3EE3A

Crystal structure of acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ee3A00
2BEFA 1WKKA 3FCWA 4S0MA 1JXVA 3Q83A 3NGSA 1UCNA 1BUXA 1LEOA 1MN7A 3ZTSA 1F6TA 1ZS6A 4ANCA 4ANDA 3EM1A 3Q89A 3EJMA 2B8PA 5IOLA 3VGTA 3VVTA 3VGSA 2DYAA 3NGTA 4WBFA 4DUTA 3PRVA 3ETMA 4CP5A 1WKLA 4KPCA 3ZTOA 2VU5A 3EICA 3ELHA 4F36A 3Q8UA 2DXEA 1HIYA 2DXFA 1BHNA 1S59A 4ANEA 4EK2A 4ENOA 1WKJA 2BX6A 1NSQA 3FBEA 3B54A 1F3FA 2HURA 1PKUA 3BH7B 1KDNA 4FKYA 3WX8A 3GP9A 1XQIA 3ZTQA 4UOHA 1PAEX 3GPAA 1B4SA 1NHKL 3EVOA 3VGUA 1NPKA 4F4AA 3VGVA 3ZTRA 1XIQA 1B99A 4DI6A 1EHWA 1NDLA 2DXDA 3Q86A 1K44A 2NCKL 1U8WA 1NDKA 3FC9A 1NDCA 3PJ9A 3FBCA 3NGUA 2AZ1A 1NLKL 2HVDA 3JS9A 4UOGA 2CWKA 3BBFA 3NGRA 3DKDA 3Q8VA 4C6AA 3BBCA 3FBBA 1LWXA 5CABA 3EE3A 1W7WA 3MPDA 3FBFA 5C7PA 3ENAA 3EMTA 1HLWA 1S57A 4O0NA 5BXIA 3VVUA 3DDIA 4DZ6A 1HHQA 2HVEA 1MN9A 2DY9A 1NSKL 1NSPA 1S5ZA 1NB2A 3BH6B 3R9LA 3B6BA 3Q8YA 1VYAA 5CAAA 4FKXA 3BBBA 4UOFA 4W98A 4HR2A 1BE4A 3EVWA 1NDPA 3G2XA 3L7UA 3FCVA 3FKBA 1NUEA 2ZUAA 3EVMA 2B8QA 1NCLA 3ZTPA 2AZ3A
chains in the Genus database with same CATH superfamily
4DDFA 1H6KX 2BEFA 3R6LB 5AE2A 4DFJA 4ETZA 2J7WA 3FK4A 3MMJA 1S97A 3N0VA 3KLHB 2YY3A 5FIIA 2XEXA 3W64A 2BW7A 2QLFB 2ROPA 3HXMA 1HI8A 2MZQA 4X4VA 4URSA 3BREA 3H20A 3LWMA 1X9WA 1HNWF 2YH1A 4ZJQA 3MM6A 1TVRA 4IDKA 1Q8BA 1SQFA 2XNQA 3FEYB 4YN3B 3W2WB 1C0UA 3B4MA 3DLHA 4L74A 2VG5B 4I2PB 3MMAA 3DGVA 5KFOA 1Y7PA 2R7TA 2MGZB 3IAS9 2GGPB 2AGOA 4ER8A 1IBKJ 3GWCA 1S1TB 1TKTB 2OPRB 4CO5A 5CD4A 3UVJA 3IC1A 3HSZA 3DMJA 3FJ2A 3U1NA 4F8RA 2G0IA 3A4TA 2XULA 5KG2A 2DTJA 4DR6F 5IS2A 1MLAA 3PACA 3MTJA 2AU0A 2KYXA 3MZIA 2NXCA 4DX6A 2LXIA 3LP2A 1Q78A 4QR2A 4CLFA 2IMOA 4H4OA 3NS7B 3JYTA 1G4CA 3QNWB 3MEEB 2VJVA 2IA0A 2A1BA 4P6QA 2BE2A 2XS5A 1MMNA 1WF1A 3I9V9 4F0MA 4YOEA 3M2VA 3BJYA 1BGXT 1OSCA 3LPEA 3T9NA 4ENOA 2HHXA 4K7QA 2E1RA 2HQDA 3SSSA 1VQKS 1BQNA 3IBCB 4QQBA 3UCZP 1SH3A 1OJ4A 3WZ0A 4YHHJ 4M5LA 1RWKB 1GX5A 3OXLA 2DNZA 1FRKA 3ZZYA 3N6MA 5K5MA 4FKYA 1KDNA 4MIAA 3SCKE 4ZHRB 5IV3A 4LQ3A 3HM9A 3GPAA 1UZDA 4HLBA 1B4SA 4LF6F 3KK2B 3G6ES 3TWZA 7FD1A 3CMQA 4ECRA 2E9TA 4I6AA 2E9ZA 2E1AA 4QW8A 2IVFB 1KQFB 4CLUA 2HWHA 3PW5A 1N6QA 1S0VA 4RWWA 1SC6A 4XDCA 4DZDA 1NDLA 2VG6A 1RT4A 3NMRA 4PAAA 1M5VC 2VV5A 1KVIA 2HGMA 4NRUA 1BMQB 2QG9B 4MJKA 1HFEL 1YJ9S 3G9CA 2DHGA 2KL8A 1H7WA 1F5CA 4L3KA 1IM6A 5A2QY 4DUZF 2IDLA 4ZVGA 3NL0A 4BHQA 3G82A 5EDWA 3Q22A 1JLEA 2XWXA 3TZYA 4FF4A 2ZBCA 1N5TA 2CWKA 1TMJA 2ZE2A 3QZ8A 1WUUA 4N8OA 4IO1A 4QIWD 1WG1A 3BBFA 4AL7A 1TK5A 2UXBF 1X5TA 4DPUA 4RPFA 5BYQA 3DNCA 2DGQA 1LW0A 5KFRA 3BQ0A 4I4BA 3MCSA 1I94J 1F5AA 1J5EF 1HBOB 1R8AA 4UUXA 4R8UA 3C8YA 3SFUA 2FLNA 1NJWA 4FNHA 3M2RA 4XPCA 1CJVB 3H4DA 3JAMY 1SV5A 1LW2B 3F73A 2CPXA 1X4BA 2BKPA 2V2KA 4PG5A 3EGZA 2IBOA 2CPIA 1EKRA 5MAOA 2CA9A 3L3CA 2GA7A 4H4MA 3E2EA 4IR1A 4F02A 2CQPA 2HWTA 4HDHA 2MYFA 3HHDA 2EFOA 2XMKA 1VRTA 3FCVA 3MR3A 1S1XB 3SEOA 1VBXA 3P49B 4J5OA 4OI6A 5HO4A 4DF8A 4R5PB 1T9XA 3R5AA 3T6BA 2KJWA 1S10A 5J2NB 3QGHA 4Q7AA 3KHGA 1T9TA 1RTZA 2CQGA 3KLHA 1CC7A 2HLUA 2LXFA 2DGXA 1DARA 2M70A 2RS8A 4UOCA 2VBYA 3SCIE 7AT1B 1JXVA 3RRKA 3W5YA 5DG7A 1N34J 3V6JA 1FRXA 3DOKB 3CCRS 2QTWA 1S76D 2AT1B 3HX9A 3BQ1A 1BWEA 1WC6A 2BJ8A 1Y9OA 2VOOA 2UXCF 3CW2C 4ZPVR 1SL2A 4K2XA 5AJ3J 2MQ8A 2V8PA 3WX4A 1S9EB 4ECQA 2VOPA 4Q8FA 2B6AB 2CPDA 1C4CA 3F44A 4KQZA 5E2QA 2AYBA 2DIUA 3D1QA 4WP9A 1FFGB 2IHR1 2OFGX 3TVZA 3H2LA 3PEHA 3VGTA 1S72S 2ZZMA 3ZZPA 4I0WA 2HFNA 3KLIB 3NKYA 1WTBA 4KYZA 3ULHA 4O4GB 1IR1A 4NWBA 3LP2B 3JYTB 5B09A 4L72B 4Q2MA 4RW7A 1H2TZ 2ZOGA 4CP5A 4AE5A 4ZK7M 3KHLA 2VU5A 3NP5A 4CYUB 1RWPB 1S7HA 1X4GA 2DNYA 3CJSA 1WC0A 3IRXB 2GHPA 5G0RA 2V67A 1S1WA 4KE5A 2VFVA 3NEKA 3VHQA 4OIXA 2RH3A 3DM2B 5CCMA 4DSEA 4FBUA 5RUBA 4OHZA 3HVAA 4ID8A 1EJ7L 3M30A 4I69A 4A8QA 3L09A 2MPUA 1FK9A 1Q7LB 2UUCF 2E7WA 2RSQA 1G3OA 2FHJD 2IY5B 1T02A 3MD3A 5D0GA 3DRYA 3W7BA 4TY9A 1FDBA 2MY7A 1HPZA 2I9SA 3ENVA 3R5JB 3ZTQA 4CLZA 4ED7A 3PO5A 1AZSB 2WW8A 2XI2A 4FDFA 2IC3A 3UWTA 1J27A 3K17A 3MI7X 4WWSA 4WFZA 2CJXB 5D0EA 3EGNA 4CWBA 4CZCA 4LF7J 4OV6A 4ZP8A 4OZJA 1L3UA 3I4HX 4JYAJ 1PC5A 2YX1A 1KQSR 2JOQA 1FXDA 2RILA 3FGVA 5EX0A 1MSWD 1RHMB 1RT5A 3SIPB 2E5LJ 4JI0F 8AT1B 2VPYB 4USIA 2FHKA 2DNNA 4P9SA 2APOA 2RUGA 4PG4A 3CUNA 1R6YA 1RYSA 2ATLA 1UW9A 4OYOA 5M2UA 2B3TB 5HI7A 3ZZZA 4WE1B 4I1TA 4BWJA 1P9YA 1R0BG 1X7VA 2J8SA 2XC9A 4CDIA 2U2FA 3FMBA 3TP2A 2LQ8A 1JLBA 4B3MJ 2VASA 1DZ5A 2DHSA 4PABA 3DOMB 1CJUA 1HWIA 4OHVA 1DAXA 4DS4A 1S0OA 2F8MA 3HCXA 1Q7YT 1HYSA 1U1NA 3TJ8A 3BKTA 4EGLA 2C3OA 1LWXA 1TVRB 4WJBA 1HBOA 3MPDA 4WYLA 4PG8A 1HBUA 1PYOB 1TKXA 5CABA 4LR9A 3MUMP 2FLPA 4PQUA 1VJQA 2CQ2A 1ZM2A 1F0XA 1XERA 2QIFA 3EDRB 3KKFA 3OFHA 4ZVTB 3M2RB 5GAHU 2ZITA 5J2PB 3P6YC 1HHQA 1EX8A 4ECYA 4DHVA 5DQIA 2HZVA 2BM0A 3JTPA 4LF9F 1NSPA 4GMKA 4WZMA 3ENWA 4ED6A 1M5OC 4A8MP 2E5LF 2V4JA 1VYAA 3R1LA 5DGBA 5KG6A 3FCHA 3AY0A 1KLMB 4NLPA 3D7SB 3W61A 4L73A 3W65A 1NPPA 4D3GA 4DR5F 2AGQA 2UVVA 4LF7F 1S77D 4PQAA 4QPTA 3M1VB 4DQPA 2X1BA 1YZ7A 3NY0A 3L7UA 4P72A 2OPPB 3M2UB 3T6JA 4QWDA 2QMUB 6FDRA 4KRWA 4LMZA 1VQPS 3TJAA 2AZ3A 3TUZC 5ETPA 3RB3A 5ETVA 5L1JA 1IN0A 1JIHA 4USKA 3FCWA 2GVDB 1FFWB 1YSJA 4DU7A 1SI9A 4WU2A 4J9KA 3CDEA 1FJGJ 2E9RX 2BRKA 1JLAB 2V63A 3BQ2A 1DQ8A 3Q24A 2V94A 2UVUA 3HHKA 3MEGB 3V4IA 3PRBA 4ZVPB 3FNNA 2WONB 1MN7A 4MK9A 1WEYA 1NEEA 3N4WA 4BLGA 3C2PA 3L7PA 4ZPWR 2OUGA 4Y0FA 1P1TA 4ZP6A 1WELA 3BZQA 1I6JA 3OFGA 2B9YA 1C0UB 3LW5C 4X4PA 2Y8YA 3QRQA 2EFPA 4DX7A 2W8LA 1FVQA 2LEBA 5IOLA 1TZ0A 5GMKa 5KG5A 2ASDA 3CO9A 3HFVA 2VONA 4QBUA 3IS9B 1VFJA 1F9FA 1YJWS 3NGTA 5EX3A 4DUTA 3KK1B 5A8WB 2ADCA 1RAIB 2ZE2B 3HHLC 2HS4A 2K7JA 3DCAA 3IMQJ 4DR1J 2LLZA 1T94A 2YNGA 3AB2B 3MEDA 3G8TA 4DCJB 2AKWB 2IIHA 2VFRA 2F3JA 4HTJA 1HR0F 2JLGA 4AYBD 2J8AA 2V4RA 2F9DA 5GMEA 2EVZA 2PD1A 2ZHBA 1QTMA 4IH6A 2AIRB 4TLQA 2XS2A 1O6XA 1X4FA 1XNQF 3EXCX 1T11A 5CYMB 1SH2A 1UW4A 5HP1A 2JVRA 5A2QU 2B4OA 3GP9A 4B9UA 3H5XA 2ZH3A 1GTEA 1ZAWA 3AQOA 2EK1A 1HNXF 3BN7A 1QVGR 4GKKJ 2YKQA 1YLXA 2A6OA 2RU9A 4QWAA 2R8KA 5HQ8A 2OAUA 2BANB 4OYZA 2UP1A 1WEXA 4B9MA 2KDOA 2CJKA 2COLA 2QMXA 1B99A 2C3UA 3DOLB 4KHPF 2ERRA 1UVLA 3CMAS 3BS9A 3UCUP 5LXRA 4I68A 2W25A 3GSDA 4Y65A 4M5NA 5I3PA 4KHMA 2DNGA 3K5NA 2Z57B 4FS1A 2QRRA 2HW3A 2YPZA 2FJEB 4DN0A 5DM6Q 3GYXB 1U8WA 2ILZA 2XYPB 2SXLA 1XJWB 5CYQB 4KV8B 2EPIA 4GKJF 2MHNA 2KG0A 1DURA 4NEZA 5IV4A 3VAJA 1HYSB 4W90B 2ADBA 4ALZA 3LP1B 3POTA 5KFFA 3IBFB 2HRYA 1TL1B 3KNGA 2YKAA 1HBUB 1TKXB 4LF2A 1BY9A 4MT1A 5DG9A 3CJRA 2AGPA 1OPIA 4C8MA 3LF0A 4FZVA 5K8PA 2M8DB 2J6TA 3J7AN 3IN5A 2BVZA 2JEGA 3N9UC 3CWJA 4IG0A 4JV2A 4GO7X 1R27B 1K1QA 4UF4A 5KT3A 3BSOA 1VLYA 2R3VA 3PYEA 1B0VA 4X84A 4B3OA 4USWA 3TAQA 3A8IA 1NO8A 3TI0A 1L5UA 2AYEA 2W01A 4YS2A 3TZXA 1A7GE 5KT6A 3D4JA 4AFFA 3K59A 1X31C 1YTYA 2J9CA 4F0HA 3MGJA 5D3GB 4KTQA 2VDIA 3R2CJ 1JJCB 4QIGA 2J0XA 3M8WA 3TQEA 2VH7A 1K9MT 7FDRA 4CM0A 2RT3A 1C2PA 2AJQA 2BQ3A 3ILIA 2Q66A 2DK2A 3DDNA 2ZM6J 2JSXA 3G87A 2IAJA 3KJFB 1U2RA 4C8OA 3JQKA 2YWWA 4JI8J 1TL3A 2XSJA 3TEGA 1JK9B 5FLXU 3SV3A 1Q79A 1UL3A 1RJJA 3M8QB 1CULB 4YHHF 2ZFHA 1HD0A 1WF0A 3TUPA 5KG0A 1HWUA 4DR3F 4LREA 4E2FB 1IWGA 3OR2A 3TAMB 2QT7A 3K8VA 3MM5B 3BGUA 2QL7B 3CNQP 4ZPTR 4KPYA 2ABYA 1HNWJ 1QJHA 2YQ3A 2ZZTA 4QIFA 5A0YA 2B4UA 1AW0A 3QIPB 1UCNA 2VHGA 4DV2J 2PC6A 1RI7A 2V0NA 3W2VB 3PO4A 1WHWA 3A3OB 3KHRA 2HQIA 4QWEA 2GNKA 2PMZD 2R7UA 3WIVA 1K1SA 2QSFA 2R2RA 2VPWB 2CFXA 5HMZA 1T9WA 4QWBA 4UQTA 1GX6A 1IUJA 2XQCA 2ZDOA 1IBKF 3GG1A 4LVOP 5B0EA 4K4XA 1CVJA 2B7BB 4ZCLA 1D09B 5FDLA 5EWEA 1TFYA 1FTRA 3HZEA 3RBZA 5IT4A 2JH3A 5HK4A 3FMWA 1EQ0A 2F4VF 3DOMA 4IRDA 3MEDB 2IRYA 3RU0A 3AXKA 1VQSA 3BV8A 3R5CA 4MIWA 3ET6B 4RNMA 3OV7A 3CCES 2HHVA 4TVAB 5HVHA 3V81B 3DRSA 4O3NA 5FJ4A 3GLJA 1RWWB 1HIYA 2W7AA 3DRRA 3K89A 4EK2A 2XCAA 4NLGA 5E7OB 2IVYA 2WBRA 4JI1J 3QQCD 1VDHA 1YJTA 3HVTB 4B9VA 1CC8A 1WNEA 1Z1ZA 1S99A 5HROB 2ALZA 2EFQA 1E6VB 4J9VA 3KYLA 1IBMJ 4I67A 1HD1A 3M30B 3AA8A 4RO0A 2YNIA 3QIDA 4DCPB 3HDSA 3MUVP 2NZ4A 3QLHA 5ETQA 3W62A 3DLKA 4QPXA 1R43A 1UA0A 4DX5A 2H5IB 3UI3A 1U6BA 1JJ2R 4LFBJ 1Q1KA 2UUWA 3LOUA 2HFUA 4QYRA 3OT9A 4JI5J 5KFUA 3MPYA 3JXOA 2NPFA 2JZ5A 5KG3A 2HQFA 2EWHA 2HBZB 4DL5A 5D15A 1QLNA 2BYCA 2BABA 2W9BB 3VQTA 2C2EA 1UKUA 1V5VA 1S6PB 3WQPA 4RUAA 1TKZA 3PJ9A 1N8RT 3G96A 2GO9A 3AH6A 2O66A 4FXVA 1QD1A 1TAQA 3F0NA 2N7YA 4OYBA 4B3SJ 4N41A 2XWYA 4C4WA 1WI6A 2K06A 4CQ1A 4DU8A 4IOCQ 4NCGB 1WC5A 4YY3F 3IR7B 2YWGA 1DLOB 1YVFA 4YP3A 2NR0A 1K0TA 1RT7B 3ILLA 3NS5A 5KFMA 1N32F 4B3TJ 5I3UB 2BV3A 1ZAVA 5KT5A 1S9GB 3CXCR 3SFGA 2KVQE 2WSCC 2DHAA 3H2VE 1R8PA 4XPEA 3OVSA 4DV1F 1YIJS 2XMTA 3OW2R 2J6SA 2XNRA 1Y11A 3OTBA 2EFVA 1IVZA 4NLRA 3RAMA 1U48A 2Z2LA 3PYGA 1F9HA 1JLGA 3IM8A 4NYPA 1U1LA 5K14B 3X1LB 1U7LA 5HVGA 4CH0S 1KOHA 4QJVA 3R9LA 2HHPA 4RU9A 2ZEJA 4K4WA 5F8MA 4FKXA 3G71S 4MKBA 3GU0A 4C8YA 4K4ZA 3THVA 2DT9A 3OLBA 2HGLA 2I38A 2IM2A 2CXEA 1WD6A 3B82A 2DR5A 2N4CA 5A8RA 3OXGA 1ITPA 1GH8A 1VQ7S 2JNJA 1OQ3A 3DHWC 2DO0A 1SB6A 2IYGA 3BO2A 1DRZA 5KFBA 2VQFJ 3RJMB 3KLEB 2HWIA 3MM5A 3MR6A 2O5DA 2BJ7A 3P3DA 5DGAA 4FXWA 1M1KT 3FSIA 1VHIA 3BDPA 4JI1F 4WIQA 1FKOA 1SH0A 2OD6A 3CCMS 1U47A 2E29A 2DR6A 1GMWD 2G2ZA 4F7VA 4OL8A 5H9EK 2D3O1 5LSOA 1SL1A 4K4VA 3W5XA 2V6AA 1BUXA 3OJUA 3TARA 4ZLNA 2KG1A 3CJKB 1OMSA 1FA0A 3D0HE 3MOZA 4LSZB 2W4PA 4NLWA 4FF1A 2W2QP 2JHEA 1XR6A 3CB4A 4CH7A 4DV4F 4WTOB 5C2CA 1W2IA 3JTNA 2ZZNA 1VQ4S 3SBMA 3IS9A 2CPEA 4ZITA 3EGVA 1RADB 2I0XA 1EAYC 4GVBB 4JI3F 4DV7J 5GADU 2YWKA 3IWLA 1DQ9A 4O3QA 3U7JA 2D7SA 4KGXB 2MZTA 2PA3A 3OSNA 2W9CB 4HHHA 4ECXA 2R8GA 4ANEA 1O51A 1LXJA 2VD3A 4YY3J 4X4RA 2N4DA 2J0SD 2AWZA 2GQCA 2P5VA 1S1TA 1TKTA 2OPRA 2VPZB 4RW6A 3OVBA 5E3RA 4B3OB 1RTJA 3G8QA 2HURA 3D3BJ 3QLHB 3WX8A 3MD1A 3DLKB 3U02A 2R7OA 5CH7B 3UDEA 2FUG9 2V5HG 4QR0A 4OI0A 4CT9A 2EK6A 2GJIA 4H4OB 1REVA 3VGUA 1HW8A 2O01C 2OD4A 4Q45A 4LF4J 2DNMA 3AB4B 4TLRA 1BQMB 5IM0A 3ISND 4DX8H 1JKHB 3FFIB 2FD2A 2MDAA 3OUYB 2XO7A 5C25B 5EN1A 4LF8F 1EKSA 1O0PA 3DOLA 1S6PA 3VAIA 3CCVS 2JC0A 4NLYA 2XSFA 3MPVA 1P8GA 3GIRA 3Q23A 4WFNQ 5HN0A 1Y5NB 1RCXB 3M8ZA 3P8BB 3H0PA 2CAJA 4OYAA 4PXDA 5B0DA 3BSAA 4DR2J 5HJYA 2AV5A 1X4CA 4RNOA 1N6QB 1MU2B 1T03A 4M5IA 4IRCA 2P2CB 1IXKA 2QLBB 1QUVA 5I3UA 3Q8SB 4X64J 1W2BR 1D9FA 4GC6A 3TX8A 3QJPA 2HS3A 1XMBA 2KKHA 2KYZA 2DITA 3R3TA 5KFSA 3TYTA 1LWFA 2JJ4D 4CLSA 1EQMA 3US5A 3ICLA 3MAAB 4ZPDA 3T3FA 2NPIA 4X4QA 1RB0A 1RWXB 3DRPA 1WC4A 3H42A 1KTVA 1NZ8A 1UEKA 1TU0B 3DMJB 5BYRA 3TR5A 5AXMA 4E0DA 1H2VZ 4Z7YA 1LW0B 3QFWA 3D0GE 1IKVB 2M0GB 4AT1B 3MECB 2KM8C 1WC1A 2L9DA 1RT3A 4IUFA 3BBBA 4W98A 4EO8A 5D4PA 4LF4F 3CJ3A 2PEBA 4ZKAA 3DLLQ 3AOAA 3OHBA 5A8RB 5IWAJ 4EMDA 2Y8WA 3KTQA 2O3DA 2QL9B 3PIOQ 1JLFA 2QYGA 2BJ1A 2M4MA 4YB5A 3BN4A 1WSVA 5KFDA 4J9QA 5J2QA 1LW2A 1XC9A 4M5KA 5CXTA 3LUYA 2AJ0A 2BBEA 4KIAA 5D77A 3WHIA 4JI8F 1JX4A 2OPSB 1GQEA 3ILOA 4GC7A 4P73A 2YWFA 3Q83A 4H4MB 5SUHA 4OJHA 3VV2B 1N36J 3C66A 2OEKA 3UCGA 3CCTA 1UETA 3K7RA 4NLVA 5ETKA 1KBRA 2QA1A 2V4QA 4DL0C 2CQHA 3KG4A 4LJMA 4LR8A 2HMIA 3J81U 1RT4B 2RJZA 2WRMA 4IQMA 4ITSA 4KR0B 1FD8A 2ZBIA 3PJWA 4G1QB 4PEOA 3MTKA 4F4XA 2LQ5A 2PGCA 1PYTA 4DV4J 3S1TA 1R89A 3HMJG 3DLEA 3UW1A 4MAKA 1FDDA 1U1MA 4PKDB 3OFEA 5J1EB 1YHQS 4BC7A 3PR4A 1Q5YA 2ZH5A 4NXNJ 2LDIA 4A46A 5AE1A 4MTPA 3R2DJ 2OHDA 3AOCA 2DR7A 4F4WA 3E51A 2HGNA 3ZTOA 3OL9A 5KFYA 3C6UB 4B9SA 1HI1A 2F1FA 2FDNA 3N5FA 4B9LA 2FZKB 1V3RA 3UD4P 2NSCA 1I51B 4J9LA 2IMWP 1DFDA 3PRDA 1FJGF 4K2JA 1XMOF 1OIAA 3GG0A 3L7OA 2AEJA 1HBMB 2ZBRA 3NBPA 3NAHA 5L9NA 5HL7Q 5KFCA 3EPIA 4I2PA 2DGSA 1Z2LA 2PEHA 2Z8QA 4O4GA 4CO2A 4KGZB 5LT5A 2ZBQA 5HLFA 1G2EA 3ITHB 2P6SA 2VBZA 1NM2A 5CQGA 2R2TA 1UWBB 3TVKA 3T19A 4EYHB 5JMNA 1N88A 1MNEA 4TU9A 1JKHA 4KHPJ 5DZ7A 1SJRA 4A8XA 3M6VA 3UO0A 3DHXA 4RW8B 2MKJA 2WAQD 3D68A 4PG6A 5L46A 5KFHA 4RZRA 3J7YU 2IM3A 4WFYA 1U24A 4K59A 2PA8D 2DXDA 4MKAA 1D0EA 4DV0J 1VHFA 2NCKL 1CJKA 2Z30B 3KLVA 2GMLA 1YRUA 3LH2S 3SSRA 1UMJA 4URGA 2Q79A 3QT5A 2FJAB 1NDCA 2WVEA 1NK0A 5A6PA 2Z56B 2WW4A 1AB8A 4L6V3 4ZIWA 1RT1A 2G13A 4OMFG 3JSMA 3RR8A 3OJSA 5KT7A 1XNQJ 1JNZB 2LQJA 3QAUA 1DHMA 4B3TF 4MFBA 1IKXA 3TAPA 4CI0B 4G6VB 4AL5A 4JI2J 2YKNA 5HANA 1LWEB 4LFAJ 5D6GA 4KBIA 4JI4F 1R0AB 1UJ5A 4EEYA 4QR1A 4RBUA 2WTFA 3QT7A 2VODA 4FN5A 3EE3A 2OJ3A 2JFKA 3OTOF 2N7CA 1ZOTA 2ZKUA 4C48A 4WF9Q 1RHRB 5C5JA 4Q44A 1S57A 3VCDA 2M8HA 1S9FA 3QGPA 2CIMA 2CRLA 4ZCIA 1SUQB 2FLLA 2JLFA 2F8HA 1M5PC 2BDPA 1PG5B 4ATNA 3CGIA 3ILJA 4FYWB 2DRAA 2QEXS 2W7OA 1T3OA 2XHWA 4MKVA 1S5ZA 4KHRA 3SDEB 3GR0A 3SXLA 1HNVA 2E5HA 5K14A 5KOWA 5HATA 4JI0J 1GXTA 1WHXA 3I32A 2Q6BA 4Y00A 1S1WB 1TTHB 2MB0B 2OFHX 3DFEA 1S0MA 2O67A 4UOFA 5ETRA 4JYAF 2B5JB 4NMXA 3BF4A 3H40A 2RQMA 2GIRA 3Q8QB 2LXUA 2N3OA 3W63A 3PDNA 2ZUAA 3ZTPA 2UU9F 1HPZB 4B17A 4Q2LA 1WC3A 3M9MB 2HYIB 2PI4A 1N5SA 2HZAA 4B08A 1X9SA 2OO4A 3DLGA 2M52A 2CJYB 1NRKA 5KG4A 4BC9A 4OYWA 4C3KA 1XR7A 1SKRA 3A1YG 3PG9A 1FJ7A 1X0PA 2K3IA 3KXDA 4OX8A 2C42A 4B3RJ 3AOBA 4FP9A 5C25A 2GCFA 4HH1A 4W92B 3THTA 5IT0A 2DD8S 4LRAA 1AT1B 4OX9F 1M1GA 3LGMA 4LF1A 2GC8A 4DFMA 4CTAB 2HHHF 3JTOA 1XN9A 2B8PA 3JQJA 4NMLA 2G1DA 4USJC 3VVTA 5KTQA 3LWLA 1FCAA 4KH0B 2BMBA 3R27A 4O3SA 3MUTP 1HQUA 1DQAA 2V69A 5ETTA 4TN2A 2PE8A 3OTOJ 2UXCJ 4KPCA 1MU2A 3UDLA 1T03B 5GAGI 2C3PA 3L95X 3MWBA 3Q8UA 1E6YB 4NE9C 2GZOA 1S4FA 2M88A 1YJ7A 1FXRA 2J0QD 5AE3A 4JI7F 3R8YA 4O3OA 3ZC4A 3GZ7A 4PWDB 3D67A 3MAAA 3QT6A 4G3IA 3D66A 3O6QA 4X66J 2RDDA 5I3QA 4F67A 1S9EA 1H2UX 4LBHA 4YDXA 4EBEA 1F2HA 1V9OA 2CQIA 2Z58B 3BH7B 4ZLJA 1U1KA 1CLFA 4K5RA 1HNXJ 1V6HA 3FZ2A 2ZM6F 2OIHA 3MM9B 1F5BA 2V4JB 3FVYA 3PX6A 1H38A 1PILA 2MLZA 4WYWA 3HP6A 2HNZA 1BD6A 4ZIVA 4IG3A 5ETMA 5L8RC 3BGRA 1X9MA 2C2DA 1ZA1B 1IR0A 4DI6A 2FHMA 5CYMA 2KT5A 1SCJB 4BS2A 3CC2S 1JLFB 4LFCJ 3OPKA 3BEGB 5A76A 3RB4A 1C1CA 1P1LA 1HQ2A 1N32J 2CQ4A 4NOHA 4OJ3A 2HBRB 3I5BA 2R7SA 2LEPA 4NX9A 3TEHB 4FYDA 4KKOA 1KONA 4NLUA 1VIXA 4RNHA 3Q8RB 1FRIA 1NU4A 1IKXB 2LKZA 3H25A 3MPWA 1J5EJ 1XMQF 3A8JA 3PTWA 4X2BA 1NLKL 2AHOB 2V2VA 3P5TL 4NA1A 5T7LB 5L39A 5IC6B 1CPZA 2LEAA 2YQ1A 4HI1A 2ZH4A 3QPIA 4WXWA 2I5JB 4JV5J 4NEYA 1RSCA 3DKDA 2QGFB 3Q8VA 3OQ2A 4C6AA 1JB0C 5BJRA 3G6VA 2D1CA 3CCLS 2OTJS 5B0FA 2UUBF 4ES1A 3MMBA 1WJ9A 2DPJA 1MROB 3DXBA 4LSNB 2WOMB 3TJ9A 2ASLA 4Q5VA 4XIUA 4U7CA 2LECA 1N5YA 1DTTB 2HG4A 3MR7A 4C98A 1HI0P 1S4EA 3P4UB 2J9DA 2EI5A 1RK8A 2KRRA 3H8YA 1YI2S 1NK6A 2VC1A 4NA3A 2V50A 4A47A 1MN9A 4RUCA 3V6DB 3QATA 4OZNA 2ZH1A 3FRZA 4N8NA 4O4RA 3KK1A 1AFJA 3C14A 2FHJA 4IOBA 2KXNB 3CSKA 2HIYA 2M2BA 4KAIA 4DL6A 1C0TA 4X4NA 4OI4A 3CC4S 2KFYA 2XI3A 2HSEB 2HRUA 2LVWA 5DRKA 4Q0BA 3H4BA 1KS2A 1SQEA 4NLQA 4DLEA 3PKMA 3R5BA 4UZBA 4IOAQ 1ZPVA 3BGOP 3KUHA 3QFHA 3EUNA 4XAKA 2GIFA 2EW9A 4OX6A 2JRSA 1QAXA 2DNKA 4CLWA 3A3PB 3GIKA 3CCJS 2VL1A 2YNHB 1N34F 1UPMB 1OSDA 3QWUA 2UV8G 4MIBA 4NA2A 2XLIA 3D6MB 3GB0A 3MCMA 5KT2A 3ITHA 3TQ1A 1L3SA 2VC0A 5KFEA 5J2QB 4B02A 4DLGA 3PIPQ 5HBMA 3LGNA 2UV8A 3DYAB 1ZTWA 1MWYA 2BOPA 2QO3A 3D6FB 5CA5A 2QN6B 3KJQB 3MEKA 3M8RA 1ZZNA 1LEOA 1MW7A 1NNDA 2OPQA 5C42B 1TKDA 5IZHA 4C8NA 2A18A 2LQ9A 1YWXA 3DXSX 4NRTA 3CF5Q 3M1VA 1OY6A 3H5SA 4ANDA 1LNQA 3DU6A 4LIRA 2KH9A 2ROEA 4WCEQ 1O5JA 2DPIA 1FNOA 1PSDA 1H72C 3AJ2A 3ZNJ1 2WSEC 2DRDA 2X3DA 4WK1A 1NKBA 5A0YB 1QSYA 3NNHA 2ZVIA 4WKRA 4EU0A 3QIPA 4ZA1A 3KK3B 3MPUB 1HBNA 1LWEA 3I31A 5LSLA 2MQQA 2UUBJ 1IJEB 1YJVA 2H9ZA 2YTCA 4IH5A 4IQXA 1QSLA 1RLCL 1Q8LA 1RAGB 2ZH8A 3ETOA 4JB8B 4P71A 4UZCA 3R1HA 2ZKTA 3UDCA 1IM4A 1UFLA 4M8LA 4ECTA 3GIIA 2DNRA 3IBWA 2Y0SD 4Y6IA 5KFVA 1H0HB 1HBMA 2AJFE 3NBPB 3FBEA 4NLSA 3RAQA 3H5UA 1S79A 3AT1B 2N82B 3GJSB 1RWUA 1TMMA 1PAEX 3B8HA 3TOQA 4ZMMA 1R3NA 1KVJA 3ENQA 1QUPA 2WZ1A 2QSWA 4G65A 4DPYA 2V8VA 1A6LA 4IG3B 4ELTA 4ED5A 1B0PA 2OELA 4PXCA 4ES2A 3BKUA 3PCOB 3R5GA 4CLTA 4HTIA 3NGKA 2GIQA 4PWUA 4RNNA 1N33F 3VZHA 3MAHA 1GFWB 4RKUC 3GILA 1X0FA 4N7TA 4C8KA 1RAOA 3QMQA 1ZH5A 3AA9A 2VFSA 2YNIB 4F50A 2RD5C 4HHUA 1OO0B 4M63A 4V1Ak 4IRKA 3JAMU 1FEEA 3R6GB 4J9UE 4B9NA 1RLDA 3UFCX 3FC9A 2BRLA 1XNRJ 4IH7A 4X4UA 2J6UA 1WOPA 2AZ1A 4KY3A 2Z0GA 4MK8A 5CHCB 3GCWP 4PG7A 2QA4G 5H1SV 2E7XA 3W2VA 4WTYA 1RKJA 3EZUA 3KHHA 2QLXA 5D4OA 5C2GA 4EZ9A 1NXIA 1R0CB 2DHXA 3ISZA 1W7WA 3HHLA 1T8EA 1F1BB 4A8KA 2LQBA 1TV6B 1WSRA 3EWGA 4OYPA 4E8UA 4USMA 2PI5A 4K4SA 3M9NB 1JLCA 1B7YB 5JUMA 2PT0A 4UT4A 1HNZF 3VVUA 1JLEB 3D54A 5HMYA 2OEJA 3VZIA 4DZ6A 2P8IA 1VQOS 1IBLF 2HVEA 3DI6B 3QBCA 4NLXA 2DIVA 4ZJLA 2FJXA 1RISA 1VRUA 5DJBA 1YKWA 1FFSB 4NLOA 4KV8A 1RYRA 1RT7A 4PCQA 2I2YA 5K9FA 3RYLA 5MLCV 2XMJA 3OTCA 3BO4A 4OX9J 5E3PA 4LQ9A 1VQ6S 1FDNA 1Y00A 2E44A 3DRSB 5CAAA 5LL6d 1TL1A 3EDQB 4ERDA 4G1PA 4O44A 2OSRA 1EETB 3RAXA 2JVOA 1G1XA 3RB0A 1S6OA 3MHYA 1VQNS 4QU6A 2MQLA 2RS2A 1T05B 2MGZA 3IM9A 3O5TB 4GO5X 1UFKA 1QTNB 1DTQB 5J2MB 4LRCA 4CLLA 2MQPA 5DDRC 3V6KA 2XY5A 1U45A 2CJAA 2BJ9A 3D0IE 1FXLA 4DPWA 1S7IA 2J9DE 4J7CA 4CO1A 3BSNA 5KFXA 1CJTA 2GQQA 3TW0A 2Z2ZA 4EO6A 1KQGB 5F9LA 1JXLA 1XBWA 2ZH2A 4UY85 1WOSA 3E01A 2K3KA 2P9GA 5HVFA 2HS0A 9RUBA 2G0CA 2HNZB 3W9IA 1QAIA 3TZZA 4K0KJ 3OTDA 2DNOA 1VRTB 1RWNB 3M2VB 1S1XA 4ZVOB 2OMLA 3RRHA 1K8AT 1B70B 2AF6A 2YXLA 3AD8C 1IR2A 3KG1A 4PZVA 1C1CB 4DL3A 1RWMB 1MMDA 2PIIA 2VA3A 2MKSA 1D9DA 4MYTA 2HQ3A 2RDIA 2IYIA 4UW2A 1K0VA 2MLXA 3HT3A 2EEYA 3T41A 3HHNB 2H5EA 2DYAA 2EFGA 1SJQA 4WBFA 3WC0A 4EI2A 4HYKA 1C4AA 3K5OA 3VQSA 5AJ3F 4DMZA 3C46A 2Q3PA 3MF5A 5ETSA 1VQYA 1Q5VA 2ACYA 2XY7A 2WK4A 1OQ6A 1TP7A 2H1YA 2CQ3A 3S6EA 1NJXA 4JI4J 3MR2A 1BHNA 1S59A 2AX0A 5L1LA 1MROA 3W3SA 2HVIA 3E8OA 2WOMA 2DKOB 3JSBA 3H90A 4K8RA 3P5BP 1N5YB 2FJVA 1WKJA 2L48A 2E1PA 3CVKA 2IFXA 4N76A 2J5AA 1FESA 2HEKA 2GGPA 4LUBA 2E66A 1U49A 3G82B 3IWNC 2RB7A 3PJXA 3PYFA 2CYYA 3K58A 4L76A 3QRRA 2EKYA 2GAGC 1HNIA 1SIWB 4I64A 1FKPA 3W8GA 2CPZA 4MMOA 2B56A 2CVIA 1YRTA 3K8WA 4PPDA 4ZVQB 1SKUB 3SMZA 4RUBA 2ZJQQ 1S0NA 2Y1IA 1RWVB 2QFJA 3ZTRA 2JC1A 3I82A 2X1FA 3FSYA 4RJVA 4LSLB 4UY8T 3O3LA 1RCOB 3PW7A 4PUOB 4OI3A 4JV1A 4Z37A 1RAJA 3GR1A 1CG2A 1RTJB 5HSPA 3AAWB 2EC0A 2W2OP 2IJNA 1BQNB 2VPXB 1E6VA 2KU7A 4IFVA 2IM0A 3RB6A 3SV4A 2PN6A 1X4AA 3FBCA 4YQWA 1JMTA 2ZHOA 1YDLA 2XZDB 3KUGA 3L9ZA 4QWCA 3PKYA 1XTZA 2ZH6A 4V19X 1X8DA 4V19J 5IQQA 1UEVA 2Y1LB 1BWVA 4N77A 2EC2A 2AJ1A 3GTYX 4WFXA 3UQSA 3OTEA 4X64F 5K8NA 2F63A 2JEJA 4DUYF 3HHLB 5C42A 1KHVA 1TV6A 2NSBA 4OJ1A 4J9PA 4A8SA 2WSFC 4C7QA 3QJLA 5C7PA 2JEFA 1RWOB 3B78A 1GAOA 1ULRA 4WE1A 4ELVA 4LSNA 3DI6A 4ZVFA 4ED0A 2DO4A 2KT2A 2V8GA 3DDIA 4OI2A 2WVFA 4ED4A 5C24B 2VQEJ 2DY1A 4LT6A 4DFPA 2PDAA 1U1RA 1NSKL 3M8PB 2WBMA 2P6TA 1FT8A 1HBNB 2CWXA 1LWCB 3B6BA 3LPYA 3CCQS 3KJVB 3EYZA 1N48A 3NNCA 4OQJA 2W9CA 1APSA 2D9OA 2AX1A 3AHPA 4NYOA 4HR2A 1BE4A 5J2MA 3VAKA 1HKAA 4X4TA 2XM3A 3HO1A 2R2UA 2B9XA 3MM6B 4IDKB 4YB1P 3C6TB 5LMNJ 4DR3J 4DQQA 2ILYA 2PSZA 2Q1LA 3CTRA 1NMEB 2EXUA 2RQ4A 3A12A 3OHAA 3LAMA 3PX0A 3M4XA 2HK2A 2XZWA 2ZOMA 4F4ZA 1XEZA 2EFNA 5ADZA 2FVQA 2FTRA 4CYUA 1KEKA 3DYAA 3IXQA 4NCBA 2EBGA 2OLWA 1U0HB 1X5PA 2ACMA 4DV7F 1VQ9S 2F5GA 1ZBTA 2OPPA 4Z7CA 4WK3A 3QZ7A 3K5MA 4ZJOA 1QAJA 4ZPAA 3KFWX 1RU2A 3FRYA 2E5JA 4JOUA 4DSJA 4DR6J 2MEWA 1Y5IB 4KGMA 5KFZA 3K5LA 3CDWA 3PR5B 2FLOA 3CO0P 1ZETA 4U96A 4PR6A 2ASYA 2HHUA 2H48B 4ZVSB 3HJVA 2RMLA 1NK9A 4Y2IA 3VR1A 2CG4A 2PO4A 2VFUA 2C2ZB 5F0UA 3FEZA 2HRTA 3ETMA 3D1HA 3PM9A 5T41A 3J81Y 1TL7B 2RKIA 1FJEB 3V4MA 4ZPBA 4OX7A 4WU3A 1I94F 3EPGA 4G1QA 1VRQC 3NOGA 2XTJP 1KFSA 2ZHAA 2BJDA 2XCPA 1MWZA 1VQLS 2OTLS 3RRGA 3CD5A 1IWAA 1U2CA 2FPHX 1SIZA 3BKFA 5E33A 3PVXA 2R8IA 4XTTA 3RTVA 2VQFF 2ATCB 3ADAC 3NS6A 5DO2A 1NSQA 2GMJA 2AD9A 4ILMA 2YNFA 2RE1A 1HNIB 1LQ9A 2BKOA 5LXYA 1UPPA 1IJFB 3QGGA 1XQIA 1VRUB 2HFOA 4ZN1A 2XGPA 2CJ9A 2B9WA 1FKAF 1HL6A 4P52A 5ETNA 2UUTA 5KFLA 5F8LA 1CQMA 3EVOA 1WHYA 1ZM3A 5K8OA 3PW2A 4NLTA 4QIEA 1IKWB 4RW7B 3U1LA 5K20B 2Z2MA 5GVQA 1SC3B 1X60A 3OR1A 3IRXA 1Y3KA 3D1OA 4C0HA 3J7Z5 3X3UA 3KUEA 4ED1A 3N01A 3ISNC 3J80U 5BR8J 4ETXA 4K4YA 4GKKF 1DTQA 5J2PA 2Y1JA 2K1RB 2ZD1B 3HHLD 1VQMS 3EXYA 1FK9B 5D4LA 1NDKA 4X65J 2DNLA 1VC0A 4PRFA 4MYUA 3N6LA 3A8EA 1YBUA 6AT1B 2V34A 2LDYA 3VAMA 2W8KA 5DDOC 1AZSA 1YQHA 2ZVSA 5U47A 3JS9A 2IC3B 5AXLA 2AJ2A 1WG5A 1PCAA 2ZNYA 1AYEA 4D3HA 4DJBA 4F25A 3KMSA 1REVB 1OWXA 3NCQA 1AXQA 3SZ2A 2RF2B 3E3XA 3VF0B 2E5IA 2Z2YB 2J9EA 5DZ6A 3VAGA 4M94A 4DR1F 2OKQA 4JI3J 1EZZB 1U09A 1WI8A 2VFTA 3ENAA 3M2UA 2MZ1A 3HSGA 2DR8A 4CNZA 2CVEA 5C24A 5BXIA 3NWRA 1YG0A 1F60B 1RAHB 2BUNA 2HFSA 4NZ0A 5DDPC 3EGWB 3G6YA 1H3DA 1T95A 4YDDB 2R8JA 2GVDA 5KG7A 3PZPA 1N5QA 1FHTA 2ZC4A 3GONA 2R9LA 3LQVA 5DLGA 4ECUA 3NG8A 1U1QA 1SL0A 2CPJA 2NS1B 2NUUG 2V2ZA 1CJUB 2HK3A 3PHTA 3Q8YA 3ZFVA 2W2PP 4YFUA 4JI5F 1D9AA 4PYDA 2L3MA 1YZ6A 2MKCA 2P9CA 3QO9B 2UXDJ 4HT5A 5JVGQ 2QYCA 5EHHA 3V2UC 1EETA 2F40A 1Y10A 4PQUB 5D0RA 2W7PA 2W4DA 2HHQA 4RL1A 2B8QA 1RTDB 4PYAA 1P9QC 3NXZA 3GJTB 4I7FB 1VLOA 1NHUA 1HHSA 2FJDB 4DN9A 2H65B 1MWQA 3GYGA 3MM8A 2DGOA 3CE8A 4FVMA 4OYXA 1JJHA 1FWPA 2NXUA 4S0MA 2CJQA 3W9JA 2BACA 5T14A 4A8WA 4BDPA 3DLJA 2GX8A 3SYZA 2GO8A 4ILLA 2WHOA 2EG1A 1IKVA 2FY8A 4FNIA 4DR5J 3LAKA 4NZ6A 2UVWA 1FE4A 4C0BA 1ICEB 4LSLA 5LMUJ 3BPDA 3R7NB 2C28A 4J9RA 1HQEA 4HDGA 1Q86T 2F4VJ 5KG1A 4DSFA 2J0WA 3T1YF 1F3VA 2DNQA 3T5LA 1H73A 4ZDNA 5HMXA 1J2VA 2ROGA 1R8BA 5G4DA 4IFVB 2MJNA 3K2YA 1WDTA 3TAMA 5JVHQ 1SVDA 4EYIB 2H4WB 4KFBA 1KVKA 4M5MA 2IDEA 1FNXH 3GJRB 1VQ8S 1QSSA 3AQPA 3CJTA 2BANA 1M5KC 1VK3A 4C3MA 4IR9A 2HNYB 1R0AA 3S01A 2CDRB 1QE1A 3R7SB 2HNDA 5EWFA 3PHEA 2VJUA 2KFZA 3F41A 3T1AA 1M0SA 1KKHA 4AXIA 3D5MA 4OJGA 2M9KA 1YBAA 2PMHA 4M1KA 1RT5B 4JI6J 2BX6A 2GJ2A 2MZSA 3CCWA 4CIOA 2AYMA 1QY7A 3HFZB 3N6NA 4LIWA 4JP8A 2ZWOA 4KC5A 2F4FA 1PKUA 4C11B 4RUHA 3NOCA 1KWMA 4M5HA 2C22A 4KH1B 3AJDA 5E5NA 4CH1A 4J90A 2QMWA 4KO0A 3SDEA 5ITHA 5CD4H 1SJ3P 1HNVB 4DSLA 5K8MA 4RBTA 1NKEA 4R25A 3CCZA 2QE5A 3OR1B 2CDQA 3KJVA 1NAQA 2ZC3A 1N33J 2U1AA 1TUVA 2KZMA 4TQRA 2DH9A 1S48A 2B5JA 3N79A 3ONQA 3NCRA 5F3TA 4LFBF 3UD3P 3OSPA 4PUOA 2HVZA 1V5IB 3C6TA 1G6BA 1RHQB 3G8SA 4DPXA 2MZRA 4GRSA 3HHEA 3M6XA 1K47A 1AUSL 1OPZA 1Q82T 2JFDA 2HHTA 3MM9A 3GFHA 3QSYB 2FVPA 3K5PA 3GYNA 3SQGA 2BM1A 3M7VA 5KOXA 2L08A 4LRBA 2V9WA 2C3YA 1VBYA 2DGTA 1U6FA 4C8LA 4USUA 1FERA 2A2CA 4P2MA 2HQCA 4FPIA 3TNVA 2AQ4A 4DL7A 4DQIA 2QLWA 2D74B 2FB0A 3SSQA 5LJ3Y 5AT1B 2CQ1A 2KT3A 4CLYA 3K57A 4GKJJ 3Q2SC 4RLEA 4DSIA 2BJ3A 1SQGA 1UFWA 4JV0A 3TANA 1ZYQA 4F3OA 2FGOA 1JWWA 1RP5A 2F8EX 2WVDA 1YBTA 1B3TA 1YJUA 2CQ0A 2XB2D 4U6PA 5B0AA 4P75A 5KFKA 3MDFA 2X7IA 1FEHA 2YVSA 5HJXA 3UN3A 2I5JA 4UQGA 1SJ4P 4R0EA 3I0SB 1Y0HA 3KNAA 3HVRA 4TY8B 1TL7A 2CG8A 2RKIB 5I4MA 4M5JA 1CS4B 2QX0A 1B64A 3CJ8A 1BXNA 4RW9A 4DV5J 1S9GA 4DL4A 1RE1B 5D78A 4DV2F 1UEUA 2NYIA 2Q6CA 3CDUA 3W2WA 3A13A 1DTTA 3NMAA 2V9KA 4HHJA 4ECSA 2VG5A 3HF5A 1UTAA 2G2OA 2WONA 4U8VA 5IT9Y 1NDPA 1F9EB 2C2RA 1SC4B 2MXYA 3S7RA 1YRXA 2A2DA 1RHJB 3EVMA 2E5GA 3V6DA 1D8YA 3IGVA 3IO1A 3MM8B 3JB9k 2XMVA 1B7FA 2MY8A 3NLCA 2H3EB 5D0HA 1KHWA 4X62F 2AYGA 1OS5A 1EB0A 3GE9A 2JLEA 4PXEA 3HZGA 2MSTA 3DGPB 3IP0A 3KDNA 3SI8A 1S49A 3RZAA 2RUSA 4F4YA 2JEIA 3NWGA 3HT0A 3KJNB 4FVCA 1WHVA 4DCOB 3MCNA 4WFBQ 3QJJA 1RA7A 1CEZA 3DRRB 2FJBB 1N56A 4OYMA 1FRHA 3PW0A 4WPAA 1G7CB 3ZTSA 1KTQA 1Q95G 5KFWA 1NK4A 1ZAXA 3O2IA 4W4MA 4KGKA 5I42A 2ZDPA 3W60A 5IXUA 1UVKA 1N0VC 1RTHA 2KB2A 1SPBP 2C2MB 2K1RA 2ZD1A 1U6ZA 4U7UD 4KFBB 2YKMB 3HKZD 1TL3B 2XSJB 1RA6A 4KKOB 1S6QA 1WOOA 3CMES 1VJWA 1U8SA 3KK2A 1HA1A 2Y3YA 2ALYB 4A8OA 1ZPWX 2HNYA 5L1KA 4FYVB 4NYZA 1WORA 2YQ0A 1WKLA 2IPOB 4F2SA 3W8PA 2AEMA 4QYZK 2EBEA 1D8ZA 1LFWA 3O8WA 4YUDA 3RUBL 4DOZA 5LOQA 4RU2A 4JV5F 2PFDA 2VG6B 3O44A 1VK8A 1NK5A 2G4BA 3H7HB 3D3CJ 1Q53A 3H98A 1W26A 4WP8A 2W9BA 4N47A 4J9MA 1YITS 1XMQJ 4DR7F 2XMUA 1J5OB 3TZWA 2IM1A 1RTIB 1UA1A 3GIMA 1RT2B 2NQPA 2D3UA 3ZO7A 3AODA 1TK0A 4Q8EA 2WCXA 2XMAA 5SZTA 1KP6A 2AW0A 4LFCF 1TUGB 1N5VA 3AD7C 3C14B 1EP4B 1HQUB 4PXBA 4CRJA 5EWGA 4LR7A 1N52B 3UN5A 4UTGA 3MFIA 1C0TB 1P6TA 5GAEI 1KOOA 5DQHA 1WTFA 1XK8A 5F0WA 2CNKB 3TX0A 2RQCA 1SBRA 4IFYA 2GVZB 1E6YA 2MHEA 2X3GA 4XK8C 2L9WA 4YEAA 2FZGB 1NB7A 3KDOA 5IFMA 5KFQA 2C2NA 1JQGA 1HW9A 1BLUA 4P2FA 3HI9A 3HVTA 1C1BA 1RXOB 1RTDA 2DBBA 1TUWA 4ZLLA 3VAHA 1HNZJ 1CJVA 1FX4A 2BW2A 3HKWA 2OMOA 4HVZA 1Z2ZA 1Q16B 1SJ1A 5F3ZA 3UR0A 5GMDA 5A6WA 3OBIA 3R5DA 4UOGA 5KAKA 5IM0B 4U67Q 1JLQB 4J9NA 4JI7J 3NNAA 4U7UK 5EGYA 2K2PA 1RUSA 2RDJA 4H4KC 3CD7A 1SJFA 1U02A 4DSKA 2CQDA 4WP3A 3MEEA 2RNEA 1KSPA 2D3ZA 2RF2A 2DB1A 3UR3C 5D3GA 3FBFA 4DR7J 4J91A 5IC4B 2MQMA 4B3MF 1RBAA 1LK5A 5JXSA 2RU3A 3EZOA 4LRFA 2I8EA 2KO1A 4OLOA 4R5PA 3Q8PB 3WDOA 1UVNA 4JBCA 3CD6S 3OL8A 5E3AA 4KJIA 4ZVHA 2IAJB 3KLEA 4BWMA 2IA6A 4NLDA 5DQGA 2KJVA 1RGVA 4FXDA 4DBQA 2XMWA 1NZAA 3KLGB 2FHOB 2V8DA 3MURP 5KFPA 4RW9B 3BH6B 3T5HA 2MKIA 4NCGA 2ZJRQ 3OR2B 4ID5A 5M2RA 1ROFA 2YKPA 4B3RF 2NXEA 5J1PA 1JLCB 3HD2A 1YK9A 2VF3A 2CUYA 3ZNUA 5DG8A 3QO9A 2ZH7A 1YJRA 2KM8B 1D1UA 2A10A 2OI2A 3CDAA 3FKBA 1NJZA 1I5OB 2KFNA 4OZ5A 2V8HA 3VTIA 4M5DB 3VAFA 4DL2A 1IBMF 4NASA 2LA4A 2JX2A 2RVJA 2DH8A 2VDHA 4QW9A 2UU9J 4NXMJ 2R7VA 1UWAA 3DGPA 1PO6A 1PAUB 4CNYA 1VMBA 1WKKA 3UDVA 3PV8A 4FF3A 1XMOJ 3RBDA 4GVBA 3MM7A 2I6WA 4P2SA 4DQRA 1IQZA 2MSSA 2FC9A 5G0RB 2F7VA 3UVJB 4CO0A 1LFPA 4ZVEA 1ZM4A 1X4HA 2GHWA 4M5GA 3QYYA 1GXUA 2A3JA 4H54A 5I42B 3MXHP 1V3SA 3DN9A 2B4PA 3EZ5A 3GMGA 1RHKB 1VIOA 3ET6A 4HACB 2DH7A 3BR8A 1PYSB 2B51A 4F0KA 4KT0C 3J81j 4C97A 4LF9J 5AXKA 3MCOA 4R8UB 4USVA 4JUZA 4OLPA 3Q89A 2RHSB 3EJMA 1KNZA 1K73T 3TVYA 2NZCA 4TXSA 2NUHA 2G9OA 3I0RB 1FDAA 4Y28C 1SV5B 3IWXA 4KSEB 2QL5B 4U95A 4DWIA 4CCHA 2CNNB 3BPSP 3IA0A 3H59A 4KB7A 4F36A 1ZTTA 2OP5A 5DM7Q 2DXEA 3MOJB 3HSDA 2DCUB 4RNFA 3DU5A 4LFAF 4JI2F 1M90T 1FE0A 2HNDB 3MAQA 4X4SA 1ZA2B 1U1PA 1J5OA 3DLEB 4LBPA 4AQYF 3C16B 3QWPA 3GV8B 1FI4A 4ED3A 2GHVC 3NGDA 3M9OB 3GQCA 5CYJA 2VBWA 3KMQA 4OHYA 4FYYB 4ZVUB 5J2NA 2KN4A 3F56A 1TKZB 3IR5B 3UPFA 3AFGA 1HWJA 3MMCA 4I2QB 4DV0F 2AMCB 4ZCKA 1PJ7A 1W25A 2YX4A 2KHDA 2CPFA 5HMWA 1H7XA 2IJRA 5H9FJ 4F26A 3DOKA 3T1HJ 3GFZA 2ZNZA 3VGVA 4PWWA 1FWKA 3LP0B 3M32B 4Y2AA 1TR0A 3CDBA 1KC8T 4OYIA 2DRBA 2LMIA 4AQYJ 3I5CA 5HLFB 2BOAA 5HQMA 2RHQB 4LF5F 4EUVA 1GXLA 1S1UB 1S1VB 3NCPA 1UWBA 1RACB 2KHCA 4XDDA 2W9AA 1FKPB 6FD1A 3N28A 2WB1D 1CJTB 2FVCA 2CZ9A 3NGUA 2XHCA 1JLQA 2CZ4A 1ELOA 2FIUA 3PFEA 2IJFA 2LU1A 4Y2KA 3W1YC 2UUCJ 1URNA 3MECA 1PJ6A 2FQQB 4YR2A 2EG2A 3E01B 4RW8A 1RT3B 3RW6A 3NGRA 3IG1A 3WC2A 1OY8A 2DEIA 4USTA 4A4JA 4ZN3A 1KN6A 3BBCA 3I5AA 2GS8A 1FRJA 2BQRA 1FO1A 3LGHA 2NXNA 1RU1A 3OUYA 2X1AA 3O1LA 4K50A 1KR4A 4QIVA 3ZZTA 4XO0A 4C2MA 3CIZA 3OXFA 4U9RA 3HFKA 2VKRA 2YKMA 3CCUS 2BR0A 3JSMB 3JSRA 1S6QB 4HH0A 3M8SA 4LF5J 2XLKA 1NSAA 1TL4A 2FY1A 2UZAA 2OH2A 4A8FA 1JLAA 1HARA 1X4DA 1NB2A 1RAAB 2FGCA 3D28A 4ID5B 2GFFA 2DNPA 3MEGA 4N56A 2G2YA 2FJWA 1VGYA 5KFAA 4F04B 2HBYB 3T1HF 1FKOB 1UJ6A 4DPTA 2QC3A 4FS2A 3Q2TC 5ETLA 5F9NA 5E41A 9ATCB 2FZCB 1JXEA 1P27B 3HD1A 4AL6A 3QGIA 3T9ZA 1U4BA 1HHTP 2FVSA 4M5DA 5DLFA 4LF6J 3CD0A 1LXNA 1OY9A 2V68A 3BYRA 1RT6A 4LBIA 4MKYA 5EUHA 2CPHA 2GMHA 4DG1B 3M8YA 4X62J 4DS5A 2XY6A 3PX4A 1SKWA 4NI2A 3SQOP 3M8PA 3THPA 3LANA 3GJQB 3ZZ0A 4X66F 1NH7A 4HI2A 2HKEA 4ZLPA 2E1CA 1GMUA 1V3ZA 2HBQB 1NHVA 2HFZA 5IWAF 4P7TA 2QZ8A 3KLIA 5HAOA 3ZZUA 3IRWP 2VIHA 1AUDA 3RBEA 1N4LA 1UZHA 4IFYB 3UNYA 2RRNA 1KRPA 1FWLA 1VISA 2VB6A 8RUCA 1YJNS 4O3RA 1NBEB 4OZ0A 3OL6A 4O44B 1F6TA 4A8YA 4K4UA 2OEMA 2CNLB 4L75A 2QV6A 4ANCA 3HSJA 3WIUA 3GV5B 3BR9A 1C1BB 3ZZRA 4NL5A 3I0RA 2MKHA 2HHHJ 5JJBA 1CQNA 1FRMA 1LOUA 1URRA 1VBKA 4ES3A 1T7PA 3QSIA 3L4BC 2R7RA 1Y5LB 2KVIA 1M5HA 4AUKA 3PRVA 4DR4F 1NK8A 1PBUA 4RW4A 4Y2CA 4CLKA 1REGX 1T3NA 2RAQA 5J1NA 3P96A 1KLMA 1R7IA 2UXBJ 3BGLA 4BCAA 3HK2A 3C16A 2BXJA 1BQMA 2H51B 5FD1A 4OHXA 4I6WA 2C3MA 2XYGB 1CJKB 4CTAA 5F8IA 4ED2A 2M7SA 2WB4A 4O3PA 2HMIB 1I3OB 4N5SA 2QA2A 4NXMF 3M6WA 4DUZJ 1A9NB 2YX7A 1ZM9A 1DBDA 2MJUA 1KLNA 4ECVA 2ZH9A 4WIIA 1RT1B 4TYBA 4UOHA 3J80Y 4YMEA 5J1EA 2FC8A 3H2UB 1NHKL 3QAEA 3TA1A 2DHHA 4LF8J 2C2OB 1LWCA 4RX6A 1EP4A 2OSQA 4H4KA 3BO3A 5L1IA 2HVHA 1HMVA 2I1RA 1CBKA 3KG0A 2ZWPA 3LALA 1QDUB 1PJ5A 1VR6A 3BYPA 2G0JA 3PYDA 3Q0AA 1Q8KA 2GVZA 3G4SS 3VALA 4IG0B 1S1UA 1FRLA 1T9VA 3Q86A 4DPOA 5B08A 2POKA 3TA2A 3CC7S 1LWFB 3DDKA 2EKNA 2QA4S 3R97A 5A8KA 4ELUA 2ZOFA 3RG6A 3LO3A 3HPOA 2YKOA 2DISA 3DRPB 4B9TA 2KZZA 2BE7D 3BM7A 3HLUA 3IG1B 4TU7A 4U8YA 1IKYA 4OV1A 2M5YA 2YNGB 3SCLE 1TL5A 1U0HA 2PFFB 2Y1RI 1LK7A 8ATCB 1IQTA 2W2NP 4HACA 3A3NB 1FNMA 1FF2A 3U1MA 3PY8A 2HIQA 2XZTB 2YWEA 3CJ5A 2GQ2A 3UE2A 1SC1B 2E1MC 5F41A 2BQUA 2F9JA 1LV5A 1CULA 5HP1B 5T7LA 3HULA 1BQXA 3CIMA 3DLGB 1Q8IA 5KFIA 2DY9A 4RR5A 4Y2MA 5CZVA 2A6MA 1UAWA 3I4PA 4USHA 1U1OA 3W5ZA 2R2SA 4TYAA 1IBCB 3KLGA 2AEFA 2XYHB 4RBVA 1RQ0A 2OPSA 1AROP 4MFBB 4HKQA 2YKNB 1CSJA 3PFOA 5DDQC 3RW7A 3DLBA 2QFIA 2YPYA 3MFHA 1KD1T 2JWNA 3V4IB 2VICA 2OGUA 4F3QA 5GAEU 1N36F 4DG1A 2CPYA 2BE9B 4NI2B 1RDRA 4P7VA 5B0CA 4X4OA 2KI2A 3FEXB 3J7ZT 2R42A 1R6VA 5D8HB 5FDLB 3FDSA 2GV1A 4L3NA 5F8HA 2DNHA 5CYQA 2DGVA 3RR7A 2B4VA 2E7VA 3MMCB 4I2QA 4PPZA 2BA9A 2YWHA 3PXGa 4CLPA 4Q0BB 5KT4A 3KWMA 3LP1A 3POTB 4O23A 3MM7B 2MZJA 2UXDF 5A8WA 2R8HA 2CQCA 2CKWA 1VI7A 2JDJA 2KRBA 3OFFA 1GNKA 3M32A 4URQU 1OYEA 4PWDA 4HL9A 3C6UA 1TELA 2P9EA 3MMAB 4A48A 4DV6J 2RRAA 3J7YI 1EIYB 2DEJA 2NREA 4WZQA 4NXNF 3GV7B 4Z2XA 1RAEB 4AXJA 4CO3A 4DFKA 1GT8A 2N3LA 1U26A 4P74A 1RKIA 5FLXY 1UP1A 1Y4ZB 1FVSA 2W2MP 3H5YA 2VKZG 3VGSA 4ECWA 4ILRA 4MK7A 3B4DA 2BKNA 2MTLA 4QOTA 4CT8A 4FF2A 3T5JA 3D6HB 1Q4RA 4Y34A 2LP4A 4OZ3A 2Y9HA 3PW4A 4HEA9 4OI1A 1UVMA 3C15A 3ELHA 4WKYA 2NXJA 3KLFA 2M3DA 4EZ6A 1HQEB 3CCSS 1WEZA 4K5SA 1JJ4A 2R7WA 2HQGA 4NZ7A 1LKZA 1VCTA 2W24A 3NRBA 2DJWA 3UD5A 2B9EA 2AP6A 1RBLA 1ZZFA 3W66A 1L3VA 2XO6A 3C19A 2VA2A 1WG4A 1Y3JA 1F3FA 3AD9C 3B54A 3LA0A 3M8QA 2R7XA 3GFXA 4ICLA 3BDEA 2NLWA 1WACA 5BR8F 3PEJA 1QE1B 5B0BA 3MR5A 1ACMB 2G1HA 2R7QA 4DEZA 1M1HA 2CADA 4F4AA 4DV5F 3J7A1 3NAIA 3UNGC 2LFVA 1SXLA 3WBZA 2F65A 3GCXP 4IKAA 2PMWA 3CJ0A 4TNOA 1EHWA 5L38A 1QM9A 1H98A 4MH8A 2MKYA 3LP0A 2GJFA 1RT6B 1TFWA 1RBOB 1NPRA 3V5RA 5A8KB 2VG7A 2A0FB 1GMWA 4I56A 4KO0B 1JLGB 1VC6A 3M05A 1S1VA 2YNFB 2H4YB 5E0OA 1QAYA 2DGWA 1SUQA 2UUAJ 5KFJA 3LTOA 1WDDA 2HVDA 4E98A 4CM2A 1RHUB 2X51A 5F8GA 3R7BB 4EBCA 3QRPA 3AJ1A 2GW8A 4YR0A 4DUYJ 1IKWA 3KOAA 1X4EA 4J9OA 2J76E 4DR2F 2BE2B 4ZPCA 2CQBA 4LRDA 5H9EJ 4DR4J 3EMTA 1GMVA 1HLWA 1KFDA 1UJ4A 5E3QA 5GADI 3D2WA 2UUAF 4F2RA 3I96A 2XS7A 4EBDA 5M2PA 4QYZJ 1T0TV 2H5JB 1PC4A 3BSCA 4ZS6A 2IBKA 2C2KB 2W4CA 1QVFR 4ED8A 1GK8A 1H74A 1PBAA 2JL9A 3IAM9 3IFEA 4O0IA 3CJ4A 4M95A 4C0OC 3IR6B 1AFIA 4OHWA 5KFGA 2ZUGA 4RW4B 2XMMA 3C3LA 5GAGU 2KXHA 2HZCA 2O1PA 4DV3J 1FX2A 1FTCA 2W1BA 4DF4A 3CJKA 4YB6A 1RABB 4J37A 4LVNP 2D69A 3CPWR 1JNRB 2HAIA 5THWA 2WVBA 5F8JA 1F2GA 3FSXA 1YX2A 3EVWA 3G2XA 2AJ4A 2HFVA 3MMBB 4OZ1A 4R0JA 2B43A 4RWXA 3RBXA 3RGIA 2K7KA 2ASJA 1NKCA 2D41A 3U27A 1NCLA 3M6UA 4OFZA 2BJEA 2C1EB 5B0GA 4KGVB 5LJ5Y 2WVCA 1XR5A 5HQLA 1UVIA 2UVRA 4JI6F 2MLYA 2X1GA 2H54B 5IQ6A 3JSYA 3BGFA 5LMNF 1R8HA 3KK3A 3T5KA 5IT9U 1U0SA 1OYDA 3D6TB 4YR3A 5CZXA 1L3KA 2KTQA 3NGSA 2VUGA 1D3WA 5H9FK 1HMVB 3UN2A 1T05A 4DV3F 1TAUA 4Q43A 1RAFB 2FVRA 3V81A 2YH0A 4YB7A 3TA0A 2RIJA 4RW6B 1ZS6A 2ZJPQ 4GVLA 2B0GA 3EM1A 4NCAA 2YNHA 3CEDA 1VS3A 2FYXA 1FJCA 2VQEF 3FQKA 5HROA 1TQLA 2IVMA 4C3LA 1VBZA 4I7FA 3T1YJ 1VOMA 2IRXA 3C15B 1T9UA 4UUWA 4C8ZA 3KLFB 3I56S 2RQKA 2XLJA 3V6HA 1NJIT 5HBMB 1I1GA 5LMUF 3K0JA 1IKYB 3GSIA 4F3MA 3EICA 2HHSA 4K0KF 2HHWA 1U2FA 3TUIC 3DRXA 4TQSA 4ECZA 5AXNA 5GAHI 2DR9A 1XWLA 2DXFA 2LYVA 2OPQB 3I87A 1M5SA 3I55S 2J7UA 3SCJE 1X5OA 3BGRB 2L41A 3G6XA 4J9SA 1PIEA 5F8NA 3FUYA 4P10A 4FYXB 1NK7A 4ICLB 5E3CA 5D4NA 4DQSA 2VBXA 4FPRA 3I0SA 5L9XA 4ZHRA 2MMYA 4EFAC 2V2QA 4TY8A 3OVAA 1A0OB 4IO9Q 4FBTA 1UVJA 1CS4A 4NPOA 1MG7A 1NPKA 1U25A 2D3OR 1S6UA 1FD2A 4QZVB 3D9BA 2BZ2A 1XIQA 3HJFA 1O8BA 1DLOA 2Y0BB 3ZXWA 4QCLA 1RTIA 4DXLA 4F4KA 3P45B 2VZ9A 4TU8A 2VG7B 1BC6A 3TO8A 1K44A 4WFAQ 1DJ0A 4G1IA 1RZMA 2B6AA 1IBLJ 1YGYA 3DC2A 1VC5A 1GEHA 1TK8A 2KXFA 4CO4A 1N0UA 1JLBB 1DY3A 3FQLA 4C11A 2HLTA 5KFNA 4DV1J 4BBYA 1WF2A 4QU7A 1S12A 3TRGA 1R31A 2HAFA 1HWKA 2RRBA 2XG8A 2ZBPA 5LM7E 2CNOB 2L9NA 1VQ5S 4C9DA 2DCLA 1HR0J 1B0TA 3HVWA 3VWSA 4ZVRB 1KQKA 3ZZOA 3GIJA 3EX7B 1AA1B 3FBBA 4ZP9A 2XBPA 3DM2A 4OZ2A 3S8SA 1L3TA 1GTHA 1N54B 2Z4PA 3I6PA 3CJ2A 2Q43A 2QJ3A 1MMLA 3G86A 1NH8A 3N5BA 2LA6A 3CT9A 1RTHB 2LCWA 3A8KA 4O0NA 3FZBA 4Y3CA 2HPUA 2XGQA 4B3SF 1WWHA 2LU2A 3I9ZA 3TUJC 1XNRF 2NYHA 1X5SA 4X65F 1R8CA 2DGUA 4WXOA 5DS7A 5B7WA 1SKSA 3CULA 4OZLA 1EARA 3AXMA 2QLJB 4HT7A 3PNIA 3SQGB 3OD2A 2MQNA 4DV6F 1Z4UA 2MQOA 1NJYA 3W9HA 4I6YA 4P2XA 2D9PA 4ZOSA 4ZCMA 4K4TA 2CJBA 5ETOA 2B7CB 5KFTA 3GFYA 3FFIA 3JQMA 1HWLA 2YBVA 5CCLA 2IRUA 4IYQA 2J7KA 4AD6A 5BYSA 3OL7A 2K8GA 3CJQA 5DETA 2MKKA 4ZP7A 3OLAA 3QT8A 3BB5A 4TKTA 1PGZA 1NUEA 2CZVC 1Q0NA 5LSRA 1RT2A 4EWTA 2DVIA 3IGNA 2GAHC 1T9YA 2R4FA 1Q81T
chains in the Genus database with same CATH topology
2BEFA 1WKKA 3FCWA 4S0MA 1JXVA 3Q83A 3NGSA 1UCNA 1BUXA 1LEOA 1MN7A 3ZTSA 1F6TA 1ZS6A 4ANCA 4ANDA 3EM1A 3Q89A 3EJMA 2B8PA 5IOLA 3VGTA 3VVTA 3VGSA 2DYAA 3NGTA 4WBFA 4DUTA 3PRVA 3ETMA 4CP5A 1WKLA 4KPCA 3ZTOA 2VU5A 3EICA 3ELHA 4F36A 3Q8UA 2DXEA 1HIYA 2DXFA 1BHNA 1S59A 4ANEA 4EK2A 4ENOA 1WKJA 2BX6A 1NSQA 3FBEA 3B54A 1F3FA 2HURA 1PKUA 3BH7B 1KDNA 4FKYA 3WX8A 3GP9A 1XQIA 3ZTQA 4UOHA 1PAEX 3GPAA 1B4SA 1NHKL 3EVOA 3VGUA 1NPKA 4F4AA 3VGVA 3ZTRA 1XIQA 1B99A 4DI6A 1EHWA 1NDLA 2DXDA 3Q86A 1K44A 2NCKL 1U8WA 1NDKA 3FC9A 1NDCA 3PJ9A 3FBCA 3NGUA 2AZ1A 1NLKL 2HVDA 3JS9A 4UOGA 2CWKA 3BBFA 3NGRA 3DKDA 3Q8VA 4C6AA 3BBCA 3FBBA 1LWXA 5CABA 3EE3A 1W7WA 3MPDA 3FBFA 5C7PA 3ENAA 3EMTA 1HLWA 1S57A 4O0NA 5BXIA 3VVUA 3DDIA 4DZ6A 1HHQA 2HVEA 1MN9A 2DY9A 1NSKL 1NSPA 1S5ZA 1NB2A 3BH6B 3R9LA 3B6BA 3Q8YA 1VYAA 5CAAA 4FKXA 3BBBA 4UOFA 4W98A 4HR2A 1BE4A 3EVWA 1NDPA 3G2XA 3L7UA 3FCVA 3FKBA 1NUEA 2ZUAA 3EVMA 2B8QA 1NCLA 3ZTPA 2AZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEF A;  1WKK A;  3FCW A;  4S0M A;  1JXV A;  3Q83 A;  3NGS A;  1UCN A;  1BUX A;  1LEO A;  1MN7 A;  3ZTS A;  1F6T A;  1ZS6 A;  4ANC A;  4AND A;  3EM1 A;  3Q89 A;  3EJM A;  2B8P A;  5IOL A;  3VGT A;  3VVT A;  3VGS A;  2DYA A;  3NGT A;  4WBF A;  4DUT A;  3PRV A;  3ETM A;  4CP5 A;  1WKL A;  4KPC A;  3ZTO A;  2VU5 A;  3EIC A;  3ELH A;  4F36 A;  3Q8U A;  2DXE A;  1HIY A;  2DXF A;  1BHN A;  1S59 A;  4ANE A;  4EK2 A;  4ENO A;  1WKJ A;  2BX6 A;  1NSQ A;  3FBE A;  3B54 A;  1F3F A;  2HUR A;  1PKU A;  3BH7 B;  1KDN A;  4FKY A;  3WX8 A;  3GP9 A;  1XQI A;  3ZTQ A;  4UOH A;  1PAE X;  3GPA A;  1B4S A;  1NHK L;  3EVO A;  3VGU A;  1NPK A;  4F4A A;  3VGV A;  3ZTR A;  1XIQ A;  1B99 A;  4DI6 A;  1EHW A;  1NDL A;  2DXD A;  3Q86 A;  1K44 A;  2NCK L;  1U8W A;  1NDK A;  3FC9 A;  1NDC A;  3PJ9 A;  3FBC A;  3NGU A;  2AZ1 A;  1NLK L;  2HVD A;  3JS9 A;  4UOG A;  2CWK A;  3BBF A;  3NGR A;  3DKD A;  3Q8V A;  4C6A A;  3BBC A;  3FBB A;  1LWX A;  5CAB A;  3EE3 A;  1W7W A;  3MPD A;  3FBF A;  5C7P A;  3ENA A;  3EMT A;  1HLW A;  1S57 A;  4O0N A;  5BXI A;  3VVU A;  3DDI A;  4DZ6 A;  1HHQ A;  2HVE A;  1MN9 A;  2DY9 A;  1NSK L;  1NSP A;  1S5Z A;  1NB2 A;  3BH6 B;  3R9L A;  3B6B A;  3Q8Y A;  1VYA A;  5CAA A;  4FKX A;  3BBB A;  4UOF A;  4W98 A;  4HR2 A;  1BE4 A;  3EVW A;  1NDP A;  3G2X A;  3L7U A;  3FCV A;  3FKB A;  1NUE A;  2ZUA A;  3EVM A;  2B8Q A;  1NCL A;  3ZTP A;  2AZ3 A; 
#chains in the Genus database with same CATH topology
 4DDF A;  1H6K X;  2BEF A;  3R6L B;  5AE2 A;  4DFJ A;  4ETZ A;  2J7W A;  3FK4 A;  3MMJ A;  1S97 A;  3N0V A;  3KLH B;  2YY3 A;  5FII A;  2XEX A;  3W64 A;  2BW7 A;  2QLF B;  2ROP A;  3HXM A;  1HI8 A;  2MZQ A;  4X4V A;  4URS A;  3BRE A;  3H20 A;  3LWM A;  1X9W A;  1HNW F;  2YH1 A;  4ZJQ A;  3MM6 A;  1TVR A;  4IDK A;  1Q8B A;  1SQF A;  2XNQ A;  3FEY B;  4YN3 B;  3W2W B;  1C0U A;  3B4M A;  3DLH A;  4L74 A;  2VG5 B;  4I2P B;  3MMA A;  3DGV A;  5KFO A;  1Y7P A;  2R7T A;  2MGZ B;  3IAS 9;  2GGP B;  2AGO A;  4ER8 A;  1IBK J;  3GWC A;  1S1T B;  1TKT B;  2OPR B;  4CO5 A;  5CD4 A;  3UVJ A;  3IC1 A;  3HSZ A;  3DMJ A;  3FJ2 A;  3U1N A;  4F8R A;  2G0I A;  3A4T A;  2XUL A;  5KG2 A;  2DTJ A;  4DR6 F;  5IS2 A;  1MLA A;  3PAC A;  3MTJ A;  2AU0 A;  2KYX A;  3MZI A;  2NXC A;  4DX6 A;  2LXI A;  3LP2 A;  1Q78 A;  4QR2 A;  4CLF A;  2IMO A;  4H4O A;  3NS7 B;  3JYT A;  1G4C A;  3QNW B;  3MEE B;  2VJV A;  2IA0 A;  2A1B A;  4P6Q A;  2BE2 A;  2XS5 A;  1MMN A;  1WF1 A;  3I9V 9;  4F0M A;  4YOE A;  3M2V A;  3BJY A;  1BGX T;  1OSC A;  3LPE A;  3T9N A;  4ENO A;  2HHX A;  4K7Q A;  2E1R A;  2HQD A;  3SSS A;  1VQK S;  1BQN A;  3IBC B;  4QQB A;  3UCZ P;  1SH3 A;  1OJ4 A;  3WZ0 A;  4YHH J;  4M5L A;  1RWK B;  1GX5 A;  3OXL A;  2DNZ A;  1FRK A;  3ZZY A;  3N6M A;  5K5M A;  4FKY A;  1KDN A;  4MIA A;  3SCK E;  4ZHR B;  5IV3 A;  4LQ3 A;  3HM9 A;  3GPA A;  1UZD A;  4HLB A;  1B4S A;  4LF6 F;  3KK2 B;  3G6E S;  3TWZ A;  7FD1 A;  3CMQ A;  4ECR A;  2E9T A;  4I6A A;  2E9Z A;  2E1A A;  4QW8 A;  2IVF B;  1KQF B;  4CLU A;  2HWH A;  3PW5 A;  1N6Q A;  1S0V A;  4RWW A;  1SC6 A;  4XDC A;  4DZD A;  1NDL A;  2VG6 A;  1RT4 A;  3NMR A;  4PAA A;  1M5V C;  2VV5 A;  1KVI A;  2HGM A;  4NRU A;  1BMQ B;  2QG9 B;  4MJK A;  1HFE L;  1YJ9 S;  3G9C A;  2DHG A;  2KL8 A;  1H7W A;  1F5C A;  4L3K A;  1IM6 A;  5A2Q Y;  4DUZ F;  2IDL A;  4ZVG A;  3NL0 A;  4BHQ A;  3G82 A;  5EDW A;  3Q22 A;  1JLE A;  2XWX A;  3TZY A;  4FF4 A;  2ZBC A;  1N5T A;  2CWK A;  1TMJ A;  2ZE2 A;  3QZ8 A;  1WUU A;  4N8O A;  4IO1 A;  4QIW D;  1WG1 A;  3BBF A;  4AL7 A;  1TK5 A;  2UXB F;  1X5T A;  4DPU A;  4RPF A;  5BYQ A;  3DNC A;  2DGQ A;  1LW0 A;  5KFR A;  3BQ0 A;  4I4B A;  3MCS A;  1I94 J;  1F5A A;  1J5E F;  1HBO B;  1R8A A;  4UUX A;  4R8U A;  3C8Y A;  3SFU A;  2FLN A;  1NJW A;  4FNH A;  3M2R A;  4XPC A;  1CJV B;  3H4D A;  3JAM Y;  1SV5 A;  1LW2 B;  3F73 A;  2CPX A;  1X4B A;  2BKP A;  2V2K A;  4PG5 A;  3EGZ A;  2IBO A;  2CPI A;  1EKR A;  5MAO A;  2CA9 A;  3L3C A;  2GA7 A;  4H4M A;  3E2E A;  4IR1 A;  4F02 A;  2CQP A;  2HWT A;  4HDH A;  2MYF A;  3HHD A;  2EFO A;  2XMK A;  1VRT A;  3FCV A;  3MR3 A;  1S1X B;  3SEO A;  1VBX A;  3P49 B;  4J5O A;  4OI6 A;  5HO4 A;  4DF8 A;  4R5P B;  1T9X A;  3R5A A;  3T6B A;  2KJW A;  1S10 A;  5J2N B;  3QGH A;  4Q7A A;  3KHG A;  1T9T A;  1RTZ A;  2CQG A;  3KLH A;  1CC7 A;  2HLU A;  2LXF A;  2DGX A;  1DAR A;  2M70 A;  2RS8 A;  4UOC A;  2VBY A;  3SCI E;  7AT1 B;  1JXV A;  3RRK A;  3W5Y A;  5DG7 A;  1N34 J;  3V6J A;  1FRX A;  3DOK B;  3CCR S;  2QTW A;  1S76 D;  2AT1 B;  3HX9 A;  3BQ1 A;  1BWE A;  1WC6 A;  2BJ8 A;  1Y9O A;  2VOO A;  2UXC F;  3CW2 C;  4ZPV R;  1SL2 A;  4K2X A;  5AJ3 J;  2MQ8 A;  2V8P A;  3WX4 A;  1S9E B;  4ECQ A;  2VOP A;  4Q8F A;  2B6A B;  2CPD A;  1C4C A;  3F44 A;  4KQZ A;  5E2Q A;  2AYB A;  2DIU A;  3D1Q A;  4WP9 A;  1FFG B;  2IHR 1;  2OFG X;  3TVZ A;  3H2L A;  3PEH A;  3VGT A;  1S72 S;  2ZZM A;  3ZZP A;  4I0W A;  2HFN A;  3KLI B;  3NKY A;  1WTB A;  4KYZ A;  3ULH A;  4O4G B;  1IR1 A;  4NWB A;  3LP2 B;  3JYT B;  5B09 A;  4L72 B;  4Q2M A;  4RW7 A;  1H2T Z;  2ZOG A;  4CP5 A;  4AE5 A;  4ZK7 M;  3KHL A;  2VU5 A;  3NP5 A;  4CYU B;  1RWP B;  1S7H A;  1X4G A;  2DNY A;  3CJS A;  1WC0 A;  3IRX B;  2GHP A;  5G0R A;  2V67 A;  1S1W A;  4KE5 A;  2VFV A;  3NEK A;  3VHQ A;  4OIX A;  2RH3 A;  3DM2 B;  5CCM A;  4DSE A;  4FBU A;  5RUB A;  4OHZ A;  3HVA A;  4ID8 A;  1EJ7 L;  3M30 A;  4I69 A;  4A8Q A;  3L09 A;  2MPU A;  1FK9 A;  1Q7L B;  2UUC F;  2E7W A;  2RSQ A;  1G3O A;  2FHJ D;  2IY5 B;  1T02 A;  3MD3 A;  5D0G A;  3DRY A;  3W7B A;  4TY9 A;  1FDB A;  2MY7 A;  1HPZ A;  2I9S A;  3ENV A;  3R5J B;  3ZTQ A;  4CLZ A;  4ED7 A;  3PO5 A;  1AZS B;  2WW8 A;  2XI2 A;  4FDF A;  2IC3 A;  3UWT A;  1J27 A;  3K17 A;  3MI7 X;  4WWS A;  4WFZ A;  2CJX B;  5D0E A;  3EGN A;  4CWB A;  4CZC A;  4LF7 J;  4OV6 A;  4ZP8 A;  4OZJ A;  1L3U A;  3I4H X;  4JYA J;  1PC5 A;  2YX1 A;  1KQS R;  2JOQ A;  1FXD A;  2RIL A;  3FGV A;  5EX0 A;  1MSW D;  1RHM B;  1RT5 A;  3SIP B;  2E5L J;  4JI0 F;  8AT1 B;  2VPY B;  4USI A;  2FHK A;  2DNN A;  4P9S A;  2APO A;  2RUG A;  4PG4 A;  3CUN A;  1R6Y A;  1RYS A;  2ATL A;  1UW9 A;  4OYO A;  5M2U A;  2B3T B;  5HI7 A;  3ZZZ A;  4WE1 B;  4I1T A;  4BWJ A;  1P9Y A;  1R0B G;  1X7V A;  2J8S A;  2XC9 A;  4CDI A;  2U2F A;  3FMB A;  3TP2 A;  2LQ8 A;  1JLB A;  4B3M J;  2VAS A;  1DZ5 A;  2DHS A;  4PAB A;  3DOM B;  1CJU A;  1HWI A;  4OHV A;  1DAX A;  4DS4 A;  1S0O A;  2F8M A;  3HCX A;  1Q7Y T;  1HYS A;  1U1N A;  3TJ8 A;  3BKT A;  4EGL A;  2C3O A;  1LWX A;  1TVR B;  4WJB A;  1HBO A;  3MPD A;  4WYL A;  4PG8 A;  1HBU A;  1PYO B;  1TKX A;  5CAB A;  4LR9 A;  3MUM P;  2FLP A;  4PQU A;  1VJQ A;  2CQ2 A;  1ZM2 A;  1F0X A;  1XER A;  2QIF A;  3EDR B;  3KKF A;  3OFH A;  4ZVT B;  3M2R B;  5GAH U;  2ZIT A;  5J2P B;  3P6Y C;  1HHQ A;  1EX8 A;  4ECY A;  4DHV A;  5DQI A;  2HZV A;  2BM0 A;  3JTP A;  4LF9 F;  1NSP A;  4GMK A;  4WZM A;  3ENW A;  4ED6 A;  1M5O C;  4A8M P;  2E5L F;  2V4J A;  1VYA A;  3R1L A;  5DGB A;  5KG6 A;  3FCH A;  3AY0 A;  1KLM B;  4NLP A;  3D7S B;  3W61 A;  4L73 A;  3W65 A;  1NPP A;  4D3G A;  4DR5 F;  2AGQ A;  2UVV A;  4LF7 F;  1S77 D;  4PQA A;  4QPT A;  3M1V B;  4DQP A;  2X1B A;  1YZ7 A;  3NY0 A;  3L7U A;  4P72 A;  2OPP B;  3M2U B;  3T6J A;  4QWD A;  2QMU B;  6FDR A;  4KRW A;  4LMZ A;  1VQP S;  3TJA A;  2AZ3 A;  3TUZ C;  5ETP A;  3RB3 A;  5ETV A;  5L1J A;  1IN0 A;  1JIH A;  4USK A;  3FCW A;  2GVD B;  1FFW B;  1YSJ A;  4DU7 A;  1SI9 A;  4WU2 A;  4J9K A;  3CDE A;  1FJG J;  2E9R X;  2BRK A;  1JLA B;  2V63 A;  3BQ2 A;  1DQ8 A;  3Q24 A;  2V94 A;  2UVU A;  3HHK A;  3MEG B;  3V4I A;  3PRB A;  4ZVP B;  3FNN A;  2WON B;  1MN7 A;  4MK9 A;  1WEY A;  1NEE A;  3N4W A;  4BLG A;  3C2P A;  3L7P A;  4ZPW R;  2OUG A;  4Y0F A;  1P1T A;  4ZP6 A;  1WEL A;  3BZQ A;  1I6J A;  3OFG A;  2B9Y A;  1C0U B;  3LW5 C;  4X4P A;  2Y8Y A;  3QRQ A;  2EFP A;  4DX7 A;  2W8L A;  1FVQ A;  2LEB A;  5IOL A;  1TZ0 A;  5GMK a;  5KG5 A;  2ASD A;  3CO9 A;  3HFV A;  2VON A;  4QBU A;  3IS9 B;  1VFJ A;  1F9F A;  1YJW S;  3NGT A;  5EX3 A;  4DUT A;  3KK1 B;  5A8W B;  2ADC A;  1RAI B;  2ZE2 B;  3HHL C;  2HS4 A;  2K7J A;  3DCA A;  3IMQ J;  4DR1 J;  2LLZ A;  1T94 A;  2YNG A;  3AB2 B;  3MED A;  3G8T A;  4DCJ B;  2AKW B;  2IIH A;  2VFR A;  2F3J A;  4HTJ A;  1HR0 F;  2JLG A;  4AYB D;  2J8A A;  2V4R A;  2F9D A;  5GME A;  2EVZ A;  2PD1 A;  2ZHB A;  1QTM A;  4IH6 A;  2AIR B;  4TLQ A;  2XS2 A;  1O6X A;  1X4F A;  1XNQ F;  3EXC X;  1T11 A;  5CYM B;  1SH2 A;  1UW4 A;  5HP1 A;  2JVR A;  5A2Q U;  2B4O A;  3GP9 A;  4B9U A;  3H5X A;  2ZH3 A;  1GTE A;  1ZAW A;  3AQO A;  2EK1 A;  1HNX F;  3BN7 A;  1QVG R;  4GKK J;  2YKQ A;  1YLX A;  2A6O A;  2RU9 A;  4QWA A;  2R8K A;  5HQ8 A;  2OAU A;  2BAN B;  4OYZ A;  2UP1 A;  1WEX A;  4B9M A;  2KDO A;  2CJK A;  2COL A;  2QMX A;  1B99 A;  2C3U A;  3DOL B;  4KHP F;  2ERR A;  1UVL A;  3CMA S;  3BS9 A;  3UCU P;  5LXR A;  4I68 A;  2W25 A;  3GSD A;  4Y65 A;  4M5N A;  5I3P A;  4KHM A;  2DNG A;  3K5N A;  2Z57 B;  4FS1 A;  2QRR A;  2HW3 A;  2YPZ A;  2FJE B;  4DN0 A;  5DM6 Q;  3GYX B;  1U8W A;  2ILZ A;  2XYP B;  2SXL A;  1XJW B;  5CYQ B;  4KV8 B;  2EPI A;  4GKJ F;  2MHN A;  2KG0 A;  1DUR A;  4NEZ A;  5IV4 A;  3VAJ A;  1HYS B;  4W90 B;  2ADB A;  4ALZ A;  3LP1 B;  3POT A;  5KFF A;  3IBF B;  2HRY A;  1TL1 B;  3KNG A;  2YKA A;  1HBU B;  1TKX B;  4LF2 A;  1BY9 A;  4MT1 A;  5DG9 A;  3CJR A;  2AGP A;  1OPI A;  4C8M A;  3LF0 A;  4FZV A;  5K8P A;  2M8D B;  2J6T A;  3J7A N;  3IN5 A;  2BVZ A;  2JEG A;  3N9U C;  3CWJ A;  4IG0 A;  4JV2 A;  4GO7 X;  1R27 B;  1K1Q A;  4UF4 A;  5KT3 A;  3BSO A;  1VLY A;  2R3V A;  3PYE A;  1B0V A;  4X84 A;  4B3O A;  4USW A;  3TAQ A;  3A8I A;  1NO8 A;  3TI0 A;  1L5U A;  2AYE A;  2W01 A;  4YS2 A;  3TZX A;  1A7G E;  5KT6 A;  3D4J A;  4AFF A;  3K59 A;  1X31 C;  1YTY A;  2J9C A;  4F0H A;  3MGJ A;  5D3G B;  4KTQ A;  2VDI A;  3R2C J;  1JJC B;  4QIG A;  2J0X A;  3M8W A;  3TQE A;  2VH7 A;  1K9M T;  7FDR A;  4CM0 A;  2RT3 A;  1C2P A;  2AJQ A;  2BQ3 A;  3ILI A;  2Q66 A;  2DK2 A;  3DDN A;  2ZM6 J;  2JSX A;  3G87 A;  2IAJ A;  3KJF B;  1U2R A;  4C8O A;  3JQK A;  2YWW A;  4JI8 J;  1TL3 A;  2XSJ A;  3TEG A;  1JK9 B;  5FLX U;  3SV3 A;  1Q79 A;  1UL3 A;  1RJJ A;  3M8Q B;  1CUL B;  4YHH F;  2ZFH A;  1HD0 A;  1WF0 A;  3TUP A;  5KG0 A;  1HWU A;  4DR3 F;  4LRE A;  4E2F B;  1IWG A;  3OR2 A;  3TAM B;  2QT7 A;  3K8V A;  3MM5 B;  3BGU A;  2QL7 B;  3CNQ P;  4ZPT R;  4KPY A;  2ABY A;  1HNW J;  1QJH A;  2YQ3 A;  2ZZT A;  4QIF A;  5A0Y A;  2B4U A;  1AW0 A;  3QIP B;  1UCN A;  2VHG A;  4DV2 J;  2PC6 A;  1RI7 A;  2V0N A;  3W2V B;  3PO4 A;  1WHW A;  3A3O B;  3KHR A;  2HQI A;  4QWE A;  2GNK A;  2PMZ D;  2R7U A;  3WIV A;  1K1S A;  2QSF A;  2R2R A;  2VPW B;  2CFX A;  5HMZ A;  1T9W A;  4QWB A;  4UQT A;  1GX6 A;  1IUJ A;  2XQC A;  2ZDO A;  1IBK F;  3GG1 A;  4LVO P;  5B0E A;  4K4X A;  1CVJ A;  2B7B B;  4ZCL A;  1D09 B;  5FDL A;  5EWE A;  1TFY A;  1FTR A;  3HZE A;  3RBZ A;  5IT4 A;  2JH3 A;  5HK4 A;  3FMW A;  1EQ0 A;  2F4V F;  3DOM A;  4IRD A;  3MED B;  2IRY A;  3RU0 A;  3AXK A;  1VQS A;  3BV8 A;  3R5C A;  4MIW A;  3ET6 B;  4RNM A;  3OV7 A;  3CCE S;  2HHV A;  4TVA B;  5HVH A;  3V81 B;  3DRS A;  4O3N A;  5FJ4 A;  3GLJ A;  1RWW B;  1HIY A;  2W7A A;  3DRR A;  3K89 A;  4EK2 A;  2XCA A;  4NLG A;  5E7O B;  2IVY A;  2WBR A;  4JI1 J;  3QQC D;  1VDH A;  1YJT A;  3HVT B;  4B9V A;  1CC8 A;  1WNE A;  1Z1Z A;  1S99 A;  5HRO B;  2ALZ A;  2EFQ A;  1E6V B;  4J9V A;  3KYL A;  1IBM J;  4I67 A;  1HD1 A;  3M30 B;  3AA8 A;  4RO0 A;  2YNI A;  3QID A;  4DCP B;  3HDS A;  3MUV P;  2NZ4 A;  3QLH A;  5ETQ A;  3W62 A;  3DLK A;  4QPX A;  1R43 A;  1UA0 A;  4DX5 A;  2H5I B;  3UI3 A;  1U6B A;  1JJ2 R;  4LFB J;  1Q1K A;  2UUW A;  3LOU A;  2HFU A;  4QYR A;  3OT9 A;  4JI5 J;  5KFU A;  3MPY A;  3JXO A;  2NPF A;  2JZ5 A;  5KG3 A;  2HQF A;  2EWH A;  2HBZ B;  4DL5 A;  5D15 A;  1QLN A;  2BYC A;  2BAB A;  2W9B B;  3VQT A;  2C2E A;  1UKU A;  1V5V A;  1S6P B;  3WQP A;  4RUA A;  1TKZ A;  3PJ9 A;  1N8R T;  3G96 A;  2GO9 A;  3AH6 A;  2O66 A;  4FXV A;  1QD1 A;  1TAQ A;  3F0N A;  2N7Y A;  4OYB A;  4B3S J;  4N41 A;  2XWY A;  4C4W A;  1WI6 A;  2K06 A;  4CQ1 A;  4DU8 A;  4IOC Q;  4NCG B;  1WC5 A;  4YY3 F;  3IR7 B;  2YWG A;  1DLO B;  1YVF A;  4YP3 A;  2NR0 A;  1K0T A;  1RT7 B;  3ILL A;  3NS5 A;  5KFM A;  1N32 F;  4B3T J;  5I3U B;  2BV3 A;  1ZAV A;  5KT5 A;  1S9G B;  3CXC R;  3SFG A;  2KVQ E;  2WSC C;  2DHA A;  3H2V E;  1R8P A;  4XPE A;  3OVS A;  4DV1 F;  1YIJ S;  2XMT A;  3OW2 R;  2J6S A;  2XNR A;  1Y11 A;  3OTB A;  2EFV A;  1IVZ A;  4NLR A;  3RAM A;  1U48 A;  2Z2L A;  3PYG A;  1F9H A;  1JLG A;  3IM8 A;  4NYP A;  1U1L A;  5K14 B;  3X1L B;  1U7L A;  5HVG A;  4CH0 S;  1KOH A;  4QJV A;  3R9L A;  2HHP A;  4RU9 A;  2ZEJ A;  4K4W A;  5F8M A;  4FKX A;  3G71 S;  4MKB A;  3GU0 A;  4C8Y A;  4K4Z A;  3THV A;  2DT9 A;  3OLB A;  2HGL A;  2I38 A;  2IM2 A;  2CXE A;  1WD6 A;  3B82 A;  2DR5 A;  2N4C A;  5A8R A;  3OXG A;  1ITP A;  1GH8 A;  1VQ7 S;  2JNJ A;  1OQ3 A;  3DHW C;  2DO0 A;  1SB6 A;  2IYG A;  3BO2 A;  1DRZ A;  5KFB A;  2VQF J;  3RJM B;  3KLE B;  2HWI A;  3MM5 A;  3MR6 A;  2O5D A;  2BJ7 A;  3P3D A;  5DGA A;  4FXW A;  1M1K T;  3FSI A;  1VHI A;  3BDP A;  4JI1 F;  4WIQ A;  1FKO A;  1SH0 A;  2OD6 A;  3CCM S;  1U47 A;  2E29 A;  2DR6 A;  1GMW D;  2G2Z A;  4F7V A;  4OL8 A;  5H9E K;  2D3O 1;  5LSO A;  1SL1 A;  4K4V A;  3W5X A;  2V6A A;  1BUX A;  3OJU A;  3TAR A;  4ZLN A;  2KG1 A;  3CJK B;  1OMS A;  1FA0 A;  3D0H E;  3MOZ A;  4LSZ B;  2W4P A;  4NLW A;  4FF1 A;  2W2Q P;  2JHE A;  1XR6 A;  3CB4 A;  4CH7 A;  4DV4 F;  4WTO B;  5C2C A;  1W2I A;  3JTN A;  2ZZN A;  1VQ4 S;  3SBM A;  3IS9 A;  2CPE A;  4ZIT A;  3EGV A;  1RAD B;  2I0X A;  1EAY C;  4GVB B;  4JI3 F;  4DV7 J;  5GAD U;  2YWK A;  3IWL A;  1DQ9 A;  4O3Q A;  3U7J A;  2D7S A;  4KGX B;  2MZT A;  2PA3 A;  3OSN A;  2W9C B;  4HHH A;  4ECX A;  2R8G A;  4ANE A;  1O51 A;  1LXJ A;  2VD3 A;  4YY3 J;  4X4R A;  2N4D A;  2J0S D;  2AWZ A;  2GQC A;  2P5V A;  1S1T A;  1TKT A;  2OPR A;  2VPZ B;  4RW6 A;  3OVB A;  5E3R A;  4B3O B;  1RTJ A;  3G8Q A;  2HUR A;  3D3B J;  3QLH B;  3WX8 A;  3MD1 A;  3DLK B;  3U02 A;  2R7O A;  5CH7 B;  3UDE A;  2FUG 9;  2V5H G;  4QR0 A;  4OI0 A;  4CT9 A;  2EK6 A;  2GJI A;  4H4O B;  1REV A;  3VGU A;  1HW8 A;  2O01 C;  2OD4 A;  4Q45 A;  4LF4 J;  2DNM A;  3AB4 B;  4TLR A;  1BQM B;  5IM0 A;  3ISN D;  4DX8 H;  1JKH B;  3FFI B;  2FD2 A;  2MDA A;  3OUY B;  2XO7 A;  5C25 B;  5EN1 A;  4LF8 F;  1EKS A;  1O0P A;  3DOL A;  1S6P A;  3VAI A;  3CCV S;  2JC0 A;  4NLY A;  2XSF A;  3MPV A;  1P8G A;  3GIR A;  3Q23 A;  4WFN Q;  5HN0 A;  1Y5N B;  1RCX B;  3M8Z A;  3P8B B;  3H0P A;  2CAJ A;  4OYA A;  4PXD A;  5B0D A;  3BSA A;  4DR2 J;  5HJY A;  2AV5 A;  1X4C A;  4RNO A;  1N6Q B;  1MU2 B;  1T03 A;  4M5I A;  4IRC A;  2P2C B;  1IXK A;  2QLB B;  1QUV A;  5I3U A;  3Q8S B;  4X64 J;  1W2B R;  1D9F A;  4GC6 A;  3TX8 A;  3QJP A;  2HS3 A;  1XMB A;  2KKH A;  2KYZ A;  2DIT A;  3R3T A;  5KFS A;  3TYT A;  1LWF A;  2JJ4 D;  4CLS A;  1EQM A;  3US5 A;  3ICL A;  3MAA B;  4ZPD A;  3T3F A;  2NPI A;  4X4Q A;  1RB0 A;  1RWX B;  3DRP A;  1WC4 A;  3H42 A;  1KTV A;  1NZ8 A;  1UEK A;  1TU0 B;  3DMJ B;  5BYR A;  3TR5 A;  5AXM A;  4E0D A;  1H2V Z;  4Z7Y A;  1LW0 B;  3QFW A;  3D0G E;  1IKV B;  2M0G B;  4AT1 B;  3MEC B;  2KM8 C;  1WC1 A;  2L9D A;  1RT3 A;  4IUF A;  3BBB A;  4W98 A;  4EO8 A;  5D4P A;  4LF4 F;  3CJ3 A;  2PEB A;  4ZKA A;  3DLL Q;  3AOA A;  3OHB A;  5A8R B;  5IWA J;  4EMD A;  2Y8W A;  3KTQ A;  2O3D A;  2QL9 B;  3PIO Q;  1JLF A;  2QYG A;  2BJ1 A;  2M4M A;  4YB5 A;  3BN4 A;  1WSV A;  5KFD A;  4J9Q A;  5J2Q A;  1LW2 A;  1XC9 A;  4M5K A;  5CXT A;  3LUY A;  2AJ0 A;  2BBE A;  4KIA A;  5D77 A;  3WHI A;  4JI8 F;  1JX4 A;  2OPS B;  1GQE A;  3ILO A;  4GC7 A;  4P73 A;  2YWF A;  3Q83 A;  4H4M B;  5SUH A;  4OJH A;  3VV2 B;  1N36 J;  3C66 A;  2OEK A;  3UCG A;  3CCT A;  1UET A;  3K7R A;  4NLV A;  5ETK A;  1KBR A;  2QA1 A;  2V4Q A;  4DL0 C;  2CQH A;  3KG4 A;  4LJM A;  4LR8 A;  2HMI A;  3J81 U;  1RT4 B;  2RJZ A;  2WRM A;  4IQM A;  4ITS A;  4KR0 B;  1FD8 A;  2ZBI A;  3PJW A;  4G1Q B;  4PEO A;  3MTK A;  4F4X A;  2LQ5 A;  2PGC A;  1PYT A;  4DV4 J;  3S1T A;  1R89 A;  3HMJ G;  3DLE A;  3UW1 A;  4MAK A;  1FDD A;  1U1M A;  4PKD B;  3OFE A;  5J1E B;  1YHQ S;  4BC7 A;  3PR4 A;  1Q5Y A;  2ZH5 A;  4NXN J;  2LDI A;  4A46 A;  5AE1 A;  4MTP A;  3R2D J;  2OHD A;  3AOC A;  2DR7 A;  4F4W A;  3E51 A;  2HGN A;  3ZTO A;  3OL9 A;  5KFY A;  3C6U B;  4B9S A;  1HI1 A;  2F1F A;  2FDN A;  3N5F A;  4B9L A;  2FZK B;  1V3R A;  3UD4 P;  2NSC A;  1I51 B;  4J9L A;  2IMW P;  1DFD A;  3PRD A;  1FJG F;  4K2J A;  1XMO F;  1OIA A;  3GG0 A;  3L7O A;  2AEJ A;  1HBM B;  2ZBR A;  3NBP A;  3NAH A;  5L9N A;  5HL7 Q;  5KFC A;  3EPI A;  4I2P A;  2DGS A;  1Z2L A;  2PEH A;  2Z8Q A;  4O4G A;  4CO2 A;  4KGZ B;  5LT5 A;  2ZBQ A;  5HLF A;  1G2E A;  3ITH B;  2P6S A;  2VBZ A;  1NM2 A;  5CQG A;  2R2T A;  1UWB B;  3TVK A;  3T19 A;  4EYH B;  5JMN A;  1N88 A;  1MNE A;  4TU9 A;  1JKH A;  4KHP J;  5DZ7 A;  1SJR A;  4A8X A;  3M6V A;  3UO0 A;  3DHX A;  4RW8 B;  2MKJ A;  2WAQ D;  3D68 A;  4PG6 A;  5L46 A;  5KFH A;  4RZR A;  3J7Y U;  2IM3 A;  4WFY A;  1U24 A;  4K59 A;  2PA8 D;  2DXD A;  4MKA A;  1D0E A;  4DV0 J;  1VHF A;  2NCK L;  1CJK A;  2Z30 B;  3KLV A;  2GML A;  1YRU A;  3LH2 S;  3SSR A;  1UMJ A;  4URG A;  2Q79 A;  3QT5 A;  2FJA B;  1NDC A;  2WVE A;  1NK0 A;  5A6P A;  2Z56 B;  2WW4 A;  1AB8 A;  4L6V 3;  4ZIW A;  1RT1 A;  2G13 A;  4OMF G;  3JSM A;  3RR8 A;  3OJS A;  5KT7 A;  1XNQ J;  1JNZ B;  2LQJ A;  3QAU A;  1DHM A;  4B3T F;  4MFB A;  1IKX A;  3TAP A;  4CI0 B;  4G6V B;  4AL5 A;  4JI2 J;  2YKN A;  5HAN A;  1LWE B;  4LFA J;  5D6G A;  4KBI A;  4JI4 F;  1R0A B;  1UJ5 A;  4EEY A;  4QR1 A;  4RBU A;  2WTF A;  3QT7 A;  2VOD A;  4FN5 A;  3EE3 A;  2OJ3 A;  2JFK A;  3OTO F;  2N7C A;  1ZOT A;  2ZKU A;  4C48 A;  4WF9 Q;  1RHR B;  5C5J A;  4Q44 A;  1S57 A;  3VCD A;  2M8H A;  1S9F A;  3QGP A;  2CIM A;  2CRL A;  4ZCI A;  1SUQ B;  2FLL A;  2JLF A;  2F8H A;  1M5P C;  2BDP A;  1PG5 B;  4ATN A;  3CGI A;  3ILJ A;  4FYW B;  2DRA A;  2QEX S;  2W7O A;  1T3O A;  2XHW A;  4MKV A;  1S5Z A;  4KHR A;  3SDE B;  3GR0 A;  3SXL A;  1HNV A;  2E5H A;  5K14 A;  5KOW A;  5HAT A;  4JI0 J;  1GXT A;  1WHX A;  3I32 A;  2Q6B A;  4Y00 A;  1S1W B;  1TTH B;  2MB0 B;  2OFH X;  3DFE A;  1S0M A;  2O67 A;  4UOF A;  5ETR A;  4JYA F;  2B5J B;  4NMX A;  3BF4 A;  3H40 A;  2RQM A;  2GIR A;  3Q8Q B;  2LXU A;  2N3O A;  3W63 A;  3PDN A;  2ZUA A;  3ZTP A;  2UU9 F;  1HPZ B;  4B17 A;  4Q2L A;  1WC3 A;  3M9M B;  2HYI B;  2PI4 A;  1N5S A;  2HZA A;  4B08 A;  1X9S A;  2OO4 A;  3DLG A;  2M52 A;  2CJY B;  1NRK A;  5KG4 A;  4BC9 A;  4OYW A;  4C3K A;  1XR7 A;  1SKR A;  3A1Y G;  3PG9 A;  1FJ7 A;  1X0P A;  2K3I A;  3KXD A;  4OX8 A;  2C42 A;  4B3R J;  3AOB A;  4FP9 A;  5C25 A;  2GCF A;  4HH1 A;  4W92 B;  3THT A;  5IT0 A;  2DD8 S;  4LRA A;  1AT1 B;  4OX9 F;  1M1G A;  3LGM A;  4LF1 A;  2GC8 A;  4DFM A;  4CTA B;  2HHH F;  3JTO A;  1XN9 A;  2B8P A;  3JQJ A;  4NML A;  2G1D A;  4USJ C;  3VVT A;  5KTQ A;  3LWL A;  1FCA A;  4KH0 B;  2BMB A;  3R27 A;  4O3S A;  3MUT P;  1HQU A;  1DQA A;  2V69 A;  5ETT A;  4TN2 A;  2PE8 A;  3OTO J;  2UXC J;  4KPC A;  1MU2 A;  3UDL A;  1T03 B;  5GAG I;  2C3P A;  3L95 X;  3MWB A;  3Q8U A;  1E6Y B;  4NE9 C;  2GZO A;  1S4F A;  2M88 A;  1YJ7 A;  1FXR A;  2J0Q D;  5AE3 A;  4JI7 F;  3R8Y A;  4O3O A;  3ZC4 A;  3GZ7 A;  4PWD B;  3D67 A;  3MAA A;  3QT6 A;  4G3I A;  3D66 A;  3O6Q A;  4X66 J;  2RDD A;  5I3Q A;  4F67 A;  1S9E A;  1H2U X;  4LBH A;  4YDX A;  4EBE A;  1F2H A;  1V9O A;  2CQI A;  2Z58 B;  3BH7 B;  4ZLJ A;  1U1K A;  1CLF A;  4K5R A;  1HNX J;  1V6H A;  3FZ2 A;  2ZM6 F;  2OIH A;  3MM9 B;  1F5B A;  2V4J B;  3FVY A;  3PX6 A;  1H38 A;  1PIL A;  2MLZ A;  4WYW A;  3HP6 A;  2HNZ A;  1BD6 A;  4ZIV A;  4IG3 A;  5ETM A;  5L8R C;  3BGR A;  1X9M A;  2C2D A;  1ZA1 B;  1IR0 A;  4DI6 A;  2FHM A;  5CYM A;  2KT5 A;  1SCJ B;  4BS2 A;  3CC2 S;  1JLF B;  4LFC J;  3OPK A;  3BEG B;  5A76 A;  3RB4 A;  1C1C A;  1P1L A;  1HQ2 A;  1N32 J;  2CQ4 A;  4NOH A;  4OJ3 A;  2HBR B;  3I5B A;  2R7S A;  2LEP A;  4NX9 A;  3TEH B;  4FYD A;  4KKO A;  1KON A;  4NLU A;  1VIX A;  4RNH A;  3Q8R B;  1FRI A;  1NU4 A;  1IKX B;  2LKZ A;  3H25 A;  3MPW A;  1J5E J;  1XMQ F;  3A8J A;  3PTW A;  4X2B A;  1NLK L;  2AHO B;  2V2V A;  3P5T L;  4NA1 A;  5T7L B;  5L39 A;  5IC6 B;  1CPZ A;  2LEA A;  2YQ1 A;  4HI1 A;  2ZH4 A;  3QPI A;  4WXW A;  2I5J B;  4JV5 J;  4NEY A;  1RSC A;  3DKD A;  2QGF B;  3Q8V A;  3OQ2 A;  4C6A A;  1JB0 C;  5BJR A;  3G6V A;  2D1C A;  3CCL S;  2OTJ S;  5B0F A;  2UUB F;  4ES1 A;  3MMB A;  1WJ9 A;  2DPJ A;  1MRO B;  3DXB A;  4LSN B;  2WOM B;  3TJ9 A;  2ASL A;  4Q5V A;  4XIU A;  4U7C A;  2LEC A;  1N5Y A;  1DTT B;  2HG4 A;  3MR7 A;  4C98 A;  1HI0 P;  1S4E A;  3P4U B;  2J9D A;  2EI5 A;  1RK8 A;  2KRR A;  3H8Y A;  1YI2 S;  1NK6 A;  2VC1 A;  4NA3 A;  2V50 A;  4A47 A;  1MN9 A;  4RUC A;  3V6D B;  3QAT A;  4OZN A;  2ZH1 A;  3FRZ A;  4N8N A;  4O4R A;  3KK1 A;  1AFJ A;  3C14 A;  2FHJ A;  4IOB A;  2KXN B;  3CSK A;  2HIY A;  2M2B A;  4KAI A;  4DL6 A;  1C0T A;  4X4N A;  4OI4 A;  3CC4 S;  2KFY A;  2XI3 A;  2HSE B;  2HRU A;  2LVW A;  5DRK A;  4Q0B A;  3H4B A;  1KS2 A;  1SQE A;  4NLQ A;  4DLE A;  3PKM A;  3R5B A;  4UZB A;  4IOA Q;  1ZPV A;  3BGO P;  3KUH A;  3QFH A;  3EUN A;  4XAK A;  2GIF A;  2EW9 A;  4OX6 A;  2JRS A;  1QAX A;  2DNK A;  4CLW A;  3A3P B;  3GIK A;  3CCJ S;  2VL1 A;  2YNH B;  1N34 F;  1UPM B;  1OSD A;  3QWU A;  2UV8 G;  4MIB A;  4NA2 A;  2XLI A;  3D6M B;  3GB0 A;  3MCM A;  5KT2 A;  3ITH A;  3TQ1 A;  1L3S A;  2VC0 A;  5KFE A;  5J2Q B;  4B02 A;  4DLG A;  3PIP Q;  5HBM A;  3LGN A;  2UV8 A;  3DYA B;  1ZTW A;  1MWY A;  2BOP A;  2QO3 A;  3D6F B;  5CA5 A;  2QN6 B;  3KJQ B;  3MEK A;  3M8R A;  1ZZN A;  1LEO A;  1MW7 A;  1NND A;  2OPQ A;  5C42 B;  1TKD A;  5IZH A;  4C8N A;  2A18 A;  2LQ9 A;  1YWX A;  3DXS X;  4NRT A;  3CF5 Q;  3M1V A;  1OY6 A;  3H5S A;  4AND A;  1LNQ A;  3DU6 A;  4LIR A;  2KH9 A;  2ROE A;  4WCE Q;  1O5J A;  2DPI A;  1FNO A;  1PSD A;  1H72 C;  3AJ2 A;  3ZNJ 1;  2WSE C;  2DRD A;  2X3D A;  4WK1 A;  1NKB A;  5A0Y B;  1QSY A;  3NNH A;  2ZVI A;  4WKR A;  4EU0 A;  3QIP A;  4ZA1 A;  3KK3 B;  3MPU B;  1HBN A;  1LWE A;  3I31 A;  5LSL A;  2MQQ A;  2UUB J;  1IJE B;  1YJV A;  2H9Z A;  2YTC A;  4IH5 A;  4IQX A;  1QSL A;  1RLC L;  1Q8L A;  1RAG B;  2ZH8 A;  3ETO A;  4JB8 B;  4P71 A;  4UZC A;  3R1H A;  2ZKT A;  3UDC A;  1IM4 A;  1UFL A;  4M8L A;  4ECT A;  3GII A;  2DNR A;  3IBW A;  2Y0S D;  4Y6I A;  5KFV A;  1H0H B;  1HBM A;  2AJF E;  3NBP B;  3FBE A;  4NLS A;  3RAQ A;  3H5U A;  1S79 A;  3AT1 B;  2N82 B;  3GJS B;  1RWU A;  1TMM A;  1PAE X;  3B8H A;  3TOQ A;  4ZMM A;  1R3N A;  1KVJ A;  3ENQ A;  1QUP A;  2WZ1 A;  2QSW A;  4G65 A;  4DPY A;  2V8V A;  1A6L A;  4IG3 B;  4ELT A;  4ED5 A;  1B0P A;  2OEL A;  4PXC A;  4ES2 A;  3BKU A;  3PCO B;  3R5G A;  4CLT A;  4HTI A;  3NGK A;  2GIQ A;  4PWU A;  4RNN A;  1N33 F;  3VZH A;  3MAH A;  1GFW B;  4RKU C;  3GIL A;  1X0F A;  4N7T A;  4C8K A;  1RAO A;  3QMQ A;  1ZH5 A;  3AA9 A;  2VFS A;  2YNI B;  4F50 A;  2RD5 C;  4HHU A;  1OO0 B;  4M63 A;  4V1A k;  4IRK A;  3JAM U;  1FEE A;  3R6G B;  4J9U E;  4B9N A;  1RLD A;  3UFC X;  3FC9 A;  2BRL A;  1XNR J;  4IH7 A;  4X4U A;  2J6U A;  1WOP A;  2AZ1 A;  4KY3 A;  2Z0G A;  4MK8 A;  5CHC B;  3GCW P;  4PG7 A;  2QA4 G;  5H1S V;  2E7X A;  3W2V A;  4WTY A;  1RKJ A;  3EZU A;  3KHH A;  2QLX A;  5D4O A;  5C2G A;  4EZ9 A;  1NXI A;  1R0C B;  2DHX A;  3ISZ A;  1W7W A;  3HHL A;  1T8E A;  1F1B B;  4A8K A;  2LQB A;  1TV6 B;  1WSR A;  3EWG A;  4OYP A;  4E8U A;  4USM A;  2PI5 A;  4K4S A;  3M9N B;  1JLC A;  1B7Y B;  5JUM A;  2PT0 A;  4UT4 A;  1HNZ F;  3VVU A;  1JLE B;  3D54 A;  5HMY A;  2OEJ A;  3VZI A;  4DZ6 A;  2P8I A;  1VQO S;  1IBL F;  2HVE A;  3DI6 B;  3QBC A;  4NLX A;  2DIV A;  4ZJL A;  2FJX A;  1RIS A;  1VRU A;  5DJB A;  1YKW A;  1FFS B;  4NLO A;  4KV8 A;  1RYR A;  1RT7 A;  4PCQ A;  2I2Y A;  5K9F A;  3RYL A;  5MLC V;  2XMJ A;  3OTC A;  3BO4 A;  4OX9 J;  5E3P A;  4LQ9 A;  1VQ6 S;  1FDN A;  1Y00 A;  2E44 A;  3DRS B;  5CAA A;  5LL6 d;  1TL1 A;  3EDQ B;  4ERD A;  4G1P A;  4O44 A;  2OSR A;  1EET B;  3RAX A;  2JVO A;  1G1X A;  3RB0 A;  1S6O A;  3MHY A;  1VQN S;  4QU6 A;  2MQL A;  2RS2 A;  1T05 B;  2MGZ A;  3IM9 A;  3O5T B;  4GO5 X;  1UFK A;  1QTN B;  1DTQ B;  5J2M B;  4LRC A;  4CLL A;  2MQP A;  5DDR C;  3V6K A;  2XY5 A;  1U45 A;  2CJA A;  2BJ9 A;  3D0I E;  1FXL A;  4DPW A;  1S7I A;  2J9D E;  4J7C A;  4CO1 A;  3BSN A;  5KFX A;  1CJT A;  2GQQ A;  3TW0 A;  2Z2Z A;  4EO6 A;  1KQG B;  5F9L A;  1JXL A;  1XBW A;  2ZH2 A;  4UY8 5;  1WOS A;  3E01 A;  2K3K A;  2P9G A;  5HVF A;  2HS0 A;  9RUB A;  2G0C A;  2HNZ B;  3W9I A;  1QAI A;  3TZZ A;  4K0K J;  3OTD A;  2DNO A;  1VRT B;  1RWN B;  3M2V B;  1S1X A;  4ZVO B;  2OML A;  3RRH A;  1K8A T;  1B70 B;  2AF6 A;  2YXL A;  3AD8 C;  1IR2 A;  3KG1 A;  4PZV A;  1C1C B;  4DL3 A;  1RWM B;  1MMD A;  2PII A;  2VA3 A;  2MKS A;  1D9D A;  4MYT A;  2HQ3 A;  2RDI A;  2IYI A;  4UW2 A;  1K0V A;  2MLX A;  3HT3 A;  2EEY A;  3T41 A;  3HHN B;  2H5E A;  2DYA A;  2EFG A;  1SJQ A;  4WBF A;  3WC0 A;  4EI2 A;  4HYK A;  1C4A A;  3K5O A;  3VQS A;  5AJ3 F;  4DMZ A;  3C46 A;  2Q3P A;  3MF5 A;  5ETS A;  1VQY A;  1Q5V A;  2ACY A;  2XY7 A;  2WK4 A;  1OQ6 A;  1TP7 A;  2H1Y A;  2CQ3 A;  3S6E A;  1NJX A;  4JI4 J;  3MR2 A;  1BHN A;  1S59 A;  2AX0 A;  5L1L A;  1MRO A;  3W3S A;  2HVI A;  3E8O A;  2WOM A;  2DKO B;  3JSB A;  3H90 A;  4K8R A;  3P5B P;  1N5Y B;  2FJV A;  1WKJ A;  2L48 A;  2E1P A;  3CVK A;  2IFX A;  4N76 A;  2J5A A;  1FES A;  2HEK A;  2GGP A;  4LUB A;  2E66 A;  1U49 A;  3G82 B;  3IWN C;  2RB7 A;  3PJX A;  3PYF A;  2CYY A;  3K58 A;  4L76 A;  3QRR A;  2EKY A;  2GAG C;  1HNI A;  1SIW B;  4I64 A;  1FKP A;  3W8G A;  2CPZ A;  4MMO A;  2B56 A;  2CVI A;  1YRT A;  3K8W A;  4PPD A;  4ZVQ B;  1SKU B;  3SMZ A;  4RUB A;  2ZJQ Q;  1S0N A;  2Y1I A;  1RWV B;  2QFJ A;  3ZTR A;  2JC1 A;  3I82 A;  2X1F A;  3FSY A;  4RJV A;  4LSL B;  4UY8 T;  3O3L A;  1RCO B;  3PW7 A;  4PUO B;  4OI3 A;  4JV1 A;  4Z37 A;  1RAJ A;  3GR1 A;  1CG2 A;  1RTJ B;  5HSP A;  3AAW B;  2EC0 A;  2W2O P;  2IJN A;  1BQN B;  2VPX B;  1E6V A;  2KU7 A;  4IFV A;  2IM0 A;  3RB6 A;  3SV4 A;  2PN6 A;  1X4A A;  3FBC A;  4YQW A;  1JMT A;  2ZHO A;  1YDL A;  2XZD B;  3KUG A;  3L9Z A;  4QWC A;  3PKY A;  1XTZ A;  2ZH6 A;  4V19 X;  1X8D A;  4V19 J;  5IQQ A;  1UEV A;  2Y1L B;  1BWV A;  4N77 A;  2EC2 A;  2AJ1 A;  3GTY X;  4WFX A;  3UQS A;  3OTE A;  4X64 F;  5K8N A;  2F63 A;  2JEJ A;  4DUY F;  3HHL B;  5C42 A;  1KHV A;  1TV6 A;  2NSB A;  4OJ1 A;  4J9P A;  4A8S A;  2WSF C;  4C7Q A;  3QJL A;  5C7P A;  2JEF A;  1RWO B;  3B78 A;  1GAO A;  1ULR A;  4WE1 A;  4ELV A;  4LSN A;  3DI6 A;  4ZVF A;  4ED0 A;  2DO4 A;  2KT2 A;  2V8G A;  3DDI A;  4OI2 A;  2WVF A;  4ED4 A;  5C24 B;  2VQE J;  2DY1 A;  4LT6 A;  4DFP A;  2PDA A;  1U1R A;  1NSK L;  3M8P B;  2WBM A;  2P6T A;  1FT8 A;  1HBN B;  2CWX A;  1LWC B;  3B6B A;  3LPY A;  3CCQ S;  3KJV B;  3EYZ A;  1N48 A;  3NNC A;  4OQJ A;  2W9C A;  1APS A;  2D9O A;  2AX1 A;  3AHP A;  4NYO A;  4HR2 A;  1BE4 A;  5J2M A;  3VAK A;  1HKA A;  4X4T A;  2XM3 A;  3HO1 A;  2R2U A;  2B9X A;  3MM6 B;  4IDK B;  4YB1 P;  3C6T B;  5LMN J;  4DR3 J;  4DQQ A;  2ILY A;  2PSZ A;  2Q1L A;  3CTR A;  1NME B;  2EXU A;  2RQ4 A;  3A12 A;  3OHA A;  3LAM A;  3PX0 A;  3M4X A;  2HK2 A;  2XZW A;  2ZOM A;  4F4Z A;  1XEZ A;  2EFN A;  5ADZ A;  2FVQ A;  2FTR A;  4CYU A;  1KEK A;  3DYA A;  3IXQ A;  4NCB A;  2EBG A;  2OLW A;  1U0H B;  1X5P A;  2ACM A;  4DV7 F;  1VQ9 S;  2F5G A;  1ZBT A;  2OPP A;  4Z7C A;  4WK3 A;  3QZ7 A;  3K5M A;  4ZJO A;  1QAJ A;  4ZPA A;  3KFW X;  1RU2 A;  3FRY A;  2E5J A;  4JOU A;  4DSJ A;  4DR6 J;  2MEW A;  1Y5I B;  4KGM A;  5KFZ A;  3K5L A;  3CDW A;  3PR5 B;  2FLO A;  3CO0 P;  1ZET A;  4U96 A;  4PR6 A;  2ASY A;  2HHU A;  2H48 B;  4ZVS B;  3HJV A;  2RML A;  1NK9 A;  4Y2I A;  3VR1 A;  2CG4 A;  2PO4 A;  2VFU A;  2C2Z B;  5F0U A;  3FEZ A;  2HRT A;  3ETM A;  3D1H A;  3PM9 A;  5T41 A;  3J81 Y;  1TL7 B;  2RKI A;  1FJE B;  3V4M A;  4ZPB A;  4OX7 A;  4WU3 A;  1I94 F;  3EPG A;  4G1Q A;  1VRQ C;  3NOG A;  2XTJ P;  1KFS A;  2ZHA A;  2BJD A;  2XCP A;  1MWZ A;  1VQL S;  2OTL S;  3RRG A;  3CD5 A;  1IWA A;  1U2C A;  2FPH X;  1SIZ A;  3BKF A;  5E33 A;  3PVX A;  2R8I A;  4XTT A;  3RTV A;  2VQF F;  2ATC B;  3ADA C;  3NS6 A;  5DO2 A;  1NSQ A;  2GMJ A;  2AD9 A;  4ILM A;  2YNF A;  2RE1 A;  1HNI B;  1LQ9 A;  2BKO A;  5LXY A;  1UPP A;  1IJF B;  3QGG A;  1XQI A;  1VRU B;  2HFO A;  4ZN1 A;  2XGP A;  2CJ9 A;  2B9W A;  1FKA F;  1HL6 A;  4P52 A;  5ETN A;  2UUT A;  5KFL A;  5F8L A;  1CQM A;  3EVO A;  1WHY A;  1ZM3 A;  5K8O A;  3PW2 A;  4NLT A;  4QIE A;  1IKW B;  4RW7 B;  3U1L A;  5K20 B;  2Z2M A;  5GVQ A;  1SC3 B;  1X60 A;  3OR1 A;  3IRX A;  1Y3K A;  3D1O A;  4C0H A;  3J7Z 5;  3X3U A;  3KUE A;  4ED1 A;  3N01 A;  3ISN C;  3J80 U;  5BR8 J;  4ETX A;  4K4Y A;  4GKK F;  1DTQ A;  5J2P A;  2Y1J A;  2K1R B;  2ZD1 B;  3HHL D;  1VQM S;  3EXY A;  1FK9 B;  5D4L A;  1NDK A;  4X65 J;  2DNL A;  1VC0 A;  4PRF A;  4MYU A;  3N6L A;  3A8E A;  1YBU A;  6AT1 B;  2V34 A;  2LDY A;  3VAM A;  2W8K A;  5DDO C;  1AZS A;  1YQH A;  2ZVS A;  5U47 A;  3JS9 A;  2IC3 B;  5AXL A;  2AJ2 A;  1WG5 A;  1PCA A;  2ZNY A;  1AYE A;  4D3H A;  4DJB A;  4F25 A;  3KMS A;  1REV B;  1OWX A;  3NCQ A;  1AXQ A;  3SZ2 A;  2RF2 B;  3E3X A;  3VF0 B;  2E5I A;  2Z2Y B;  2J9E A;  5DZ6 A;  3VAG A;  4M94 A;  4DR1 F;  2OKQ A;  4JI3 J;  1EZZ B;  1U09 A;  1WI8 A;  2VFT A;  3ENA A;  3M2U A;  2MZ1 A;  3HSG A;  2DR8 A;  4CNZ A;  2CVE A;  5C24 A;  5BXI A;  3NWR A;  1YG0 A;  1F60 B;  1RAH B;  2BUN A;  2HFS A;  4NZ0 A;  5DDP C;  3EGW B;  3G6Y A;  1H3D A;  1T95 A;  4YDD B;  2R8J A;  2GVD A;  5KG7 A;  3PZP A;  1N5Q A;  1FHT A;  2ZC4 A;  3GON A;  2R9L A;  3LQV A;  5DLG A;  4ECU A;  3NG8 A;  1U1Q A;  1SL0 A;  2CPJ A;  2NS1 B;  2NUU G;  2V2Z A;  1CJU B;  2HK3 A;  3PHT A;  3Q8Y A;  3ZFV A;  2W2P P;  4YFU A;  4JI5 F;  1D9A A;  4PYD A;  2L3M A;  1YZ6 A;  2MKC A;  2P9C A;  3QO9 B;  2UXD J;  4HT5 A;  5JVG Q;  2QYC A;  5EHH A;  3V2U C;  1EET A;  2F40 A;  1Y10 A;  4PQU B;  5D0R A;  2W7P A;  2W4D A;  2HHQ A;  4RL1 A;  2B8Q A;  1RTD B;  4PYA A;  1P9Q C;  3NXZ A;  3GJT B;  4I7F B;  1VLO A;  1NHU A;  1HHS A;  2FJD B;  4DN9 A;  2H65 B;  1MWQ A;  3GYG A;  3MM8 A;  2DGO A;  3CE8 A;  4FVM A;  4OYX A;  1JJH A;  1FWP A;  2NXU A;  4S0M A;  2CJQ A;  3W9J A;  2BAC A;  5T14 A;  4A8W A;  4BDP A;  3DLJ A;  2GX8 A;  3SYZ A;  2GO8 A;  4ILL A;  2WHO A;  2EG1 A;  1IKV A;  2FY8 A;  4FNI A;  4DR5 J;  3LAK A;  4NZ6 A;  2UVW A;  1FE4 A;  4C0B A;  1ICE B;  4LSL A;  5LMU J;  3BPD A;  3R7N B;  2C28 A;  4J9R A;  1HQE A;  4HDG A;  1Q86 T;  2F4V J;  5KG1 A;  4DSF A;  2J0W A;  3T1Y F;  1F3V A;  2DNQ A;  3T5L A;  1H73 A;  4ZDN A;  5HMX A;  1J2V A;  2ROG A;  1R8B A;  5G4D A;  4IFV B;  2MJN A;  3K2Y A;  1WDT A;  3TAM A;  5JVH Q;  1SVD A;  4EYI B;  2H4W B;  4KFB A;  1KVK A;  4M5M A;  2IDE A;  1FNX H;  3GJR B;  1VQ8 S;  1QSS A;  3AQP A;  3CJT A;  2BAN A;  1M5K C;  1VK3 A;  4C3M A;  4IR9 A;  2HNY B;  1R0A A;  3S01 A;  2CDR B;  1QE1 A;  3R7S B;  2HND A;  5EWF A;  3PHE A;  2VJU A;  2KFZ A;  3F41 A;  3T1A A;  1M0S A;  1KKH A;  4AXI A;  3D5M A;  4OJG A;  2M9K A;  1YBA A;  2PMH A;  4M1K A;  1RT5 B;  4JI6 J;  2BX6 A;  2GJ2 A;  2MZS A;  3CCW A;  4CIO A;  2AYM A;  1QY7 A;  3HFZ B;  3N6N A;  4LIW A;  4JP8 A;  2ZWO A;  4KC5 A;  2F4F A;  1PKU A;  4C11 B;  4RUH A;  3NOC A;  1KWM A;  4M5H A;  2C22 A;  4KH1 B;  3AJD A;  5E5N A;  4CH1 A;  4J90 A;  2QMW A;  4KO0 A;  3SDE A;  5ITH A;  5CD4 H;  1SJ3 P;  1HNV B;  4DSL A;  5K8M A;  4RBT A;  1NKE A;  4R25 A;  3CCZ A;  2QE5 A;  3OR1 B;  2CDQ A;  3KJV A;  1NAQ A;  2ZC3 A;  1N33 J;  2U1A A;  1TUV A;  2KZM A;  4TQR A;  2DH9 A;  1S48 A;  2B5J A;  3N79 A;  3ONQ A;  3NCR A;  5F3T A;  4LFB F;  3UD3 P;  3OSP A;  4PUO A;  2HVZ A;  1V5I B;  3C6T A;  1G6B A;  1RHQ B;  3G8S A;  4DPX A;  2MZR A;  4GRS A;  3HHE A;  3M6X A;  1K47 A;  1AUS L;  1OPZ A;  1Q82 T;  2JFD A;  2HHT A;  3MM9 A;  3GFH A;  3QSY B;  2FVP A;  3K5P A;  3GYN A;  3SQG A;  2BM1 A;  3M7V A;  5KOX A;  2L08 A;  4LRB A;  2V9W A;  2C3Y A;  1VBY A;  2DGT A;  1U6F A;  4C8L A;  4USU A;  1FER A;  2A2C A;  4P2M A;  2HQC A;  4FPI A;  3TNV A;  2AQ4 A;  4DL7 A;  4DQI A;  2QLW A;  2D74 B;  2FB0 A;  3SSQ A;  5LJ3 Y;  5AT1 B;  2CQ1 A;  2KT3 A;  4CLY A;  3K57 A;  4GKJ J;  3Q2S C;  4RLE A;  4DSI A;  2BJ3 A;  1SQG A;  1UFW A;  4JV0 A;  3TAN A;  1ZYQ A;  4F3O A;  2FGO A;  1JWW A;  1RP5 A;  2F8E X;  2WVD A;  1YBT A;  1B3T A;  1YJU A;  2CQ0 A;  2XB2 D;  4U6P A;  5B0A A;  4P75 A;  5KFK A;  3MDF A;  2X7I A;  1FEH A;  2YVS A;  5HJX A;  3UN3 A;  2I5J A;  4UQG A;  1SJ4 P;  4R0E A;  3I0S B;  1Y0H A;  3KNA A;  3HVR A;  4TY8 B;  1TL7 A;  2CG8 A;  2RKI B;  5I4M A;  4M5J A;  1CS4 B;  2QX0 A;  1B64 A;  3CJ8 A;  1BXN A;  4RW9 A;  4DV5 J;  1S9G A;  4DL4 A;  1RE1 B;  5D78 A;  4DV2 F;  1UEU A;  2NYI A;  2Q6C A;  3CDU A;  3W2W A;  3A13 A;  1DTT A;  3NMA A;  2V9K A;  4HHJ A;  4ECS A;  2VG5 A;  3HF5 A;  1UTA A;  2G2O A;  2WON A;  4U8V A;  5IT9 Y;  1NDP A;  1F9E B;  2C2R A;  1SC4 B;  2MXY A;  3S7R A;  1YRX A;  2A2D A;  1RHJ B;  3EVM A;  2E5G A;  3V6D A;  1D8Y A;  3IGV A;  3IO1 A;  3MM8 B;  3JB9 k;  2XMV A;  1B7F A;  2MY8 A;  3NLC A;  2H3E B;  5D0H A;  1KHW A;  4X62 F;  2AYG A;  1OS5 A;  1EB0 A;  3GE9 A;  2JLE A;  4PXE A;  3HZG A;  2MST A;  3DGP B;  3IP0 A;  3KDN A;  3SI8 A;  1S49 A;  3RZA A;  2RUS A;  4F4Y A;  2JEI A;  3NWG A;  3HT0 A;  3KJN B;  4FVC A;  1WHV A;  4DCO B;  3MCN A;  4WFB Q;  3QJJ A;  1RA7 A;  1CEZ A;  3DRR B;  2FJB B;  1N56 A;  4OYM A;  1FRH A;  3PW0 A;  4WPA A;  1G7C B;  3ZTS A;  1KTQ A;  1Q95 G;  5KFW A;  1NK4 A;  1ZAX A;  3O2I A;  4W4M A;  4KGK A;  5I42 A;  2ZDP A;  3W60 A;  5IXU A;  1UVK A;  1N0V C;  1RTH A;  2KB2 A;  1SPB P;  2C2M B;  2K1R A;  2ZD1 A;  1U6Z A;  4U7U D;  4KFB B;  2YKM B;  3HKZ D;  1TL3 B;  2XSJ B;  1RA6 A;  4KKO B;  1S6Q A;  1WOO A;  3CME S;  1VJW A;  1U8S A;  3KK2 A;  1HA1 A;  2Y3Y A;  2ALY B;  4A8O A;  1ZPW X;  2HNY A;  5L1K A;  4FYV B;  4NYZ A;  1WOR A;  2YQ0 A;  1WKL A;  2IPO B;  4F2S A;  3W8P A;  2AEM A;  4QYZ K;  2EBE A;  1D8Z A;  1LFW A;  3O8W A;  4YUD A;  3RUB L;  4DOZ A;  5LOQ A;  4RU2 A;  4JV5 F;  2PFD A;  2VG6 B;  3O44 A;  1VK8 A;  1NK5 A;  2G4B A;  3H7H B;  3D3C J;  1Q53 A;  3H98 A;  1W26 A;  4WP8 A;  2W9B A;  4N47 A;  4J9M A;  1YIT S;  1XMQ J;  4DR7 F;  2XMU A;  1J5O B;  3TZW A;  2IM1 A;  1RTI B;  1UA1 A;  3GIM A;  1RT2 B;  2NQP A;  2D3U A;  3ZO7 A;  3AOD A;  1TK0 A;  4Q8E A;  2WCX A;  2XMA A;  5SZT A;  1KP6 A;  2AW0 A;  4LFC F;  1TUG B;  1N5V A;  3AD7 C;  3C14 B;  1EP4 B;  1HQU B;  4PXB A;  4CRJ A;  5EWG A;  4LR7 A;  1N52 B;  3UN5 A;  4UTG A;  3MFI A;  1C0T B;  1P6T A;  5GAE I;  1KOO A;  5DQH A;  1WTF A;  1XK8 A;  5F0W A;  2CNK B;  3TX0 A;  2RQC A;  1SBR A;  4IFY A;  2GVZ B;  1E6Y A;  2MHE A;  2X3G A;  4XK8 C;  2L9W A;  4YEA A;  2FZG B;  1NB7 A;  3KDO A;  5IFM A;  5KFQ A;  2C2N A;  1JQG A;  1HW9 A;  1BLU A;  4P2F A;  3HI9 A;  3HVT A;  1C1B A;  1RXO B;  1RTD A;  2DBB A;  1TUW A;  4ZLL A;  3VAH A;  1HNZ J;  1CJV A;  1FX4 A;  2BW2 A;  3HKW A;  2OMO A;  4HVZ A;  1Z2Z A;  1Q16 B;  1SJ1 A;  5F3Z A;  3UR0 A;  5GMD A;  5A6W A;  3OBI A;  3R5D A;  4UOG A;  5KAK A;  5IM0 B;  4U67 Q;  1JLQ B;  4J9N A;  4JI7 J;  3NNA A;  4U7U K;  5EGY A;  2K2P A;  1RUS A;  2RDJ A;  4H4K C;  3CD7 A;  1SJF A;  1U02 A;  4DSK A;  2CQD A;  4WP3 A;  3MEE A;  2RNE A;  1KSP A;  2D3Z A;  2RF2 A;  2DB1 A;  3UR3 C;  5D3G A;  3FBF A;  4DR7 J;  4J91 A;  5IC4 B;  2MQM A;  4B3M F;  1RBA A;  1LK5 A;  5JXS A;  2RU3 A;  3EZO A;  4LRF A;  2I8E A;  2KO1 A;  4OLO A;  4R5P A;  3Q8P B;  3WDO A;  1UVN A;  4JBC A;  3CD6 S;  3OL8 A;  5E3A A;  4KJI A;  4ZVH A;  2IAJ B;  3KLE A;  4BWM A;  2IA6 A;  4NLD A;  5DQG A;  2KJV A;  1RGV A;  4FXD A;  4DBQ A;  2XMW A;  1NZA A;  3KLG B;  2FHO B;  2V8D A;  3MUR P;  5KFP A;  4RW9 B;  3BH6 B;  3T5H A;  2MKI A;  4NCG A;  2ZJR Q;  3OR2 B;  4ID5 A;  5M2R A;  1ROF A;  2YKP A;  4B3R F;  2NXE A;  5J1P A;  1JLC B;  3HD2 A;  1YK9 A;  2VF3 A;  2CUY A;  3ZNU A;  5DG8 A;  3QO9 A;  2ZH7 A;  1YJR A;  2KM8 B;  1D1U A;  2A10 A;  2OI2 A;  3CDA A;  3FKB A;  1NJZ A;  1I5O B;  2KFN A;  4OZ5 A;  2V8H A;  3VTI A;  4M5D B;  3VAF A;  4DL2 A;  1IBM F;  4NAS A;  2LA4 A;  2JX2 A;  2RVJ A;  2DH8 A;  2VDH A;  4QW9 A;  2UU9 J;  4NXM J;  2R7V A;  1UWA A;  3DGP A;  1PO6 A;  1PAU B;  4CNY A;  1VMB A;  1WKK A;  3UDV A;  3PV8 A;  4FF3 A;  1XMO J;  3RBD A;  4GVB A;  3MM7 A;  2I6W A;  4P2S A;  4DQR A;  1IQZ A;  2MSS A;  2FC9 A;  5G0R B;  2F7V A;  3UVJ B;  4CO0 A;  1LFP A;  4ZVE A;  1ZM4 A;  1X4H A;  2GHW A;  4M5G A;  3QYY A;  1GXU A;  2A3J A;  4H54 A;  5I42 B;  3MXH P;  1V3S A;  3DN9 A;  2B4P A;  3EZ5 A;  3GMG A;  1RHK B;  1VIO A;  3ET6 A;  4HAC B;  2DH7 A;  3BR8 A;  1PYS B;  2B51 A;  4F0K A;  4KT0 C;  3J81 j;  4C97 A;  4LF9 J;  5AXK A;  3MCO A;  4R8U B;  4USV A;  4JUZ A;  4OLP A;  3Q89 A;  2RHS B;  3EJM A;  1KNZ A;  1K73 T;  3TVY A;  2NZC A;  4TXS A;  2NUH A;  2G9O A;  3I0R B;  1FDA A;  4Y28 C;  1SV5 B;  3IWX A;  4KSE B;  2QL5 B;  4U95 A;  4DWI A;  4CCH A;  2CNN B;  3BPS P;  3IA0 A;  3H59 A;  4KB7 A;  4F36 A;  1ZTT A;  2OP5 A;  5DM7 Q;  2DXE A;  3MOJ B;  3HSD A;  2DCU B;  4RNF A;  3DU5 A;  4LFA F;  4JI2 F;  1M90 T;  1FE0 A;  2HND B;  3MAQ A;  4X4S A;  1ZA2 B;  1U1P A;  1J5O A;  3DLE B;  4LBP A;  4AQY F;  3C16 B;  3QWP A;  3GV8 B;  1FI4 A;  4ED3 A;  2GHV C;  3NGD A;  3M9O B;  3GQC A;  5CYJ A;  2VBW A;  3KMQ A;  4OHY A;  4FYY B;  4ZVU B;  5J2N A;  2KN4 A;  3F56 A;  1TKZ B;  3IR5 B;  3UPF A;  3AFG A;  1HWJ A;  3MMC A;  4I2Q B;  4DV0 F;  2AMC B;  4ZCK A;  1PJ7 A;  1W25 A;  2YX4 A;  2KHD A;  2CPF A;  5HMW A;  1H7X A;  2IJR A;  5H9F J;  4F26 A;  3DOK A;  3T1H J;  3GFZ A;  2ZNZ A;  3VGV A;  4PWW A;  1FWK A;  3LP0 B;  3M32 B;  4Y2A A;  1TR0 A;  3CDB A;  1KC8 T;  4OYI A;  2DRB A;  2LMI A;  4AQY J;  3I5C A;  5HLF B;  2BOA A;  5HQM A;  2RHQ B;  4LF5 F;  4EUV A;  1GXL A;  1S1U B;  1S1V B;  3NCP A;  1UWB A;  1RAC B;  2KHC A;  4XDD A;  2W9A A;  1FKP B;  6FD1 A;  3N28 A;  2WB1 D;  1CJT B;  2FVC A;  2CZ9 A;  3NGU A;  2XHC A;  1JLQ A;  2CZ4 A;  1ELO A;  2FIU A;  3PFE A;  2IJF A;  2LU1 A;  4Y2K A;  3W1Y C;  2UUC J;  1URN A;  3MEC A;  1PJ6 A;  2FQQ B;  4YR2 A;  2EG2 A;  3E01 B;  4RW8 A;  1RT3 B;  3RW6 A;  3NGR A;  3IG1 A;  3WC2 A;  1OY8 A;  2DEI A;  4UST A;  4A4J A;  4ZN3 A;  1KN6 A;  3BBC A;  3I5A A;  2GS8 A;  1FRJ A;  2BQR A;  1FO1 A;  3LGH A;  2NXN A;  1RU1 A;  3OUY A;  2X1A A;  3O1L A;  4K50 A;  1KR4 A;  4QIV A;  3ZZT A;  4XO0 A;  4C2M A;  3CIZ A;  3OXF A;  4U9R A;  3HFK A;  2VKR A;  2YKM A;  3CCU S;  2BR0 A;  3JSM B;  3JSR A;  1S6Q B;  4HH0 A;  3M8S A;  4LF5 J;  2XLK A;  1NSA A;  1TL4 A;  2FY1 A;  2UZA A;  2OH2 A;  4A8F A;  1JLA A;  1HAR A;  1X4D A;  1NB2 A;  1RAA B;  2FGC A;  3D28 A;  4ID5 B;  2GFF A;  2DNP A;  3MEG A;  4N56 A;  2G2Y A;  2FJW A;  1VGY A;  5KFA A;  4F04 B;  2HBY B;  3T1H F;  1FKO B;  1UJ6 A;  4DPT A;  2QC3 A;  4FS2 A;  3Q2T C;  5ETL A;  5F9N A;  5E41 A;  9ATC B;  2FZC B;  1JXE A;  1P27 B;  3HD1 A;  4AL6 A;  3QGI A;  3T9Z A;  1U4B A;  1HHT P;  2FVS A;  4M5D A;  5DLF A;  4LF6 J;  3CD0 A;  1LXN A;  1OY9 A;  2V68 A;  3BYR A;  1RT6 A;  4LBI A;  4MKY A;  5EUH A;  2CPH A;  2GMH A;  4DG1 B;  3M8Y A;  4X62 J;  4DS5 A;  2XY6 A;  3PX4 A;  1SKW A;  4NI2 A;  3SQO P;  3M8P A;  3THP A;  3LAN A;  3GJQ B;  3ZZ0 A;  4X66 F;  1NH7 A;  4HI2 A;  2HKE A;  4ZLP A;  2E1C A;  1GMU A;  1V3Z A;  2HBQ B;  1NHV A;  2HFZ A;  5IWA F;  4P7T A;  2QZ8 A;  3KLI A;  5HAO A;  3ZZU A;  3IRW P;  2VIH A;  1AUD A;  3RBE A;  1N4L A;  1UZH A;  4IFY B;  3UNY A;  2RRN A;  1KRP A;  1FWL A;  1VIS A;  2VB6 A;  8RUC A;  1YJN S;  4O3R A;  1NBE B;  4OZ0 A;  3OL6 A;  4O44 B;  1F6T A;  4A8Y A;  4K4U A;  2OEM A;  2CNL B;  4L75 A;  2QV6 A;  4ANC A;  3HSJ A;  3WIU A;  3GV5 B;  3BR9 A;  1C1B B;  3ZZR A;  4NL5 A;  3I0R A;  2MKH A;  2HHH J;  5JJB A;  1CQN A;  1FRM A;  1LOU A;  1URR A;  1VBK A;  4ES3 A;  1T7P A;  3QSI A;  3L4B C;  2R7R A;  1Y5L B;  2KVI A;  1M5H A;  4AUK A;  3PRV A;  4DR4 F;  1NK8 A;  1PBU A;  4RW4 A;  4Y2C A;  4CLK A;  1REG X;  1T3N A;  2RAQ A;  5J1N A;  3P96 A;  1KLM A;  1R7I A;  2UXB J;  3BGL A;  4BCA A;  3HK2 A;  3C16 A;  2BXJ A;  1BQM A;  2H51 B;  5FD1 A;  4OHX A;  4I6W A;  2C3M A;  2XYG B;  1CJK B;  4CTA A;  5F8I A;  4ED2 A;  2M7S A;  2WB4 A;  4O3P A;  2HMI B;  1I3O B;  4N5S A;  2QA2 A;  4NXM F;  3M6W A;  4DUZ J;  1A9N B;  2YX7 A;  1ZM9 A;  1DBD A;  2MJU A;  1KLN A;  4ECV A;  2ZH9 A;  4WII A;  1RT1 B;  4TYB A;  4UOH A;  3J80 Y;  4YME A;  5J1E A;  2FC8 A;  3H2U B;  1NHK L;  3QAE A;  3TA1 A;  2DHH A;  4LF8 J;  2C2O B;  1LWC A;  4RX6 A;  1EP4 A;  2OSQ A;  4H4K A;  3BO3 A;  5L1I A;  2HVH A;  1HMV A;  2I1R A;  1CBK A;  3KG0 A;  2ZWP A;  3LAL A;  1QDU B;  1PJ5 A;  1VR6 A;  3BYP A;  2G0J A;  3PYD A;  3Q0A A;  1Q8K A;  2GVZ A;  3G4S S;  3VAL A;  4IG0 B;  1S1U A;  1FRL A;  1T9V A;  3Q86 A;  4DPO A;  5B08 A;  2POK A;  3TA2 A;  3CC7 S;  1LWF B;  3DDK A;  2EKN A;  2QA4 S;  3R97 A;  5A8K A;  4ELU A;  2ZOF A;  3RG6 A;  3LO3 A;  3HPO A;  2YKO A;  2DIS A;  3DRP B;  4B9T A;  2KZZ A;  2BE7 D;  3BM7 A;  3HLU A;  3IG1 B;  4TU7 A;  4U8Y A;  1IKY A;  4OV1 A;  2M5Y A;  2YNG B;  3SCL E;  1TL5 A;  1U0H A;  2PFF B;  2Y1R I;  1LK7 A;  8ATC B;  1IQT A;  2W2N P;  4HAC A;  3A3N B;  1FNM A;  1FF2 A;  3U1M A;  3PY8 A;  2HIQ A;  2XZT B;  2YWE A;  3CJ5 A;  2GQ2 A;  3UE2 A;  1SC1 B;  2E1M C;  5F41 A;  2BQU A;  2F9J A;  1LV5 A;  1CUL A;  5HP1 B;  5T7L A;  3HUL A;  1BQX A;  3CIM A;  3DLG B;  1Q8I A;  5KFI A;  2DY9 A;  4RR5 A;  4Y2M A;  5CZV A;  2A6M A;  1UAW A;  3I4P A;  4USH A;  1U1O A;  3W5Z A;  2R2S A;  4TYA A;  1IBC B;  3KLG A;  2AEF A;  2XYH B;  4RBV A;  1RQ0 A;  2OPS A;  1ARO P;  4MFB B;  4HKQ A;  2YKN B;  1CSJ A;  3PFO A;  5DDQ C;  3RW7 A;  3DLB A;  2QFI A;  2YPY A;  3MFH A;  1KD1 T;  2JWN A;  3V4I B;  2VIC A;  2OGU A;  4F3Q A;  5GAE U;  1N36 F;  4DG1 A;  2CPY A;  2BE9 B;  4NI2 B;  1RDR A;  4P7V A;  5B0C A;  4X4O A;  2KI2 A;  3FEX B;  3J7Z T;  2R42 A;  1R6V A;  5D8H B;  5FDL B;  3FDS A;  2GV1 A;  4L3N A;  5F8H A;  2DNH A;  5CYQ A;  2DGV A;  3RR7 A;  2B4V A;  2E7V A;  3MMC B;  4I2Q A;  4PPZ A;  2BA9 A;  2YWH A;  3PXG a;  4CLP A;  4Q0B B;  5KT4 A;  3KWM A;  3LP1 A;  3POT B;  4O23 A;  3MM7 B;  2MZJ A;  2UXD F;  5A8W A;  2R8H A;  2CQC A;  2CKW A;  1VI7 A;  2JDJ A;  2KRB A;  3OFF A;  1GNK A;  3M32 A;  4URQ U;  1OYE A;  4PWD A;  4HL9 A;  3C6U A;  1TEL A;  2P9E A;  3MMA B;  4A48 A;  4DV6 J;  2RRA A;  3J7Y I;  1EIY B;  2DEJ A;  2NRE A;  4WZQ A;  4NXN F;  3GV7 B;  4Z2X A;  1RAE B;  4AXJ A;  4CO3 A;  4DFK A;  1GT8 A;  2N3L A;  1U26 A;  4P74 A;  1RKI A;  5FLX Y;  1UP1 A;  1Y4Z B;  1FVS A;  2W2M P;  3H5Y A;  2VKZ G;  3VGS A;  4ECW A;  4ILR A;  4MK7 A;  3B4D A;  2BKN A;  2MTL A;  4QOT A;  4CT8 A;  4FF2 A;  3T5J A;  3D6H B;  1Q4R A;  4Y34 A;  2LP4 A;  4OZ3 A;  2Y9H A;  3PW4 A;  4HEA 9;  4OI1 A;  1UVM A;  3C15 A;  3ELH A;  4WKY A;  2NXJ A;  3KLF A;  2M3D A;  4EZ6 A;  1HQE B;  3CCS S;  1WEZ A;  4K5S A;  1JJ4 A;  2R7W A;  2HQG A;  4NZ7 A;  1LKZ A;  1VCT A;  2W24 A;  3NRB A;  2DJW A;  3UD5 A;  2B9E A;  2AP6 A;  1RBL A;  1ZZF A;  3W66 A;  1L3V A;  2XO6 A;  3C19 A;  2VA2 A;  1WG4 A;  1Y3J A;  1F3F A;  3AD9 C;  3B54 A;  3LA0 A;  3M8Q A;  2R7X A;  3GFX A;  4ICL A;  3BDE A;  2NLW A;  1WAC A;  5BR8 F;  3PEJ A;  1QE1 B;  5B0B A;  3MR5 A;  1ACM B;  2G1H A;  2R7Q A;  4DEZ A;  1M1H A;  2CAD A;  4F4A A;  4DV5 F;  3J7A 1;  3NAI A;  3UNG C;  2LFV A;  1SXL A;  3WBZ A;  2F65 A;  3GCX P;  4IKA A;  2PMW A;  3CJ0 A;  4TNO A;  1EHW A;  5L38 A;  1QM9 A;  1H98 A;  4MH8 A;  2MKY A;  3LP0 A;  2GJF A;  1RT6 B;  1TFW A;  1RBO B;  1NPR A;  3V5R A;  5A8K B;  2VG7 A;  2A0F B;  1GMW A;  4I56 A;  4KO0 B;  1JLG B;  1VC6 A;  3M05 A;  1S1V A;  2YNF B;  2H4Y B;  5E0O A;  1QAY A;  2DGW A;  1SUQ A;  2UUA J;  5KFJ A;  3LTO A;  1WDD A;  2HVD A;  4E98 A;  4CM2 A;  1RHU B;  2X51 A;  5F8G A;  3R7B B;  4EBC A;  3QRP A;  3AJ1 A;  2GW8 A;  4YR0 A;  4DUY J;  1IKW A;  3KOA A;  1X4E A;  4J9O A;  2J76 E;  4DR2 F;  2BE2 B;  4ZPC A;  2CQB A;  4LRD A;  5H9E J;  4DR4 J;  3EMT A;  1GMV A;  1HLW A;  1KFD A;  1UJ4 A;  5E3Q A;  5GAD I;  3D2W A;  2UUA F;  4F2R A;  3I96 A;  2XS7 A;  4EBD A;  5M2P A;  4QYZ J;  1T0T V;  2H5J B;  1PC4 A;  3BSC A;  4ZS6 A;  2IBK A;  2C2K B;  2W4C A;  1QVF R;  4ED8 A;  1GK8 A;  1H74 A;  1PBA A;  2JL9 A;  3IAM 9;  3IFE A;  4O0I A;  3CJ4 A;  4M95 A;  4C0O C;  3IR6 B;  1AFI A;  4OHW A;  5KFG A;  2ZUG A;  4RW4 B;  2XMM A;  3C3L A;  5GAG U;  2KXH A;  2HZC A;  2O1P A;  4DV3 J;  1FX2 A;  1FTC A;  2W1B A;  4DF4 A;  3CJK A;  4YB6 A;  1RAB B;  4J37 A;  4LVN P;  2D69 A;  3CPW R;  1JNR B;  2HAI A;  5THW A;  2WVB A;  5F8J A;  1F2G A;  3FSX A;  1YX2 A;  3EVW A;  3G2X A;  2AJ4 A;  2HFV A;  3MMB B;  4OZ1 A;  4R0J A;  2B43 A;  4RWX A;  3RBX A;  3RGI A;  2K7K A;  2ASJ A;  1NKC A;  2D41 A;  3U27 A;  1NCL A;  3M6U A;  4OFZ A;  2BJE A;  2C1E B;  5B0G A;  4KGV B;  5LJ5 Y;  2WVC A;  1XR5 A;  5HQL A;  1UVI A;  2UVR A;  4JI6 F;  2MLY A;  2X1G A;  2H54 B;  5IQ6 A;  3JSY A;  3BGF A;  5LMN F;  1R8H A;  3KK3 A;  3T5K A;  5IT9 U;  1U0S A;  1OYD A;  3D6T B;  4YR3 A;  5CZX A;  1L3K A;  2KTQ A;  3NGS A;  2VUG A;  1D3W A;  5H9F K;  1HMV B;  3UN2 A;  1T05 A;  4DV3 F;  1TAU A;  4Q43 A;  1RAF B;  2FVR A;  3V81 A;  2YH0 A;  4YB7 A;  3TA0 A;  2RIJ A;  4RW6 B;  1ZS6 A;  2ZJP Q;  4GVL A;  2B0G A;  3EM1 A;  4NCA A;  2YNH A;  3CED A;  1VS3 A;  2FYX A;  1FJC A;  2VQE F;  3FQK A;  5HRO A;  1TQL A;  2IVM A;  4C3L A;  1VBZ A;  4I7F A;  3T1Y J;  1VOM A;  2IRX A;  3C15 B;  1T9U A;  4UUW A;  4C8Z A;  3KLF B;  3I56 S;  2RQK A;  2XLJ A;  3V6H A;  1NJI T;  5HBM B;  1I1G A;  5LMU F;  3K0J A;  1IKY B;  3GSI A;  4F3M A;  3EIC A;  2HHS A;  4K0K F;  2HHW A;  1U2F A;  3TUI C;  3DRX A;  4TQS A;  4ECZ A;  5AXN A;  5GAH I;  2DR9 A;  1XWL A;  2DXF A;  2LYV A;  2OPQ B;  3I87 A;  1M5S A;  3I55 S;  2J7U A;  3SCJ E;  1X5O A;  3BGR B;  2L41 A;  3G6X A;  4J9S A;  1PIE A;  5F8N A;  3FUY A;  4P10 A;  4FYX B;  1NK7 A;  4ICL B;  5E3C A;  5D4N A;  4DQS A;  2VBX A;  4FPR A;  3I0S A;  5L9X A;  4ZHR A;  2MMY A;  4EFA C;  2V2Q A;  4TY8 A;  3OVA A;  1A0O B;  4IO9 Q;  4FBT A;  1UVJ A;  1CS4 A;  4NPO A;  1MG7 A;  1NPK A;  1U25 A;  2D3O R;  1S6U A;  1FD2 A;  4QZV B;  3D9B A;  2BZ2 A;  1XIQ A;  3HJF A;  1O8B A;  1DLO A;  2Y0B B;  3ZXW A;  4QCL A;  1RTI A;  4DXL A;  4F4K A;  3P45 B;  2VZ9 A;  4TU8 A;  2VG7 B;  1BC6 A;  3TO8 A;  1K44 A;  4WFA Q;  1DJ0 A;  4G1I A;  1RZM A;  2B6A A;  1IBL J;  1YGY A;  3DC2 A;  1VC5 A;  1GEH A;  1TK8 A;  2KXF A;  4CO4 A;  1N0U A;  1JLB B;  1DY3 A;  3FQL A;  4C11 A;  2HLT A;  5KFN A;  4DV1 J;  4BBY A;  1WF2 A;  4QU7 A;  1S12 A;  3TRG A;  1R31 A;  2HAF A;  1HWK A;  2RRB A;  2XG8 A;  2ZBP A;  5LM7 E;  2CNO B;  2L9N A;  1VQ5 S;  4C9D A;  2DCL A;  1HR0 J;  1B0T A;  3HVW A;  3VWS A;  4ZVR B;  1KQK A;  3ZZO A;  3GIJ A;  3EX7 B;  1AA1 B;  3FBB A;  4ZP9 A;  2XBP A;  3DM2 A;  4OZ2 A;  3S8S A;  1L3T A;  1GTH A;  1N54 B;  2Z4P A;  3I6P A;  3CJ2 A;  2Q43 A;  2QJ3 A;  1MML A;  3G86 A;  1NH8 A;  3N5B A;  2LA6 A;  3CT9 A;  1RTH B;  2LCW A;  3A8K A;  4O0N A;  3FZB A;  4Y3C A;  2HPU A;  2XGQ A;  4B3S F;  1WWH A;  2LU2 A;  3I9Z A;  3TUJ C;  1XNR F;  2NYH A;  1X5S A;  4X65 F;  1R8C A;  2DGU A;  4WXO A;  5DS7 A;  5B7W A;  1SKS A;  3CUL A;  4OZL A;  1EAR A;  3AXM A;  2QLJ B;  4HT7 A;  3PNI A;  3SQG B;  3OD2 A;  2MQN A;  4DV6 F;  1Z4U A;  2MQO A;  1NJY A;  3W9H A;  4I6Y A;  4P2X A;  2D9P A;  4ZOS A;  4ZCM A;  4K4T A;  2CJB A;  5ETO A;  2B7C B;  5KFT A;  3GFY A;  3FFI A;  3JQM A;  1HWL A;  2YBV A;  5CCL A;  2IRU A;  4IYQ A;  2J7K A;  4AD6 A;  5BYS A;  3OL7 A;  2K8G A;  3CJQ A;  5DET A;  2MKK A;  4ZP7 A;  3OLA A;  3QT8 A;  3BB5 A;  4TKT A;  1PGZ A;  1NUE A;  2CZV C;  1Q0N A;  5LSR A;  1RT2 A;  4EWT A;  2DVI A;  3IGN A;  2GAH C;  1T9Y A;  2R4F A;  1Q81 T; 
#chains in the Genus database with same CATH homology
 2BEF A;  1WKK A;  3FCW A;  4S0M A;  1JXV A;  3Q83 A;  3NGS A;  1UCN A;  1BUX A;  1LEO A;  1MN7 A;  3ZTS A;  1F6T A;  1ZS6 A;  4ANC A;  4AND A;  3EM1 A;  3Q89 A;  3EJM A;  2B8P A;  5IOL A;  3VGT A;  3VVT A;  3VGS A;  2DYA A;  3NGT A;  4WBF A;  4DUT A;  3PRV A;  3ETM A;  4CP5 A;  1WKL A;  4KPC A;  3ZTO A;  2VU5 A;  3EIC A;  3ELH A;  4F36 A;  3Q8U A;  2DXE A;  1HIY A;  2DXF A;  1BHN A;  1S59 A;  4ANE A;  4EK2 A;  4ENO A;  1WKJ A;  2BX6 A;  1NSQ A;  3FBE A;  3B54 A;  1F3F A;  2HUR A;  1PKU A;  3BH7 B;  1KDN A;  4FKY A;  3WX8 A;  3GP9 A;  1XQI A;  3ZTQ A;  4UOH A;  1PAE X;  3GPA A;  1B4S A;  1NHK L;  3EVO A;  3VGU A;  1NPK A;  4F4A A;  3VGV A;  3ZTR A;  1XIQ A;  1B99 A;  4DI6 A;  1EHW A;  1NDL A;  2DXD A;  3Q86 A;  1K44 A;  2NCK L;  1U8W A;  1NDK A;  3FC9 A;  1NDC A;  3PJ9 A;  3FBC A;  3NGU A;  2AZ1 A;  1NLK L;  2HVD A;  3JS9 A;  4UOG A;  2CWK A;  3BBF A;  3NGR A;  3DKD A;  3Q8V A;  4C6A A;  3BBC A;  3FBB A;  1LWX A;  5CAB A;  3EE3 A;  1W7W A;  3MPD A;  3FBF A;  5C7P A;  3ENA A;  3EMT A;  1HLW A;  1S57 A;  4O0N A;  5BXI A;  3VVU A;  3DDI A;  4DZ6 A;  1HHQ A;  2HVE A;  1MN9 A;  2DY9 A;  1NSK L;  1NSP A;  1S5Z A;  1NB2 A;  3BH6 B;  3R9L A;  3B6B A;  3Q8Y A;  1VYA A;  5CAA A;  4FKX A;  3BBB A;  4UOF A;  4W98 A;  4HR2 A;  1BE4 A;  3EVW A;  1NDP A;  3G2X A;  3L7U A;  3FCV A;  3FKB A;  1NUE A;  2ZUA A;  3EVM A;  2B8Q A;  1NCL A;  3ZTP A;  2AZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...