3EE3A

Crystal structure of acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
b'GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ee3A00
2BEFA 1VYAA 3GP9A 1BUXA 3Q8UA 3BH7B 2DY9A 3DKDA 3EM1A 3ETMA 3FKBA 3ENAA 4DI6A 4EK2A 2DXEA 1U8WA 3BBFA 3ELHA 3EMTA 3FBCA 1NPKA 1LEOA 4O0NA 1ZS6A 4ANCA 1NSQA 4UOGA 1LWXA 1BE4A 3VVTA 3R9LA 1B99A 3BBBA 3ZTQA 3BH6B 1NDPA 3FBBA 3FBFA 3MPDA 1UCNA 3PRVA 3Q83A 3VGUA 4F36A 4S0MA 2DXFA 4FKYA 4KPCA 3Q8VA 4F4AA 1K44A 1NSKL 3EJMA 5CAAA 2HVDA 4HR2A 4UOHA 1NSPA 4DZ6A 5C7PA 1NB2A 3VGVA 2DXDA 1PKUA 3L7UA 4ENOA 1S59A 2HURA 4UOFA 5CABA 3EICA 1WKLA 1HLWA 2BX6A 3ZTSA 1HIYA 1W7WA 1S5ZA 1JXVA 1XIQA 1KDNA 3ZTRA 2B8PA 1PAEX 1B4SA 3NGUA 1WKKA 4FKXA 2VU5A 3ZTOA 1XQIA 3ZTPA 3FCVA 3BBCA 3GPAA 3FC9A 3WX8A 1NDCA 2CWKA 3EVWA 3DDIA 3NGRA 1MN7A 3FCWA 1F6TA 1S57A 3EE3A 4WBFA 3VVUA 3PJ9A 3B6BA 1MN9A 2B8QA 3Q8YA 1NCLA 4W98A 2AZ3A 5BXIA 1NLKL 1BHNA 1NDLA 2NCKL 3NGTA 4ANEA 1EHWA 4CP5A 3EVOA 3Q86A 1WKJA 2AZ1A 3FBEA 3G2XA 3VGSA 1NUEA 2HVEA 3EVMA 5IOLA 4DUTA 3Q89A 3VGTA 2DYAA 3NGSA 1NHKL 1NDKA 3JS9A 1HHQA 3B54A 4C6AA 1F3FA 4ANDA 2ZUAA
chains in the Genus database with same CATH superfamily
3ZZ0A 3DI6B 2H51B 1U48A 3MR7A 2QGFB 3I31A 3UN5A 2OHDA 4ES2A 4YDXA 5CXTA 2ZJPQ 3Q8QB 4K5SA 3EZ5A 3VR1A 3TX0A 1FK9A 5ETVA 1NSKL 2BYCA 2V34A 4XO0A 4K50A 5A76A 2HW3A 3BGLA 2AJ4A 3JAMY 3OVBA 1VHFA 3RAQA 1S1UA 4PXDA 1N0UA 3MPWA 3QNWB 3MEDA 1RHRB 3N28A 3BYPA 1BQNA 1QE1A 1U09A 2D3O1 2FVCA 3V6KA 2ZH9A 3MAAA 3T5JA 3H5YA 1NRKA 4ZCMA 3A3PB 4CLUA 2DH9A 1RCXB 4CO0A 2OFHX 2RRBA 1S0OA 2BQ3A 2ZH5A 3RRHA 4DUTA 3VAIA 3OJUA 4NLDA 4A47A 1SKWA 2W01A 3CJ4A 5F3TA 1XK8A 3W2VB 2CJAA 2BOAA 1F5CA 1S7HA 3PTWA 2DGXA 2HFZA 2P9EA 4WKRA 3CSKA 1N36J 3CDEA 3Q8PB 2I2YA 4RL1A 3DLHA 2B43A 4ZOSA 4YHHJ 2SXLA 2LU1A 2KT5A 2F5GA 4QCLA 1WJ9A 3QAEA 3HHEA 1WUUA 1EZZB 2DHXA 1FWLA 3PM9A 1W7WA 1S5ZA 1SUQA 4TQRA 1RA7A 4XPEA 4K4VA 4ZMMA 1RBLA 3T1YF 4AL6A 1ZM4A 3N5BA 5ITHA 1P9YA 1IM4A 2IFXA 1I6JA 3UN3A 3KNAA 2F40A 3RAXA 1TV6A 3JTNA 2HK3A 4ED7A 1TMMA 4NYPA 4WU3A 5IT4A 1N5SA 1XMQF 2MLXA 1T0TV 1RT4A 3I87A 4M5IA 4ZP8A 2OMOA 5E3AA 3J7Z5 3POTA 4OI6A 1REVA 4ZVEA 2FLPA 3IR6B 4LF6F 4RNFA 2WAQD 1OY8A 3B4MA 1AUSL 3PJWA 3RYLA 1NSQA 1VDHA 2YWFA 3QSIA 4OYIA 3HM9A 2HRUA 3ZZZA 3BF4A 3WBZA 3IS9A 3DGVA 3KDOA 3TI0A 2B7BB 4UUXA 1DY3A 2B5JB 5A2QY 3KDNA 3QJPA 2VG7A 2MQQA 3NS7B 2D1CA 5A0YA 1ZZNA 1H7WA 2N4CA 3IR7B 3N01A 3PCOB 4DL6A 4DV7F 4OMFG 1RKJA 2EBEA 2F8HA 3NNCA 3N0VA 1KC8T 2YNFB 4MKVA 4IFVA 3OTBA 3NCRA 2DEJA 1TELA 3FEXB 4DSIA 3EGWB 1AZSB 3FC9A 2CWKA 4TXSA 5ADZA 4DR1F 3KLFA 2UXBJ 4AT1B 5AXKA 1M5OC 1SV5A 1YJUA 3KK2A 5B0CA 4XIUA 1S10A 4DV1F 2E29A 2YPYA 3LAMA 1APSA 2B6AA 2DYAA 4B9MA 4B08A 2MLZA 3DDNA 3VAJA 4OZ2A 1LXNA 1RT5B 3OVSA 1OQ3A 2ALYB 5IQ6A 5DLFA 2MQ8A 4R0JA 4ID5B 4GC6A 2ZWPA 4LFAF 5JUMA 4OL8A 1IUJA 3JQKA 4UZCA 3BEGB 2LP4A 3N4WA 5LJ3Y 1RHQB 2BE2B 2Y8YA 2RD5C 4F4WA 3RG6A 1WELA 2YKNB 5EWFA 2BJ7A 3Q8VA 2PIIA 1BQMA 1K9MT 4TYAA 5F9LA 2E7WA 3UO0A 3KOAA 3PW5A 3WDOA 2VB6A 4U7CA 3B82A 1B7FA 5IZHA 4RUAA 3SCKE 5K14A 3M2VA 2P6TA 1UVJA 4EZ9A 3OR1A 3IC1A 3IXQA 1Q95G 2PI5A 3AJ1A 4ED2A 4I67A 2PFDA 3FZ2A 2W9AA 4P7TA 2FY1A 4LQ9A 4LF5J 1FFWB 2BM0A 1C0UB 5J1NA 2HBRB 4X64F 4OI1A 2GAGC 1QAIA 2UVUA 1FD2A 2XMUA 4V1Ak 4UW2A 5GMDA 2VHGA 1AYEA 1YRTA 2Y1IA 1HHQA 4J9MA 5HMYA 4F0MA 5HK4A 4DQRA 5SUHA 1C1CB 2DGWA 2MKCA 2J0WA 2CQPA 5KFVA 3ZTQA 1TL7A 1JLGA 2J5AA 3NWRA 2MEWA 3OTOF 4RU9A 1NK5A 2HVZA 2LQ5A 3UDCA 2O5DA 1M90T 4J9PA 4RNNA 4HKQA 4DR2J 4FP9A 2JHEA 1LW0B 2E9TA 4OV6A 4F0KA 1VRUA 3IM8A 5HP1B 1PO6A 3ILLA 4ETZA 2VOPA 3SXLA 3HLUA 1C0TA 1U0HB 5D78A 3MUMP 2MDAA 2EKYA 3D1HA 3QFHA 2N3OA 2B8QA 2HZAA 4RUCA 3H25A 4ELUA 1Q5VA 3HX9A 2R3VA 4IG0B 3MR6A 1VLYA 2W8LA 5GAGI 5LMUF 4XTTA 2HHUA 2MQNA 1VK8A 3SDEB 1C4CA 2BANA 3HDSA 2XMAA 2RJZA 2UU9F 3DYAA 4P7VA 4EWTA 2C3PA 1CS4B 3CD7A 4W4MA 2KHCA 2JEIA 1FXRA 3EMTA 4URGA 4UOGA 1R43A 1SXLA 3RBDA 1BWEA 5D4NA 4B9SA 3W62A 4F36A 4C8LA 5ETTA 3GV8B 4FS2A 1UP1A 3K5MA 4NRUA 1WTBA 4X65J 1FFGB 2J8SA 4RX6A 1PJ6A 1TK0A 3LAKA 3H2VE 1VI7A 2B9YA 2VJUA 1K47A 4QR0A 2AF6A 4KGMA 4YOEA 4F02A 1RT3A 1KFDA 1MROB 3LQVA 1U7LA 1U8SA 3KLIA 1ZBTA 2F65A 4YY3J 1NPPA 4R8UA 1W2BR 2FHMA 4M5JA 1H3DA 4Y00A 2CZ9A 2YX1A 4N8NA 3R7NB 2Q66A 1RAJA 3VCDA 2B4PA 3HD2A 3DLBA 1S9GB 2OEJA 5GADU 1IKYB 2ALZA 2DEIA 2FVPA 2C2DA 4HT5A 2VC1A 4FYDA 4DL2A 3EWGA 4DG1A 2GS8A 1MSWD 2PA8D 1S6UA 2P9CA 2RHQB 5CQGA 1YRUA 2MSTA 2YKQA 2VQEF 4IKAA 5J2MA 5I4MA 2VBXA 4DL3A 4H4OA 2ZDOA 4CT8A 1HPZB 5HJYA 4E98A 1HLWA 4ZITA 4MK8A 4ZVUB 4UZBA 2DCUB 1RYSA 2XHCA 3NGUA 2ZJQQ 4CRJA 1NXIA 5HVHA 3A8IA 2AJ1A 3JXOA 5M2RA 1UZDA 4DQSA 1J5OA 3CCVS 2XBPA 1NZ8A 2A1BA 1EP4A 4B3MF 5KG2A 1X4GA 2GC8A 2Z2MA 1NK0A 3N6MA 1WG5A 2HFUA 4B9VA 3GP9A 2FHJA 2QLJB 1TKTB 2YWEA 3D67A 1EARA 4AXJA 4KO0B 4N76A 2KXHA 2V8VA 3EZUA 5CHCB 5BR8F 2UV8A 3M8QA 2QO3A 2NYIA 3W5YA 3MF5A 3CJSA 3ET6A 3FEYB 2KJWA 2F4VJ 3HHLD 3LP1B 2GGPB 1LOUA 1D8ZA 2CRLA 4Q2LA 1NSAA 5CABA 1FHTA 3C14B 2VG5B 2GVZB 2C3UA 2DNOA 3W9JA 1WD6A 2E1CA 1SH0A 2PMHA 3BDPA 4ZPCA 2PE8A 3VWSA 1DURA 2XSJB 2BKPA 2XYHB 3AOAA 4ZVFA 3OD2A 3SSQA 2IYGA 2UUWA 2AGPA 3NBPA 3O6QA 1IQTA 3TEGA 2DD8S 2E5HA 3BN7A 5C25A 1ZM9A 4USVA 4LR9A 1DQ9A 3AXKA 4ED6A 2OMLA 1S6OA 1KHWA 3P49B 5KFBA 3DRPA 1ZZFA 4DR7J 4IH7A 3CJKA 3LP2A 1MU2B 1N52B 1RT1A 3M8PA 4YEAA 3H20A 2MXYA 2AKWB 2KXFA 3SSSA 4Q0BB 4B02A 3DMJA 5KFJA 4WF9Q 3MI7X 2IBOA 4RPFA 4DL7A 4K4SA 3T5LA 5D8HB 3AA9A 1A7GE 3NL0A 2VQFJ 1X60A 1BY9A 1FJGJ 1YSJA 2R7WA 1RE1B 4AXIA 2FJVA 3CEDA 1KQGB 2G1DA 2DGTA 2A18A 3EVOA 5EN1A 4I6AA 1N6QB 2LQ8A 1PG5B 1VQNS 3I0SB 1YQHA 5H9EJ 4FVCA 2R7QA 1SC3B 4QR2A 4JI1J 2NXEA 1FI4A 2LLZA 1A9NB 2PI4A 1HBUA 3T5HA 2CJQA 2DR9A 3PFEA 4O0NA 2O66A 1Q8LA 5M2PA 4DV3F 2W9CA 3HVAA 4IDKA 1HHTP 2RNEA 1HL6A 1WC5A 3TVKA 5BYSA 1TQLA 3N6NA 1OJ4A 5F3ZA 4I7FA 4X2BA 2CVIA 4KGZB 5K8PA 1T9TA 1S59A 1PC4A 2IHR1 1WKLA 2DR6A 5KFWA 2GHVC 3R7BB 3IRXB 1L3VA 2J76E 2ZNZA 2ADBA 3OPKA 1TMJA 2HVIA 1Y0HA 5DM6Q 3NCPA 1XMOF 2CQGA 1SQGA 4YB5A 1YJWS 4XAKA 2Y1LB 3QLHA 5FD1A 3HHNB 2LQ9A 1S7IA 1PIEA 3SI8A 3G8TA 2FLNA 5LXRA 3K5NA 4HDGA 5K8OA 4OZ0A 4KGKA 4EI2A 4QBUA 3BH7B 3DM2A 2A10A 3ZZUA 2DGSA 2FVQA 1CLFA 1PGZA 2GQQA 2OPPB 1WWHA 4DV6J 4JI2J 4NCGA 1CC7A 4LFBF 3H7HB 3CCWA 2LDYA 2P5VA 4DZDA 2G13A 3D68A 3MPYA 2HQGA 5KFAA 4CM0A 3DRYA 2E9ZA 2PMWA 5MLCV 4OYPA 3BSCA 2V2VA 1WOOA 1HR0J 4H4MB 1N8RT 4HTIA 1NB7A 2ZKTA 3GFHA 4F8RA 4PQUA 3W9HA 4K59A 4BLGA 1NLKL 3S01A 5HATA 2VASA 2J9DA 4P2XA 1W2IA 4K0KF 2XY6A 2V9WA 2KXNB 3M9OB 3KK1A 1HWLA 1GMUA 1RTHA 4WK1A 5EWGA 1RWXB 2NPFA 3EX7B 3V6HA 4LSLA 3MURP 2QSWA 3EM1A 4QWEA 1UZHA 5DGBA 3DRSB 1V6HA 4P71A 3DI6A 2LEBA 3DOLA 2HHXA 2FJDB 2FPHX 2YKAA 1TL3A 2E44A 3PEHA 3OV7A 1M0SA 4J9RA 4D3GA 4L3NA 2V2QA 3BGUA 2N4DA 1RAAB 4U7UD 1U1PA 4WKYA 1UWBA 3ZZPA 1F9HA 1YWXA 2HS4A 3GYNA 3GFZA 3A1YG 1NK7A 4OJHA 3MM8B 3BO3A 3KLHA 3J7ZT 3PIPQ 3K2YA 1HYSB 4O4GA 3QFWA 2EVZA 2FY8A 4LF1A 1M5VC 4ERDA 4EEYA 5B08A 1UEUA 2OJ3A 2D41A 1FDAA 1NK8A 5KG7A 2OPQB 4JI7F 2ZUAA 3GZ7A 3S8SA 4J9OA 4FS1A 1RI7A 2P2CB 3BBFA 1R8AA 3L7PA 4DX7A 1B99A 2XHWA 2H5IB 4V19X 2CQHA 2HQCA 1V5VA 3P4UB 3EGZA 3R5GA 1UETA 1HNIB 1KVKA 1U4BA 1KONA 1GEHA 1CJUA 3IBCB 4A4JA 3R27A 2D3UA 4Y2KA 4LSNA 1S97A 1NKCA 4P52A 2VKZG 3S7RA 5EX3A 3VF0B 2JZ5A 3D2WA 5LXYA 3UE2A 3FSYA 2OPSA 2M8DB 4Y65A 2MTLA 1T05A 5EX0A 4A8MP 3K5PA 2WOMB 1J2VA 4TNOA 2QLXA 2ZITA 3DOKB 3ONQA 2GO9A 1ZA2B 3HZEA 4JI3F 5GADI 4DSLA 2PFFB 4ED4A 3HVWA 4ZCLA 5A8KB 1RHKB 1X5SA 4PAAA 4USHA 4DV4F 3GFXA 3W64A 1CEZA 1BQXA 1KTQA 1WHVA 1M5KC 2LXUA 5D4LA 4Q44A 1B0PA 2B5JA 5C7PA 4GO5X 3UFCX 2E1AA 1RAHB 4DV0J 1YK9A 4ZCKA 3HF5A 4UY85 4A8XA 1XNQF 2L3MA 4DFMA 2OEMA 5IV4A 2CPHA 4DR5J 4U9RA 2W9BB 1FRKA 3KHGA 4K8RA 4USTA 4WP9A 4G1QA 5IC4B 1Q1KA 2JEJA 1MN9A 1VBKA 1REGX 1TL5A 1FKPA 3C46A 2HHHF 2PEBA 2QIFA 3CC4S 2OO4A 3OL9A 1FKOA 3HMJG 1EB0A 1RCOB 2RAQA 1FRHA 3E01A 4XK8C 3TA1A 3ZFVA 4CWBA 1U45A 4X4VA 2BXJA 4C98A 4MYTA 4DPUA 3BGRA 2Y0BB 2Z2ZA 1K8AT 4L72B 1UFLA 4F4YA 3VQTA 4ID5A 1X4BA 5DG8A 3VVTA 2WB1D 4DV5F 3KHRA 2COLA 3D1OA 4TKTA 2BE2A 1TKXB 5JMNA 3K8WA 3KUGA 2C2RA 3UD4P 4F25A 1IKXA 3SV3A 2WSEC 3A8EA 4ZPVR 2ZBIA 3PRDA 1T11A 1NH7A 4ZPWR 4X4PA 4QZVB 1XNRJ 1G6BA 5J2NA 2ZHBA 4JYAJ 2HNZA 3TYTA 1MW7A 3J80U 3D4JA 4UOCA 5LOQA 4ELVA 2FUG9 1R0AB 4CO5A 2X7IA 5ETQA 4W98A 2XO6A 4AL7A 2R7VA 3M32B 1IM6A 3VQSA 4IR1A 2IMWP 2ZM6J 1C0UA 2H5JB 2VJVA 1IWGA 2JOQA 3CD6S 2AIRB 1RLCL 4AL5A 2POKA 2CQ4A 2HBZB 1R8PA 3T6JA 2B9EA 5DDPC 1HNWF 5KFYA 3SQGB 4USIA 2BACA 1O6XA 3CUNA 4DCOB 1LW2B 3TR5A 1SJ4P 4DR4J 3SZ2A 2LVWA 1ITPA 3W2WB 1KQSR 1SJQA 1Q5YA 1GTHA 3IBWA 1HHSA 4RWWA 2APOA 3I4HX 1FJCA 1ZM2A 2DNNA 2ZD1B 3T6BA 4J91A 2KT3A 5C42A 2EKNA 1N34F 3RB3A 3QO9B 2AV5A 1U0HA 4C8ZA 1E6YB 4XDCA 3BKTA 2QC3A 1BLUA 4DQIA 1WEZA 2EFPA 2C42A 1HWIA 3ISND 1HKAA 4IG0A 4C8MA 5HLFA 4K5RA 1FRIA 3UCZP 3RBEA 1SH3A 5IQQA 4ZVHA 1RWWB 4NLXA 1QD1A 1CS4A 1R6YA 3AQOA 2ILZA 3VALA 2HS3A 3MEDB 3M6VA 2GHWA 2RVJA 2W24A 1BQNB 1JKHA 1HNXJ 3SQOP 1ZPVA 4WTOB 1QE1B 1WSVA 1TU0B 3G96A 4CTAB 2QX0A 2W4DA 2ZVIA 2K06A 3PVXA 3FMWA 2HVDA 5KG6A 2UXCF 2HVHA 3MAAB 3C8YA 1UEKA 2AEJA 2B4OA 4AD6A 4U8YA 2FDNA 5LSLA 4NCAA 2B8PA 4U6PA 1VQ6S 1XTZA 1LWEA 4LVOP 1FX4A 1HQ2A 2V2ZA 2ZC4A 1QSLA 3GMGA 4QWDA 4PUOB 1VHIA 2HAFA 2J0XA 3EUNA 5CCLA 1AFJA 1RAGB 4HL9A 2AJQA 4D3HA 2B9WA 2VKRA 4ZVPB 5D0HA 1TK5A 2DNGA 3K7RA 2AYEA 1QTNB 4RO0A 1UJ6A 2FGOA 4RBVA 3HFVA 1IN0A 2GIQA 1NHKL 2XS5A 5GMKa 1RWVB 3OXGA 1SJ1A 4DR6J 5BYRA 5HVFA 3CDWA 4B3TF 4LF9J 3KHHA 2Z4PA 3RB6A 1MWZA 3UWTA 1SUQB 3WZ0A 2ZEJA 2DNZA 4XPCA 3A4TA 1IKYA 2KVQE 2D7SA 1W26A 2KB2A 2XG8A 3TJAA 3GONA 1C4AA 2DBBA 5A6PA 3VTIA 3CW2C 4H54A 4KE5A 1YRXA 3CDUA 3H4DA 1TV6B 2DNYA 3RZAA 2DHSA 1OPIA 1LFPA 1S6QB 3PV8A 2R8HA 4YFUA 1WNEA 4UTGA 4ED8A 4M5LA 3POTB 1R27B 1PSDA 1GFWB 4HH1A 2ZBQA 1REVB 2HHQA 3K89A 1BD6A 1RK8A 3OFGA 2NZ4A 3PHEA 3EXYA 5LMNJ 2H65B 1JK9B 4QPXA 3PO5A 4QW8A 4HT7A 3TJ8A 2A6OA 2ZKUA 4I69A 2L48A 4C0OC 3NGSA 2FTRA 4CH7A 1HNVA 3B78A 2VG7B 3R7SB 5A0YB 2RUGA 1U26A 3GG0A 1FWPA 4NA2A 2FJBB 1F2HA 4USMA 3NAIA 4IOAQ 5IWAF 4B9NA 1XR7A 5ETPA 1KLMA 3NRBA 1TKZB 2HBQB 3MEGA 2CG8A 2JJ4D 8ATCB 3KLFB 2L9DA 2DITA 1X8DA 4UF4A 3R8YA 4ITSA 3HT3A 4OHXA 2VA2A 1SV5B 2JDJA 1UL3A 5E3CA 3KK2B 3PZPA 2QZ8A 2GGPA 4QWBA 1RAFB 2W2PP 4F2SA 3GJSB 4Y28C 4B3OA 1XERA 4K4XA 1RACB 5LT5A 4YHHF 2DCLA 5KFLA 1SKUB 3LA0A 5F8MA 2QL5B 3BQ1A 4OZLA 1N56A 4CLPA 2YWKA 3TA2A 1CBKA 2ZDPA 1YJVA 4FYWB 2GJIA 3D3BJ 4O3OA 1N0VC 1F2GA 1U1OA 4JI8J 2GV1A 2XEXA 4LF2A 5KFIA 3C6TA 5K20B 4ZN3A 1HNZJ 1UVMA 1QAXA 2EFNA 4OYOA 1NAQA 3DLKA 3IFEA 3CJ3A 4I0WA 1SPBP 2H3EB 4J9LA 2C3OA 2IAJA 2P8IA 4HI1A 2UZAA 3M8YA 5HI7A 3M2VB 1MU2A 3LPEA 4OV1A 1P1TA 3IAM9 2BW2A 3OXLA 3O8WA 4I2PB 1R3NA 5L1JA 2M2BA 1U47A 2HURA 1J5EJ 4K4UA 1H73A 1RWUA 3OUYA 3LW5C 1NJZA 2KHDA 2DR8A 1ZAXA 2MMYA 3BR9A 3RBZA 3AY0A 3GPAA 1HMVB 4O3NA 1LV5A 4LFCF 1TUWA 1R8CA 2AZ3A 2V2KA 3ILJA 4K4TA 1H74A 4ECYA 3QATA 2OI2A 1JLGB 3Q8SB 2VDIA 4NL5A 2HMIA 4ZHRA 2UXBF 5F41A 4GVBB 3I0SA 2GIFA 3UCGA 1Z2LA 3MR3A 3M6WA 4YR2A 1VRUB 2CKWA 3I9V9 3BBBA 1C0TB 2CDRB 2FD2A 2KFYA 1N5YA 3QBCA 4F7VA 4ATNA 2GMHA 5IM0A 4V19J 2FC8A 3KYLA 3IG1A 1JIHA 1G2EA 2V6AA 2Q6CA 4DU7A 4WU2A 3IRXA 3RTVA 1YZ7A 4NYOA 3DYAB 1OSDA 3BBCA 1ULRA 3IO1A 1F6TA 1UKUA 4PQAA 2G0IA 3KK3B 1T03A 2WW8A 2XI3A 3HKWA 3T3FA 2VDHA 1UJ5A 4DPTA 1FTCA 1U1MA 2WBRA 2R8JA 1VJQA 4YB7A 2QG9B 1VK3A 4ZLLA 4OYZA 4LF5F 3M8ZA 3BV8A 3R6GB 3QGIA 4I1TA 4ECQA 2I1RA 2XMTA 4ECZA 4DSFA 2YKMA 1WF0A 3W63A 3CB4A 4HLBA 4X66J 4S0MA 1IBKJ 2CWXA 2R2RA 1K1SA 1XC9A 4IFYA 2V0NA 4R8UB 4RW4A 2BDPA 4DN9A 1Q82T 3HHKA 3TP2A 3ILIA 8RUCA 1MWYA 3J7YU 3KXDA 3H42A 3GB0A 1FJEB 4DXLA 3ZTOA 4LF8F 4Y2MA 3HSJA 1Y5NB 1S57A 3V4MA 4J9SA 4P72A 5AJ3J 4DR2F 2VICA 2ZH3A 3DDKA 2KG1A 4NZ6A 4DG1B 4RNMA 4MT1A 3C15A 1JWWA 2AW0A 3CDAA 1D9DA 2CJYB 3TVZA 3K5OA 2MY8A 5J2MB 3LO3A 1JJHA 3OJSA 3I5AA 4H4OB 1RGVA 1YBAA 1N54B 2FZGB 1O51A 4N41A 2AU0A 2BA9A 3BGOP 1A0OB 2LDIA 2XCPA 1KNZA 1U25A 2OSRA 3MECB 4QIEA 3DRSA 4ZPDA 3HCXA 4WXWA 2W2OP 4C7QA 2BRKA 2YXLA 5D6GA 3PG9A 2JH3A 5KFQA 4NLGA 1RT6A 2F7VA 2Z2YB 1J5OB 4RW9B 2YWHA 4CLZA 5DRKA 1EP4B 3Q0AA 3KG4A 1B0TA 1WDTA 4OJ3A 1P9QC 2AP6A 2Z58B 3N6LA 5LL6d 3TW0A 4DR1J 3M6UA 2XMWA 3RU0A 4CIOA 1KRPA 2CJXB 4X65F 3NMAA 1OYEA 5E41A 4DUZF 1EAYC 1NKBA 3M8QB 3G6YA 3ET6B 4NMLA 1FWKA 1I1GA 3CO9A 4URQU 1BUXA 4GC7A 1RQ0A 5HSPA 5J1EA 4JV0A 4YY3F 4QW9A 2NXNA 4EO8A 2O01C 2JLFA 3Q2TC 1T8EA 3GTYX 4UY8T 5D77A 5KT6A 3AHPA 1IKWA 4K7QA 3ICLA 1ZYQA 1AFIA 4A8WA 1Q0NA 2RQKA 4ZVTB 1X4FA 2ACMA 3DLJA 3IGVA 4MJKA 2EK6A 4BC7A 2GJ2A 3NBPB 2BX6A 4C8KA 2CPFA 1SH2A 3P3DA 5C25B 3DRPB 5BYQA 2IVFB 2C1EB 4X64J 3CJKB 2F9JA 5BXIA 3KUEA 4F4KA 4NZ7A 2D3ZA 2E5JA 2HNYA 3LP2B 1RT1B 5KFNA 4DFKA 2EEYA 1CULA 4GO7X 2R8GA 3KLEA 2W25A 2WOMA 2KRBA 2VL1A 3LWMA 2UXDJ 3PY8A 2HZCA 3ENVA 5KFDA 1IWAA 1Q79A 3OBIA 2VZ9A 5T7LA 4USKA 1N5TA 1OPZA 3ELHA 4F26A 5D15A 5KG5A 4RW6A 2DR5A 2VFSA 1X4AA 3MPDA 4IRDA 2YWGA 3BPDA 1V5IB 3TUPA 1TUGB 2IDEA 2MHNA 3JTOA 5ETRA 2ZBRA 1S1TB 3ZC4A 1Y5LB 2MKSA 3ZTSA 1LWCA 4C11A 1JXVA 3CJ2A 1JXEA 1ZAWA 2WK4A 3RJMB 3P6YC 2CQ2A 2MY7A 3RGIA 3E51A 4WIQA 2YNHB 1TKDA 5IS2A 4WFYA 2F4VF 1VCTA 2XS7A 4DDFA 2R2TA 2W9BA 1S1VA 5E3PA 3U1MA 4KSEB 1UPMB 4Q45A 3NGTA 5LMUJ 1E6VA 2W9CB 1R0CB 2KDOA 1TZ0A 1OS5A 1H2UX 4GVLA 4HYKA 2UU9J 5HO4A 4I7FB 2DY1A 3CCTA 2LMIA 1T7PA 1TL4A 3EXCX 4LRBA 5L9XA 1VRQC 2BQUA 2AQ4A 2DISA 4ZLNA 3LANA 1UVNA 3DLLQ 4ICLA 5KAKA 2VFRA 2AJFE 2IVMA 5GMEA 1KD1T 2Y3YA 1FXDA 1LWXA 2NLWA 4P10A 2VPZB 4HDHA 5T41A 3CCZA 4ZPBA 4I6YA 4C8YA 9ATCB 4NLWA 4CO1A 4WYWA 1U1KA 3PKMA 1AUDA 1S77D 3CJTA 3MMAB 3QLHB 5D3GB 2MB0B 5H1SV 1P8GA 4CH1A 2XYGB 1BC6A 4KT0C 3FRZA 3OXFA 5HJXA 5SZTA 4BWJA 4WE1A 4A8SA 4MIBA 1KQFB 1RDRA 2XMVA 3DM2B 1X31C 4JV2A 4MKBA 4DR3J 1R0AA 1XJWB 3UNYA 3TQ1A 1SL0A 5D0RA 2AZ1A 4FZVA 4LRFA 2VQFF 4LF4J 3MM7B 2VPWB 1NZAA 3GYXB 1D8YA 4NCGB 2G0CA 4C6AA 1KLNA 4ANDA 4O3SA 2ABYA 1H38A 1WTFA 1Y00A 5KFEA 1R7IA 3QZ8A 4DUYJ 4O3PA 2W4PA 1JJCB 2DIUA 3C19A 5AE2A 3ZZOA 1XN9A 4R25A 1HQEB 2VQEJ 2AX0A 1P1LA 3CJQA 4W90B 1CVJA 3OSPA 4PQUB 1EJ7L 2KFNA 2BJEA 2NSCA 3AB4B 3OW2R 1SB6A 2OPRA 4JOUA 3KK1B 1RTHB 2OEKA 4JUZA 4GKKF 2M88A 2VG6A 4OX8A 4LSLB 2ILYA 4YB1P 4IQXA 4ES1A 2NXCA 4F4ZA 4U96A 3QO9A 3DOLB 3GSIA 4G1PA 4M63A 3HZGA 4OJ1A 1E6YA 1N33J 4PG8A 4QYRA 1NDKA 1TL3B 1Y4ZB 3THVA 4F3MA 4C4WA 3CJ0A 4CO3A 3RAMA 5KFTA 2ZJRQ 1UWBB 3UDEA 1KSPA 2LEPA 3MEEA 2ASYA 1MNEA 2A3JA 2XMMA 1KKHA 3KLHB 2U2FA 5GAHU 1WDDA 3QAUA 2YKPA 4C0BA 4O4GB 3H0PA 2BABA 1R31A 4CTAA 4I68A 1WORA 3PYGA 3GJRB 4LBHA 3SMZA 3NG8A 1DAXA 4WFZA 4DPYA 2N7CA 1VQOS 2J6TA 2XLJA 3DHXA 4DV6F 4JI2F 2I9SA 4U95A 3ADAC 1YGYA 3FVYA 5IT9U 3R2CJ 3LTOA 4AQYJ 3IWNC 1JLBA 4X4TA 1WOSA 3HPOA 1UVLA 4PUOA 4TLQA 3J81j 4KHRA 1FT8A 2JL9A 1QY7A 3M2UA 3G2XA 1YKWA 4PZVA 1UVKA 1HR0F 2ZZTA 2JX2A 4WFAQ 4KQZA 7FD1A 1NJIT 2V63A 3CO0P 2Q79A 1CJUB 1PYSB 5KFSA 1RWOB 4ZK7M 3MOJB 1DTQB 3NNHA 4LSNB 4MH8A 3CCRS 3A12A 3M6XA 4C8NA 1Y5IB 5KFMA 2OPSB 4P9SA 2GAHC 4K4ZA 2DXDA 2KM8C 1T05B 3L7UA 3FJ2A 3HSGA 2JC0A 2J7KA 1VQPS 3ZNJ1 3EYZA 3AB2B 3J7YI 1L3KA 3MR2A 4EZ6A 2YNIA 2DNRA 3OVAA 3LGNA 3TZZA 3RW7A 1WI6A 1S6QA 5H9FK 2ZC3A 4NXNF 1DLOA 2WW4A 2HQFA 1VGYA 1B70B 5ETKA 1IBCB 2JVOA 5F9NA 2HEKA 2AHOB 3WIUA 2HBYB 2HHPA 2HAIA 2LYVA 3H90A 2RRNA 3OFEA 3J80Y 2JLEA 3I55S 4X62J 1RWNB 2GIRA 3PXGa 2QL9B 3IBFB 5KG4A 1WHWA 1IR2A 4ER8A 2HRYA 4J90A 1ZA1B 1HBOA 2MZSA 3AAWB 3DKDA 2EWHA 2LEAA 3A13A 4YQWA 1NPKA 1Z2ZA 2CQBA 2ROEA 4IUFA 3D66A 1T94A 4Q8FA 3R5DA 4B17A 2CPEA 1YDLA 1RB0A 2RUSA 2IYIA 1TKZA 3FDSA 4G1QB 2EG2A 1K44A 3A8JA 5LM7E 3W66A 4GKJF 1B0VA 3L9ZA 2B4UA 1FKPB 3EICA 1YJRA 4OZJA 8AT1B 4B9UA 3JSMB 4ZP6A 5J1PA 1FKOB 2WVEA 3V81A 4F3QA 1XMOJ 3E01B 4KAIA 2PGCA 4B3RF 3K17A 3NGDA 5J2PB 4OHVA 3R1HA 1L3UA 3LOUA 1BXNA 3W61A 3GJQB 4WTYA 1B64A 3BGRB 2EFOA 3D5MA 2X1FA 4X84A 4Y0FA 6FD1A 5EGYA 1H7XA 2CNOB 4LRDA 4QPTA 2MYFA 4OX6A 1SVDA 5KFCA 4BHQA 1HI8A 1IKXB 1WF2A 3KJNB 2MLYA 1QAYA 3OFHA 3PACA 5J2NB 2EXUA 2JLGA 2HNZB 2HHSA 3PNIA 2HIQA 5H9EK 2B0GA 1PBAA 3OL6A 3NXZA 2AYMA 1HBNA 4K2XA 1UVIA 4FKYA 4G6VB 2B3TB 1U1LA 4OI4A 3GIKA 1M1KT 4ETXA 3FEZA 1RT2A 2PC6A 2QA1A 4OI0A 4CNYA 2QJ3A 2ZH7A 4I2PA 4K4WA 2AD9A 2DR7A 1X4DA 2ASLA 4JP8A 4ZCIA 2FIUA 2R8KA 3MD3A 4Q2MA 2ZFHA 1AXQA 3C2PA 2BJ1A 1PBUA 4CLTA 4L3KA 2H9ZA 1HMVA 4DV0F 2J7WA 4CCHA 3W8PA 3SCIE 1X9SA 2JEFA 1DQ8A 4O4RA 3VZIA 3SV4A 1N32J 3F56A 2DGOA 3MOZA 3VZHA 4C3LA 5LSOA 3V5RA 1H6KX 4Q7AA 1I5OB 1SJFA 1VQMS 3FCHA 1UWAA 4JV1A 1TFWA 4DEZA 4GVBA 3T1AA 1FVSA 1IQZA 4IRKA 2ROPA 4Q43A 3QZ7A 1TFYA 5C42B 4Z7CA 1CJKA 1NK4A 2HWTA 1RWMB 3GR0A 1QJHA 4MTPA 3DCAA 1RAOA 1ZH5A 4PWDB 3D6FB 4ENOA 3PYEA 3IWXA 1VQ7S 3QIPA 4FYYB 1KFSA 1HBMA 3UR0A 1VC5A 5HLFB 4NXMJ 3ZTPA 4DMZA 1VRTB 1U0SA 3M8WA 1FEHA 4C8OA 3OL8A 4M5MA 3GJTB 3I5CA 3G9CA 3O2IA 1I94J 3KK3A 2WVBA 4FF1A 4ID8A 3V4IB 2HHTA 1JKHB 4JYAF 5KFHA 2LQJA 4URSA 2GNKA 1GXTA 1URRA 2R7OA 4PWUA 3G8SA 5ETLA 1VR6A 4OZ1A 2BKOA 3GLJA 1T9YA 5FDLA 2UUTA 4TU7A 2VONA 4NMXA 1U6ZA 2DXEA 1X9WA 2DH8A 2YY3A 2ZOGA 2RKIB 1KS2A 1GMWA 1FJ7A 1LWEB 1IBLJ 2AYGA 2AWZA 1QVFR 1R6VA 4KTQA 1SIWB 2RHSB 3VHQA 2H4YB 4A46A 3OLBA 3JYTB 4OLOA 2WSFC 3O3LA 2RQCA 3DU5A 3THPA 2DTJA 1RU1A 2XM3A 2YVSA 4IOCQ 4NX9A 2QA4S 4JI0J 4DR4F 1DQAA 3PR4A 4KHMA 3HULA 3T41A 2EI5A 3H40A 4X4RA 3AH6A 1ZTWA 3K59A 4N56A 1RXOB 4DJBA 2CQ3A 1FE4A 2VPXB 4NA3A 2ZH6A 4KBIA 4LMZA 3CD0A 4DQPA 2JFKA 5CYMB 4MAKA 2CXEA 1MG7A 4EK2A 2CG4A 2BW7A 2GX8A 4ANCA 3ITHA 1X7VA 1JB0C 5AT1B 4E0DA 3RRKA 2N82B 1Q16B 1DTTA 1U24A 4MFBA 3MECA 4JV5J 3K0JA 5J2QB 1CC8A 1KVJA 4KV8A 3PKYA 2XC9A 2CA9A 3G6VA 3TX8A 1KVIA 2OFGX 1HNXF 1UPPA 3CE8A 4RW9A 3OSNA 4EBDA 4LF7J 4KGXB 1YLXA 1HNVB 4J9VA 3LPYA 1SL2A 1LK5A 4M5DB 1H2TZ 2MPUA 3OR2A 3G4SS 4R5PA 3E3XA 1YG0A 2EK1A 1NHVA 3MTJA 1EX8A 3I96A 3CULA 1KLMB 3AODA 4ES3A 1HI1A 3TVYA 2FQQB 2QA4G 3L09A 1YBTA 3MEGB 3F73A 4QU7A 2R7UA 4ZKAA 2KYZA 3W5XA 1VIOA 2Q3PA 1VQKS 4UUWA 4BBYA 3UW1A 3W1YC 4ED3A 2XULA 4B3OB 3L7OA 3NGKA 2Z2LA 1JMTA 4USUA 3TQEA 2DO0A 4KY3A 5GAHI 2YBVA 2IA6A 2V5HG 1ZETA 5CCMA 2RQMA 2ZH2A 2IVYA 1G7CB 1F9EB 5DQHA 4O3RA 4DR6F 2J6SA 3GIMA 4F67A 3GIRA 4KC5A 3AA8A 5D0EA 4BS2A 4ECWA 1RABB 2Q1LA 2DB1A 2ZHAA 1I3OB 2BKNA 4NZ0A 3C6TB 2HKEA 5L9NA 2C2KB 1WC4A 3RUBL 4ZVOB 1DRZA 3BYRA 4IQMA 2PN6A 3TEHB 2DRBA 4DS5A 4IO1A 2HGNA 3DLKB 4OX9J 2WONA 3CCLS 5G0RA 2IAJB 2QT7A 3W8GA 4RUBA 4EYHB 3L4BC 3MDFA 1NJYA 1RWKB 4FXVA 4WYLA 3MFIA 2M70A 2MJNA 4RBTA 3V6DB 1U1QA 2FHJD 4CQ1A 1AA1B 1F3FA 5F8IA 1RA6A 1AROP 3CXCR 5LMNF 1FF2A 3M8SA 5F8GA 3TUIC 4F50A 3OUYB 4TY8A 4ZVGA 4OHWA 5GAGU 2A2DA 3THTA 5F8HA 2FJEB 1FNMA 3KHLA 1K1QA 1P6TA 4DLGA 4USJC 2QL7B 3KG1A 5HQ8A 2JSXA 3PW2A 1NSPA 1YJNS 3N79A 1X0FA 2Z8QA 2G2YA 1FRXA 1O0PA 2B56A 1FRMA 2IBKA 3H5XA 1S1TA 3AOCA 4EBCA 4DPOA 2CYYA 4FXDA 1WKKA 2HPUA 4I56A 3CMES 2VODA 1N34J 3FQKA 2RDDA 2HMIB 2D69A 4ZHRB 2Z57B 2YNHA 1S79A 2G2OA 2M8HA 4RNHA 4EYIB 4E2FB 2RH3A 1NKEA 4C3KA 2OP5A 2HGLA 4LRAA 3ULHA 2I5JA 1WKJA 1C2PA 1T9UA 5DQGA 5A8WA 4MIWA 3QMQA 5KT4A 4NYZA 4DSEA 4PG6A 3BQ0A 5I42A 1R89A 4JB8B 3GWCA 4Y2AA 4ZN1A 4Q8EA 4DL5A 1N5YB 1WG1A 1ICEB 2Z30B 2R7XA 2HLUA 1MMDA 5C2GA 6FDRA 4KH0B 3IM9A 3H4BA 5IM0B 3FBCA 4L76A 3IG1B 2NS1B 2KZMA 2HNDA 1GXLA 3MM6B 2XGQA 2DNKA 1NDPA 1VMBA 2BE9B 5DG9A 1HNZF 4KHPJ 1T03B 4CH0S 1PYOB 2CZ4A 2D9PA 3KLGA 3JQMA 4Y6IA 2XMKA 5EWEA 1HIYA 3KWMA 3MMAA 5D3GA 1ZPWX 2HLTA 3ZNUA 3D3CJ 2RU3A 2AJ2A 2AT1B 1V3SA 1J27A 2PDAA 5F8NA 1R8HA 3G87A 1NO8A 1GQEA 3M30A 4F2RA 1J5EF 2BOPA 2KJVA 4ECUA 2J6UA 2NR0A 3UN2A 4CLWA 2PA3A 2HGMA 3DNCA 3GE9A 2NXUA 3DRRA 2YKMB 4PG7A 5KFOA 4P6QA 2K8GA 3G86A 1H2VZ 1HA1A 1RZMA 1RWPB 3WIVA 3ZO7A 1Y3JA 2GA7A 4IFYB 3MM7A 4B3TJ 5LJ5Y 2BVZA 4RW4B 4DF8A 4ZPTR 5IV3A 1OQ6A 3HT0A 5CYQA 1L3TA 2G4BA 3OTCA 2V4JA 2WTFA 3NKYA 2UUBF 2M5YA 1HQEA 2HRTA 4L75A 3I56S 2CPYA 3C15B 1VQ8S 1WC1A 1ACMB 4QWCA 2KYXA 4J37A 3OL7A 2RT3A 3F44A 4BDPA 4N77A 4C97A 2M52A 3KTQA 1U2CA 3HVRA 3BB5A 2EBGA 4YR0A 1SC6A 3QT7A 3H59A 5EHHA 1LWFA 2R42A 4G1IA 4MYUA 3BKFA 3PW7A 4OLPA 2V4RA 3CVKA 4NEZA 1S72S 1QUVA 2XNQA 2GW8A 4KKOA 1GAOA 2BEFA 3D6TB 2FJWA 1RT6B 3QGHA 2HQIA 2X51A 3O5TB 5IWAJ 5K9FA 3D0GE 3PIOQ 3M2RA 4OYBA 4ZIVA 3RW6A 1CPZA 4ECVA 2YKOA 2CDQA 3DOMA 1S49A 2VF3A 2G9OA 2AYBA 4FYVB 1YTYA 4PR6A 2KH9A 4PG4A 1PJ7A 2IJNA 3GR1A 3M8RA 3VGVA 5DETA 2R7SA 4KPYA 3QJJA 1NMEB 2FHKA 1U6BA 2IY5B 4DPXA 3DGPA 5HBMA 3NOGA 5KT5A 2BBEA 4X66F 1IBKF 1OY9A 2CJ9A 4FPIA 4OZ3A 2R4FA 2W2QP 5K8NA 4G3IA 2K3KA 2DRDA 5J1EB 2AEMA 3PW0A 4KFBA 5L39A 2ERRA 4KIAA 1ELOA 3BDEA 1RHMB 1IKWB 2BMBA 2HVEA 4NPOA 1VQSA 1TAUA 2CFXA 2N3LA 3H98A 2WHOA 3MM5A 3CIMA 1U2RA 4KRWA 4YR3A 5AJ3F 1FDBA 4NOHA 2Y9HA 2UUAJ 4HI2A 4ECXA 2C2EA 3HKZD 3UDLA 3BZQA 3B4DA 5I3UB 2I6WA 3AD8C 3OT9A 1IBMJ 1RTDB 1GT8A 4DWIA 1IXKA 1DTQA 2OTLS 2JRSA 5AXNA 3QQCD 2FZKB 2IRYA 4RUHA 2RU9A 2DGQA 2HNYB 5U47A 5B0FA 1CULB 2YX4A 3WHIA 3KLEB 4DCJB 1B4SA 3SBMA 4FF3A 4DBQA 4LFCJ 5T7LB 3PX6A 3CCJS 1CJTA 3MMBB 1PJ5A 1W25A 2XYPB 3ENWA 1FE0A 2X1GA 2VBWA 2ACYA 2GMJA 3DFEA 3H2LA 4RW6B 3FBEA 4QOTA 2WB4A 2QLWA 2MQLA 2F3JA 3Q89A 3TRGA 2IDLA 4ZLJA 2I0XA 4DOZA 3CC2S 3JS9A 3MWBA 4OYMA 4WFBQ 4NRTA 5D4PA 2CPJA 4LUBA 1TL1A 3SIPB 4L74A 3I5BA 3GU0A 2KRRA 3D6HB 4JI4J 1UA0A 1LWCB 3CCMS 2NQPA 1FERA 3M1VB 4C11B 2WBMA 4J5OA 1WF1A 2G0JA 2XMJA 3AD9C 5ETSA 2LU2A 1YZ6A 4PWWA 2GQCA 4L6V3 5KOXA 3K58A 3R5AA 1S1VB 1FTRA 4LIWA 3MHYA 3MGJA 2PMZD 1YJ9S 1E6VB 2KKHA 2C2NA 5FLXU 1VQLS 1FRLA 2V9KA 1KDNA 3N9UC 2VH7A 5C24A 2W1BA 3JSMA 1XQIA 2QE5A 2XWYA 4LREA 1LK7A 4ICLB 1EKSA 5J2PA 3LGHA 1TP7A 1F3VA 1M5SA 2WVFA 1RTZA 3SEOA 2R2UA 3VAFA 4EFAC 4CT9A 3MR5A 2IM1A 2K3IA 3QPIA 4N8OA 1NJWA 4OZ5A 1WACA 1JLEB 4R0EA 2ATCB 2OLWA 3KG0A 1NU4A 1U8WA 4PYDA 4ILRA 2VA3A 5DZ6A 5IC6B 4WCEQ 5KG3A 2UUCF 3T5KA 1HI0P 4C0HA 2UXDF 4WE1B 1DJ0A 3RR8A 4X4QA 2ZE2A 5L38A 1YIJS 1NH8A 3CMQA 4IG3A 4FBTA 3MEKA 4NI2A 3KKFA 2CIMA 2PSZA 2MZ1A 2J8AA 3WC0A 5AXMA 3TAQA 4O3QA 1FRJA 5LSRA 3LH2S 2YNGB 3A3NB 5F8JA 4EUVA 4LF8J 1M5PC 3CTRA 1D0EA 3X1LB 3DDIA 2VBZA 5RUBA 3L95X 2KVIA 3HSZA 2XY7A 5E2QA 1VQ4S 1L5UA 3V6JA 2VFTA 5T14A 3TOQA 5IT9Y 4ECRA 1CQMA 5BJRA 1OY6A 2FZCB 5HQMA 1RTIA 5F0UA 3R5CA 3AJ2A 4NLPA 5GVQA 4DL4A 5M2UA 2N7YA 3WC2A 2FHOB 1FEEA 2QV6A 3ZZYA 3KJFB 5D0GA 2YTCA 3V2UC 3CJ5A 3KJQB 3PEJA 2OPRB 1BE4A 3EDRB 3NLCA 2VIHA 5F0WA 2IIHA 3PRVA 3Q83A 1TK8A 2E7XA 1LFWA 2VG6B 3FSXA 4JI6J 2B4VA 1HFEL 2GCFA 3QT8A 2ZNYA 1Q8BA 3BREA 1GXUA 4DN0A 4LQ3A 1JLFA 2IC3A 4PWDA 3IP0A 1KP6A 5DO2A 4U7UK 4IYQA 1JLQA 4WFXA 4FF4A 1MN7A 3VVUA 1VRTA 5A8RA 2KTQA 1S6PA 3PDNA 4DUZJ 3MEEB 1D09B 2L08A 3VGSA 5EDWA 2DHHA 2GZOA 5B0DA 1HQUA 5F8LA 1QM9A 3LP0A 1NHUA 3V4IA 2KI2A 1SQEA 3HVTA 1X0PA 1EQ0A 3R3TA 2XB2D 1Y11A 3QRRA 4DR3F 4ZVRB 3T1HJ 1EETA 4Y2CA 2NZCA 1S76D 2CQCA 1UW9A 2BZ2A 4J9UE 2DKOB 4LF4F 1R8BA 2ADCA 2RKIA 2Z0GA 1S0NA 3UVJB 4J9KA 1UJ4A 3HHLA 3MUTP 2H5EA 2E1MC 1JLBB 2XLKA 4OI3A 2CPZA 2BRLA 2KM8B 2H48B 4DUYF 2V50A 1EIYB 3HP6A 3QYYA 2QFJA 3M2UB 3ZZRA 3DHWC 1HWUA 1S4FA 2K1RB 5CD4H 3OHAA 3JYTA 1UFWA 2MQPA 4FVMA 2YH0A 4JI5J 4RZRA 3K8VA 3FCVA 4MIAA 1X5PA 3W60A 4DV2J 3NY0A 1BGXT 2ZUGA 4KGVB 1JLCA 1S99A 3RR7A 1SCJB 2ZH1A 3Q2SC 4WWSA 4RKUC 3EGVA 2YPZA 4ZVSB 1FCAA 3TAMA 6AT1B 3HHLC 3FFIB 1F1BB 4DHVA 2XZDB 4K2JA 1D9AA 2V68A 5CYMA 1OMSA 5DLGA 5DDOC 1VS3A 1SKRA 1H72C 2YNIB 2CQDA 1Q8KA 1CJVA 4DS4A 4QYZK 1N33F 1TAQA 2ZZMA 3VGUA 1DLOB 2VFVA 3C6UB 4C3MA 3TZWA 5CZXA 3PHTA 1S4EA 3TUJC 1NB2A 4YUDA 3K5LA 3QT5A 1FNOA 2OUGA 1FX2A 1TVRA 3PYFA 4ZA1A 5J2QA 2IM0A 3C16A 3WX4A 2R8IA 1S1WB 1OSCA 3KJVB 1YI2S 4ELTA 5KFPA 3J81U 5H9FJ 2DPJA 4WP3A 1HBOB 2E5LJ 3N5FA 1HW8A 1RISA 5IT0A 4M5DA 4NLUA 1G4CA 2QMUB 3U1NA 2D9OA 5KTQA 2QLFB 4OIXA 4HH0A 1RTJB 4CLLA 1NK6A 2YX7A 3DXSX 3HHDA 2W4CA 2XO7A 3NNAA 2IPOB 3B54A 4WK3A 3EPGA 2HZVA 3PJXA 4AQYF 1FESA 3P96A 2HFSA 3IWLA 3MM9A 5KG1A 5CA5A 1YHQS 3Q8RB 1N36F 3V81B 4LIRA 3CCQS 4FYXB 3VAGA 3G82A 1YVFA 1NJXA 3BM7A 1RU2A 3PYDA 1FD8A 5JXSA 2LFVA 3A3OB 2DT9A 2MZRA 4M8LA 1EKRA 1M1GA 4JBCA 2VFUA 5L1KA 3SCJE 4A8FA 2CPDA 1CG2A 2Y1RI 3SFGA 1F60B 4KB7A 5I3QA 1H0HB 4P2MA 2RDIA 1IJEB 1PAUB 2FC9A 1XR5A 2LA6A 2B7CB 2IM3A 5B0AA 2NXJA 2D74B 1C1BA 5KFFA 1OIAA 4IRCA 4M5GA 5E5NA 5FIIA 3BSOA 4BC9A 5KFRA 1HBNB 2E7VA 4B3SJ 3D0HE 4QQBA 3W9IA 1RT2B 7AT1B 3V6DA 5HQLA 3B8HA 3FKBA 5K5MA 2V69A 2XGPA 5AXLA 2V8GA 5DGAA 1WI8A 4X62F 2E1PA 4Z37A 2XZWA 2GVDA 2QLBB 1PKUA 2QMXA 4ZVQB 2HFNA 3D7SB 4TN2A 3UPFA 2OKQA 2K2PA 3AJDA 3IAS9 2MGZA 3IN5A 4P74A 4NE9C 2MSSA 3R1LA 4GKKJ 1IVZA 3I0RA 3CT9A 2LQBA 1UMJA 1RUSA 3ISZA 5K8MA 1JXLA 1XR6A 4H4KA 1Y3KA 1NCLA 4NLSA 1RAEB 3QSYB 2FVRA 3TARA 2UV8G 1IKVA 3TWZA 4FXWA 3VGTA 4ZDNA 1H98A 1UEVA 1CJKB 4AFFA 2HFVA 1RKIA 1JNRB 4WXOA 1S1XB 1D3WA 3ENAA 4CLYA 2FYXA 4I4BA 3VAMA 1QSSA 3QIPB 2LKZA 1GMVA 2W7AA 4PRFA 2MJUA 1HBMB 2VV5A 4RJVA 3FBFA 2HFOA 4P75A 4H4KC 3MM6A 1RSCA 1TR0A 3EJMA 4RW8B 4F0HA 2JFDA 1KR4A 4HACB 3EGNA 2XNRA 3G8QA 2F9DA 3UDVA 4WPAA 2AGQA 3F41A 2GO8A 5FDLB 2BUNA 4QU6A 3UI3A 2F8EX 3OTEA 3NEKA 3MMCA 2E9RX 4OYAA 2KT2A 3R5BA 4P73A 4ANEA 4OYWA 4ZJOA 3GG1A 3U02A 1S48A 1WG4A 1Y10A 3P45B 3MPUB 2X1AA 1KBRA 4AYBD 5IXUA 2FVSA 4CYUA 2ZZNA 2QTWA 4NCBA 4OFZA 2JC1A 1T02A 3PX4A 4DI6A 1D1UA 2VUGA 1KN6A 4EU0A 1N48A 3R9LA 3SCLE 2Q43A 1D9FA 5DDQC 1N32F 1X4CA 3KMSA 3T1YJ 1JLAB 2Z56B 4O44B 4QIFA 2RF2A 3BS9A 1GNKA 2ZOMA 3T9NA 1S0VA 4C48A 2XQCA 3G6ES 3DLEB 5DDRC 1RBAA 1QSYA 4ZPAA 2L41A 2CQ1A 2DIVA 1RYRA 4WFNQ 1FFSB 3GV5B 4NXNJ 1XMQJ 1SIZA 3MCSA 3QRPA 2F63A 4ZS6A 2NPIA 4FNHA 3FMBA 4LF6J 4LVNP 4RW7B 2DK2A 3ITHB 5ETOA 4CP5A 3Q86A 2DNMA 2HWIA 4NXMF 2OD4A 2V8DA 1DTTB 4MFBB 2DJWA 2ZH8A 1DARA 2CUYA 3S6EA 5EUHA 4KV8B 3DN9A 2J0QD 1ZTTA 2A6MA 4Y2IA 1I94F 3M05A 4LR7A 3BN4A 4DV7J 3M9NB 4Y3CA 1VLOA 1KQKA 4BWMA 3FQLA 2M3DA 4MKYA 2XY5A 2NUHA 2GQ2A 4KYZA 2ZWOA 1MMLA 4UQGA 5L1LA 4LSZB 2DXFA 2OELA 2QRRA 5C5JA 3D1QA 5L46A 3W2VA 4GKJJ 3OR2B 4U67Q 3W65A 4R5PB 2VC0A 3M9MB 2F8MA 3T19A 3HXMA 4PPZA 1IBLF 1PAEX 4DV1J 4B3RJ 1RT7B 2VPYB 3NGRA 1RP5A 2A0FB 4MKAA 5KFXA 1U02A 4CLKA 1QLNA 1VISA 4CI0B 5E33A 4LFAJ 1GTEA 4CM2A 4JI0F 5HN0A 4KR0B 2QEXS 1WC0A 3GV7B 1UAWA 3QT6A 4B9TA 2KFZA 2V8PA 5HMZA 2EW9A 4Z2XA 2HHVA 4M1KA 3CF5Q 4Y34A 4ILLA 2MQMA 3BH6B 3JAMU 1S9EB 4NA1A 5I3UA 1RAIB 2E5IA 1T9VA 1RTDA 2MKKA 5HROB 2CPXA 3MCNA 4HR2A 4RWXA 2WONB 5G0RB 2UVRA 3UR3C 4NLVA 2R9LA 2BQRA 3DLGB 4WJBA 1JQGA 1GK8A 1RLDA 2Y1JA 1X5OA 4OHZA 3G6XA 1XEZA 4JV5F 3WX8A 2WZ1A 1HWKA 3OLAA 1NNDA 3CIZA 1KWMA 1VFJA 4TY8B 5DS7A 3MMBA 4DCPB 2QSFA 4C2MA 4LF7F 2YNFA 2M7SA 2MQOA 4PXEA 3OTOJ 5ETMA 3Q22A 1AZSA 5B7WA 1VYAA 4PEOA 1UA1A 4DPWA 3PR5B 3GFYA 3PW4A 4GMKA 3HJFA 4HTJA 3HO1A 2DHGA 4Q5VA 3W3SA 1VBYA 1AT1B 3M1VA 3AQPA 3UNGC 1XMBA 1RT5A 5KT2A 4YP3A 1V3ZA 3NCQA 2I5JB 1M5HA 5A8WB 3JTPA 2U1AA 5KFUA 1HD1A 3QJLA 5I42B 2EFVA 2NREA 1SL1A 3FGVA 2YKNA 2UP1A 4ZLPA 4TU9A 5B0EA 4X4SA 3TAPA 2HNDB 3BSNA 1GX5A 1WEYA 3H8YA 1R0BG 4NLOA 1SQFA 3BSAA 4EBEA 2XSFA 3S1TA 3IR5B 2KG0A 2XI2A 2ROGA 2DGVA 3PFOA 3H5UA 3R2DJ 4TLRA 5HANA 1FA0A 4O23A 4WIIA 4OX9F 3KLGB 2BJ9A 3O44A 5A2QU 4DSKA 2MZQA 4DR7F 1JLEA 1LEOA 4TY9A 2LXFA 2PEHA 2C28A 2ASDA 1V9OA 3JSYA 3DC2A 2OH2A 1F0XA 4GRSA 3I32A 2DO4A 3M30B 4DLEA 1U2FA 4A8KA 4PABA 5CH7B 2OIHA 5CZVA 1N5VA 4UOFA 2ZBCA 3DRRB 5KFGA 5E0OA 1C1CA 4I2QB 3I82A 4ZJQA 1DBDA 2XLIA 3ISNC 4FKXA 4NWBA 2Y0SD 3BQ2A 1K73T 2YNGA 3JQJA 4OQJA 1FJGF 2O1PA 3FCWA 1KOOA 2DNPA 1YJTA 3D54A 1YX2A 5CYQB 1VC6A 1LW0A 2J9CA 2V4JB 5HMWA 5HP1A 2YQ1A 2W8KA 2BV3A 3ILOA 2HHWA 3KUHA 3LGMA 5HAOA 3BO2A 3NOCA 3M4XA 3Q8UA 5L1IA 1Q7YT 3ETMA 1JJ2R 4JI1F 2ASJA 2RB7A 2B9XA 2AJ0A 1U49A 1FK9B 1UCNA 4YMEA 1ZAVA 3H2UB 1T9XA 3SDEA 2I8EA 4I64A 4KPCA 2OAUA 3IGNA 3NS6A 3RRGA 4PCQA 1S1UB 1T3NA 4F3OA 4QR1A 1LWFB 3CC7S 2RQ4A 4G65A 4FPRA 1K0TA 3VV2B 4B3MJ 2CJKA 4KKOB 4KHPF 4AUKA 1U1RA 2CNNB 3W7BA 1MLAA 1LQ9A 3M2RB 1X9MA 3MMJA 4FDFA 3C66A 3DOMB 1RHJB 5BR8J 1U1NA 2DH7A 2W2MP 2E1RA 2HQ3A 1NBEB 4IO9Q 4A8QA 3NWGA 2UVVA 3TZXA 9RUBA 3CWJA 4IH6A 1AW0A 5KFKA 1MROA 2DY9A 4HHHA 3GQCA 1YBUA 3CD5A 1WOPA 3DGPB 5HBMB 3I6PA 7FDRA 1MWQA 1PYTA 3GCXP 2MHEA 2VOOA 5HVGA 2CZVC 1PCAA 4RNOA 3G71S 4KFBB 1X4EA 1S9GA 2F4FA 3MCOA 2RILA 3UVJA 4OZNA 2RE1A 5E3RA 3J7A1 2EFQA 1GH8A 2A2CA 1FDNA 4Z7YA 2C3YA 4PYAA 3HK2A 3MM5B 2K1RA 2DNHA 4QJVA 5KT3A 3QGPA 3FZBA 4ECSA 5FLXY 1Y7PA 1LNQA 4HHJA 3BJYA 2ZHOA 3ENQA 3NMRA 4LT6A 3FSIA 1HPZA 1RT4B 3LWLA 1F5AA 5FJ4A 2OTJS 3O1LA 1FKAF 1Q7LB 3MXHP 1V3RA 3TA0A 2CNLB 2QA2A 1DHMA 1WSRA 1L3SA 4ILMA 1WHXA 3FFIA 3IS9B 4CO2A 5DQIA 5D4OA 2C2OB 3MCMA 4LBIA 2P9GA 3NP5A 3M7VA 3DXBA 2BJ3A 1VBZA 5IFMA 5CAAA 1CJTB 5E7OB 4WP8A 3C6UA 3D28A 2FLLA 3FNNA 1TKTA 2RDJA 4YS2A 3BGFA 4IFVB 4KO0A 3Q24A 1T9WA 4N7TA 1XBWA 1XIQA 4DX8H 4CNZA 2C2ZB 3CJRA 3WQPA 1S1WA 1SC4B 3KJVA 1TL1B 3EDQB 3LP1A 3SYZA 2BR0A 4RR5A 4TVAB 4EGLA 5KFZA 2B6AB 4NLTA 4LJMA 4I6WA 3C14A 2VG5A 2GVZA 4QIWD 3KLVA 4DV3J 3UCUP 2ZBPA 3D9BA 4OJGA 3GYGA 3X3UA 2IM2A 3QRQA 1RTJA 4M94A 2XSJA 1T3OA 1LXJA 2ZVSA 3I9ZA 1F9FA 5DG7A 1WEXA 4CO4A 3VAKA 1G3OA 4NLRA 2MZTA 5C24B 1BQMB 1PILA 2OGUA 2FB0A 3OTDA 3OQ2A 2EFGA 1JJ4A 1M1HA 1Q8IA 2M4MA 3FRYA 4U8VA 3F0NA 2L9WA 3KMQA 2JNJA 3P8BB 1EQMA 1ZM3A 4EMDA 4A48A 3P5TL 1RBOB 2UUAF 4CZCA 2JWNA 2QN6B 5K14B 5E3QA 1IBMF 3OR1B 3UD3P 5CYJA 1BWVA 4Q0BA 3HI9A 2ZH4A 5KT7A 1PC5A 4M5KA 4PKDB 3E8OA 2AMCB 1TUVA 4PXBA 1NDLA 3KNGA 3GILA 4CDIA 2OD6A 5GAEU 1UW4A 1SI9A 1HWJA 1XWLA 4M5HA 5MAOA 4OI2A 2YQ3A 2GHPA 2ZE2B 4IG3B 4NI2B 3PO4A 1LKZA 4ZP9A 1I51B 2IJRA 5B0GA 2R2SA 4LFBJ 2M9KA 2MKHA 1TL7B 1S9FA 1BMQB 2BJDA 2B51A 4RLEA 4TYBA 5DZ7A 4DFJA 3ZXWA 5AE3A 4ZIWA 3D0IE 3QWPA 1N6QA 5B09A 4DF4A 2E66A 2V4QA 2UUBJ 4J9NA 1OYDA 2C3MA 4QIVA 4NLYA 4AE5A 4MMOA 3ZZTA 2K7JA 4JI4F 1VIXA 2RRAA 2OSQA 5C2CA 2EPIA 4DSJA 2ATLA 3GIJA 5G4DA 3IMQJ 4K0KJ 3Q23A 1N5QA 4USWA 1HD0A 1RTIB 2BM1A 3HJVA 4DR5F 1KOHA 4LRCA 2KU7A 2RIJA 2PO4A 3MUVP 3CPWR 1VC0A 3VAHA 3L3CA 1IR0A 2BANB 3A8KA 3AOBA 5IOLA 2J9EA 1Z1ZA 3P5BP 5HL7Q 2QYGA 1RADB 2H54B 3GIIA 1FVQA 4W92B 1JLFB 1QAJA 2IC3B 1S1XA 3CGIA 4QIGA 1QVGR 4C9DA 1JLQB 4IOBA 4RU2A 3SSRA 3US5A 3JSRA 2I38A 3H5SA 4X4OA 1X5TA 4HHUA 5A8RB 2DPIA 3MAQA 1S6PB 4RW8A 2HYIB 2X3DA 2C2MB 1QDUB 1KEKA 4CLSA 1MMNA 1HQUB 4DU8A 3LP0B 1RT3B 1XNRF 1SJ3P 2KZZA 4N47A 3CCES 1SJRA 3HVTB 3KLIB 2OPPA 4HACA 4DFPA 4JI7J 4ED0A 1U6FA 1WHYA 2QYCA 3PRBA 3MD1A 2V67A 2PD1A 1EETB 1ROFA 2AEFA 2GJFA 3J81Y 1EHWA 3TJ9A 1P27B 1IR1A 3EVMA 2ZM6F 1VQYA 1HW9A 4N5SA 1UTAA 1Z4UA 3CNQP 5DJBA 4H4MA 3HHLB 2AX1A 1OWXA 3TZYA 5I3PA 1DZ5A 3AD7C 3NS5A 3CDBA 3KFWX 4YDDB 1T95A 5DM7Q 1UFKA 4TQSA 3E2EA 5HMXA 4MK9A 4YN3B 2CQ0A 2EG1A 3MTKA 2VBYA 2HSEB 3IRWP 1JLAA 4B9LA 3QIDA 4DX5A 4O44A 3MAHA 1JLCB 3CJ8A 2HG4A 4HEA9 1Y9OA 3DLEA 1A6LA 2LXIA 3TAMB 5AE1A 2O67A 1N4LA 3IA0A 4FN5A 2R7RA 4JI6F 2IMOA 4IH5A 4JI3J 2X3GA 5KOWA 4LR8A 4UQTA 2LA4A 3PJ9A 1WC6A 2G1HA 4DQQA 2WSCC 2NCKL 4PXCA 1CJVB 5JVHQ 4J7CA 3MFHA 4FF2A 2R7TA 3DRXA 3LF0A 1HARA 4RW7A 2RS2A 4DL0C 2NYHA 3HD1A 4F04B 4DV4J 1AB8A 1QUPA 3MM8A 2C22A 2FJXA 2MKYA 2KN4A 1HYSA 2CQIA 1YITS 2QMWA 1TVRB 2EC0A 3SFUA 1Q86T 2JEGA 1GMWD 3C16B 2YH1A 1VQ9S 1XNQJ 4X4NA 4QYZJ 2E5GA 4M95A 2BE7D 2OPQA 4OYXA 4UOHA 2AGOA 3R5JB 3EPIA 4ED5A 2GMLA 2D3OR 3T1HF 1URNA 3RBXA 1OO0B 2HHHJ 1VQ5S 1KHVA 5ETNA 3MZIA 1NK9A 5THWA 1JNZB 3LALA 3U1LA 3I4PA 4ALZA 3BO4A 4F4XA 1NDCA 1SC1B 1S12A 5B0BA 3W5ZA 4NEYA 1HNIA 4FNIA 1RT7A 3Q8YA 4XDDA 4EO6A 3MM9B 3GCWP 3CCSS 2HK2A 2QFIA 2J9DE 4NASA 1O5JA 2YWWA 2XCAA 3JB9k 2NSBA 2ZOFA 2DVIA 4JI5F 4DV5J 2J0SD 3G82B 1RJJA 4WZMA 2DNLA 4DV2F 2XS2A 1F5BA 4ED1A 2HS0A 2DGUA 1JX4A 3M8PB 3RB0A 4LF9F 4TU8A 3ETOA 2DRAA 2UUCJ 3DMJB 1O8BA 3LUYA 1FO1A 3BR8A 3FK4A 1DFDA 3DOKA 4P2FA 1S9EA 4DZ6A 3R97A 3J7AN 2X1BA 1KTVA 2CAJA 2V8HA 5HROA 1B3TA 1C1BB 4CLFA 5JVGQ 3OHBA 2M0GB 5A8KA 3ZTRA 1NM2A 4J9QA 3HFKA 2O3DA 2VU5A 2K7KA 3QWUA 2IJFA 3DLGA 4M5NA 4OHYA 1TTHB 3BPSP 2MKJA 1FXLA 2H1YA 2RMLA 5A6WA 2FGCA 1HNWJ 1CSJA 4HVZA 3OFFA 3EZOA 2LCWA 3UQSA 2GVDB 2GFFA 2E5LF 4A8YA 1HBUB 2DNQA 4ECTA 1CQNA 4IDKB 2XWXA 4KH1B 4L73A 2DHAA 2EC2A 2BJ8A 2WRMA 1ZS6A 2MGZB 3FUYA 3RB4A 3NAHA 3I0RB 2KL8A 1Q78A 2CNKB 3QGGA 2J7UA 3TANA 2W7OA 3AFGA 2CADA 2CVEA 2FLOA 3DU6A 4LBPA 1NEEA 2WVCA 3T9ZA 2PT0A 4RBUA 1NPRA 2V94A 3AT1B 2W7PA 2HIYA 2UVWA 1SKSA 1IKVB 1WC3A 2RSQA 4A8OA 4E8UA 4P2SA 1GX6A 3JSBA 1QTMA 1IJFB 2H4WB 2NUUG 5KG0A 2Y8WA 2XTJP 1TKXA 3EE3A 4IR9A 4PG5A 2W2NP 4WBFA 3B6BA 1N88A 2LECA 3CCUS 4ZJLA 1NUEA 3TNVA 1K0VA 2IRUA 3PX0A 2CPIA 3U7JA 4JI8F 5L8RC 2WVDA 4ZP7A 2Q6BA 1FNXH 2G2ZA 2HWHA 2UXCJ 3CMAS 4BCAA 2FJAB 2L9NA 4UT4A 3UD5A 2VD3A 4K4YA 3BKUA 2P6SA 2YQ0A 4MK7A 3M32A 4O0IA 1VBXA 1VJWA 3FBBA 3C3LA 4WZQA 2KO1A 4B3SF 4F4AA 1FDDA 2JVRA 4DX6A 2F1FA 2CJBA 3MMCB 1ZOTA 5JJBA 5CD4A 3TUZC 4X4UA 1SBRA 4KJIA 2XZTB 3SQGA 3U27A 3HFZB 4YB6A 1LW2A 4I2QA 4CYUB 2IA0A 3EVWA 4OX7A 3MPVA 1RHUB 2RS8A 3GSDA 3R6LB 1Q81T 2MZJA 4NLQA 3W2WA 1YJ7A 1B7YB 2HQDA 1BHNA 4PPDA 4FBUA 2MKIA 2IRXA 3D6MB 5GAEI 1S0MA 4QWAA 1X4HA 1G1XA 1Q4RA 2WCXA 3HSDA 3K57A 2ZD1A 3TO8A 3AXMA 1Q53A 1VOMA 2RF2B
chains in the Genus database with same CATH topology
2BEFA 1VYAA 3GP9A 1BUXA 3Q8UA 3BH7B 2DY9A 3DKDA 3EM1A 3ETMA 3FKBA 3ENAA 4DI6A 4EK2A 2DXEA 1U8WA 3BBFA 3ELHA 3EMTA 3FBCA 1NPKA 1LEOA 4O0NA 1ZS6A 4ANCA 1NSQA 4UOGA 1LWXA 1BE4A 3VVTA 3R9LA 1B99A 3BBBA 3ZTQA 3BH6B 1NDPA 3FBBA 3FBFA 3MPDA 1UCNA 3PRVA 3Q83A 3VGUA 4F36A 4S0MA 2DXFA 4FKYA 4KPCA 3Q8VA 4F4AA 1K44A 1NSKL 3EJMA 5CAAA 2HVDA 4HR2A 4UOHA 1NSPA 4DZ6A 5C7PA 1NB2A 3VGVA 2DXDA 1PKUA 3L7UA 4ENOA 1S59A 2HURA 4UOFA 5CABA 3EICA 1WKLA 1HLWA 2BX6A 3ZTSA 1HIYA 1W7WA 1S5ZA 1JXVA 1XIQA 1KDNA 3ZTRA 2B8PA 1PAEX 1B4SA 3NGUA 1WKKA 4FKXA 2VU5A 3ZTOA 1XQIA 3ZTPA 3FCVA 3BBCA 3GPAA 3FC9A 3WX8A 1NDCA 2CWKA 3EVWA 3DDIA 3NGRA 1MN7A 3FCWA 1F6TA 1S57A 3EE3A 4WBFA 3VVUA 3PJ9A 3B6BA 1MN9A 2B8QA 3Q8YA 1NCLA 4W98A 2AZ3A 5BXIA 1NLKL 1BHNA 1NDLA 2NCKL 3NGTA 4ANEA 1EHWA 4CP5A 3EVOA 3Q86A 1WKJA 2AZ1A 3FBEA 3G2XA 3VGSA 1NUEA 2HVEA 3EVMA 5IOLA 4DUTA 3Q89A 3VGTA 2DYAA 3NGSA 1NHKL 1NDKA 3JS9A 1HHQA 3B54A 4C6AA 1F3FA 4ANDA 2ZUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEF A;  1VYA A;  3GP9 A;  1BUX A;  3Q8U A;  3BH7 B;  2DY9 A;  3DKD A;  3EM1 A;  3ETM A;  3FKB A;  3ENA A;  4DI6 A;  4EK2 A;  2DXE A;  1U8W A;  3BBF A;  3ELH A;  3EMT A;  3FBC A;  1NPK A;  1LEO A;  4O0N A;  1ZS6 A;  4ANC A;  1NSQ A;  4UOG A;  1LWX A;  1BE4 A;  3VVT A;  3R9L A;  1B99 A;  3BBB A;  3ZTQ A;  3BH6 B;  1NDP A;  3FBB A;  3FBF A;  3MPD A;  1UCN A;  3PRV A;  3Q83 A;  3VGU A;  4F36 A;  4S0M A;  2DXF A;  4FKY A;  4KPC A;  3Q8V A;  4F4A A;  1K44 A;  1NSK L;  3EJM A;  5CAA A;  2HVD A;  4HR2 A;  4UOH A;  1NSP A;  4DZ6 A;  5C7P A;  1NB2 A;  3VGV A;  2DXD A;  1PKU A;  3L7U A;  4ENO A;  1S59 A;  2HUR A;  4UOF A;  5CAB A;  3EIC A;  1WKL A;  1HLW A;  2BX6 A;  3ZTS A;  1HIY A;  1W7W A;  1S5Z A;  1JXV A;  1XIQ A;  1KDN A;  3ZTR A;  2B8P A;  1PAE X;  1B4S A;  3NGU A;  1WKK A;  4FKX A;  2VU5 A;  3ZTO A;  1XQI A;  3ZTP A;  3FCV A;  3BBC A;  3GPA A;  3FC9 A;  3WX8 A;  1NDC A;  2CWK A;  3EVW A;  3DDI A;  3NGR A;  1MN7 A;  3FCW A;  1F6T A;  1S57 A;  3EE3 A;  4WBF A;  3VVU A;  3PJ9 A;  3B6B A;  1MN9 A;  2B8Q A;  3Q8Y A;  1NCL A;  4W98 A;  2AZ3 A;  5BXI A;  1NLK L;  1BHN A;  1NDL A;  2NCK L;  3NGT A;  4ANE A;  1EHW A;  4CP5 A;  3EVO A;  3Q86 A;  1WKJ A;  2AZ1 A;  3FBE A;  3G2X A;  3VGS A;  1NUE A;  2HVE A;  3EVM A;  5IOL A;  4DUT A;  3Q89 A;  3VGT A;  2DYA A;  3NGS A;  1NHK L;  1NDK A;  3JS9 A;  1HHQ A;  3B54 A;  4C6A A;  1F3F A;  4AND A;  2ZUA A; 
#chains in the Genus database with same CATH topology
 3ZZ0 A;  3DI6 B;  2H51 B;  1U48 A;  3MR7 A;  2QGF B;  3I31 A;  3UN5 A;  2OHD A;  4ES2 A;  4YDX A;  5CXT A;  2ZJP Q;  3Q8Q B;  4K5S A;  3EZ5 A;  3VR1 A;  3TX0 A;  1FK9 A;  5ETV A;  1NSK L;  2BYC A;  2V34 A;  4XO0 A;  4K50 A;  5A76 A;  2HW3 A;  3BGL A;  2AJ4 A;  3JAM Y;  3OVB A;  1VHF A;  3RAQ A;  1S1U A;  4PXD A;  1N0U A;  3MPW A;  3QNW B;  3MED A;  1RHR B;  3N28 A;  3BYP A;  1BQN A;  1QE1 A;  1U09 A;  2D3O 1;  2FVC A;  3V6K A;  2ZH9 A;  3MAA A;  3T5J A;  3H5Y A;  1NRK A;  4ZCM A;  3A3P B;  4CLU A;  2DH9 A;  1RCX B;  4CO0 A;  2OFH X;  2RRB A;  1S0O A;  2BQ3 A;  2ZH5 A;  3RRH A;  4DUT A;  3VAI A;  3OJU A;  4NLD A;  4A47 A;  1SKW A;  2W01 A;  3CJ4 A;  5F3T A;  1XK8 A;  3W2V B;  2CJA A;  2BOA A;  1F5C A;  1S7H A;  3PTW A;  2DGX A;  2HFZ A;  2P9E A;  4WKR A;  3CSK A;  1N36 J;  3CDE A;  3Q8P B;  2I2Y A;  4RL1 A;  3DLH A;  2B43 A;  4ZOS A;  4YHH J;  2SXL A;  2LU1 A;  2KT5 A;  2F5G A;  4QCL A;  1WJ9 A;  3QAE A;  3HHE A;  1WUU A;  1EZZ B;  2DHX A;  1FWL A;  3PM9 A;  1W7W A;  1S5Z A;  1SUQ A;  4TQR A;  1RA7 A;  4XPE A;  4K4V A;  4ZMM A;  1RBL A;  3T1Y F;  4AL6 A;  1ZM4 A;  3N5B A;  5ITH A;  1P9Y A;  1IM4 A;  2IFX A;  1I6J A;  3UN3 A;  3KNA A;  2F40 A;  3RAX A;  1TV6 A;  3JTN A;  2HK3 A;  4ED7 A;  1TMM A;  4NYP A;  4WU3 A;  5IT4 A;  1N5S A;  1XMQ F;  2MLX A;  1T0T V;  1RT4 A;  3I87 A;  4M5I A;  4ZP8 A;  2OMO A;  5E3A A;  3J7Z 5;  3POT A;  4OI6 A;  1REV A;  4ZVE A;  2FLP A;  3IR6 B;  4LF6 F;  4RNF A;  2WAQ D;  1OY8 A;  3B4M A;  1AUS L;  3PJW A;  3RYL A;  1NSQ A;  1VDH A;  2YWF A;  3QSI A;  4OYI A;  3HM9 A;  2HRU A;  3ZZZ A;  3BF4 A;  3WBZ A;  3IS9 A;  3DGV A;  3KDO A;  3TI0 A;  2B7B B;  4UUX A;  1DY3 A;  2B5J B;  5A2Q Y;  3KDN A;  3QJP A;  2VG7 A;  2MQQ A;  3NS7 B;  2D1C A;  5A0Y A;  1ZZN A;  1H7W A;  2N4C A;  3IR7 B;  3N01 A;  3PCO B;  4DL6 A;  4DV7 F;  4OMF G;  1RKJ A;  2EBE A;  2F8H A;  3NNC A;  3N0V A;  1KC8 T;  2YNF B;  4MKV A;  4IFV A;  3OTB A;  3NCR A;  2DEJ A;  1TEL A;  3FEX B;  4DSI A;  3EGW B;  1AZS B;  3FC9 A;  2CWK A;  4TXS A;  5ADZ A;  4DR1 F;  3KLF A;  2UXB J;  4AT1 B;  5AXK A;  1M5O C;  1SV5 A;  1YJU A;  3KK2 A;  5B0C A;  4XIU A;  1S10 A;  4DV1 F;  2E29 A;  2YPY A;  3LAM A;  1APS A;  2B6A A;  2DYA A;  4B9M A;  4B08 A;  2MLZ A;  3DDN A;  3VAJ A;  4OZ2 A;  1LXN A;  1RT5 B;  3OVS A;  1OQ3 A;  2ALY B;  5IQ6 A;  5DLF A;  2MQ8 A;  4R0J A;  4ID5 B;  4GC6 A;  2ZWP A;  4LFA F;  5JUM A;  4OL8 A;  1IUJ A;  3JQK A;  4UZC A;  3BEG B;  2LP4 A;  3N4W A;  5LJ3 Y;  1RHQ B;  2BE2 B;  2Y8Y A;  2RD5 C;  4F4W A;  3RG6 A;  1WEL A;  2YKN B;  5EWF A;  2BJ7 A;  3Q8V A;  2PII A;  1BQM A;  1K9M T;  4TYA A;  5F9L A;  2E7W A;  3UO0 A;  3KOA A;  3PW5 A;  3WDO A;  2VB6 A;  4U7C A;  3B82 A;  1B7F A;  5IZH A;  4RUA A;  3SCK E;  5K14 A;  3M2V A;  2P6T A;  1UVJ A;  4EZ9 A;  3OR1 A;  3IC1 A;  3IXQ A;  1Q95 G;  2PI5 A;  3AJ1 A;  4ED2 A;  4I67 A;  2PFD A;  3FZ2 A;  2W9A A;  4P7T A;  2FY1 A;  4LQ9 A;  4LF5 J;  1FFW B;  2BM0 A;  1C0U B;  5J1N A;  2HBR B;  4X64 F;  4OI1 A;  2GAG C;  1QAI A;  2UVU A;  1FD2 A;  2XMU A;  4V1A k;  4UW2 A;  5GMD A;  2VHG A;  1AYE A;  1YRT A;  2Y1I A;  1HHQ A;  4J9M A;  5HMY A;  4F0M A;  5HK4 A;  4DQR A;  5SUH A;  1C1C B;  2DGW A;  2MKC A;  2J0W A;  2CQP A;  5KFV A;  3ZTQ A;  1TL7 A;  1JLG A;  2J5A A;  3NWR A;  2MEW A;  3OTO F;  4RU9 A;  1NK5 A;  2HVZ A;  2LQ5 A;  3UDC A;  2O5D A;  1M90 T;  4J9P A;  4RNN A;  4HKQ A;  4DR2 J;  4FP9 A;  2JHE A;  1LW0 B;  2E9T A;  4OV6 A;  4F0K A;  1VRU A;  3IM8 A;  5HP1 B;  1PO6 A;  3ILL A;  4ETZ A;  2VOP A;  3SXL A;  3HLU A;  1C0T A;  1U0H B;  5D78 A;  3MUM P;  2MDA A;  2EKY A;  3D1H A;  3QFH A;  2N3O A;  2B8Q A;  2HZA A;  4RUC A;  3H25 A;  4ELU A;  1Q5V A;  3HX9 A;  2R3V A;  4IG0 B;  3MR6 A;  1VLY A;  2W8L A;  5GAG I;  5LMU F;  4XTT A;  2HHU A;  2MQN A;  1VK8 A;  3SDE B;  1C4C A;  2BAN A;  3HDS A;  2XMA A;  2RJZ A;  2UU9 F;  3DYA A;  4P7V A;  4EWT A;  2C3P A;  1CS4 B;  3CD7 A;  4W4M A;  2KHC A;  2JEI A;  1FXR A;  3EMT A;  4URG A;  4UOG A;  1R43 A;  1SXL A;  3RBD A;  1BWE A;  5D4N A;  4B9S A;  3W62 A;  4F36 A;  4C8L A;  5ETT A;  3GV8 B;  4FS2 A;  1UP1 A;  3K5M A;  4NRU A;  1WTB A;  4X65 J;  1FFG B;  2J8S A;  4RX6 A;  1PJ6 A;  1TK0 A;  3LAK A;  3H2V E;  1VI7 A;  2B9Y A;  2VJU A;  1K47 A;  4QR0 A;  2AF6 A;  4KGM A;  4YOE A;  4F02 A;  1RT3 A;  1KFD A;  1MRO B;  3LQV A;  1U7L A;  1U8S A;  3KLI A;  1ZBT A;  2F65 A;  4YY3 J;  1NPP A;  4R8U A;  1W2B R;  2FHM A;  4M5J A;  1H3D A;  4Y00 A;  2CZ9 A;  2YX1 A;  4N8N A;  3R7N B;  2Q66 A;  1RAJ A;  3VCD A;  2B4P A;  3HD2 A;  3DLB A;  1S9G B;  2OEJ A;  5GAD U;  1IKY B;  2ALZ A;  2DEI A;  2FVP A;  2C2D A;  4HT5 A;  2VC1 A;  4FYD A;  4DL2 A;  3EWG A;  4DG1 A;  2GS8 A;  1MSW D;  2PA8 D;  1S6U A;  2P9C A;  2RHQ B;  5CQG A;  1YRU A;  2MST A;  2YKQ A;  2VQE F;  4IKA A;  5J2M A;  5I4M A;  2VBX A;  4DL3 A;  4H4O A;  2ZDO A;  4CT8 A;  1HPZ B;  5HJY A;  4E98 A;  1HLW A;  4ZIT A;  4MK8 A;  4ZVU B;  4UZB A;  2DCU B;  1RYS A;  2XHC A;  3NGU A;  2ZJQ Q;  4CRJ A;  1NXI A;  5HVH A;  3A8I A;  2AJ1 A;  3JXO A;  5M2R A;  1UZD A;  4DQS A;  1J5O A;  3CCV S;  2XBP A;  1NZ8 A;  2A1B A;  1EP4 A;  4B3M F;  5KG2 A;  1X4G A;  2GC8 A;  2Z2M A;  1NK0 A;  3N6M A;  1WG5 A;  2HFU A;  4B9V A;  3GP9 A;  2FHJ A;  2QLJ B;  1TKT B;  2YWE A;  3D67 A;  1EAR A;  4AXJ A;  4KO0 B;  4N76 A;  2KXH A;  2V8V A;  3EZU A;  5CHC B;  5BR8 F;  2UV8 A;  3M8Q A;  2QO3 A;  2NYI A;  3W5Y A;  3MF5 A;  3CJS A;  3ET6 A;  3FEY B;  2KJW A;  2F4V J;  3HHL D;  3LP1 B;  2GGP B;  1LOU A;  1D8Z A;  2CRL A;  4Q2L A;  1NSA A;  5CAB A;  1FHT A;  3C14 B;  2VG5 B;  2GVZ B;  2C3U A;  2DNO A;  3W9J A;  1WD6 A;  2E1C A;  1SH0 A;  2PMH A;  3BDP A;  4ZPC A;  2PE8 A;  3VWS A;  1DUR A;  2XSJ B;  2BKP A;  2XYH B;  3AOA A;  4ZVF A;  3OD2 A;  3SSQ A;  2IYG A;  2UUW A;  2AGP A;  3NBP A;  3O6Q A;  1IQT A;  3TEG A;  2DD8 S;  2E5H A;  3BN7 A;  5C25 A;  1ZM9 A;  4USV A;  4LR9 A;  1DQ9 A;  3AXK A;  4ED6 A;  2OML A;  1S6O A;  1KHW A;  3P49 B;  5KFB A;  3DRP A;  1ZZF A;  4DR7 J;  4IH7 A;  3CJK A;  3LP2 A;  1MU2 B;  1N52 B;  1RT1 A;  3M8P A;  4YEA A;  3H20 A;  2MXY A;  2AKW B;  2KXF A;  3SSS A;  4Q0B B;  4B02 A;  3DMJ A;  5KFJ A;  4WF9 Q;  3MI7 X;  2IBO A;  4RPF A;  4DL7 A;  4K4S A;  3T5L A;  5D8H B;  3AA9 A;  1A7G E;  3NL0 A;  2VQF J;  1X60 A;  1BY9 A;  1FJG J;  1YSJ A;  2R7W A;  1RE1 B;  4AXI A;  2FJV A;  3CED A;  1KQG B;  2G1D A;  2DGT A;  2A18 A;  3EVO A;  5EN1 A;  4I6A A;  1N6Q B;  2LQ8 A;  1PG5 B;  1VQN S;  3I0S B;  1YQH A;  5H9E J;  4FVC A;  2R7Q A;  1SC3 B;  4QR2 A;  4JI1 J;  2NXE A;  1FI4 A;  2LLZ A;  1A9N B;  2PI4 A;  1HBU A;  3T5H A;  2CJQ A;  2DR9 A;  3PFE A;  4O0N A;  2O66 A;  1Q8L A;  5M2P A;  4DV3 F;  2W9C A;  3HVA A;  4IDK A;  1HHT P;  2RNE A;  1HL6 A;  1WC5 A;  3TVK A;  5BYS A;  1TQL A;  3N6N A;  1OJ4 A;  5F3Z A;  4I7F A;  4X2B A;  2CVI A;  4KGZ B;  5K8P A;  1T9T A;  1S59 A;  1PC4 A;  2IHR 1;  1WKL A;  2DR6 A;  5KFW A;  2GHV C;  3R7B B;  3IRX B;  1L3V A;  2J76 E;  2ZNZ A;  2ADB A;  3OPK A;  1TMJ A;  2HVI A;  1Y0H A;  5DM6 Q;  3NCP A;  1XMO F;  2CQG A;  1SQG A;  4YB5 A;  1YJW S;  4XAK A;  2Y1L B;  3QLH A;  5FD1 A;  3HHN B;  2LQ9 A;  1S7I A;  1PIE A;  3SI8 A;  3G8T A;  2FLN A;  5LXR A;  3K5N A;  4HDG A;  5K8O A;  4OZ0 A;  4KGK A;  4EI2 A;  4QBU A;  3BH7 B;  3DM2 A;  2A10 A;  3ZZU A;  2DGS A;  2FVQ A;  1CLF A;  1PGZ A;  2GQQ A;  2OPP B;  1WWH A;  4DV6 J;  4JI2 J;  4NCG A;  1CC7 A;  4LFB F;  3H7H B;  3CCW A;  2LDY A;  2P5V A;  4DZD A;  2G13 A;  3D68 A;  3MPY A;  2HQG A;  5KFA A;  4CM0 A;  3DRY A;  2E9Z A;  2PMW A;  5MLC V;  4OYP A;  3BSC A;  2V2V A;  1WOO A;  1HR0 J;  4H4M B;  1N8R T;  4HTI A;  1NB7 A;  2ZKT A;  3GFH A;  4F8R A;  4PQU A;  3W9H A;  4K59 A;  4BLG A;  1NLK L;  3S01 A;  5HAT A;  2VAS A;  2J9D A;  4P2X A;  1W2I A;  4K0K F;  2XY6 A;  2V9W A;  2KXN B;  3M9O B;  3KK1 A;  1HWL A;  1GMU A;  1RTH A;  4WK1 A;  5EWG A;  1RWX B;  2NPF A;  3EX7 B;  3V6H A;  4LSL A;  3MUR P;  2QSW A;  3EM1 A;  4QWE A;  1UZH A;  5DGB A;  3DRS B;  1V6H A;  4P71 A;  3DI6 A;  2LEB A;  3DOL A;  2HHX A;  2FJD B;  2FPH X;  2YKA A;  1TL3 A;  2E44 A;  3PEH A;  3OV7 A;  1M0S A;  4J9R A;  4D3G A;  4L3N A;  2V2Q A;  3BGU A;  2N4D A;  1RAA B;  4U7U D;  1U1P A;  4WKY A;  1UWB A;  3ZZP A;  1F9H A;  1YWX A;  2HS4 A;  3GYN A;  3GFZ A;  3A1Y G;  1NK7 A;  4OJH A;  3MM8 B;  3BO3 A;  3KLH A;  3J7Z T;  3PIP Q;  3K2Y A;  1HYS B;  4O4G A;  3QFW A;  2EVZ A;  2FY8 A;  4LF1 A;  1M5V C;  4ERD A;  4EEY A;  5B08 A;  1UEU A;  2OJ3 A;  2D41 A;  1FDA A;  1NK8 A;  5KG7 A;  2OPQ B;  4JI7 F;  2ZUA A;  3GZ7 A;  3S8S A;  4J9O A;  4FS1 A;  1RI7 A;  2P2C B;  3BBF A;  1R8A A;  3L7P A;  4DX7 A;  1B99 A;  2XHW A;  2H5I B;  4V19 X;  2CQH A;  2HQC A;  1V5V A;  3P4U B;  3EGZ A;  3R5G A;  1UET A;  1HNI B;  1KVK A;  1U4B A;  1KON A;  1GEH A;  1CJU A;  3IBC B;  4A4J A;  3R27 A;  2D3U A;  4Y2K A;  4LSN A;  1S97 A;  1NKC A;  4P52 A;  2VKZ G;  3S7R A;  5EX3 A;  3VF0 B;  2JZ5 A;  3D2W A;  5LXY A;  3UE2 A;  3FSY A;  2OPS A;  2M8D B;  4Y65 A;  2MTL A;  1T05 A;  5EX0 A;  4A8M P;  3K5P A;  2WOM B;  1J2V A;  4TNO A;  2QLX A;  2ZIT A;  3DOK B;  3ONQ A;  2GO9 A;  1ZA2 B;  3HZE A;  4JI3 F;  5GAD I;  4DSL A;  2PFF B;  4ED4 A;  3HVW A;  4ZCL A;  5A8K B;  1RHK B;  1X5S A;  4PAA A;  4USH A;  4DV4 F;  3GFX A;  3W64 A;  1CEZ A;  1BQX A;  1KTQ A;  1WHV A;  1M5K C;  2LXU A;  5D4L A;  4Q44 A;  1B0P A;  2B5J A;  5C7P A;  4GO5 X;  3UFC X;  2E1A A;  1RAH B;  4DV0 J;  1YK9 A;  4ZCK A;  3HF5 A;  4UY8 5;  4A8X A;  1XNQ F;  2L3M A;  4DFM A;  2OEM A;  5IV4 A;  2CPH A;  4DR5 J;  4U9R A;  2W9B B;  1FRK A;  3KHG A;  4K8R A;  4UST A;  4WP9 A;  4G1Q A;  5IC4 B;  1Q1K A;  2JEJ A;  1MN9 A;  1VBK A;  1REG X;  1TL5 A;  1FKP A;  3C46 A;  2HHH F;  2PEB A;  2QIF A;  3CC4 S;  2OO4 A;  3OL9 A;  1FKO A;  3HMJ G;  1EB0 A;  1RCO B;  2RAQ A;  1FRH A;  3E01 A;  4XK8 C;  3TA1 A;  3ZFV A;  4CWB A;  1U45 A;  4X4V A;  2BXJ A;  4C98 A;  4MYT A;  4DPU A;  3BGR A;  2Y0B B;  2Z2Z A;  1K8A T;  4L72 B;  1UFL A;  4F4Y A;  3VQT A;  4ID5 A;  1X4B A;  5DG8 A;  3VVT A;  2WB1 D;  4DV5 F;  3KHR A;  2COL A;  3D1O A;  4TKT A;  2BE2 A;  1TKX B;  5JMN A;  3K8W A;  3KUG A;  2C2R A;  3UD4 P;  4F25 A;  1IKX A;  3SV3 A;  2WSE C;  3A8E A;  4ZPV R;  2ZBI A;  3PRD A;  1T11 A;  1NH7 A;  4ZPW R;  4X4P A;  4QZV B;  1XNR J;  1G6B A;  5J2N A;  2ZHB A;  4JYA J;  2HNZ A;  3TYT A;  1MW7 A;  3J80 U;  3D4J A;  4UOC A;  5LOQ A;  4ELV A;  2FUG 9;  1R0A B;  4CO5 A;  2X7I A;  5ETQ A;  4W98 A;  2XO6 A;  4AL7 A;  2R7V A;  3M32 B;  1IM6 A;  3VQS A;  4IR1 A;  2IMW P;  2ZM6 J;  1C0U A;  2H5J B;  2VJV A;  1IWG A;  2JOQ A;  3CD6 S;  2AIR B;  1RLC L;  4AL5 A;  2POK A;  2CQ4 A;  2HBZ B;  1R8P A;  3T6J A;  2B9E A;  5DDP C;  1HNW F;  5KFY A;  3SQG B;  4USI A;  2BAC A;  1O6X A;  3CUN A;  4DCO B;  1LW2 B;  3TR5 A;  1SJ4 P;  4DR4 J;  3SZ2 A;  2LVW A;  1ITP A;  3W2W B;  1KQS R;  1SJQ A;  1Q5Y A;  1GTH A;  3IBW A;  1HHS A;  4RWW A;  2APO A;  3I4H X;  1FJC A;  1ZM2 A;  2DNN A;  2ZD1 B;  3T6B A;  4J91 A;  2KT3 A;  5C42 A;  2EKN A;  1N34 F;  3RB3 A;  3QO9 B;  2AV5 A;  1U0H A;  4C8Z A;  1E6Y B;  4XDC A;  3BKT A;  2QC3 A;  1BLU A;  4DQI A;  1WEZ A;  2EFP A;  2C42 A;  1HWI A;  3ISN D;  1HKA A;  4IG0 A;  4C8M A;  5HLF A;  4K5R A;  1FRI A;  3UCZ P;  3RBE A;  1SH3 A;  5IQQ A;  4ZVH A;  1RWW B;  4NLX A;  1QD1 A;  1CS4 A;  1R6Y A;  3AQO A;  2ILZ A;  3VAL A;  2HS3 A;  3MED B;  3M6V A;  2GHW A;  2RVJ A;  2W24 A;  1BQN B;  1JKH A;  1HNX J;  3SQO P;  1ZPV A;  4WTO B;  1QE1 B;  1WSV A;  1TU0 B;  3G96 A;  4CTA B;  2QX0 A;  2W4D A;  2ZVI A;  2K06 A;  3PVX A;  3FMW A;  2HVD A;  5KG6 A;  2UXC F;  2HVH A;  3MAA B;  3C8Y A;  1UEK A;  2AEJ A;  2B4O A;  4AD6 A;  4U8Y A;  2FDN A;  5LSL A;  4NCA A;  2B8P A;  4U6P A;  1VQ6 S;  1XTZ A;  1LWE A;  4LVO P;  1FX4 A;  1HQ2 A;  2V2Z A;  2ZC4 A;  1QSL A;  3GMG A;  4QWD A;  4PUO B;  1VHI A;  2HAF A;  2J0X A;  3EUN A;  5CCL A;  1AFJ A;  1RAG B;  4HL9 A;  2AJQ A;  4D3H A;  2B9W A;  2VKR A;  4ZVP B;  5D0H A;  1TK5 A;  2DNG A;  3K7R A;  2AYE A;  1QTN B;  4RO0 A;  1UJ6 A;  2FGO A;  4RBV A;  3HFV A;  1IN0 A;  2GIQ A;  1NHK L;  2XS5 A;  5GMK a;  1RWV B;  3OXG A;  1SJ1 A;  4DR6 J;  5BYR A;  5HVF A;  3CDW A;  4B3T F;  4LF9 J;  3KHH A;  2Z4P A;  3RB6 A;  1MWZ A;  3UWT A;  1SUQ B;  3WZ0 A;  2ZEJ A;  2DNZ A;  4XPC A;  3A4T A;  1IKY A;  2KVQ E;  2D7S A;  1W26 A;  2KB2 A;  2XG8 A;  3TJA A;  3GON A;  1C4A A;  2DBB A;  5A6P A;  3VTI A;  3CW2 C;  4H54 A;  4KE5 A;  1YRX A;  3CDU A;  3H4D A;  1TV6 B;  2DNY A;  3RZA A;  2DHS A;  1OPI A;  1LFP A;  1S6Q B;  3PV8 A;  2R8H A;  4YFU A;  1WNE A;  4UTG A;  4ED8 A;  4M5L A;  3POT B;  1R27 B;  1PSD A;  1GFW B;  4HH1 A;  2ZBQ A;  1REV B;  2HHQ A;  3K89 A;  1BD6 A;  1RK8 A;  3OFG A;  2NZ4 A;  3PHE A;  3EXY A;  5LMN J;  2H65 B;  1JK9 B;  4QPX A;  3PO5 A;  4QW8 A;  4HT7 A;  3TJ8 A;  2A6O A;  2ZKU A;  4I69 A;  2L48 A;  4C0O C;  3NGS A;  2FTR A;  4CH7 A;  1HNV A;  3B78 A;  2VG7 B;  3R7S B;  5A0Y B;  2RUG A;  1U26 A;  3GG0 A;  1FWP A;  4NA2 A;  2FJB B;  1F2H A;  4USM A;  3NAI A;  4IOA Q;  5IWA F;  4B9N A;  1XR7 A;  5ETP A;  1KLM A;  3NRB A;  1TKZ B;  2HBQ B;  3MEG A;  2CG8 A;  2JJ4 D;  8ATC B;  3KLF B;  2L9D A;  2DIT A;  1X8D A;  4UF4 A;  3R8Y A;  4ITS A;  3HT3 A;  4OHX A;  2VA2 A;  1SV5 B;  2JDJ A;  1UL3 A;  5E3C A;  3KK2 B;  3PZP A;  2QZ8 A;  2GGP A;  4QWB A;  1RAF B;  2W2P P;  4F2S A;  3GJS B;  4Y28 C;  4B3O A;  1XER A;  4K4X A;  1RAC B;  5LT5 A;  4YHH F;  2DCL A;  5KFL A;  1SKU B;  3LA0 A;  5F8M A;  2QL5 B;  3BQ1 A;  4OZL A;  1N56 A;  4CLP A;  2YWK A;  3TA2 A;  1CBK A;  2ZDP A;  1YJV A;  4FYW B;  2GJI A;  3D3B J;  4O3O A;  1N0V C;  1F2G A;  1U1O A;  4JI8 J;  2GV1 A;  2XEX A;  4LF2 A;  5KFI A;  3C6T A;  5K20 B;  4ZN3 A;  1HNZ J;  1UVM A;  1QAX A;  2EFN A;  4OYO A;  1NAQ A;  3DLK A;  3IFE A;  3CJ3 A;  4I0W A;  1SPB P;  2H3E B;  4J9L A;  2C3O A;  2IAJ A;  2P8I A;  4HI1 A;  2UZA A;  3M8Y A;  5HI7 A;  3M2V B;  1MU2 A;  3LPE A;  4OV1 A;  1P1T A;  3IAM 9;  2BW2 A;  3OXL A;  3O8W A;  4I2P B;  1R3N A;  5L1J A;  2M2B A;  1U47 A;  2HUR A;  1J5E J;  4K4U A;  1H73 A;  1RWU A;  3OUY A;  3LW5 C;  1NJZ A;  2KHD A;  2DR8 A;  1ZAX A;  2MMY A;  3BR9 A;  3RBZ A;  3AY0 A;  3GPA A;  1HMV B;  4O3N A;  1LV5 A;  4LFC F;  1TUW A;  1R8C A;  2AZ3 A;  2V2K A;  3ILJ A;  4K4T A;  1H74 A;  4ECY A;  3QAT A;  2OI2 A;  1JLG B;  3Q8S B;  2VDI A;  4NL5 A;  2HMI A;  4ZHR A;  2UXB F;  5F41 A;  4GVB B;  3I0S A;  2GIF A;  3UCG A;  1Z2L A;  3MR3 A;  3M6W A;  4YR2 A;  1VRU B;  2CKW A;  3I9V 9;  3BBB A;  1C0T B;  2CDR B;  2FD2 A;  2KFY A;  1N5Y A;  3QBC A;  4F7V A;  4ATN A;  2GMH A;  5IM0 A;  4V19 J;  2FC8 A;  3KYL A;  3IG1 A;  1JIH A;  1G2E A;  2V6A A;  2Q6C A;  4DU7 A;  4WU2 A;  3IRX A;  3RTV A;  1YZ7 A;  4NYO A;  3DYA B;  1OSD A;  3BBC A;  1ULR A;  3IO1 A;  1F6T A;  1UKU A;  4PQA A;  2G0I A;  3KK3 B;  1T03 A;  2WW8 A;  2XI3 A;  3HKW A;  3T3F A;  2VDH A;  1UJ5 A;  4DPT A;  1FTC A;  1U1M A;  2WBR A;  2R8J A;  1VJQ A;  4YB7 A;  2QG9 B;  1VK3 A;  4ZLL A;  4OYZ A;  4LF5 F;  3M8Z A;  3BV8 A;  3R6G B;  3QGI A;  4I1T A;  4ECQ A;  2I1R A;  2XMT A;  4ECZ A;  4DSF A;  2YKM A;  1WF0 A;  3W63 A;  3CB4 A;  4HLB A;  4X66 J;  4S0M A;  1IBK J;  2CWX A;  2R2R A;  1K1S A;  1XC9 A;  4IFY A;  2V0N A;  4R8U B;  4RW4 A;  2BDP A;  4DN9 A;  1Q82 T;  3HHK A;  3TP2 A;  3ILI A;  8RUC A;  1MWY A;  3J7Y U;  3KXD A;  3H42 A;  3GB0 A;  1FJE B;  4DXL A;  3ZTO A;  4LF8 F;  4Y2M A;  3HSJ A;  1Y5N B;  1S57 A;  3V4M A;  4J9S A;  4P72 A;  5AJ3 J;  4DR2 F;  2VIC A;  2ZH3 A;  3DDK A;  2KG1 A;  4NZ6 A;  4DG1 B;  4RNM A;  4MT1 A;  3C15 A;  1JWW A;  2AW0 A;  3CDA A;  1D9D A;  2CJY B;  3TVZ A;  3K5O A;  2MY8 A;  5J2M B;  3LO3 A;  1JJH A;  3OJS A;  3I5A A;  4H4O B;  1RGV A;  1YBA A;  1N54 B;  2FZG B;  1O51 A;  4N41 A;  2AU0 A;  2BA9 A;  3BGO P;  1A0O B;  2LDI A;  2XCP A;  1KNZ A;  1U25 A;  2OSR A;  3MEC B;  4QIE A;  3DRS A;  4ZPD A;  3HCX A;  4WXW A;  2W2O P;  4C7Q A;  2BRK A;  2YXL A;  5D6G A;  3PG9 A;  2JH3 A;  5KFQ A;  4NLG A;  1RT6 A;  2F7V A;  2Z2Y B;  1J5O B;  4RW9 B;  2YWH A;  4CLZ A;  5DRK A;  1EP4 B;  3Q0A A;  3KG4 A;  1B0T A;  1WDT A;  4OJ3 A;  1P9Q C;  2AP6 A;  2Z58 B;  3N6L A;  5LL6 d;  3TW0 A;  4DR1 J;  3M6U A;  2XMW A;  3RU0 A;  4CIO A;  1KRP A;  2CJX B;  4X65 F;  3NMA A;  1OYE A;  5E41 A;  4DUZ F;  1EAY C;  1NKB A;  3M8Q B;  3G6Y A;  3ET6 B;  4NML A;  1FWK A;  1I1G A;  3CO9 A;  4URQ U;  1BUX A;  4GC7 A;  1RQ0 A;  5HSP A;  5J1E A;  4JV0 A;  4YY3 F;  4QW9 A;  2NXN A;  4EO8 A;  2O01 C;  2JLF A;  3Q2T C;  1T8E A;  3GTY X;  4UY8 T;  5D77 A;  5KT6 A;  3AHP A;  1IKW A;  4K7Q A;  3ICL A;  1ZYQ A;  1AFI A;  4A8W A;  1Q0N A;  2RQK A;  4ZVT B;  1X4F A;  2ACM A;  3DLJ A;  3IGV A;  4MJK A;  2EK6 A;  4BC7 A;  2GJ2 A;  3NBP B;  2BX6 A;  4C8K A;  2CPF A;  1SH2 A;  3P3D A;  5C25 B;  3DRP B;  5BYQ A;  2IVF B;  2C1E B;  4X64 J;  3CJK B;  2F9J A;  5BXI A;  3KUE A;  4F4K A;  4NZ7 A;  2D3Z A;  2E5J A;  2HNY A;  3LP2 B;  1RT1 B;  5KFN A;  4DFK A;  2EEY A;  1CUL A;  4GO7 X;  2R8G A;  3KLE A;  2W25 A;  2WOM A;  2KRB A;  2VL1 A;  3LWM A;  2UXD J;  3PY8 A;  2HZC A;  3ENV A;  5KFD A;  1IWA A;  1Q79 A;  3OBI A;  2VZ9 A;  5T7L A;  4USK A;  1N5T A;  1OPZ A;  3ELH A;  4F26 A;  5D15 A;  5KG5 A;  4RW6 A;  2DR5 A;  2VFS A;  1X4A A;  3MPD A;  4IRD A;  2YWG A;  3BPD A;  1V5I B;  3TUP A;  1TUG B;  2IDE A;  2MHN A;  3JTO A;  5ETR A;  2ZBR A;  1S1T B;  3ZC4 A;  1Y5L B;  2MKS A;  3ZTS A;  1LWC A;  4C11 A;  1JXV A;  3CJ2 A;  1JXE A;  1ZAW A;  2WK4 A;  3RJM B;  3P6Y C;  2CQ2 A;  2MY7 A;  3RGI A;  3E51 A;  4WIQ A;  2YNH B;  1TKD A;  5IS2 A;  4WFY A;  2F4V F;  1VCT A;  2XS7 A;  4DDF A;  2R2T A;  2W9B A;  1S1V A;  5E3P A;  3U1M A;  4KSE B;  1UPM B;  4Q45 A;  3NGT A;  5LMU J;  1E6V A;  2W9C B;  1R0C B;  2KDO A;  1TZ0 A;  1OS5 A;  1H2U X;  4GVL A;  4HYK A;  2UU9 J;  5HO4 A;  4I7F B;  2DY1 A;  3CCT A;  2LMI A;  1T7P A;  1TL4 A;  3EXC X;  4LRB A;  5L9X A;  1VRQ C;  2BQU A;  2AQ4 A;  2DIS A;  4ZLN A;  3LAN A;  1UVN A;  3DLL Q;  4ICL A;  5KAK A;  2VFR A;  2AJF E;  2IVM A;  5GME A;  1KD1 T;  2Y3Y A;  1FXD A;  1LWX A;  2NLW A;  4P10 A;  2VPZ B;  4HDH A;  5T41 A;  3CCZ A;  4ZPB A;  4I6Y A;  4C8Y A;  9ATC B;  4NLW A;  4CO1 A;  4WYW A;  1U1K A;  3PKM A;  1AUD A;  1S77 D;  3CJT A;  3MMA B;  3QLH B;  5D3G B;  2MB0 B;  5H1S V;  1P8G A;  4CH1 A;  2XYG B;  1BC6 A;  4KT0 C;  3FRZ A;  3OXF A;  5HJX A;  5SZT A;  4BWJ A;  4WE1 A;  4A8S A;  4MIB A;  1KQF B;  1RDR A;  2XMV A;  3DM2 B;  1X31 C;  4JV2 A;  4MKB A;  4DR3 J;  1R0A A;  1XJW B;  3UNY A;  3TQ1 A;  1SL0 A;  5D0R A;  2AZ1 A;  4FZV A;  4LRF A;  2VQF F;  4LF4 J;  3MM7 B;  2VPW B;  1NZA A;  3GYX B;  1D8Y A;  4NCG B;  2G0C A;  4C6A A;  1KLN A;  4AND A;  4O3S A;  2ABY A;  1H38 A;  1WTF A;  1Y00 A;  5KFE A;  1R7I A;  3QZ8 A;  4DUY J;  4O3P A;  2W4P A;  1JJC B;  2DIU A;  3C19 A;  5AE2 A;  3ZZO A;  1XN9 A;  4R25 A;  1HQE B;  2VQE J;  2AX0 A;  1P1L A;  3CJQ A;  4W90 B;  1CVJ A;  3OSP A;  4PQU B;  1EJ7 L;  2KFN A;  2BJE A;  2NSC A;  3AB4 B;  3OW2 R;  1SB6 A;  2OPR A;  4JOU A;  3KK1 B;  1RTH B;  2OEK A;  4JUZ A;  4GKK F;  2M88 A;  2VG6 A;  4OX8 A;  4LSL B;  2ILY A;  4YB1 P;  4IQX A;  4ES1 A;  2NXC A;  4F4Z A;  4U96 A;  3QO9 A;  3DOL B;  3GSI A;  4G1P A;  4M63 A;  3HZG A;  4OJ1 A;  1E6Y A;  1N33 J;  4PG8 A;  4QYR A;  1NDK A;  1TL3 B;  1Y4Z B;  3THV A;  4F3M A;  4C4W A;  3CJ0 A;  4CO3 A;  3RAM A;  5KFT A;  2ZJR Q;  1UWB B;  3UDE A;  1KSP A;  2LEP A;  3MEE A;  2ASY A;  1MNE A;  2A3J A;  2XMM A;  1KKH A;  3KLH B;  2U2F A;  5GAH U;  1WDD A;  3QAU A;  2YKP A;  4C0B A;  4O4G B;  3H0P A;  2BAB A;  1R31 A;  4CTA A;  4I68 A;  1WOR A;  3PYG A;  3GJR B;  4LBH A;  3SMZ A;  3NG8 A;  1DAX A;  4WFZ A;  4DPY A;  2N7C A;  1VQO S;  2J6T A;  2XLJ A;  3DHX A;  4DV6 F;  4JI2 F;  2I9S A;  4U95 A;  3ADA C;  1YGY A;  3FVY A;  5IT9 U;  3R2C J;  3LTO A;  4AQY J;  3IWN C;  1JLB A;  4X4T A;  1WOS A;  3HPO A;  1UVL A;  4PUO A;  4TLQ A;  3J81 j;  4KHR A;  1FT8 A;  2JL9 A;  1QY7 A;  3M2U A;  3G2X A;  1YKW A;  4PZV A;  1UVK A;  1HR0 F;  2ZZT A;  2JX2 A;  4WFA Q;  4KQZ A;  7FD1 A;  1NJI T;  2V63 A;  3CO0 P;  2Q79 A;  1CJU B;  1PYS B;  5KFS A;  1RWO B;  4ZK7 M;  3MOJ B;  1DTQ B;  3NNH A;  4LSN B;  4MH8 A;  3CCR S;  3A12 A;  3M6X A;  4C8N A;  1Y5I B;  5KFM A;  2OPS B;  4P9S A;  2GAH C;  4K4Z A;  2DXD A;  2KM8 C;  1T05 B;  3L7U A;  3FJ2 A;  3HSG A;  2JC0 A;  2J7K A;  1VQP S;  3ZNJ 1;  3EYZ A;  3AB2 B;  3J7Y I;  1L3K A;  3MR2 A;  4EZ6 A;  2YNI A;  2DNR A;  3OVA A;  3LGN A;  3TZZ A;  3RW7 A;  1WI6 A;  1S6Q A;  5H9F K;  2ZC3 A;  4NXN F;  1DLO A;  2WW4 A;  2HQF A;  1VGY A;  1B70 B;  5ETK A;  1IBC B;  2JVO A;  5F9N A;  2HEK A;  2AHO B;  3WIU A;  2HBY B;  2HHP A;  2HAI A;  2LYV A;  3H90 A;  2RRN A;  3OFE A;  3J80 Y;  2JLE A;  3I55 S;  4X62 J;  1RWN B;  2GIR A;  3PXG a;  2QL9 B;  3IBF B;  5KG4 A;  1WHW A;  1IR2 A;  4ER8 A;  2HRY A;  4J90 A;  1ZA1 B;  1HBO A;  2MZS A;  3AAW B;  3DKD A;  2EWH A;  2LEA A;  3A13 A;  4YQW A;  1NPK A;  1Z2Z A;  2CQB A;  2ROE A;  4IUF A;  3D66 A;  1T94 A;  4Q8F A;  3R5D A;  4B17 A;  2CPE A;  1YDL A;  1RB0 A;  2RUS A;  2IYI A;  1TKZ A;  3FDS A;  4G1Q B;  2EG2 A;  1K44 A;  3A8J A;  5LM7 E;  3W66 A;  4GKJ F;  1B0V A;  3L9Z A;  2B4U A;  1FKP B;  3EIC A;  1YJR A;  4OZJ A;  8AT1 B;  4B9U A;  3JSM B;  4ZP6 A;  5J1P A;  1FKO B;  2WVE A;  3V81 A;  4F3Q A;  1XMO J;  3E01 B;  4KAI A;  2PGC A;  4B3R F;  3K17 A;  3NGD A;  5J2P B;  4OHV A;  3R1H A;  1L3U A;  3LOU A;  1BXN A;  3W61 A;  3GJQ B;  4WTY A;  1B64 A;  3BGR B;  2EFO A;  3D5M A;  2X1F A;  4X84 A;  4Y0F A;  6FD1 A;  5EGY A;  1H7X A;  2CNO B;  4LRD A;  4QPT A;  2MYF A;  4OX6 A;  1SVD A;  5KFC A;  4BHQ A;  1HI8 A;  1IKX B;  1WF2 A;  3KJN B;  2MLY A;  1QAY A;  3OFH A;  3PAC A;  5J2N B;  2EXU A;  2JLG A;  2HNZ B;  2HHS A;  3PNI A;  2HIQ A;  5H9E K;  2B0G A;  1PBA A;  3OL6 A;  3NXZ A;  2AYM A;  1HBN A;  4K2X A;  1UVI A;  4FKY A;  4G6V B;  2B3T B;  1U1L A;  4OI4 A;  3GIK A;  1M1K T;  4ETX A;  3FEZ A;  1RT2 A;  2PC6 A;  2QA1 A;  4OI0 A;  4CNY A;  2QJ3 A;  2ZH7 A;  4I2P A;  4K4W A;  2AD9 A;  2DR7 A;  1X4D A;  2ASL A;  4JP8 A;  4ZCI A;  2FIU A;  2R8K A;  3MD3 A;  4Q2M A;  2ZFH A;  1AXQ A;  3C2P A;  2BJ1 A;  1PBU A;  4CLT A;  4L3K A;  2H9Z A;  1HMV A;  4DV0 F;  2J7W A;  4CCH A;  3W8P A;  3SCI E;  1X9S A;  2JEF A;  1DQ8 A;  4O4R A;  3VZI A;  3SV4 A;  1N32 J;  3F56 A;  2DGO A;  3MOZ A;  3VZH A;  4C3L A;  5LSO A;  3V5R A;  1H6K X;  4Q7A A;  1I5O B;  1SJF A;  1VQM S;  3FCH A;  1UWA A;  4JV1 A;  1TFW A;  4DEZ A;  4GVB A;  3T1A A;  1FVS A;  1IQZ A;  4IRK A;  2ROP A;  4Q43 A;  3QZ7 A;  1TFY A;  5C42 B;  4Z7C A;  1CJK A;  1NK4 A;  2HWT A;  1RWM B;  3GR0 A;  1QJH A;  4MTP A;  3DCA A;  1RAO A;  1ZH5 A;  4PWD B;  3D6F B;  4ENO A;  3PYE A;  3IWX A;  1VQ7 S;  3QIP A;  4FYY B;  1KFS A;  1HBM A;  3UR0 A;  1VC5 A;  5HLF B;  4NXM J;  3ZTP A;  4DMZ A;  1VRT B;  1U0S A;  3M8W A;  1FEH A;  4C8O A;  3OL8 A;  4M5M A;  3GJT B;  3I5C A;  3G9C A;  3O2I A;  1I94 J;  3KK3 A;  2WVB A;  4FF1 A;  4ID8 A;  3V4I B;  2HHT A;  1JKH B;  4JYA F;  5KFH A;  2LQJ A;  4URS A;  2GNK A;  1GXT A;  1URR A;  2R7O A;  4PWU A;  3G8S A;  5ETL A;  1VR6 A;  4OZ1 A;  2BKO A;  3GLJ A;  1T9Y A;  5FDL A;  2UUT A;  4TU7 A;  2VON A;  4NMX A;  1U6Z A;  2DXE A;  1X9W A;  2DH8 A;  2YY3 A;  2ZOG A;  2RKI B;  1KS2 A;  1GMW A;  1FJ7 A;  1LWE B;  1IBL J;  2AYG A;  2AWZ A;  1QVF R;  1R6V A;  4KTQ A;  1SIW B;  2RHS B;  3VHQ A;  2H4Y B;  4A46 A;  3OLB A;  3JYT B;  4OLO A;  2WSF C;  3O3L A;  2RQC A;  3DU5 A;  3THP A;  2DTJ A;  1RU1 A;  2XM3 A;  2YVS A;  4IOC Q;  4NX9 A;  2QA4 S;  4JI0 J;  4DR4 F;  1DQA A;  3PR4 A;  4KHM A;  3HUL A;  3T41 A;  2EI5 A;  3H40 A;  4X4R A;  3AH6 A;  1ZTW A;  3K59 A;  4N56 A;  1RXO B;  4DJB A;  2CQ3 A;  1FE4 A;  2VPX B;  4NA3 A;  2ZH6 A;  4KBI A;  4LMZ A;  3CD0 A;  4DQP A;  2JFK A;  5CYM B;  4MAK A;  2CXE A;  1MG7 A;  4EK2 A;  2CG4 A;  2BW7 A;  2GX8 A;  4ANC A;  3ITH A;  1X7V A;  1JB0 C;  5AT1 B;  4E0D A;  3RRK A;  2N82 B;  1Q16 B;  1DTT A;  1U24 A;  4MFB A;  3MEC A;  4JV5 J;  3K0J A;  5J2Q B;  1CC8 A;  1KVJ A;  4KV8 A;  3PKY A;  2XC9 A;  2CA9 A;  3G6V A;  3TX8 A;  1KVI A;  2OFG X;  1HNX F;  1UPP A;  3CE8 A;  4RW9 A;  3OSN A;  4EBD A;  4LF7 J;  4KGX B;  1YLX A;  1HNV B;  4J9V A;  3LPY A;  1SL2 A;  1LK5 A;  4M5D B;  1H2T Z;  2MPU A;  3OR2 A;  3G4S S;  4R5P A;  3E3X A;  1YG0 A;  2EK1 A;  1NHV A;  3MTJ A;  1EX8 A;  3I96 A;  3CUL A;  1KLM B;  3AOD A;  4ES3 A;  1HI1 A;  3TVY A;  2FQQ B;  2QA4 G;  3L09 A;  1YBT A;  3MEG B;  3F73 A;  4QU7 A;  2R7U A;  4ZKA A;  2KYZ A;  3W5X A;  1VIO A;  2Q3P A;  1VQK S;  4UUW A;  4BBY A;  3UW1 A;  3W1Y C;  4ED3 A;  2XUL A;  4B3O B;  3L7O A;  3NGK A;  2Z2L A;  1JMT A;  4USU A;  3TQE A;  2DO0 A;  4KY3 A;  5GAH I;  2YBV A;  2IA6 A;  2V5H G;  1ZET A;  5CCM A;  2RQM A;  2ZH2 A;  2IVY A;  1G7C B;  1F9E B;  5DQH A;  4O3R A;  4DR6 F;  2J6S A;  3GIM A;  4F67 A;  3GIR A;  4KC5 A;  3AA8 A;  5D0E A;  4BS2 A;  4ECW A;  1RAB B;  2Q1L A;  2DB1 A;  2ZHA A;  1I3O B;  2BKN A;  4NZ0 A;  3C6T B;  2HKE A;  5L9N A;  2C2K B;  1WC4 A;  3RUB L;  4ZVO B;  1DRZ A;  3BYR A;  4IQM A;  2PN6 A;  3TEH B;  2DRB A;  4DS5 A;  4IO1 A;  2HGN A;  3DLK B;  4OX9 J;  2WON A;  3CCL S;  5G0R A;  2IAJ B;  2QT7 A;  3W8G A;  4RUB A;  4EYH B;  3L4B C;  3MDF A;  1NJY A;  1RWK B;  4FXV A;  4WYL A;  3MFI A;  2M70 A;  2MJN A;  4RBT A;  3V6D B;  1U1Q A;  2FHJ D;  4CQ1 A;  1AA1 B;  1F3F A;  5F8I A;  1RA6 A;  1ARO P;  3CXC R;  5LMN F;  1FF2 A;  3M8S A;  5F8G A;  3TUI C;  4F50 A;  3OUY B;  4TY8 A;  4ZVG A;  4OHW A;  5GAG U;  2A2D A;  3THT A;  5F8H A;  2FJE B;  1FNM A;  3KHL A;  1K1Q A;  1P6T A;  4DLG A;  4USJ C;  2QL7 B;  3KG1 A;  5HQ8 A;  2JSX A;  3PW2 A;  1NSP A;  1YJN S;  3N79 A;  1X0F A;  2Z8Q A;  2G2Y A;  1FRX A;  1O0P A;  2B56 A;  1FRM A;  2IBK A;  3H5X A;  1S1T A;  3AOC A;  4EBC A;  4DPO A;  2CYY A;  4FXD A;  1WKK A;  2HPU A;  4I56 A;  3CME S;  2VOD A;  1N34 J;  3FQK A;  2RDD A;  2HMI B;  2D69 A;  4ZHR B;  2Z57 B;  2YNH A;  1S79 A;  2G2O A;  2M8H A;  4RNH A;  4EYI B;  4E2F B;  2RH3 A;  1NKE A;  4C3K A;  2OP5 A;  2HGL A;  4LRA A;  3ULH A;  2I5J A;  1WKJ A;  1C2P A;  1T9U A;  5DQG A;  5A8W A;  4MIW A;  3QMQ A;  5KT4 A;  4NYZ A;  4DSE A;  4PG6 A;  3BQ0 A;  5I42 A;  1R89 A;  4JB8 B;  3GWC A;  4Y2A A;  4ZN1 A;  4Q8E A;  4DL5 A;  1N5Y B;  1WG1 A;  1ICE B;  2Z30 B;  2R7X A;  2HLU A;  1MMD A;  5C2G A;  6FDR A;  4KH0 B;  3IM9 A;  3H4B A;  5IM0 B;  3FBC A;  4L76 A;  3IG1 B;  2NS1 B;  2KZM A;  2HND A;  1GXL A;  3MM6 B;  2XGQ A;  2DNK A;  1NDP A;  1VMB A;  2BE9 B;  5DG9 A;  1HNZ F;  4KHP J;  1T03 B;  4CH0 S;  1PYO B;  2CZ4 A;  2D9P A;  3KLG A;  3JQM A;  4Y6I A;  2XMK A;  5EWE A;  1HIY A;  3KWM A;  3MMA A;  5D3G A;  1ZPW X;  2HLT A;  3ZNU A;  3D3C J;  2RU3 A;  2AJ2 A;  2AT1 B;  1V3S A;  1J27 A;  2PDA A;  5F8N A;  1R8H A;  3G87 A;  1NO8 A;  1GQE A;  3M30 A;  4F2R A;  1J5E F;  2BOP A;  2KJV A;  4ECU A;  2J6U A;  2NR0 A;  3UN2 A;  4CLW A;  2PA3 A;  2HGM A;  3DNC A;  3GE9 A;  2NXU A;  3DRR A;  2YKM B;  4PG7 A;  5KFO A;  4P6Q A;  2K8G A;  3G86 A;  1H2V Z;  1HA1 A;  1RZM A;  1RWP B;  3WIV A;  3ZO7 A;  1Y3J A;  2GA7 A;  4IFY B;  3MM7 A;  4B3T J;  5LJ5 Y;  2BVZ A;  4RW4 B;  4DF8 A;  4ZPT R;  5IV3 A;  1OQ6 A;  3HT0 A;  5CYQ A;  1L3T A;  2G4B A;  3OTC A;  2V4J A;  2WTF A;  3NKY A;  2UUB F;  2M5Y A;  1HQE A;  2HRT A;  4L75 A;  3I56 S;  2CPY A;  3C15 B;  1VQ8 S;  1WC1 A;  1ACM B;  4QWC A;  2KYX A;  4J37 A;  3OL7 A;  2RT3 A;  3F44 A;  4BDP A;  4N77 A;  4C97 A;  2M52 A;  3KTQ A;  1U2C A;  3HVR A;  3BB5 A;  2EBG A;  4YR0 A;  1SC6 A;  3QT7 A;  3H59 A;  5EHH A;  1LWF A;  2R42 A;  4G1I A;  4MYU A;  3BKF A;  3PW7 A;  4OLP A;  2V4R A;  3CVK A;  4NEZ A;  1S72 S;  1QUV A;  2XNQ A;  2GW8 A;  4KKO A;  1GAO A;  2BEF A;  3D6T B;  2FJW A;  1RT6 B;  3QGH A;  2HQI A;  2X51 A;  3O5T B;  5IWA J;  5K9F A;  3D0G E;  3PIO Q;  3M2R A;  4OYB A;  4ZIV A;  3RW6 A;  1CPZ A;  4ECV A;  2YKO A;  2CDQ A;  3DOM A;  1S49 A;  2VF3 A;  2G9O A;  2AYB A;  4FYV B;  1YTY A;  4PR6 A;  2KH9 A;  4PG4 A;  1PJ7 A;  2IJN A;  3GR1 A;  3M8R A;  3VGV A;  5DET A;  2R7S A;  4KPY A;  3QJJ A;  1NME B;  2FHK A;  1U6B A;  2IY5 B;  4DPX A;  3DGP A;  5HBM A;  3NOG A;  5KT5 A;  2BBE A;  4X66 F;  1IBK F;  1OY9 A;  2CJ9 A;  4FPI A;  4OZ3 A;  2R4F A;  2W2Q P;  5K8N A;  4G3I A;  2K3K A;  2DRD A;  5J1E B;  2AEM A;  3PW0 A;  4KFB A;  5L39 A;  2ERR A;  4KIA A;  1ELO A;  3BDE A;  1RHM B;  1IKW B;  2BMB A;  2HVE A;  4NPO A;  1VQS A;  1TAU A;  2CFX A;  2N3L A;  3H98 A;  2WHO A;  3MM5 A;  3CIM A;  1U2R A;  4KRW A;  4YR3 A;  5AJ3 F;  1FDB A;  4NOH A;  2Y9H A;  2UUA J;  4HI2 A;  4ECX A;  2C2E A;  3HKZ D;  3UDL A;  3BZQ A;  3B4D A;  5I3U B;  2I6W A;  3AD8 C;  3OT9 A;  1IBM J;  1RTD B;  1GT8 A;  4DWI A;  1IXK A;  1DTQ A;  2OTL S;  2JRS A;  5AXN A;  3QQC D;  2FZK B;  2IRY A;  4RUH A;  2RU9 A;  2DGQ A;  2HNY B;  5U47 A;  5B0F A;  1CUL B;  2YX4 A;  3WHI A;  3KLE B;  4DCJ B;  1B4S A;  3SBM A;  4FF3 A;  4DBQ A;  4LFC J;  5T7L B;  3PX6 A;  3CCJ S;  1CJT A;  3MMB B;  1PJ5 A;  1W25 A;  2XYP B;  3ENW A;  1FE0 A;  2X1G A;  2VBW A;  2ACY A;  2GMJ A;  3DFE A;  3H2L A;  4RW6 B;  3FBE A;  4QOT A;  2WB4 A;  2QLW A;  2MQL A;  2F3J A;  3Q89 A;  3TRG A;  2IDL A;  4ZLJ A;  2I0X A;  4DOZ A;  3CC2 S;  3JS9 A;  3MWB A;  4OYM A;  4WFB Q;  4NRT A;  5D4P A;  2CPJ A;  4LUB A;  1TL1 A;  3SIP B;  4L74 A;  3I5B A;  3GU0 A;  2KRR A;  3D6H B;  4JI4 J;  1UA0 A;  1LWC B;  3CCM S;  2NQP A;  1FER A;  3M1V B;  4C11 B;  2WBM A;  4J5O A;  1WF1 A;  2G0J A;  2XMJ A;  3AD9 C;  5ETS A;  2LU2 A;  1YZ6 A;  4PWW A;  2GQC A;  4L6V 3;  5KOX A;  3K58 A;  3R5A A;  1S1V B;  1FTR A;  4LIW A;  3MHY A;  3MGJ A;  2PMZ D;  1YJ9 S;  1E6V B;  2KKH A;  2C2N A;  5FLX U;  1VQL S;  1FRL A;  2V9K A;  1KDN A;  3N9U C;  2VH7 A;  5C24 A;  2W1B A;  3JSM A;  1XQI A;  2QE5 A;  2XWY A;  4LRE A;  1LK7 A;  4ICL B;  1EKS A;  5J2P A;  3LGH A;  1TP7 A;  1F3V A;  1M5S A;  2WVF A;  1RTZ A;  3SEO A;  2R2U A;  3VAF A;  4EFA C;  4CT9 A;  3MR5 A;  2IM1 A;  2K3I A;  3QPI A;  4N8O A;  1NJW A;  4OZ5 A;  1WAC A;  1JLE B;  4R0E A;  2ATC B;  2OLW A;  3KG0 A;  1NU4 A;  1U8W A;  4PYD A;  4ILR A;  2VA3 A;  5DZ6 A;  5IC6 B;  4WCE Q;  5KG3 A;  2UUC F;  3T5K A;  1HI0 P;  4C0H A;  2UXD F;  4WE1 B;  1DJ0 A;  3RR8 A;  4X4Q A;  2ZE2 A;  5L38 A;  1YIJ S;  1NH8 A;  3CMQ A;  4IG3 A;  4FBT A;  3MEK A;  4NI2 A;  3KKF A;  2CIM A;  2PSZ A;  2MZ1 A;  2J8A A;  3WC0 A;  5AXM A;  3TAQ A;  4O3Q A;  1FRJ A;  5LSR A;  3LH2 S;  2YNG B;  3A3N B;  5F8J A;  4EUV A;  4LF8 J;  1M5P C;  3CTR A;  1D0E A;  3X1L B;  3DDI A;  2VBZ A;  5RUB A;  3L95 X;  2KVI A;  3HSZ A;  2XY7 A;  5E2Q A;  1VQ4 S;  1L5U A;  3V6J A;  2VFT A;  5T14 A;  3TOQ A;  5IT9 Y;  4ECR A;  1CQM A;  5BJR A;  1OY6 A;  2FZC B;  5HQM A;  1RTI A;  5F0U A;  3R5C A;  3AJ2 A;  4NLP A;  5GVQ A;  4DL4 A;  5M2U A;  2N7Y A;  3WC2 A;  2FHO B;  1FEE A;  2QV6 A;  3ZZY A;  3KJF B;  5D0G A;  2YTC A;  3V2U C;  3CJ5 A;  3KJQ B;  3PEJ A;  2OPR B;  1BE4 A;  3EDR B;  3NLC A;  2VIH A;  5F0W A;  2IIH A;  3PRV A;  3Q83 A;  1TK8 A;  2E7X A;  1LFW A;  2VG6 B;  3FSX A;  4JI6 J;  2B4V A;  1HFE L;  2GCF A;  3QT8 A;  2ZNY A;  1Q8B A;  3BRE A;  1GXU A;  4DN0 A;  4LQ3 A;  1JLF A;  2IC3 A;  4PWD A;  3IP0 A;  1KP6 A;  5DO2 A;  4U7U K;  4IYQ A;  1JLQ A;  4WFX A;  4FF4 A;  1MN7 A;  3VVU A;  1VRT A;  5A8R A;  2KTQ A;  1S6P A;  3PDN A;  4DUZ J;  3MEE B;  1D09 B;  2L08 A;  3VGS A;  5EDW A;  2DHH A;  2GZO A;  5B0D A;  1HQU A;  5F8L A;  1QM9 A;  3LP0 A;  1NHU A;  3V4I A;  2KI2 A;  1SQE A;  3HVT A;  1X0P A;  1EQ0 A;  3R3T A;  2XB2 D;  1Y11 A;  3QRR A;  4DR3 F;  4ZVR B;  3T1H J;  1EET A;  4Y2C A;  2NZC A;  1S76 D;  2CQC A;  1UW9 A;  2BZ2 A;  4J9U E;  2DKO B;  4LF4 F;  1R8B A;  2ADC A;  2RKI A;  2Z0G A;  1S0N A;  3UVJ B;  4J9K A;  1UJ4 A;  3HHL A;  3MUT P;  2H5E A;  2E1M C;  1JLB B;  2XLK A;  4OI3 A;  2CPZ A;  2BRL A;  2KM8 B;  2H48 B;  4DUY F;  2V50 A;  1EIY B;  3HP6 A;  3QYY A;  2QFJ A;  3M2U B;  3ZZR A;  3DHW C;  1HWU A;  1S4F A;  2K1R B;  5CD4 H;  3OHA A;  3JYT A;  1UFW A;  2MQP A;  4FVM A;  2YH0 A;  4JI5 J;  4RZR A;  3K8V A;  3FCV A;  4MIA A;  1X5P A;  3W60 A;  4DV2 J;  3NY0 A;  1BGX T;  2ZUG A;  4KGV B;  1JLC A;  1S99 A;  3RR7 A;  1SCJ B;  2ZH1 A;  3Q2S C;  4WWS A;  4RKU C;  3EGV A;  2YPZ A;  4ZVS B;  1FCA A;  3TAM A;  6AT1 B;  3HHL C;  3FFI B;  1F1B B;  4DHV A;  2XZD B;  4K2J A;  1D9A A;  2V68 A;  5CYM A;  1OMS A;  5DLG A;  5DDO C;  1VS3 A;  1SKR A;  1H72 C;  2YNI B;  2CQD A;  1Q8K A;  1CJV A;  4DS4 A;  4QYZ K;  1N33 F;  1TAQ A;  2ZZM A;  3VGU A;  1DLO B;  2VFV A;  3C6U B;  4C3M A;  3TZW A;  5CZX A;  3PHT A;  1S4E A;  3TUJ C;  1NB2 A;  4YUD A;  3K5L A;  3QT5 A;  1FNO A;  2OUG A;  1FX2 A;  1TVR A;  3PYF A;  4ZA1 A;  5J2Q A;  2IM0 A;  3C16 A;  3WX4 A;  2R8I A;  1S1W B;  1OSC A;  3KJV B;  1YI2 S;  4ELT A;  5KFP A;  3J81 U;  5H9F J;  2DPJ A;  4WP3 A;  1HBO B;  2E5L J;  3N5F A;  1HW8 A;  1RIS A;  5IT0 A;  4M5D A;  4NLU A;  1G4C A;  2QMU B;  3U1N A;  2D9O A;  5KTQ A;  2QLF B;  4OIX A;  4HH0 A;  1RTJ B;  4CLL A;  1NK6 A;  2YX7 A;  3DXS X;  3HHD A;  2W4C A;  2XO7 A;  3NNA A;  2IPO B;  3B54 A;  4WK3 A;  3EPG A;  2HZV A;  3PJX A;  4AQY F;  1FES A;  3P96 A;  2HFS A;  3IWL A;  3MM9 A;  5KG1 A;  5CA5 A;  1YHQ S;  3Q8R B;  1N36 F;  3V81 B;  4LIR A;  3CCQ S;  4FYX B;  3VAG A;  3G82 A;  1YVF A;  1NJX A;  3BM7 A;  1RU2 A;  3PYD A;  1FD8 A;  5JXS A;  2LFV A;  3A3O B;  2DT9 A;  2MZR A;  4M8L A;  1EKR A;  1M1G A;  4JBC A;  2VFU A;  5L1K A;  3SCJ E;  4A8F A;  2CPD A;  1CG2 A;  2Y1R I;  3SFG A;  1F60 B;  4KB7 A;  5I3Q A;  1H0H B;  4P2M A;  2RDI A;  1IJE B;  1PAU B;  2FC9 A;  1XR5 A;  2LA6 A;  2B7C B;  2IM3 A;  5B0A A;  2NXJ A;  2D74 B;  1C1B A;  5KFF A;  1OIA A;  4IRC A;  4M5G A;  5E5N A;  5FII A;  3BSO A;  4BC9 A;  5KFR A;  1HBN B;  2E7V A;  4B3S J;  3D0H E;  4QQB A;  3W9I A;  1RT2 B;  7AT1 B;  3V6D A;  5HQL A;  3B8H A;  3FKB A;  5K5M A;  2V69 A;  2XGP A;  5AXL A;  2V8G A;  5DGA A;  1WI8 A;  4X62 F;  2E1P A;  4Z37 A;  2XZW A;  2GVD A;  2QLB B;  1PKU A;  2QMX A;  4ZVQ B;  2HFN A;  3D7S B;  4TN2 A;  3UPF A;  2OKQ A;  2K2P A;  3AJD A;  3IAS 9;  2MGZ A;  3IN5 A;  4P74 A;  4NE9 C;  2MSS A;  3R1L A;  4GKK J;  1IVZ A;  3I0R A;  3CT9 A;  2LQB A;  1UMJ A;  1RUS A;  3ISZ A;  5K8M A;  1JXL A;  1XR6 A;  4H4K A;  1Y3K A;  1NCL A;  4NLS A;  1RAE B;  3QSY B;  2FVR A;  3TAR A;  2UV8 G;  1IKV A;  3TWZ A;  4FXW A;  3VGT A;  4ZDN A;  1H98 A;  1UEV A;  1CJK B;  4AFF A;  2HFV A;  1RKI A;  1JNR B;  4WXO A;  1S1X B;  1D3W A;  3ENA A;  4CLY A;  2FYX A;  4I4B A;  3VAM A;  1QSS A;  3QIP B;  2LKZ A;  1GMV A;  2W7A A;  4PRF A;  2MJU A;  1HBM B;  2VV5 A;  4RJV A;  3FBF A;  2HFO A;  4P75 A;  4H4K C;  3MM6 A;  1RSC A;  1TR0 A;  3EJM A;  4RW8 B;  4F0H A;  2JFD A;  1KR4 A;  4HAC B;  3EGN A;  2XNR A;  3G8Q A;  2F9D A;  3UDV A;  4WPA A;  2AGQ A;  3F41 A;  2GO8 A;  5FDL B;  2BUN A;  4QU6 A;  3UI3 A;  2F8E X;  3OTE A;  3NEK A;  3MMC A;  2E9R X;  4OYA A;  2KT2 A;  3R5B A;  4P73 A;  4ANE A;  4OYW A;  4ZJO A;  3GG1 A;  3U02 A;  1S48 A;  1WG4 A;  1Y10 A;  3P45 B;  3MPU B;  2X1A A;  1KBR A;  4AYB D;  5IXU A;  2FVS A;  4CYU A;  2ZZN A;  2QTW A;  4NCB A;  4OFZ A;  2JC1 A;  1T02 A;  3PX4 A;  4DI6 A;  1D1U A;  2VUG A;  1KN6 A;  4EU0 A;  1N48 A;  3R9L A;  3SCL E;  2Q43 A;  1D9F A;  5DDQ C;  1N32 F;  1X4C A;  3KMS A;  3T1Y J;  1JLA B;  2Z56 B;  4O44 B;  4QIF A;  2RF2 A;  3BS9 A;  1GNK A;  2ZOM A;  3T9N A;  1S0V A;  4C48 A;  2XQC A;  3G6E S;  3DLE B;  5DDR C;  1RBA A;  1QSY A;  4ZPA A;  2L41 A;  2CQ1 A;  2DIV A;  1RYR A;  4WFN Q;  1FFS B;  3GV5 B;  4NXN J;  1XMQ J;  1SIZ A;  3MCS A;  3QRP A;  2F63 A;  4ZS6 A;  2NPI A;  4FNH A;  3FMB A;  4LF6 J;  4LVN P;  4RW7 B;  2DK2 A;  3ITH B;  5ETO A;  4CP5 A;  3Q86 A;  2DNM A;  2HWI A;  4NXM F;  2OD4 A;  2V8D A;  1DTT B;  4MFB B;  2DJW A;  2ZH8 A;  1DAR A;  2CUY A;  3S6E A;  5EUH A;  4KV8 B;  3DN9 A;  2J0Q D;  1ZTT A;  2A6M A;  4Y2I A;  1I94 F;  3M05 A;  4LR7 A;  3BN4 A;  4DV7 J;  3M9N B;  4Y3C A;  1VLO A;  1KQK A;  4BWM A;  3FQL A;  2M3D A;  4MKY A;  2XY5 A;  2NUH A;  2GQ2 A;  4KYZ A;  2ZWO A;  1MML A;  4UQG A;  5L1L A;  4LSZ B;  2DXF A;  2OEL A;  2QRR A;  5C5J A;  3D1Q A;  5L46 A;  3W2V A;  4GKJ J;  3OR2 B;  4U67 Q;  3W65 A;  4R5P B;  2VC0 A;  3M9M B;  2F8M A;  3T19 A;  3HXM A;  4PPZ A;  1IBL F;  1PAE X;  4DV1 J;  4B3R J;  1RT7 B;  2VPY B;  3NGR A;  1RP5 A;  2A0F B;  4MKA A;  5KFX A;  1U02 A;  4CLK A;  1QLN A;  1VIS A;  4CI0 B;  5E33 A;  4LFA J;  1GTE A;  4CM2 A;  4JI0 F;  5HN0 A;  4KR0 B;  2QEX S;  1WC0 A;  3GV7 B;  1UAW A;  3QT6 A;  4B9T A;  2KFZ A;  2V8P A;  5HMZ A;  2EW9 A;  4Z2X A;  2HHV A;  4M1K A;  3CF5 Q;  4Y34 A;  4ILL A;  2MQM A;  3BH6 B;  3JAM U;  1S9E B;  4NA1 A;  5I3U A;  1RAI B;  2E5I A;  1T9V A;  1RTD A;  2MKK A;  5HRO B;  2CPX A;  3MCN A;  4HR2 A;  4RWX A;  2WON B;  5G0R B;  2UVR A;  3UR3 C;  4NLV A;  2R9L A;  2BQR A;  3DLG B;  4WJB A;  1JQG A;  1GK8 A;  1RLD A;  2Y1J A;  1X5O A;  4OHZ A;  3G6X A;  1XEZ A;  4JV5 F;  3WX8 A;  2WZ1 A;  1HWK A;  3OLA A;  1NND A;  3CIZ A;  1KWM A;  1VFJ A;  4TY8 B;  5DS7 A;  3MMB A;  4DCP B;  2QSF A;  4C2M A;  4LF7 F;  2YNF A;  2M7S A;  2MQO A;  4PXE A;  3OTO J;  5ETM A;  3Q22 A;  1AZS A;  5B7W A;  1VYA A;  4PEO A;  1UA1 A;  4DPW A;  3PR5 B;  3GFY A;  3PW4 A;  4GMK A;  3HJF A;  4HTJ A;  3HO1 A;  2DHG A;  4Q5V A;  3W3S A;  1VBY A;  1AT1 B;  3M1V A;  3AQP A;  3UNG C;  1XMB A;  1RT5 A;  5KT2 A;  4YP3 A;  1V3Z A;  3NCQ A;  2I5J B;  1M5H A;  5A8W B;  3JTP A;  2U1A A;  5KFU A;  1HD1 A;  3QJL A;  5I42 B;  2EFV A;  2NRE A;  1SL1 A;  3FGV A;  2YKN A;  2UP1 A;  4ZLP A;  4TU9 A;  5B0E A;  4X4S A;  3TAP A;  2HND B;  3BSN A;  1GX5 A;  1WEY A;  3H8Y A;  1R0B G;  4NLO A;  1SQF A;  3BSA A;  4EBE A;  2XSF A;  3S1T A;  3IR5 B;  2KG0 A;  2XI2 A;  2ROG A;  2DGV A;  3PFO A;  3H5U A;  3R2D J;  4TLR A;  5HAN A;  1FA0 A;  4O23 A;  4WII A;  4OX9 F;  3KLG B;  2BJ9 A;  3O44 A;  5A2Q U;  4DSK A;  2MZQ A;  4DR7 F;  1JLE A;  1LEO A;  4TY9 A;  2LXF A;  2PEH A;  2C28 A;  2ASD A;  1V9O A;  3JSY A;  3DC2 A;  2OH2 A;  1F0X A;  4GRS A;  3I32 A;  2DO4 A;  3M30 B;  4DLE A;  1U2F A;  4A8K A;  4PAB A;  5CH7 B;  2OIH A;  5CZV A;  1N5V A;  4UOF A;  2ZBC A;  3DRR B;  5KFG A;  5E0O A;  1C1C A;  4I2Q B;  3I82 A;  4ZJQ A;  1DBD A;  2XLI A;  3ISN C;  4FKX A;  4NWB A;  2Y0S D;  3BQ2 A;  1K73 T;  2YNG A;  3JQJ A;  4OQJ A;  1FJG F;  2O1P A;  3FCW A;  1KOO A;  2DNP A;  1YJT A;  3D54 A;  1YX2 A;  5CYQ B;  1VC6 A;  1LW0 A;  2J9C A;  2V4J B;  5HMW A;  5HP1 A;  2YQ1 A;  2W8K A;  2BV3 A;  3ILO A;  2HHW A;  3KUH A;  3LGM A;  5HAO A;  3BO2 A;  3NOC A;  3M4X A;  3Q8U A;  5L1I A;  1Q7Y T;  3ETM A;  1JJ2 R;  4JI1 F;  2ASJ A;  2RB7 A;  2B9X A;  2AJ0 A;  1U49 A;  1FK9 B;  1UCN A;  4YME A;  1ZAV A;  3H2U B;  1T9X A;  3SDE A;  2I8E A;  4I64 A;  4KPC A;  2OAU A;  3IGN A;  3NS6 A;  3RRG A;  4PCQ A;  1S1U B;  1T3N A;  4F3O A;  4QR1 A;  1LWF B;  3CC7 S;  2RQ4 A;  4G65 A;  4FPR A;  1K0T A;  3VV2 B;  4B3M J;  2CJK A;  4KKO B;  4KHP F;  4AUK A;  1U1R A;  2CNN B;  3W7B A;  1MLA A;  1LQ9 A;  3M2R B;  1X9M A;  3MMJ A;  4FDF A;  3C66 A;  3DOM B;  1RHJ B;  5BR8 J;  1U1N A;  2DH7 A;  2W2M P;  2E1R A;  2HQ3 A;  1NBE B;  4IO9 Q;  4A8Q A;  3NWG A;  2UVV A;  3TZX A;  9RUB A;  3CWJ A;  4IH6 A;  1AW0 A;  5KFK A;  1MRO A;  2DY9 A;  4HHH A;  3GQC A;  1YBU A;  3CD5 A;  1WOP A;  3DGP B;  5HBM B;  3I6P A;  7FDR A;  1MWQ A;  1PYT A;  3GCX P;  2MHE A;  2VOO A;  5HVG A;  2CZV C;  1PCA A;  4RNO A;  3G71 S;  4KFB B;  1X4E A;  1S9G A;  2F4F A;  3MCO A;  2RIL A;  3UVJ A;  4OZN A;  2RE1 A;  5E3R A;  3J7A 1;  2EFQ A;  1GH8 A;  2A2C A;  1FDN A;  4Z7Y A;  2C3Y A;  4PYA A;  3HK2 A;  3MM5 B;  2K1R A;  2DNH A;  4QJV A;  5KT3 A;  3QGP A;  3FZB A;  4ECS A;  5FLX Y;  1Y7P A;  1LNQ A;  4HHJ A;  3BJY A;  2ZHO A;  3ENQ A;  3NMR A;  4LT6 A;  3FSI A;  1HPZ A;  1RT4 B;  3LWL A;  1F5A A;  5FJ4 A;  2OTJ S;  3O1L A;  1FKA F;  1Q7L B;  3MXH P;  1V3R A;  3TA0 A;  2CNL B;  2QA2 A;  1DHM A;  1WSR A;  1L3S A;  4ILM A;  1WHX A;  3FFI A;  3IS9 B;  4CO2 A;  5DQI A;  5D4O A;  2C2O B;  3MCM A;  4LBI A;  2P9G A;  3NP5 A;  3M7V A;  3DXB A;  2BJ3 A;  1VBZ A;  5IFM A;  5CAA A;  1CJT B;  5E7O B;  4WP8 A;  3C6U A;  3D28 A;  2FLL A;  3FNN A;  1TKT A;  2RDJ A;  4YS2 A;  3BGF A;  4IFV B;  4KO0 A;  3Q24 A;  1T9W A;  4N7T A;  1XBW A;  1XIQ A;  4DX8 H;  4CNZ A;  2C2Z B;  3CJR A;  3WQP A;  1S1W A;  1SC4 B;  3KJV A;  1TL1 B;  3EDQ B;  3LP1 A;  3SYZ A;  2BR0 A;  4RR5 A;  4TVA B;  4EGL A;  5KFZ A;  2B6A B;  4NLT A;  4LJM A;  4I6W A;  3C14 A;  2VG5 A;  2GVZ A;  4QIW D;  3KLV A;  4DV3 J;  3UCU P;  2ZBP A;  3D9B A;  4OJG A;  3GYG A;  3X3U A;  2IM2 A;  3QRQ A;  1RTJ A;  4M94 A;  2XSJ A;  1T3O A;  1LXJ A;  2ZVS A;  3I9Z A;  1F9F A;  5DG7 A;  1WEX A;  4CO4 A;  3VAK A;  1G3O A;  4NLR A;  2MZT A;  5C24 B;  1BQM B;  1PIL A;  2OGU A;  2FB0 A;  3OTD A;  3OQ2 A;  2EFG A;  1JJ4 A;  1M1H A;  1Q8I A;  2M4M A;  3FRY A;  4U8V A;  3F0N A;  2L9W A;  3KMQ A;  2JNJ A;  3P8B B;  1EQM A;  1ZM3 A;  4EMD A;  4A48 A;  3P5T L;  1RBO B;  2UUA F;  4CZC A;  2JWN A;  2QN6 B;  5K14 B;  5E3Q A;  1IBM F;  3OR1 B;  3UD3 P;  5CYJ A;  1BWV A;  4Q0B A;  3HI9 A;  2ZH4 A;  5KT7 A;  1PC5 A;  4M5K A;  4PKD B;  3E8O A;  2AMC B;  1TUV A;  4PXB A;  1NDL A;  3KNG A;  3GIL A;  4CDI A;  2OD6 A;  5GAE U;  1UW4 A;  1SI9 A;  1HWJ A;  1XWL A;  4M5H A;  5MAO A;  4OI2 A;  2YQ3 A;  2GHP A;  2ZE2 B;  4IG3 B;  4NI2 B;  3PO4 A;  1LKZ A;  4ZP9 A;  1I51 B;  2IJR A;  5B0G A;  2R2S A;  4LFB J;  2M9K A;  2MKH A;  1TL7 B;  1S9F A;  1BMQ B;  2BJD A;  2B51 A;  4RLE A;  4TYB A;  5DZ7 A;  4DFJ A;  3ZXW A;  5AE3 A;  4ZIW A;  3D0I E;  3QWP A;  1N6Q A;  5B09 A;  4DF4 A;  2E66 A;  2V4Q A;  2UUB J;  4J9N A;  1OYD A;  2C3M A;  4QIV A;  4NLY A;  4AE5 A;  4MMO A;  3ZZT A;  2K7J A;  4JI4 F;  1VIX A;  2RRA A;  2OSQ A;  5C2C A;  2EPI A;  4DSJ A;  2ATL A;  3GIJ A;  5G4D A;  3IMQ J;  4K0K J;  3Q23 A;  1N5Q A;  4USW A;  1HD0 A;  1RTI B;  2BM1 A;  3HJV A;  4DR5 F;  1KOH A;  4LRC A;  2KU7 A;  2RIJ A;  2PO4 A;  3MUV P;  3CPW R;  1VC0 A;  3VAH A;  3L3C A;  1IR0 A;  2BAN B;  3A8K A;  3AOB A;  5IOL A;  2J9E A;  1Z1Z A;  3P5B P;  5HL7 Q;  2QYG A;  1RAD B;  2H54 B;  3GII A;  1FVQ A;  4W92 B;  1JLF B;  1QAJ A;  2IC3 B;  1S1X A;  3CGI A;  4QIG A;  1QVG R;  4C9D A;  1JLQ B;  4IOB A;  4RU2 A;  3SSR A;  3US5 A;  3JSR A;  2I38 A;  3H5S A;  4X4O A;  1X5T A;  4HHU A;  5A8R B;  2DPI A;  3MAQ A;  1S6P B;  4RW8 A;  2HYI B;  2X3D A;  2C2M B;  1QDU B;  1KEK A;  4CLS A;  1MMN A;  1HQU B;  4DU8 A;  3LP0 B;  1RT3 B;  1XNR F;  1SJ3 P;  2KZZ A;  4N47 A;  3CCE S;  1SJR A;  3HVT B;  3KLI B;  2OPP A;  4HAC A;  4DFP A;  4JI7 J;  4ED0 A;  1U6F A;  1WHY A;  2QYC A;  3PRB A;  3MD1 A;  2V67 A;  2PD1 A;  1EET B;  1ROF A;  2AEF A;  2GJF A;  3J81 Y;  1EHW A;  3TJ9 A;  1P27 B;  1IR1 A;  3EVM A;  2ZM6 F;  1VQY A;  1HW9 A;  4N5S A;  1UTA A;  1Z4U A;  3CNQ P;  5DJB A;  4H4M A;  3HHL B;  2AX1 A;  1OWX A;  3TZY A;  5I3P A;  1DZ5 A;  3AD7 C;  3NS5 A;  3CDB A;  3KFW X;  4YDD B;  1T95 A;  5DM7 Q;  1UFK A;  4TQS A;  3E2E A;  5HMX A;  4MK9 A;  4YN3 B;  2CQ0 A;  2EG1 A;  3MTK A;  2VBY A;  2HSE B;  3IRW P;  1JLA A;  4B9L A;  3QID A;  4DX5 A;  4O44 A;  3MAH A;  1JLC B;  3CJ8 A;  2HG4 A;  4HEA 9;  1Y9O A;  3DLE A;  1A6L A;  2LXI A;  3TAM B;  5AE1 A;  2O67 A;  1N4L A;  3IA0 A;  4FN5 A;  2R7R A;  4JI6 F;  2IMO A;  4IH5 A;  4JI3 J;  2X3G A;  5KOW A;  4LR8 A;  4UQT A;  2LA4 A;  3PJ9 A;  1WC6 A;  2G1H A;  4DQQ A;  2WSC C;  2NCK L;  4PXC A;  1CJV B;  5JVH Q;  4J7C A;  3MFH A;  4FF2 A;  2R7T A;  3DRX A;  3LF0 A;  1HAR A;  4RW7 A;  2RS2 A;  4DL0 C;  2NYH A;  3HD1 A;  4F04 B;  4DV4 J;  1AB8 A;  1QUP A;  3MM8 A;  2C22 A;  2FJX A;  2MKY A;  2KN4 A;  1HYS A;  2CQI A;  1YIT S;  2QMW A;  1TVR B;  2EC0 A;  3SFU A;  1Q86 T;  2JEG A;  1GMW D;  3C16 B;  2YH1 A;  1VQ9 S;  1XNQ J;  4X4N A;  4QYZ J;  2E5G A;  4M95 A;  2BE7 D;  2OPQ A;  4OYX A;  4UOH A;  2AGO A;  3R5J B;  3EPI A;  4ED5 A;  2GML A;  2D3O R;  3T1H F;  1URN A;  3RBX A;  1OO0 B;  2HHH J;  1VQ5 S;  1KHV A;  5ETN A;  3MZI A;  1NK9 A;  5THW A;  1JNZ B;  3LAL A;  3U1L A;  3I4P A;  4ALZ A;  3BO4 A;  4F4X A;  1NDC A;  1SC1 B;  1S12 A;  5B0B A;  3W5Z A;  4NEY A;  1HNI A;  4FNI A;  1RT7 A;  3Q8Y A;  4XDD A;  4EO6 A;  3MM9 B;  3GCW P;  3CCS S;  2HK2 A;  2QFI A;  2J9D E;  4NAS A;  1O5J A;  2YWW A;  2XCA A;  3JB9 k;  2NSB A;  2ZOF A;  2DVI A;  4JI5 F;  4DV5 J;  2J0S D;  3G82 B;  1RJJ A;  4WZM A;  2DNL A;  4DV2 F;  2XS2 A;  1F5B A;  4ED1 A;  2HS0 A;  2DGU A;  1JX4 A;  3M8P B;  3RB0 A;  4LF9 F;  4TU8 A;  3ETO A;  2DRA A;  2UUC J;  3DMJ B;  1O8B A;  3LUY A;  1FO1 A;  3BR8 A;  3FK4 A;  1DFD A;  3DOK A;  4P2F A;  1S9E A;  4DZ6 A;  3R97 A;  3J7A N;  2X1B A;  1KTV A;  2CAJ A;  2V8H A;  5HRO A;  1B3T A;  1C1B B;  4CLF A;  5JVG Q;  3OHB A;  2M0G B;  5A8K A;  3ZTR A;  1NM2 A;  4J9Q A;  3HFK A;  2O3D A;  2VU5 A;  2K7K A;  3QWU A;  2IJF A;  3DLG A;  4M5N A;  4OHY A;  1TTH B;  3BPS P;  2MKJ A;  1FXL A;  2H1Y A;  2RML A;  5A6W A;  2FGC A;  1HNW J;  1CSJ A;  4HVZ A;  3OFF A;  3EZO A;  2LCW A;  3UQS A;  2GVD B;  2GFF A;  2E5L F;  4A8Y A;  1HBU B;  2DNQ A;  4ECT A;  1CQN A;  4IDK B;  2XWX A;  4KH1 B;  4L73 A;  2DHA A;  2EC2 A;  2BJ8 A;  2WRM A;  1ZS6 A;  2MGZ B;  3FUY A;  3RB4 A;  3NAH A;  3I0R B;  2KL8 A;  1Q78 A;  2CNK B;  3QGG A;  2J7U A;  3TAN A;  2W7O A;  3AFG A;  2CAD A;  2CVE A;  2FLO A;  3DU6 A;  4LBP A;  1NEE A;  2WVC A;  3T9Z A;  2PT0 A;  4RBU A;  1NPR A;  2V94 A;  3AT1 B;  2W7P A;  2HIY A;  2UVW A;  1SKS A;  1IKV B;  1WC3 A;  2RSQ A;  4A8O A;  4E8U A;  4P2S A;  1GX6 A;  3JSB A;  1QTM A;  1IJF B;  2H4W B;  2NUU G;  5KG0 A;  2Y8W A;  2XTJ P;  1TKX A;  3EE3 A;  4IR9 A;  4PG5 A;  2W2N P;  4WBF A;  3B6B A;  1N88 A;  2LEC A;  3CCU S;  4ZJL A;  1NUE A;  3TNV A;  1K0V A;  2IRU A;  3PX0 A;  2CPI A;  3U7J A;  4JI8 F;  5L8R C;  2WVD A;  4ZP7 A;  2Q6B A;  1FNX H;  2G2Z A;  2HWH A;  2UXC J;  3CMA S;  4BCA A;  2FJA B;  2L9N A;  4UT4 A;  3UD5 A;  2VD3 A;  4K4Y A;  3BKU A;  2P6S A;  2YQ0 A;  4MK7 A;  3M32 A;  4O0I A;  1VBX A;  1VJW A;  3FBB A;  3C3L A;  4WZQ A;  2KO1 A;  4B3S F;  4F4A A;  1FDD A;  2JVR A;  4DX6 A;  2F1F A;  2CJB A;  3MMC B;  1ZOT A;  5JJB A;  5CD4 A;  3TUZ C;  4X4U A;  1SBR A;  4KJI A;  2XZT B;  3SQG A;  3U27 A;  3HFZ B;  4YB6 A;  1LW2 A;  4I2Q A;  4CYU B;  2IA0 A;  3EVW A;  4OX7 A;  3MPV A;  1RHU B;  2RS8 A;  3GSD A;  3R6L B;  1Q81 T;  2MZJ A;  4NLQ A;  3W2W A;  1YJ7 A;  1B7Y B;  2HQD A;  1BHN A;  4PPD A;  4FBU A;  2MKI A;  2IRX A;  3D6M B;  5GAE I;  1S0M A;  4QWA A;  1X4H A;  1G1X A;  1Q4R A;  2WCX A;  3HSD A;  3K57 A;  2ZD1 A;  3TO8 A;  3AXM A;  1Q53 A;  1VOM A;  2RF2 B; 
#chains in the Genus database with same CATH homology
 2BEF A;  1VYA A;  3GP9 A;  1BUX A;  3Q8U A;  3BH7 B;  2DY9 A;  3DKD A;  3EM1 A;  3ETM A;  3FKB A;  3ENA A;  4DI6 A;  4EK2 A;  2DXE A;  1U8W A;  3BBF A;  3ELH A;  3EMT A;  3FBC A;  1NPK A;  1LEO A;  4O0N A;  1ZS6 A;  4ANC A;  1NSQ A;  4UOG A;  1LWX A;  1BE4 A;  3VVT A;  3R9L A;  1B99 A;  3BBB A;  3ZTQ A;  3BH6 B;  1NDP A;  3FBB A;  3FBF A;  3MPD A;  1UCN A;  3PRV A;  3Q83 A;  3VGU A;  4F36 A;  4S0M A;  2DXF A;  4FKY A;  4KPC A;  3Q8V A;  4F4A A;  1K44 A;  1NSK L;  3EJM A;  5CAA A;  2HVD A;  4HR2 A;  4UOH A;  1NSP A;  4DZ6 A;  5C7P A;  1NB2 A;  3VGV A;  2DXD A;  1PKU A;  3L7U A;  4ENO A;  1S59 A;  2HUR A;  4UOF A;  5CAB A;  3EIC A;  1WKL A;  1HLW A;  2BX6 A;  3ZTS A;  1HIY A;  1W7W A;  1S5Z A;  1JXV A;  1XIQ A;  1KDN A;  3ZTR A;  2B8P A;  1PAE X;  1B4S A;  3NGU A;  1WKK A;  4FKX A;  2VU5 A;  3ZTO A;  1XQI A;  3ZTP A;  3FCV A;  3BBC A;  3GPA A;  3FC9 A;  3WX8 A;  1NDC A;  2CWK A;  3EVW A;  3DDI A;  3NGR A;  1MN7 A;  3FCW A;  1F6T A;  1S57 A;  3EE3 A;  4WBF A;  3VVU A;  3PJ9 A;  3B6B A;  1MN9 A;  2B8Q A;  3Q8Y A;  1NCL A;  4W98 A;  2AZ3 A;  5BXI A;  1NLK L;  1BHN A;  1NDL A;  2NCK L;  3NGT A;  4ANE A;  1EHW A;  4CP5 A;  3EVO A;  3Q86 A;  1WKJ A;  2AZ1 A;  3FBE A;  3G2X A;  3VGS A;  1NUE A;  2HVE A;  3EVM A;  5IOL A;  4DUT A;  3Q89 A;  3VGT A;  2DYA A;  3NGS A;  1NHK L;  1NDK A;  3JS9 A;  1HHQ A;  3B54 A;  4C6A A;  1F3F A;  4AND A;  2ZUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...