN0A 1Q0LA 4F72A 4Q4CA 4JI8B 3B7PA 3QLJA 1RHKA 2D4HA 3A9RA 4PPNA 3ROQA 2XNDD 3SZLA 1PJTA 3TR0A 2QNBA 3KXLA 1V35A 2D54A 5I7UA 4NYIQ 2C42A 3PEYA 3CR7A 4UNIA 3HXOA 4EGSA 4FZ3A 3EXHA 2BVNA 4IFTA 5GJVC 4ZOEA 1B0PA 2A0FA 3CM0A 1EG2A 4RLFA 2PYIA 2A58A 3EJWA 3PFHA 4U1RA 5CNMA 4DY6A 1R5NA 2AS0A 1QC5B 2G70A 4HPJB 4TL8A 5CJJA 3VA7A 4FLFA 4EW1A 5F1YA 2FF5A 1H5NA 2DH6A 4AKGA 1UKZA 1SPBS 2XYPA 5KUTA 2P77A 1GSAA 4IEFB 1MHPA 4LQCA 4UUBA 1M75A 2ZU6A 2HLDA 4RD0A 4RK7A 2AX4A 3RVRA 1KWKA 1NXPA 3FF1A 5AKLA 3FKQA 5LLSA 5JSZB 1NUAA 1PTKA 2FX2A 1M7BA 2FRDA 4IWXA 3V80A 4XSVA 4IICA 4CQMA 3OTOB 1WMDA 4IUDS 4GZ3A 4RDHA 5DNVA 5KOHA 2G9UA 2CUZA 2J8ZA 3HBMA 3I76A 1FX0A 4MS1A 4Y2TA 1Y33E 2FG5A 1EJBA 1EAYA 4OI2A 1JLLB 2IPLA 4GX0A 2WK1A 2YRWA 5L8VA 1NMZA 3C6ZA 1TTHA 5ECDA 3VBEA 4JLSA 3G8DA 1DKPA 1TKRA 3ZQJA 3D02A 4QPPA 4GGMX 4AJHA 1H8HD 2IX9A 1N3YA 2AJDA 2X1VA 1RM4A 5K09A 1STOA 5H8WA 1D07A 3C3WA 2I2AA 2WHPB 3EIXA 3WZ2A 2HMVA 1JWBB 1M6EX 4II7A 3IILA 1S3GA 1AKYA 3Q72A 3Q6MA 4FR5A 4BO9A 3U19A 5CEJA 2X9GA 5AKHA 2O5EA 2HMWA 2PZEA 2C9CA 4UHEA 3GRFA 4XVQA 1O5OA 2IPNA 4KH0A 4ZOLF 3T3MB 1TC2A 3UAGA 1NAIA 2IHTA 4U7JA 1ZHFA 1QWSA 5JPIA 3X1ZA 5T4EA 4D0SA 4UHFA 5G0SA 3HJUA 5E6RA 5C18A 2GBIA 4QA9A 4BNGA 1B16A 2UVPB 4G36A 2IYSA 4OHFA 1BJRE 4ENSA 1GPNA 1XGKA 1JJIA 4FZJA 3PNKA 3EPKA 4B8ZA 2WABA 3UHOA 4EPXA 1WEKA 1X70A 4WINA 3UF0A 4BECA 1Q16A 1S9HA 1KORA 3RK4A 3AW9A 1SFRA 2C5BA 5BQOA 1DBIA 4HYTA 2OZKA 4B33A 1DC3A 2IP1A 2HHLA 2Q3JA 2DPMA 4JKOA 1XXHA 5JFOA 6ADHA 1AM4D 4MEJA 2JGJA 3BK1A 3BZBA 4A9AA 4E5DA 3ER8A 4F9GA 1E3MA 4ZXFA 4LY9A 4MO2A 1F2DA 2ADOA 4CNBA 5I7FA 1TVCA 3LW8A 4JHLA 3GRKA 3ZDXB 1PR1A 1C1DA 2JLCA 3O95A 2Q6KA 4JK3A 3Q2IA 5GPBA 1HX7A 3BXHA 2RH8A 4PIMA 3A8TA 2DLDA 3I4CA 4YGYA 3RVBA 3WLKX 5A62A 3ZUGA 3HNPA 1RMQA 1QE3A 1DELA 1RXVA 1ONSA 2FSPA 3QG5A 4ABTA 2I6GA 4YLYA 1EDOA 2NQTA 3PE3A 3NTQA 3BC1A 3CX3A 2WI8A 4KKXB 4FYYA 4YI3A 3C3CA 3EQ7A 2HQRA 2R1ZA 2F3RA 5BN5B 3VMFA 2WSMA 2ZJ3A 4JXJA 1IG0A 5TR9A 1S2IA 5DXJA 1PQYA 4DR4B 1B74A 3HP1A 1QS0A 4HLNA 3T3OA 2RK6A 3AZOA 2XODA 4J4BA 2C2GA 3QU7A 4HDSA 3OAAA 2M98A 1QANA 2VYCA 2V7TA 3IERA 2VKTA 4ITRC 4MCJA 4LNUA 2P8SA 3GDOA 2VPYA 3VC2A 2RGGA 2QHXA 3GJXC 1MH1A 4Y2QA 1RZRA 3BWYA 2PLRA 4AO6A 4LXTA 5SY4A 3A6PC 3EUEA 1UMDB 3AETB 1DX9A 4L7VA 2IOFA 4KLRA 4PX2A 4HAOA 3PEWA 3IHKA 1WWKA 3QJGA 3OO0A 2VWPA 2VHYA 1C0PA 3IQXA 1UFVA 1I3NA 2VOEA 1L3BA 3JYQA 4MMXB 5AI8A 1KYYA 1G5PA 3A1VA 3NEAA 3PBKA 4LA4A 1JFFA 4O2LA 4M88A 3OQIA 1K9VF 1MIHA 3TVYA 5CX1B 3FFBA 2IZZA 3BFKA 3UANA 3ZPXA 1KRWA 1QH9A 5IP5A 3PC8C 1TGVA 3L7YA 4EBBA 2YOFA 4CM9A 3VDNB 4LSZA 5LJIA 3WKBA 5D5QA 2QUZA 2HT6A 4R2XA 5B5SA 2B2CA 2LXNA 5D3QA 2BGIA 1E7SA 2YRXA 5CLFA 3ND6A 4FQ8A 4MEBA 4NYMQ 2A0YA 3H5OA 1GAQA 1ORWA 4QTTB 3S40A 5JEEA 5JXWA 4DA6A 3RS5A 3LCVB 3QYAA 4Z53A 2OAP1 1PVOA 2EW2A 2IITA 4ZO4A 2O8CA 1HE2A 3GH1A 5JSUA 3PQCA 3IE2A 4V3BA 4B3GA 2GOYA 3S1AB 2VCEA 4BDTA 1B14A 2PZBA 5KTYA 3MELA 2OZEA 4BCCA 3SIXA 4BLTA 2I71A 4E94A 2FJ0A 2QD4A 4R5HA 1H1TA 5HUHA 1LPSA 2RHJA 1FS6A 2EQAA 1OT5A 4Q1VA 4M37A 1Y48E 4S24A 2J5XA 4YRRA 5A4IS 4EHFA 1BA2A 3RKRA 1E2PA 2DUNA 4CV2A 1CJBA 1I2CA 1N2SA 4QAQA 4CQLB 2P9ZA 4F56A 1DC4A 1TFUA 5CFLA 1KKMA 4Q9JA 4N54A 1OWLA 4QU8A 1EWTA 1M6VB 2I8CA 2W37A 4AC9A 5C1OA 1JB1A 1OA0A 5JSQA 1L4UA 1XPOA 1EBFA 1U0RA 2FMHA 3KHTA 2W6JD 1RZUA 5FPPA 3CVJA 5A5FA 3EXFA 4IAOA 2OXTA 3WSTA 3UH1A 1J07A 1V3TA 1FB5A 2JCBA 2JGFA 3JQDA 2XBUA 5ALPA 2IXAA 3SI7A 4ZYXA 3MB8A 4N7JA 3UW3A 2BZ0A 4HTFB 4CMEA 4GKJB 4MYHA 2GZ2A 2O9JA 4JZKA 4DMHA 2BEUB 1I32A 3WLPA 4HT3B 5AK0A 1ISJA 2C9YA 4K46A 2C7BA 4CT5A 1WHTB 2V3VA 3FNIA 3PS9A 5ANRB 3W6PA 1SKYE 2XKAA 4UCQA 2WNHA 1G5IA 3ZWBA 2AXEA 2Y71A 2Q0HA 1NE7A 2L42A 2WIBA 1HOTA 4U7FA 1F3LA 5KJFA 4HB2A 3AR7A 2AN3A 4PLZA 2Q7OE 2BSQA 2GEKA 3RC2A 2DT5A 2EGGA 3FVQA 1X8XA 4R84A 2QN7A 4Y0NA 4DVGA 1IUPA 1NN0A 1NW7A 4DREA 4ZTZB 1BFDA 2BEJA 3U4AA 1RRFA 3IDQA 5ALJA 2BLLA 4ECAA 3A9SA 4CM8A 1NUQA 1UFKA 4EYKA 1QQ5A 3TEMA 4MDYA 4GZ6A 4KIWA 2VYVA 3T8YA 3R4VA 3WRVA 4B3DA 4IOJA 4RJKA 2Q3EA 3G7NA 1ATZA 3BGVA 3HYRA 3L6RA 3W6OA 2CZQA 1G5FA 4N0EA 2ANBA 4G1BA 4F9FA 1Z0FA 2VYNA 2H2IA 4I2VA 1RT9A 1XTRA 3OA0A 3V6LA 5I9IA 1R5BA 1G9TA 3EG9A 4WXHA 3L9WA 3MXOA 4PRLA 2L2QA 4QUIA 4IIJB 1WDKA 1E8NA 5JJIA 2X76A 3AHDA 4NJMB 3L1IA 4LRQA 2CB9A 1GEEA 4ZV4A 1MQAA 3IV7A 1C9MA 1C9JA 3AOEC 5DKFA 4DGSA 3M3PA 1DFHA 1JS1X 4C88A 5AM5A 1R2QA 1PJQA 3HM2A 1PJSA 1SZPA 3JQEA 1Y80A 4AO7A 2GFIA 4D6PA 1O96A 1GPLA 1EE2A 1XMPA 2RGAA 3DGFC 4MLCA 4EMBA 3JQ7A 1V5FA 3TQTA 2KW5A 4UDYX 5DEIA 2B34A 2RHTA 4G9BA 3U4QB 4MV8A 1QVAA 4AROA 4M1ZA 7AT1A 1Z6QA 3OP1A 4OMFG 1Z5ZA 3BQ9A 1JQLB 2OMEA 1H6CA 1QFYA 1ZGAA 3RS4A 2AI3A 3KAKA 2Y6VA 3JQAA 2YWCA 5K3SA 3EEBA 1JAIA 1LBSA 5AJXA 1E94E 3VBCA 5FOQA 3FRIA 3D6UA 4YJ2B 3HCFA 4MB2A 5F21A 2VXOA 3RFCA 3SJCA 2J0UA 5L3SB 3UQZA 1SOUA 3K0EA 1YS2X 3DUFB 5ES4B 1PGOA 1SUWA 1WP4A 4G84A 3TXAA 1OAKA 4L4XA 3P2EA 4V0KA 4PYOA 4ZJPA 2XIJA 1XZNA 2C7QA 2WF9A 2X0NA 1CUEA 2J3JA 4MVJG 5I4IA 4MHSA 4LZJA 1NVTA 4RLQA 4PE5B 1XL1A 3K3PA 2A92A 4Z51A 4ZI3A 3NANA 4P33A 4LDAA 5EYPB 2PUDA 5D1NA 3H16A 2FAXA 2BM0A 1QGDA 1LXCA 2HYDA 3GGCA 3H2KA 1KZYC 4Z3DA 5E9AA 4UQLA 2NSHA 4L0QA 2I34A 1GPH1 1TO1E 4X1IA 4HDSB 1YULA 3IA2A 4FVTA 4DUPA 4CKWA 4JR2A 4MUKA 4BKUA 5DNYB 1YVPA 2H1FA 4HOYA 1WPRA 4RVGA 3BJZA 2WJJA 3LBHA 1BCRA 3A4NA 3H5VA 3CLSC 5FYQA 4PAQA 4B4OA 1XWIA 2VQDA 3DPSA 5K45A 1EXVA 4Y9DA 3I2JA 2WHRA 4F96A 4R1TA 1VMEA 3O83A 1BXGA 2Z57A 1I9CA 2K2WA 5HKOA 3SVLA 4K2HA 4OLJA 4OUDA 3ROXA 2VYFA 4E2FA 4ENRA 3V8VA 3LU1A 2RIPA 1V6AA 1C0EA 2OPBA 4DLLA 4PF1A 5IM4F 2D7JA 1ENYA 4Z9FA 1V95A 2G36A 3A37A 3GFTA 2NNWB 5CXQA 1CDEA 2HFJA 2Q5EA 1OZ0A 4OBBA 4XWWA 4V02A 2J5KA 3M4XA 1E92A 5JNUA 1DQPA 3FTNA 3TQCA 4P1ZA 2N0SA 4PZYA 4F5EA 4YCLA 1U90A 5AJHA 3L0CA 3RO7A 3DHYA 1RI1A 5GZ1A 4MWGA 4MPTA 3T7EA 3C3KA 1THGA 3SIWA 5CXUA 1SHKA 4A6DA 4OHYA 3E6AA 3NHBA 2HI0A 4DARA 1IULA 3IBFA 3WHIA 2A6PA 1CUSA 2AJCA 2OEPA 4FGLA 4H18A 5AUPB 2UYHA 1PEYA 1UANA 4I7EA 2X0EA 1QC5A 2GTPA 3B5JA 1QRAA 2VZLA 3NIBA 4LHEA 4LV6A 3ND7A 2C5AA 2F67A 4TKVB 3TD9A 2C3UA 3EXHB 1J49A 1HA3A 4CMGA 4FMDB 1VGVA 4QDUA 5A2GA 1GR1A 1W2GA 4MNTA 3KNZA 1B93A 2IXDA 5A4MS 1HEIA 4RFSB 1DKQA 3WGOA 3DEJA 1EEXB 5EHQA 4IR7A 3VR5D 1KZ6A 1N2OA 3RIMA 4B5LA 5AVUA 4J7UA 4S2EA 4AG6A 3BVPA 3MT9A 4DUGD 3H84A 1NLFA 3GGPA 3L40A 4FFRA 4O8ZA 4GICA 4A6XA 2NUTB 4LJLA 2XNDA 5EZSA 2JHCA 3SBEA 4A0FA 2PWBA 1G0NA 1Z4KA 5PGMA 1EDBA 5F4ZA 4ZGGA 1FX0B 1XJQA 3LSYA 4OX9Y 2ORYA 1C9EA 5AJVB 2M32A 1Y7LA 3LZCA 5BQPA 4KQJA 1ZI9A 5DSTA 5EWLA 3ZGXA 1P1HA 4QXRA 1CQIB 4ANFA 4W8HA 5TPZD 4ENWA 3IFSA 2BFDB 4OHUA 2R1UA 4L0MA 1ZKDA 1H0HA 1Q83A 3D7NA 3EVEA 3QF4A 3VZSA 2VAMA 4B6FA 1KJZA 1GPDG 2C9OA 2DPHA 3EG5A 1UC5B 4RSRA 4BZPA 1Y1KE 1LY1A 4JU8A 4MRAA 2WFAA 3LPNA 4MVJA 2FW1A 2PXCA 4QSHA 2RB5A 4QRIA 1BYUA 1OLUB 3RAPR 3LKVA 1CR2A 2BN4A 4FHEA 2ESRA 2G7MC 1SBIA 3C98A 4EVRA 2QTGA 1RRMA 2QL7A 4OY3A 2OYSA 2PTHA 4WCFA 2W58A 1JDJA 1BCRB 3W6NA 4MAFA 2RGYA 1RXUA 3D4LA 3O3NB 1VI5A 2BRUC 2YJNA 5DMHA 2SKDA 1O94D 1T0IA 1NYQA 1KEUA 1JZSA 2I55A 1BHJA 1YDGA 3IHTA 2CK3A 1JAYA 1E9AA 4DB4A 5C8ZA 2QRNA 1UP4A 5J4YA 1Y89A 3IIMA 4DNOA 2EJBA 3OQ1A 4H6WA 2ZDHA 2FPWA 4YLEA 3M1LA 5D3MA 1VLJA 2NU8A 2Z8YM 2I66A 3OM9A 4XYGA 4ZOBA 3TL6A 1ZUIA 3G9QA 5EVCA 4LRTB 1DWQA 1JSCA 1M72A 4UXHA 4RTNA 2BSXA 3JQCA 4KQHA 1O97D 1YS7A 2ID9A 2JFUA 3AHGA 3GAFA 4AUEA 3DT9A 4PS0A 4Q3CA 4FYIA 1Z22A 4F4CA 1FFBA 3N0RA 4PFQA 1JILA 1RNLA 5EN4A 2ZSAA 4PZUA 4ARIA 3AP1A 2WU1A 1O6ZA 3GN2A 4FR2A 2PJUA 4L02A 2ZRAA 2YASA 2GBPA 2CXSA 4TTAA 3CLKA 5M5BA 4QYIB 3PYMA 2B20A 3F4BA 1M74A 5FNVF 1L6IA 4CIWA 2AD1A 5E4JA 4XWGA 3ZBQA 1J70A 1KAGA 2I2CA 3B1JA 3DHVA 3HN2A 4TLMB 4BGIA 5EFOA 5LDHA 1E2NA 1Q0HA 2M6LA 1HFJA 4HLUC 4ARUA 1M54A 3DZGA 1JSZA 1TM3E 2C8VA 3LQ2A 4KQIA 4TXMA 2JLAA 1ZPDA 1DAFA 2QD2A 4JGIA 3VR6D 1Q57A 3UMFA 5CLQA 5PNTA 2FSVC 2W2VA 5CM8B 3VNRA 1N4DA 4MA4A 1R88A 3H2ZA 3H3FA 5BV2P 1EM6A 3CH6A 2Z09A 3DZIA 3DAGA 3L4BC 2CXOA 1XKXA 3REGA 2HJ9A 2PUCA 1NW9B 4MP8A 1AGNA 3WL6A 1CUGA 4GQAA 2X8BA 5HRCA 4L9RA 4ENPA 3JWEA 1SN7A 4LGMA 4GBGA 4QRHA 5BYJA 1P80A 3WO0A 4DV7B 1YRAA 4KO3S 1YZUA 4PQEA 1JAXA 1ZYUA 1FUIA 1W2WB 2V7EA 4RJLA 3RFVA 4MWTA 1H6AA 2PWYA 3N39C 1NM5A 4IDQA 5DDIP 1EQUA 2JH9A 3EVZA 1UEIA 2HQSA 4NBVA 5E0KB 3GFQA 1ZJ4A 2JGAA 2VF8A 4IIFA 2XJ4A 3O8LA 4NESA 1WXXA 3GJ8A 2NVWA 3NVAA 4V0LA 1GA1A 4ZCSA 5HF9A 1L5NA 1EFDN 1QYVA 3E8SA 3T7AA 3V9PA 1VI6A 4HEA1 3KFVA 3PF8A 5IAKA 1CQPA 3COVA 4F91B 3RWMB 3I32A 4BOYA 1HURA 2QYSA 2CHEA 1DIAA 2F8LA 5H59A 1G8KA 1CX9B 1DTSA 1MQSA 1XI2A 2DX7A 3ETDA 4L8FA 4C4PA 4ENVA 3CFYA 4DT1B 2LDXA 2DT8A 1S1MA 1OAAA 3EOAI 2OM2A 1SXQA 1OC4A 4LVUA 2GXAA 2QRJA 4WACA 3C5EA 4DMFA 3U49A 5FA6A 4RCVA 4RTKA 3OKCA 1RQPA 3H04A 4FKBA 1WXWA 1DJMA 4KR9A 4PYLA 1ZFNA 3FR8A 2PANA 2RAPA 2BUBA 2GN6A 2IUFA 5JECA 1LQ2A 1YJ5A 3MJEA 4BNJA 2DLCX 1KXJA 2F62A 3ZHZA 1EGAA 1ZVMA 2LWIA 1FUUA 3T41A 1L7XA 5DGTA 4DRXB 2X2PA 4M1SA 4DJJA 3H6HA 2O8VA 1XRQA 3M3HA 2GPAA 1KIFA 2I6FA 4CQLA 2PS9A 3IKVA 1YJAA 1QRDA 1X94A 2Z3WA 4WWHA 3CUVA 1WXEA 3SICE 4MRPA 3NTRA 2H7VA 2W43A 2EL7A 4O29A 4EYSA 2WQZA 2P4UA 1ZQ9A 1EESA 1M2GA 4J4TA 3QU9A 4K1LA 1L5VA 4ARZA 1F8FA 1V7CA 2ST1A 4MR8B 1CNMA 4HAVA 1N6IA 3SHWA 5KYWA 2HJVA 1QGAA 4Q9HA 5DB4A 3RG8A 3TPFA 2V54A 2A5YB 3SHFA 3UCFA 1K3TA 3GBSA 5F73A 2C4KA 5BT8A 1KRXA 3QVKA 1QIFA 3E5MA 3ZCVA 3O26A 2YV4A 4MWZA 1RI2A 2JKYA 3RIHA 1PV4A 2H5LA 1LPMA 4EH1A 3DTNA 1LW6E 3EVDA 1FNCA 3SZOA 2G6TA 1A5SB 1KI3A 2XRZA 4KREA 2AC2A 2I4RA 3N8NA 3S2SA 4A3SA 1EG7A 3ITKA 1HLDA 1S02A 1CVIA 3D2CA 3CCBA 3UXMA 2UVPA 2Q4BA 3ZD6A 5K0BA 2O50A 3CS3A 4L5AA 3U3KA 1E3WB 3GCWA 1QOZA 2FZGA 3P9ZA 4GLFA 4JA0A 5LB4A 5T3UA 1VDZA 4A26A 4F60A 1O6BA 2D6FA 2JFHA 4CU5A 2W2OA 2WWRA 3PICA 1OZHA 1NOKA 2ZR8A 4Q4HA 3NCHA 3LQKA 4MRNA 2V6FA 3HBFA 1US8A 2AEJA 3AL2A 1R4AA 3PIIA 4OOEA 1B6TA 1J2EA 2WF5A 3CRNA 1NJFA 2VXBA 3AR8A 3N59A 4J16A 1MH9A 4XI9A 3FYCA 4DSAA 3EVCA 4C87A 4DIBA 5AD1A 1V2HE 4ZVQA 1MPXA 3AWDA 4JGGA 4DIKA 1QH0A 1PN3A 1JDBB 1Z8FA 4MUGA 1T4GA 5J5VA 4C0AC 3ZJTA 3G5LA 1E98A 3RIGA 3DV0A 5I7AA 4OGFA 4IZOA 1ID8A 1SQFA 3SQMA 2FR8A 4L15A 2JAHA 3WZMA 2AVNA 1IBKB 1OFGA 2MHCA 3LUKA 2QXUA 5REQA 1O96B 3R7BA 3A9CA 3WDKA 1FLVA 2WQ6A 4LZZA 1EUZA 1VBKA 4OKIA 4HN4B 4KX3A 5A04A 1LPBB 2AV6A 2V59A 2GHIA 1HL3A 3AVQA 1TPZA 4M0FA 1ZN9A 2VJOA 2D1TA 4C21A 3PNMA 1ESMA 3ITDA 1K8YB 3K73O 4MKXA 1Z0IA 2XKBA 2E4UA 1XTUA 1J23A 3CB4A 2CVFA 3IO3A 2WWXA 1VJ0A 4RTSA 4GYJA 4ASUD 4I08A 4BYGA 2IYZA 2O1SA 2XUGA 1PZNA 2ZTUA 2E3JA 3K2EA 4AWBA 2QM3A 5I01A 2UUAB 4JCOA 3SXUB 3D2BA 2E82A 2HUPA 1DOHA 2PJZA 1XT6A 2J07A 2HJHA 2QTMA 3G9ZA 3MUOA 1AQIA 3PCXA 3OEED 1YL6A 3N3BC 3E22B 1M34B 3DCYA 1Z18A 1XTPA 4L3WA 1HV8A 2BPOA 5DYNA 3CPJB 5BPFA 3EEQA 5THXA 2AG1A 1NULA 1XJ5A 1UADA 2QN8A 3PP8A 4XWAA 4Y2RA 2V8OA 3IQHX 4MR7B 3SDSA 3V2GA 3RJ9A 2ZAOA 1HLGA 2XXAB 1G55A 2GEVA 5DTJA 4I55F 2HBZA 4O2AA 3D64A 3DYIA 1E3IA 4YRZA 1Q19A 1VLVA 2P1ZA 1PUXA 4M4SA 1T10A 1LZLA 1ODIA 2BR5A 4Q4AB 2ETXA 3SXJA 1FFCA 1Z34A 4RA9A 1CUWA 3G0IA 3MYRA 3ZVKA 2CVZA 3KKMA 1RABA 2A9JA 2BFBA 2MDTA 2OHFA 3IIJA 3O0TA 1CETA 2I6TA 3RYCA 4N5DA 3T1HB 3HO1A 2NVUA 3A6EA 1IHPA 4ZC8A 4PY2A 3OH8A 4Y9SA 2R2GA 2D1FA 5BWMA 5EP4A 2XUQA 4PW0A 4WLNA 4BE9A 3SVZA 2IK8A 4G63A 5HQ3B 1YK0A 2ZE8A 3JWPA 3ECSA 2OL4A 1D5WA 1R3UA 1U8TA 3D8HA 2XB4A 5FWYA 4AQ7A 5KPJA 3EZ7A 3O03A 5KKNB 3WRYA 1MX5A 2J6BA 4Y2UA 1WDLA 3KXDA 3VAYA 4B5KA 2RH4A 1J8QA 2WFZA 3LZDA 4NCKA 1K5HA 1XCMA 4I50F 1I1OA 4BATA 5FR1A 1UMBA 1LSSA 4DA7A 2VO1A 3M9XA 2O52A 2FFQA 4GRAA 2V3CC 3JQ8B 2RHCA 2FQ1A 2NX2A 1H6BA 3ZDCA 4X24A 1VJ5A 1RAAA 3C3EA 1UJ2A 1Y1LA 4H6PA 1KHTA 2Q07A 4RQUA 3DZDA 4BE4A 3KYCB 3U9LA 1ZX1A 3L7NA 5JWOA 5JI3E 3RVNA 1PX2A 2ZXFA 1QDUA 3PVCA 4HTFA 4IMPA 4MI1A 2A0KA 2F48A 5E9QA 3LA8A 5DK4A 4I4LA 3SLGA 1G19A 2YQZA 1AS0A 2QY9A 3I5AA 5JFTA 4HEA6 2UXDB 2Z6VA 3AIIA 1N6OA 4ZTBA 3HCNA 2ZRPA 4RZSA 3U39A 1GAEO 2I2XB 1E2KA 4B83A 3EJ6A 5LPNA 3ROTA 2J6IA 4N0PA 5J59A 4BB5A 1XO1A 2Q3HA 2OY0A 3BGDA 4NULA 1V3QE 2CEAA 5HPYB 3ZDAA 4PRKA 4Y6QA 1ZD3A 4GVXA 5MF6A 3LFHA 4EIWA 1SU8A 5BYKA 4NG4A 1GZHB 2QPTA 3UMJA 2QUAA 3LY7A 2GJ9A 1B0ZA 3LRTA 3ISJA 4OQQA 1HNWB 2YXEA 3GLTA 2ZRIA 2P30A 8ABPA 3OHPA 2PMEA 1G60A 1N2CB 2PYDA 2VP6A 2XUKA 3O9ZA 5CFNA 1WY5A 1SQ6A 1TC1A 3UPTA 2PKQO 5ED0A 2PUHA 1W85B 3A2LA 2J45A 3G9UA 2OPHA 4LC0A 3W9YA 4A2QA 2VPPA 4RKWA 2ZI9A 5BN5A 4GO1A 3QENA 2LKDA 2BFDA 3D4NA 3U7RA 1JHXA 1KH2A 2O3UA 3CB2A 1J2YA 1XMIA 3ESXA 3F6BX 1Y81A 3NC0C 3NXKA 1OLUA 4M86A 5T8KC 3ZHXA 4RO0A 4ZCMA 1WCXA 2PTGA 1K97A 2QTFA 1YB1A 4FFOA 1OAOA 4F4FA 2WWFA 3LIIA 4UZSA 1M0WA 3HEMA 1E1QD 4JAVC 1EWRA 4M7RA 2AL7A 1AE1A 3BIFA 2YIJA 2PX3A 2Q2OA 3KT0A 2ZRKA 4J0HA 2OV3A 3SXPA 4MP6A 1NXSA 4XH9B 2PCLA 2Q21A 5GM2A 1D2CA 3VHXA 3D1VA 4YAWA 3WL3A 1DQZA 2PT5A 2OYCA 3WL4A 2Y9PB 3X3HA 2RHHA 3FUVA 4HPWA 2Y9MB 1F06A 3WIVA 2FN3A 2ZIZA 3MS4A 3Q1LA 4RV5A 3TK1A 5KIAA 1A1VA 2MYPA 1RQ2A 3IE0A 3RS7A 1HG0A 1E2LA 2Y1GA 3QVJA 3NHUA 4JLPA 5D3MB 1JXQA 3EYWA 2EFCB 4GW3A 1HMYA 5DTEA 1QRSA 5HZKA 4XPIB 4MLPA 4B6OA 1JP7A 4MVJD 2H48A 3KZ1E 1RP1A 3RB8A 5LZ5A 3B2NA 1LPNA 1Y8QB 1PAUA 4I81A 4P3KA 4POAA 4ACAA 3C5WP 3GUVA 3PNBA 1C4KA 3K5WA 1KEEB 4JVMA 5EPOA 5CYPA 1TKCA 2EL9A 4D8YA 1TEHA 5LP6C 3SKYA 3UUWA 2WJGA 3VVBA 1PW7A 3OOYA 2ZYHA 2WJYA 3JQ8A 3NYWA 3WJ1A 2FGJA 2IYXA 2ZJ0A 4ATNA 2WJAA 3DL7A 5JWHA 1REQA 3DT6A 1XRSB 5GQSA 4CKCB 4LXIA 5HK8A 4FMBB 4A0QA 5HKKD 1R50A 1ZJWA 1DGQA 1GL6A 3N2IA 1ZC4A 3LWZA 2FPKA 3STWA 4KFTA 2ZT5A 1I1HA 3ZI0A 2LRHA 1TCUA 4MCHA 1CJMA 1DAIA 3B2EA 3B5EA 3LPDA 1W1WA 4MB0A 2O0HA 3UGTA 1MAWA 3ZN2A 2WUEA 3FVRA 2B92A 3FB4A 3FNBA 4WFJA 4I99A 4F97A 5ITZA 5JRJA 4O3FA 3P52A 1ZY2A 3SE7A 3TCXB 1W5EA 4DB2A 3ORRA 3GNTA 4Y18A 1DO8A 3L4SO 1MVNA 1TF7A 3DW3X 4H4CA 1BDIA 1TMYA 3K9GA 1VL6A 5E7MA 5CFZA 1AZSC 2JJ2D 1II0A 1GRVA 4G0XA 4TKLA 2ZYDA 3HYSA 1FMJA 2WOOA 4CWAA 1T3HA 1Z2DA 2YV5A 2HQBA 3H6GA 4Q3LA 3BIXA 1OYVA 4KR0A 1OPXA 1GD1O 1IB6A 1UJCA 3I9FA 3NJ8A 4YCNA 1N2CA 1I6MA 1T6XA 4DMCA 4YUZA 1JQDA 3R5FA 3D6JA 3R6TA 2YWBA 5TGDA 1GU7A 5JCOC 2C0QA 1W85A 2QDKA 3UA4A 3ROKA 4BVHA 4CF5A 3MJTA 4KO1S 2MCFA 1A9PA 3M0EA 1H8EA 2OO5C 3TQSA 5CGZA 4YRAA 1DKOA 2CUKA 3WTBA 1L7QA 5BXYA 5FUXA 5HQTA 4K6OA 1YOVA 3ADDA 1VHLA 3U3XA 1EXDA 3NNSA 3L18A 3EGDB 3CKYA 4X1YA 4YK7A 5IDVA 3OLZA 1D9XA 2CMKA 2BFBB 3IP8A 3LUPA 1MTOA 4JP2A 6PFKA 4DXHA 4LI3X 2W0SA 4YP7A 1P60A 2C8JA 1RWMA 1S96A 4QGHA 3ZXYA 4Q05A 4RS4A 5KQLA 1U5AA 2BGMA 5EZYA 3KT6A 4LYEA 3SFVA 5AP9A 4KOEC 2Q2QA 3TIVA 4NBTA 1I2BA 1NIPA 1RQ7A 1PR2A 1Z0JA 5CT9A 5IC5A 3WGJA 4I5EA 4MMZB 4NBLA 1X7WA 3ZR4B 2HM7A 3EWIA 3Q2KA 1RRCA 1USGA 2VWQA 2CV2A 1SIUA 4I1YA 2D5LA 3TLMA 3QEKA 1AHPA 2CLFB 4XPIA 4ZYWA 4V0RA 4N3BA 4U7TB 2H0QA 1PR0A 4JBHA 4KR2A 2A84A 2CUNA 4P7FA 1B6RA 5COAA 4BX2A 4J07A 1II8A 1J0CA 1KGDA 1R5JA 2EATA 2VSNA 2XUFA 4GMFA 4M7OA 1MP0A 1NA5A 4TTQA 2PE5A 2RKOA 4GU5A 2PZGA 1ELOA 1SZJG 1D4AA 3E5NA 3I2GA 2VRCA 1RLJA 3LLSA 4LXHA 3H1GA 3U3MA 3GR6A 1Q50A 4XA8A 3QE3A 2MYTA 3RTEA 3WLRA 5LQJA 1P5JA 1KA9H 3GDGA 1LI7A 3VXKA 3R4CA 4EFMA 2BCEA 3LGSA 3BTSA 4LRXA 4XR9A 2WA1A 4I4CA 2DP4E 1Z6YA 3ANYB 3B1VA 4RJIA 3T5GA 2RE8A 4LJ7A 2QQGA 1IL0A 1OU4A 1MPTA 1QO9A 1P75A 1VCMA 2ID4A 2VDUE 2G4VA 4LOKA 4NZNA 4TMKA 1ZSVA 3VX4A 3DV9A 1CKEA 1QIKA 2PK3A 3DMRA 3QMWA 2LKCA 5K2MA 1C8BA 2ABWA 3GLRA 4W1QA 3ZWXA 1MKYA 4IJQA 1D0SA 4MDFA 3OF5A 1SKUA 1ZXBA 5GZ6A 3FTPA 4E2WA 2OCLA 4G25A 1JL3A 1WMBA 2XITA 2C8LA 1ZH4A 1SUPA 1NRJB 1KIAA 4TS9A 1S4MA 3ZU2A 2AQKA 5CDGA 3DEZA 1EVEA 1T36B 1XPRA 4E5PA 2G9ZA 3O92A 4GOOD 3W4KA 2ECOA 4N8SA 2O2GA 1YZKA 3CJTA 3SGLA 1O1YA 3C4QA 4I1PA 2A7XA 4I3GA 2I54A 3RREA 1YQEA 3KJQA 2G6BA 3I04M 5D7BA 4AURA 1PDOA 4WK0B 2Q3DA 1DMSA 2DMRA 3AESA 5CVCA 3SHTA 5JJBA 4OA8A 4J91A 3OZUA 4YRLA 2AQHA 3VNAA 5JXGA 4NY1A 3OLYA 2C3PA 4OVKA 3IS3A 3TTXA 4KV9A 3VKGA 2CL5A 1YOVB 1TJ4A 5K3EA 1JPJA 3OQMA 5EWMB 1KJWA 3RVOA 5IWCA 1RYHA 3DLAA 3WLQA 2O1XA 1WB4A 4MULA 2Q5CA 1U8ZA 2IFTA 2OWEA 3DMHA 3H4MA 4JLAA 1P33A 1NBHA 2ZSJA 4LSGA 4WGGA 1ZD2P 2RBEA 5FEMA 1TUBA 3NBZC 5HF8A 3ZTTA 3RUFA 1FPQA 3TLYA 1PVVA 4TXNA 1ORRA 1FSZA 4C7OB 2BKAA 3BRCA 3DOUA 1RWNA 5I8ZA 2IUSA 3MTAA 4DHWA 5BVHB 3H75A 2B7CA 1G3QA 1G1MA 1Z0AA 2XCOA 1OLSB 2P3LA 3HCDA 2ERYA 3IAEA 1K1EA 3NIGB 1TFRA 1RWPA 4CLHA 1PJ3A 2Q1XA 1Z4MA 2F64A 3R8CA 3SS8A 5EE3A 3B9RA 3NVMB 4JBLA 3QOXA 5HK9A 4MQMA 3EY9A 3ZE7A 1PV2A 3P9SA 1XJWA 5JNRA 1X2EA 3QNUA 2AZMA 4KPFC 4RX1A 4ND8B 5H3LA 2WMYA 3BQMB 3EEYA 2RKBA 4MW6A 1XDDA 5E6UA 3TDMA 1E8MA 1P7VA 1ZOSA 4ZODA 3JYOA 4YMHA 2XWJI 4ZARA 2Q3MA 4ZHQB 3OEYA 1W4LA 4UAGA 3S8MA 4ED9A 4RVSA 3EIHA 3UW1A 1J9ZA 4Q3DA 3MGAA 5LOVB 1FTSA 1ZINA 3KJGA 3LT4A 4R01A 3TZCA 2XXAA 1QO7A 1UAGA 3ZYZA 3ZOKA 3TLXA 1NURA 4UUNA 3AR4A 3DWGA 3M6VA 4LF6B 4K6KA 4JI3B 2FZ5A 3LF2A 4QWWA 5I4CA 1T9HA 4B7UA 3LX5A 4FZ5A 1F8GA 1VYTA 2WWHA 3HCRA 4V03A 2Q5OA 4OGGA 2I6UA 2EFYA 1SXIA 4JLBA 4WLVA 2HPHA 3ZHRA 1T43A 5EKXA 3RHTA 2PU5A 2WIAA 1GVNB 3C3MA 3G2QA 5FL7D 3TG8A 4OP2A 2XTZA 5KWJA 1Q74A 3WIEA 3I9LA 3C5HA 2LTAA 3E81A 1SBYA 3EMKA 3OJ0A 4QTZA 1G4HA 4B79A 5JJLA 3AEZA 3I23A 4FEAA 4B6SA 5JYCA 4KDFA 1YUBA 1WUTA 1P2BA 3HA5A 4WW0A 2Z5FA 3R5JA 4MWBA 5FFNA 5LCXA 3CJRA 2J48A 4XDYA 2OD2A 3A2KA 3CUWA 1PYGA 5DWQA 4X7MA 4F3TA 1LLDA 4BNLA 3BJIC 1JDBC 2Z8XA 1I4LD 2NYAA 2QX4A 1W5BA 2OAEA 4X6XA 4D79A 1FQWA 2P0YA 1BSVA 2OV1A 4KACA 4DLRA 1DBWA 4JH0A 3WLJA 4UOEA 5BNIA 5JATA 4PHHA 3NGMA 5FFMA 3HYLA 3LY5A 2FZLA 2GPBA 1TT7A 4XR4A 5DNWA 4Y6GB 1WVIA 4ZK2A 1GM5A 3DMNA 1WVMA 2Q49A 5ELLA 4TT8A 5EESA 4B81A 2VUIB 4F6RA 3FOBA 3ZNNA 4L2IB 4B9AA 2AFVA 1PJLA 2B8JA 4UVGA 5A3QA 5F2EA 3L6OO 4C0XA 1E2QA 1ZQ1A 2E7ZA 4EJ2A 1ZIPA 2QP4A 4GKBA 5DLQC 4K1XA 4Q82A 5DW0A 1VLZA 4PEVA 4QULA 1U9IA 3AV0B 3HXLA 4OBEA 1V8PA 3B2QA 2NSLA 3QNWA 4BL5A 3MXTA 4YUYA 1AGYA 4EG6A 3SSNA 5L3QA 1O3YA 3LPMA 1ESDA 5KPDA 1GOTA 5AHKA 4EQ6A 4HD8A 2MINA 3PTAA 3GVXA 4QDZA 4MUHA 2H2HA 3PUVA 3WQBA 1O9BA 1RM5A 3CHYA 5AVKA 2PKCA 4XFJA 4RMGA 4U0JA 5C8YF 3MWYW 1TNDA 4IFIA 1WHSB 3AY3A 1M33A 1Q1AA 1JUDA 3HA3A 4NWIA 4W6ZA 1AURA 3SLRA 4M99A 3WGTA 4DCGA 4KQCA 1XMQB 3LL4A 4Z7QB 2OBYA 3ER9A 2X1MA 4KVZA 3BRWD 2C9MA 2CLLB 3VR3D 1V8OA 3TFQA 3QOYA 3OJOA 4FSDA 5BQ5A 4B3CA 4KMSA 2JIRA 4TVKA 1UWCA 2Q7XA 3GXOA 5TVKA 3PQ5A 1PW5A 5HQJA 3WGIA 4OM8A 4WVLA 4LF5B 5ESWA 1LVHA 3N0TA 4PZ0A 2BBSA 3KVYA 4RIIA 1X1RA 2ZM6B 2XMSA 3GC6A 4L50A 2QU7A 4Q3EA 1CZHA 3ZV6A 9LDTA 1ZIOA 1T29A 5KCZA 4RCYA 2EP5A 4RY8A 2R85A 4XDZA 2ZUWA 1G2OA 5DCYA 4C01A 5LDGA 4CKWB 3C1AA 1UKAA 2VJBA 3GQBB 5B4TA 4IXTA 5K3OA 3AVTA 4DG5A 3R44A 3ED5A 4C0WA 2CJFA 3LK6A 3WHPA 4AX8A 4B35A 1O94A 1UZUA 2GDZA 2IGBA 3LO5A 4IVNA 4ZI7B 2MSDB 1ML3A 1N9GA 2JJ1A 3KT8A 1IAQA 3L0ZA 3MOGA 5FCDA 2QEQA 1E9DA 4R51A 1CJVC 3ZDFA 1W46A 5DGXA 1P44A 4FINA 1Y1PA 2JGMA 1JZQA 1FSGA 1ETHA 4P32A 1TJPB 2EBHX 5KHOC 2FPRA 4J0GA 1KO1A 3QXHA 5HMLA 3A6LA 4HWGA 1RIIA 4BU1A 5IT4A 1DAGA 2YZNA 1K3FA 2QQEA 5J4HA 5FL7A 1M10A 1HT1E 2DPYA 1XP8A 2OSVA 1YR9A 3KKOA 3MEQA 4G8JA 1RFGE 1KSFX 4QTUB 3RGGA 1FVXA 1FP4B 3Q3GE 1WXGA 5CH3A 4CMEC 4HNSA 1QF9A 4G0PA 5KYUA 1UOQA 1GKIA 2VSFA 4EPVA 4CEHB 2VCYA 2RHLA 3JQQA 5KNBA 4AY6A 2ZJ5A 1UBUS 3DE2X 5ENZA 3WDSA 4EY4A 1SPXA 1RTKA 1PIWA 2Z2KA 5CRIA 4AJOA 1Y1QA 1EAMA 1KY4A 4AYWA 4MMYB 2PIAA 1CF4A 1NUPA 5F1KA 1M2EA 2FN7A 1ZCBA 2H9IA 3HRHA 4FGZA 4MA5A 4UEQA 3AGPA 2VZ9A 5F5XA 4D8VA 4R41A 5B1YA 3TI9A 4AI6A 4LKRA 5J2UB 1QZZA 3T9CA 2P75A 4Q48A 4Z8YA 3U09A 3RSOA 4YQEA 1GNSA 1GPAA 4OGKA 4A6EA 2IIQA 1RI3A 1L2TA 2H2GA 4UQPA 1LLCA 3ZW7A 5B3JC 3HJNA 1A9XA 2E48A 2QTBA 4CLOA 2OTCA 4PYMA 5BPHA 1Q6YA 3A9VA 2YNMD 3PT9A 2WM8A 1F5NA 1A95A 3R74A 5B6IA 3QVSA 1T0HB 4QASA 3DWEX 1EEHA 1I30A 3KP1A 2A0XA 2R2AA 2X4IA 2EBWA 3BWBA 5JMPA 4XVHA 5JAZA 2Z5GA 1T0UA 4Q1BA 2IUUA 4GRDA 3S70A 2C0CA 4BMNA 1XRLA 4CTJA 2XEXA 2HA3A 2ZBVA 4R3NA 4EY5A 2UVDA 1EZ1A 4AG5A 2PWAA 1M2VA 1CQIA 4IIBA 2UDPA 1NPDA 3BDIA 1O08A 4OHZA 3QEBZ 1BXKA 5EYPA 1FFEA 2XD9A 1P17A 4QOSA 1BZYA 3QUTA 2DXIA 2EFJA 3FPAA 1MEEA 1TYEB 2EFDB 2ECFA 3ZWCA 1NQUA 4OQPA 5J1TB 1K9SA 4ZDJA 5KSWB 4KP7A 4B73A 3SS7X 1X3SA 4M36A 3GJ0A 1SCIA 5CYFA 5EIBD 3D4IA 1DV1A 5ALDA 3EGDA 4QQNA 3UJBA 1J25A 3RVQA 3OMLA 3ZWWA 4EMTA 1IBRA 3DWIA 4PYIA 1BN7A 2FPLA 2A7QA 2TMYA 1V3UA 4PAOA 5G1NA 2RJOA 4YPVA 3ZOZA 3T1NA 2R97A 3GLHB 5DCUA 4BV2A 1SG0A 2VBIA 3MBIA 4ILEA 2GVNA 1CUAA 3KKPA 4LYAA 5I7WA 4L8VA 1TT5A 5KC9A 1J0BA 4MGEA 4PNPA 2Q8PA 3A1EA 1QHIA 5E38A 4X92A 4F6LA 1R6AA 5H82A 3OU7A 1U11A 3OPYI 3AFIA 1GUZA 3ZV7A 1JTVA 2YIDA 4AICA 4D9MA 2XUZA 1CIVA 3FYSA 2J9FB 2X0JA 3Q2OA 4JBNA 2C78A 3L3BA 4M0LA 4XGQA 3JQAD 1SCAA 4AZ0B 3VAAA 4BVFA 4FMCB 4JSRA 3IBGA 5LYYA 4EP1A 3MHTA 3ITEA 1S01A 2QI9C 5AK6A 3SR0A 4EFKA 3ASUA 4RULA 3OICA 2X22A 4BLSA 1BE0A 3K1AB 2JRCA 4B76A 5KNDD 2GCNA 1GDTA 2HEIA 2J4CA 3UK1A 8ADHA 3EEFA 4DNPA 2QPLA 3EGEA 3RRZA 1BVYF 1GTMA 1Y8ZA 1P5HA 2BUAA 5REQB 4MV9A 2JARA 3W1EA 1U3GA 3C87A 3IDZA 1QTRA 5MGBA 2GNOA 3U1TA 2Z08A 4NJEB 4TKUB 5B3KA 3I0MA 2IY9A 4BVGA 2CF6A 4OSEA 4PGAA 4CIYA 2RGUA 3DDNA 1LRKA 4KLZA 4QYIA 5K0SA 2WZBA 1HO3A 2GVDC 5G4KB 3HS3A 5GZ3A 1T8PA 5LP1A 3BG5A 1L1EA 2FN9A 1MT3A 2J31A 4LXYA 2WDPA 3PTLA 4D9IA 3PXDA 2XXBA 3O91A 2E4XA 1PJ8A 1RMTA 2CB0A 5CIWA 3ZHSA 1MRSA 2CXRA 4D9EA 2WU8A 3H7IA 3C41J 3L82B 4RTPA 4N8EA 3GIDA 3G0CA 3LP8A 1SXJA 3DCIA 1Z2NX 4NBRA 5E4YA 1K5GA 3BWXA 1KIMA 4IGEA 4DCTA 3ZY5A 2VRWA 5FO0A 2NUTA 4F12A 2Q5LA 4CM8B 1I1NA 4N3AA 3BHIA 4GBJA 2FMXA 1M0EA 4KSBA 2A0WA 3E4DA 4DMGA 2JI7A 4DPLA 4WY2A 1E6CA 1T36A 3U3ZA 4KQXA 3BM5A 1TRKA 5LSAA 3FOEC 3AESB 4KE8A 1SU6A 2BF7A 2JGEA 2NW6A 1BMFA 4PC6A 4S1NA 1AMOA 2FMIA 3GZ4A 3DFUA 3AUJB 4M6WB 4QVIA 3DVAB 5C53B 3AIOA 4QQFA 2PZKA 2VHJA 2XB6A 3IJRA 5TDHA 5TEVA 3SDZA 3GFPA 4WDQA 3VR2D 1KI7A 1QBGA 4DQ0A 1R5OA 4XKJA 1TQ2A 3VDQA 2YKGA 4F7WA 3WMRA 1GV1A 1HOXA 1L8XA 2QMHA 1AN9A 1Z8DA 1QKIA 1GNRA 2B1IA 2WAMA 4LOAA 1X8KA 3P32A 3DZBA 3BKXA 4GC9A 4NBKA 3TDKA 5EJGA 4MUJA 1P81A 1H2AS 3V8EA 2ADMA 2WIGA 2YMLA 2PM8A 3E05A 3P9RA 8MHTA 4Q3BA 1VP9A 4GR9A 2G1AA 1VE7A 4S1VA 4BO4A 3VPBA 2PFSA 4HRXA 5EINA 1JHOA 4WFQA 1FOEB 1S2OA 2GKGA 2XDQB 5CH8A 4EF6A 1MJHA 1KFEB 4IVRA 4ZQFA 3CVUA 1O4VA 2R8ZA 1NVBA 1SK9A 3LUJA 2ONKA 4JSTA 3WWDA 4IZIA 2VHZA 2QB5A 2EW8A 2HA2A 4M1WA 4FOPA 5L53A 4F4UA 1QX3A 5CT4A 3U26A 2BFEA 2W6OA 3UOGA 3OC6A 3PUXA 5EUCA 3WLNA 5IDWA 4QOHA 4Q19A 3E2IA 5LUAA 4IL5A 1ZK3A 2DWUA 2VP9A 3CRQA 4D8TA 1WW2A 1T8UA 4RXMA 2P2CA 3H9GA 4E33A 5BQFA 4M2LA 5JS8A 2A67A 8OHMA 3BE5A 3AFNA 4EENA 5ELMA 4I1IA 3GQVA 4IHJB 1QNFA 4L57A 2WPNA 3NDJA 3C16C 1BXZA 3PQ6A 1RS0A 2OLKA 3COZA 1F12A 1XNGA 3KX2A 1ZMOA 3WNZA 4DR7B 2UZ4A 3GEMA 2NPFA 1C8LA 4QDOA 2XZTA 3ZHVA 2REXB 3MQFA 4RMJA 2F4NA 3TM4A 1I7QB 1X7HA 2INGX 4FILA 1PJ4A 2O7NA 2IHZA 1EP2B 2L17A 5JO9A 3FTEA 2XVAA 4OHXA 1LDNA 3BJMA 2O8BA 2R84A 3UJAA 4E4YA 5I9TA 1JEEA 1Q3KA 1K5PA 5SZIA 2D3WA 1XCGB 2R62A 2HA0A 4ZRNA 4QGFA 4GWLA 4MRMB 1XFDA 4B75A 5HJ7A 2AK3A 1B2RA 1L5RA 4LJ4A 2GZAA 1XNHA 5WRFA 1AF4A 5EC8A 1NX9A 2Y8EA 1NVVQ 4U02A 2JIDA 1J5PA 1EHYA 2X4LA 3DKVA 4DNFA 5C52B 1Z15A 1E2FA 2PXXA 2A5LA 4XCQA 3T6KA 4DLVA 1BE1A 5TIIA 5KZMB 1RLMA 3DBLA 3SS9X 4A82A 1CDZA 1LSUA 4I5IA 4FEEA 1C3OB 3QE4A 1YVUA 3T3GA 3JCZA 4ZT5A 5LL6P 3CVWA 3N6XA 2JPDA 2F8SA 3RE1A 4F1WA 1DAMA 5HIJA 3CSDA 1A8QA 5A03A 5DHPA 1V9SA 3E48A 1G64A 1ZM2A 3NZEA 3NUZA 4LVNA 4QGGA 2AW3A 1AGPA 3ET4A 1II8B 4L8LA 5DOVA 4YRPA 3EX7C 1I94B 3DA8A 2ZYRA 4MQEB 3DZFA 5CNKA 1UXHA 1JDVA 1XU9A 3GMIA 4IGIA 1K6JA 4PSAA 4CJXA 4RGBA 3H2HA 4XQ9A 4PSUA 4ZO8A 3K72B 4OHOA 4EX7A 1U04A 3ZY4A 3N86A 1T1JA 4QX6A 2DBZA 2R7KA 4FR0A 2OCXA 3K30A 3N8IA 4GLOA 4JOBA 1UBOS 1O54A 2GT1A 2J1LA 4UCXA 4YLGA 5AI0A 2W4MA 4KX5A 2CYAA 3ZBTA 2GZRA 1SG6A 1XQYA 5DHRA 4CMAA 2R68A 1JHPA 4XPZA 2XMBA 1ISRA 1RPNA 4ZQCB 4WRRA 4V1CB 4EQ6B 4M55A 1DAEA 4L1KA 2BM8A 3EFEA 1QVRA 4B17A 2WSBA 4I9HA 2P79A 2QMEA 4TOIA 4XVCA 1WHSA 3EW7A 2JVKA 1VJDA 2C92A 4CUKA 1GCIA 2AMJA 5IUJC 4HY3A 1QGED 3IB6A 1ZVQA 4TSRA 3ZCRA 4U9IS 3MMSA 3UK2A 4DBLE 4DZTA 4YMSA 1C1XB 1JEOA 4TT3D 2V55B 1FFGA 2QTLA 2D74A 2NVOA 3GU3A 3S28A 4ZJUA 1L5OA 2IVFA 2P0AA 1EK2A 1RZ3A 1CS0A 3L7BA 5KYYA 1AVTA 4HZGA 4RTLA 1JX6A 1KPHA 4PM4A 4ZVOA 3COPA 2HF9A 3GV0A 3NYQA 3ZWDA 1GYPA 3JATB 2XKKA 2QMYA 1DAHA 3IR6A 1ISSA 4ZJZA 3T5BA 1QS0B 3ZLJA 4L51A 4R1MA 1GUFA 1L7OA 3AEQA 3AL3A 5MFPA 2O8FB 4WBNF 1R6BX 2NACA 4M7PA 1ZUWA 2HIHA 4EHBA 1J33A 2QMUA 5JDIA 4LNUB 1KEPA 3BCRA 3ST7A 3LBYA 3JPYA 4WLUA 3W7VA 1OREA 2VHCA 3B5IA 3MCVA 5TEWA 4JLWA 3V33A 2ZVQX 2WHXA 3LPCA 4Q1AA 2IUEA 4BZQA 4C5BA 1E63A 1G291 1Q22A 2C7GA 4XM2A 3H0EA 3U3RA 3M6FA 4IDHA 1XVLA 3A36A 5LP6F 1IUKA 5ENVA 1ECFA 2HB6A 4Q5IA 4ZTUB 4C7OA 1W59A 3FZGA 4G26A 5CVJA 4J3FA 4ZI7A 3KQMA 1AU9A 4QHSA 4JI6B 3K4PA 1GCOA 4I6GA 2LBPA 4U00A 1Z4JA 3T5AA 4DLTA 2QRUA 1CBUA 4JC5A 4P93A 5FWYB 1NU6A 5AFSA 4B74A 2GGSA 5KOJB 3ZJYA 4BFUA 4HXYA 4OM7A 2C5FA 2Z2JA 4QYXA 5EE5B 2VSXA 3HR4A 2C2OA 1YR3A 721PA 3A2NA 5BSWA 3T0IA 5M34A 1DCMA 3B8EA 3DZJA 1UT6A 1IZ7A 5DU2A 4DUYB 1EQAA 4F85A 4RANA 4TSFA 2OUKA 4LXGA 1SKQA 1WCV1 3OJLA 1X7XB 1PGJA 4IV0A 2XJ9A 4XZ3A 1VIYA 4N12A 5EZYB 5EJ8A 1SMKA 3RFTA 3SEFA 4MS3B 3AXTA 5EZ5A 3EDMA 5DI3B 3ZWOA 4ENUA 1T9AA 3VTZA 3VC3A 3DYBA 5IBPA 5LQAA 1MO3A 2NXJA 1KU6A 1SVSA 2BFFA 3INTA 4NF2A 5BO5A 1U0NA 3D5TA 3OHSX 3GA7A 5A4AA 2ZYGA 5B37A 1RYDA 1L5SA 2GTHA 2FYTA 1L0BA 2JASA 5C5CA 4RVNA 3CCCA 1H2RS 3P71T 4EPYA 4GPEA 1W36B 1T4DA 2VHVA 2C5LA 1YR1A 4IQGA 5U1PA 4EI8A 3I92A 1KERA 5B1EA 3EXEA 4LOHA 2R6DA 4BLWA 5AKZA 2IYUA 3PK0A 1RP7A 1IHUA 2VAWA 3VR4A 4AP9A 2A3NA 1YI8A 4GX1A 5CT8A 3NRBA 1QB7A 4OQXA 2Z58A 3CEMA 4BEBA 1ZXLA 5SY9A 3VNQA 1MOZA 1JLLA 2DHRA 3K35A 3GUCA 2HKIA 3ANXA 1TU0A 3ID6C 4YAEA 1DXHA 3IAAA 4L72A 3AH8A 3VR3A 3JR3A 4EZEA 1ZD9A 1POXA 2J3DA 1L1FA 5BMOA 5CVVA 5AUNB 2I9PA 2GJ4A 3K1ZA 4CT0A 2Q9CA 4YO8A 4LHSA 3G23A 1CE8B 4ZU3A 4EEXA 2X0FA 4V0OA 1OLXA 3A4TA 2FUG6 5FPHA 4AAYA 3WB0A 1UBJS 1ZOIA 1GZVA 2W6ID 5DGCA 3D5QA 5IKEA 4E70A 3RWBA 4JHXA 3WP1B 4DCNA 2GTIA 3EZFA 2JF0A 2AH5A 1MEJA 2CL6X 3L05A 4G0UA 1FDIA 2VJPA 2JFXA 5COBA 1RBQA 3ZE9A 5IN5A 4TYPA 3QYPA 1RC1A 1MB4A 1R6UA 4KGVA 4MQ5A 1U0TA 3QX8A 3QMMA 1B1AA 1C7FA 1VL5A 5U4XA 3S2IA 4DQXA 1DIBA 1C1YA 1QRUA 1K3UB 3B3FA 1PSDA 1YAJA 2ZIXB 4XYEA 2ZDQA 3QPVA 1HETA 3QQPA 2CHGA 5A1JA 1OGJA 2H54A 5G0TA 1RXEA 2BZSA 4FSXA 1IU9A 3BIOA 4GP9A 3R5HA 4QDXA 2IVZA 4CM4B 2I67A 3CZ5A 3UMSA 4I9NA 4ZVUA 2H59A 4DXDA 4A1FA 1WCWA 3QI2A 2H9YA 3LXXA 4CETA 1IJFA 2F90A 4IFEA 4WX2B 3SYRA 1T1RA 2QR3A 4KIJA 2HA4A 3GEEA 4CN9A 3GY0A 1ZMTA 4L5CA 2O2XA 4YRNA 3TJRA 4F2GA 5FF9A 2V96A 1DC8A 4MR8A 3M5PA 1E66A 2ASEA 1T5SA 1Z6PA 1X0XA 4M3NA 4UBMA 4P6VF 3WAJA 2O5RA 3TNLA 4B9EA